WO2018057904A1 - Chimeric antigen receptors and compositions and methods of use thereof - Google Patents

Chimeric antigen receptors and compositions and methods of use thereof Download PDF

Info

Publication number
WO2018057904A1
WO2018057904A1 PCT/US2017/052974 US2017052974W WO2018057904A1 WO 2018057904 A1 WO2018057904 A1 WO 2018057904A1 US 2017052974 W US2017052974 W US 2017052974W WO 2018057904 A1 WO2018057904 A1 WO 2018057904A1
Authority
WO
WIPO (PCT)
Prior art keywords
car
acid sequence
hla
equivalent
antibody
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/052974
Other languages
English (en)
French (fr)
Inventor
Alan L. Epstein
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Southern California USC
Original Assignee
University of Southern California USC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Southern California USC filed Critical University of Southern California USC
Priority to CN201780071631.4A priority Critical patent/CN110225766A/zh
Priority to JP2019515810A priority patent/JP2020501512A/ja
Priority to US16/335,570 priority patent/US20200016201A1/en
Priority to CA3037528A priority patent/CA3037528A1/en
Priority to AU2017330423A priority patent/AU2017330423A1/en
Priority to EP17853995.3A priority patent/EP3515493A4/en
Priority to IL265438A priority patent/IL265438B2/en
Publication of WO2018057904A1 publication Critical patent/WO2018057904A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4237Hormones, e.g. calcitonin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4254Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
    • A61K40/4255Mesothelin [MSLN]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4256Tumor associated carbohydrates
    • A61K40/4257Mucins, e.g. MUC-1
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/08Drugs for disorders of the urinary system of the prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70532B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/72Receptors; Cell surface antigens; Cell surface determinants for hormones
    • C07K14/723G protein coupled receptor, e.g. TSHR-thyrotropin-receptor, LH/hCG receptor, FSH receptor
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2869Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against hormone receptors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • C07K16/3092Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/27Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
    • A61K2239/29Multispecific CARs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/59Reproductive system, e.g. uterus, ovaries, cervix or testes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • This disclosure relates to novel luteinizing hormone receptor (LHR), B7-H4, HLA-G, or HLA-DR chimeric antigen receptor (CAR), cells or compositions comprising the same, and methods for using the same for therapy including solid tumors. Also provided herein are isolated peptides and fusion proteins containing immunogenic determinants for the luteinizing hormone receptor, B7-H4, HLA-G, or HLA-DR chimeric antigen receptor.
  • Ovarian carcinoma is the most common cause of cancer death from gynecologic tumors (Siegel, R. et al. (2012) CA Cancer J. Clin. 62: 10-29). Approximately 25,000 new cases and 14,000 deaths are expected to occur in the United States every year (Siegel, R. et al. (2012) CA Cancer J. Clin. 62: 10-29). Overall survival of ovarian carcinoma appears to have improved in the last 30 years as median survival during the 1960s was approximately 12 months compared to the current 38 months. However, the 5-year survival for stage III ovarian cancer has not changed significantly and remains at 25%. The improvement in median survival can be explained in part due to the improvement in front line chemotherapy.
  • the mortality rate for patients with breast cancer has decreased since 1989 due to earlier detection, improved treatments, and possibly a decreased incidence because of the declining use of postmenopausal hormone therapy.
  • the 5-year survival for localized breast cancer is 99%.
  • the 5-year survival for regional disease is 84% and importantly, for metastatic disease, it drops precipitously to 24%.
  • CAR modified T-cells combine the HLA-independent targeting specificity of a monoclonal antibody with the cytolytic activity, proliferation, and homing properties of activated T-cells, but do not respond to checkpoint suppression. Because of their ability to kill antigen expressing targets directly, CAR T-cells are highly toxic to any antigen positive cells or tissues making it a requirement to construct CARs with highly tumor specific antibodies. To date, CAR modified T-cells to ovarian carcinomas have been constructed against the a-folate receptor, mesothelin, and MUC-CD, but all of these have some off-target expression of antigen.
  • novel anti-B7-H4 antibodies and methods of their use diagnostically and therapeutically.
  • an isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope of human B7-H4 comprising the amino acid sequence:
  • ULA-G is is a non-classical MHC class I molecule which primarily serves to suppress cytotoxic immune cell function, particularly as a ligand for the inhibitory K cell receptors.
  • novel anti-HLA-G antibodies and methods of their use diagnostically and therapeutically.
  • an isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope of human HLA-G comprising the amino acid sequence:
  • GSHSMRYFSA AVSRPGRGEP
  • RFIAMGYVDD TQFVRFDSDS ACPRMEPRAP WVEQEGPEYW EEETRNTKAH AQTDRMNLQT LRGYYNQSEA
  • SSHTLQWMIG CDLGSDGRLL RGYEQYAYDG KDYLALNEDL RSWTAADTAA QISKRKCEAA NVAEQRRAYL
  • GEDQTQDVEL VETRPAGDGT FQKWAAVVVP SGEEQRYTCH VQHEGLPEPL MLRWKQSSLP TIPIMGI VAGLVVLAAV VTGAAVAAVL WRKKSSD, or an equivalent thereof.
  • Lym-1 and Lym-2 are directed against MHC class II HLA-DR molecules which are primarily expressed on the surface of human B cells, dendritic cells, and B-cell derived lymphomas and leukemias. Aspects of the disclosure relate to an isolated nucleic acid sequence encoding a Lyml or Lym-2 CARs, antibodies, and vectors comprising the isolated nucleic acid sequences.
  • This disclosure provides a new target for the treatment of solid tumors that include, but are not limited to, ovarian, breast, renal, and prostate carcinomas as well as a B-cell lymphoma or leukemia.
  • the targets which include LHR, B7-H4, HLA-G, and HLA-DR are often expressed on the majority of these tumors but has restricted off-target positivity and therefore a desirable safety profile.
  • the compositions are particularly useful in the treatment of tumors or cancerous cell that express or overexpress LHR, B7-H4, HLA-G, HLA-DR.
  • the antibodies possess a specific binding affinity of at least 10 ⁇ 6 M. In certain aspects, antibodies bind with affinities of at least about 10 ⁇ 7 M, and preferably 10 ⁇ 8 M, 10 "9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • the present disclosure provides an isolated antibodies, the antibodies comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope of a luteinizing hormone receptor (LHR), B7-H4, HLA-G, or HLA-DR.
  • LHR luteinizing hormone receptor
  • this disclosure provides an isolated anti-LHR, anti-B7-H4, anti-HLA-g, or anti-HLA-DR antibodies or fragments thereof as disclosed herein and a detectable or purification label, alone or in combination with an LHR, B7-H4, HLA-G, or HLA-DR antigen or fragment thereof.
  • an ex vivo cell comprising this antigen/antibody complex.
  • CAR chimeric antigen receptor
  • a chimeric antigen receptor comprising: (a) an antigen binding domain of a LHR, B7-H4, HLA-G, or HLA-DR antibody; (b) a hinge domain; (c) a CD28 transmembrane domain; (d) one or more costimulatory regions selected from a CD28 costimulatory signaling region, a 4- IBB costimulatory signaling region, an ICOS
  • the present disclosure provides a chimeric antigen receptor (CAR) comprising: (a) an antigen binding domain of an anti-luteinizing hormone receptor ("LHR"), B7-H4, HLA-G, or HLA-DR antibody, (b) a CD 8 a hinge domain; (c) a CD 8 a
  • transmembrane domain (d) a CD28 and/or a 4-1BB costimulatory signaling region; and (e) a CD3 zeta signaling domain and alternatives thereof.
  • the present disclosure provides an isolated nucleic acid sequence encoding the anti-LHR, -B7-H4, -HLA-G, or HLA-DR antibody, or the anti-LHR, -B7-H4, - HLA-G, or -HLA-DR CAR.
  • the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-LHR, -B7-H4, -HLA-G, or -HLA-DR antibody, or the anti-LHR, -B7-H4, -HLA-G, or -HLA-DR CAR.
  • the present disclosure provides a vector comprising the isolated nucleic acid sequence encoding the anti-LHR, -B7-H4, -HLA-G, or -HLA-DR antibody, or the anti-LHR, -B7-H4, -HLA-G, or -HLA-DR CAR.
  • the present disclosure provides a composition comprising a carrier and one or more of: the anti-LHR, -B7-H4, -HLA-G, or -HLA-DR antibody; and/or the anti- LHR, -B7-H4, -HLA-G, or -HLA-DR CAR; and/or the isolated nucleic acid encoding the anti-LHR, -B7-H4, -HLA-G, or -HLA-DR antibody or the anti-LHR, -B7-H4, -HLA-G, or - HLA-DR CAR; and/or the vector comprising the isolated nucleic acid sequence encoding the anti-LHR, -B7-H4, -HLA-G, or -HLA-DR antibody, or the anti-LHR, -B7-H4, -HLA-G, or - HLA-DR CAR; and/or an isolated cell comprising the anti-LHR, -B7-
  • aspects of the disclosure relate to an isolated cell comprising a LHR, B7-H4, HLA-G, or HLA-DR CAR and methods of producing such cells. Still other method aspects of the disclosure relate to methods for inhibiting the growth of a tumor, e.g., a solid tumor, and treating a cancer patient comprising administering an effective amount of the isolated cell.
  • a tumor e.g., a solid tumor
  • the disclosure provides a composition comprising, or alternatively consisting essentially of, or yet further consisting of a carrier and one or more of: an antibody or fragment thereof, a nucleic acid encoding the antibody or fragment thereof, an isolated cell comprising an anti-LHR, -B7-H4, -HLA-G, or -HLA-DR CAR; and/or the isolated nucleic acid encoding the CAR; and/or the vector comprising the nucleic acid encoding the CAR; and/or the isolated cell expressing an anti-LHR CAR, -B7-H4, -HLA-G, or -HLA-DR; and/or the anti-LHR, -B7-H4, -HLA-G, or -HLA-DR antibody.
  • FIGS. 1A-1C show flow cytometry profiles of (FIG. 1A) LHR on TOV21G, (FIG. IB) mesothelin on SKOV3, and (FIG. 1C) MUC16 on CAOV3 cell lines.
  • FIGS. 2A-2C show positive immunohistochemistry staining patterns of (FIG. 2 A) LHR antibody on a Stage 2 serous papillary adenocarcinoma; (FIG. 2B) MUC16 antibody on a Stage IIIC endometrioid adenocarcinoma; and (FIG. 2C) mesothelin antibody on a Stage 1C serous papillary adenocarcinoma.
  • FIG. 3 shows the sequence used to generate LHR-Fc.
  • Amino acid structure of LHR G-protein showing sequence (outlined area) used to generate a LHR-Fc used in immunization and screening methods to identify potential LHR binding antibodies useful for the generation of LHR CARs.
  • FIG. 4 shows typical flow cytometry screen of LHR-Fc ELISA positive antibodies on the ES-2 ovarian carcinoma cell line demonstrating strong reactivity by hybridoma 8B7 only.
  • FIG. 5 shows flow cytometry of 5 candidate LHR antibody subclones with highest MFI values on ES-2 human ovarian carcinoma cells.
  • FIG. 6 shows a schematic diagram of the DNA sequence for, and the theoretical structure of an anti-LHR CAR in the plasma membrane.
  • FIG. 7 shows the alignments of the heavy chain and light chain sequences of LHR antibody subclones.
  • FIGS. 8A-D shows a distribution of LHR positive cancers(FIG. 8A); the distribution of LHR intensity with multiple tumor histology groups (FIG. 8B); LHR staining intensity in patients with ovarian, peritoneal, or fallopian tube cancer (FIG. 8C); and LHR staining intensity by tumor pathologic stage group (FIG. 8D).
  • FIGS. 9A-D LHR expression in prostate cancer, in histology (FIG. 9A), relative mRNA levels in (AD) prostate cancer and castration resistant (CR) prostate cancer (FIG. 9B) and Western blot (FIG. 9C-D).
  • FIG. 10 shows the backbone of the gene transfer vector is an HIV-based, bicistronic lentiviral vector, pLVX-IRES-ZsGreen containing HIV-1 5' and 3' long terminal repeats (LTRs), packaging signal ( ⁇ ), EFla promoter, internal ribosome entry site (IRES), ZsGreen, a green fluorescent protein, woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), and simian virus 40 origin (SV40).
  • Constitutive expression of the transgene comprising of a scFV specific to LHR, a CD8 hinge and transmembrane region and CD28, 4- 1BB and 033 ⁇ signaling domain, is insured by the presence of the EF-la promoter.
  • ZsGreen is carried out by the IRES region. Integration of the vector was assayed by the presence of ZsGreen in the cells, via fluorescent microscopy.
  • FIG. 11 depicts the results of the cytotoxicity assay of LHR CAR T-cells.
  • Cytotoxicity of the LHR CAR expressing T-cells was determined using an LDH cytotoxicity kit as described in the Methods. Prior to the assay, T-cells were activated using aCD3/CD8 beads (Stem Cell Technologies, 30 ul to 2 ml of media). The activated T-cells were transduced with LHR lentiviral particles, following which the T cells were activated for using the aCD3/CD8 beds. Un-transduced, activated T-cells were used as a control. 3,000 SKOV3 cells were plated per well. LHR transduced T cells were added in ratios of 20: 1, 10: 1, 5: 1 and 1 : 1 (60,000 - 3000) to the wells. Each data point represents the average of triplicate measurements.
  • FIG. 12 depicts mRNA expression of the LHR CAR in primary T-cells.
  • Primary T- cells transduced with the LHR CAR show expression of the LHR mRNA.
  • Primers used spanned the area between the CD8 hinge and the 4-1BB signaling domain (300 bp).
  • FIGS. 13A-13C show a schematic diagram and HPLC Analysis of Human B7-H4-Fc Fusion Protein Used as Antigen.
  • FIG. 1A The vector used to construct the gene;
  • FIG. IB the completed B7-H4-Fc fusion protein in which the B7-H4 was fused to the N-terminus of the immunoglobulin Fc region of human IgGl producing a dimeric protein used as antigen.
  • FIG. 1C HPLC analysis of purified B7-H4-Fc showing the expected retention time indicative of its molecular weight.
  • FIG. 14 shows representative flow cytometry data for mouse monoclonal anti-human B7-H4 on SKBR-3, HT-29, JAR, and T47D cell lines derived from breast adenocarcinoma, colorectal adenocarcinoma, choriocarcinoma, and breast ductal carcinoma, respectively. Darker line represents cells stained for B7-H4, and lighter line represents cells stained with isotype control. A sheep anti-mouse IgG conjugated to FITC was used as the secondary antibody. Cell surface expression of B7-H4 matches q-PCR data for b7-h4 expression in these cell lines (data not shown).
  • FIG. 15 shows flow cytometry screening data of newly generated and purified monoclonal antibodies to human B7-H4.
  • Subclones of positive hybridomas (35-8 and 5F6- 6) were selected for the generation of CAR T-cells based upon these results.
  • Clone 35-8 was then sequenced and used to produce B7-H4 CAR T-cells for immunotherapy.
  • FIGS. 16A-B show representative images of B7-H4 antibody (clone #35-8) staining on 16normal and cancer tissue microarrays.
  • FIG. 16A B7-H4 staining on normal tissues.
  • FIG. 16B B7-H4 staining on normal and cancer tissue of the breast.
  • Other normal tissues found negative for B7-H4 positivity include the following: adrenal gland, bone marrow, cerebellum, esophagus, hypophysis, intestine, lymph node, ovary, prostate, stomach, testis, thyroid, thymus, tongue, uterine, skin, and nerve tissue.
  • FIG. 17 shows a schematic diagram of the DNA sequence for, and the theoretical structure of third generation anti-B7-H4 CAR in the plasma membrane.
  • FIG. 18A-B shows immunohistochemistry staining of B7-H4 on sections of (FIG. 18A) human breast carcinoma biopsy and (FIG. 18B) SKBR3 human breast cancer cell line pellet showing cell surface positivity for antigen (brown staining).
  • FIG. 19 shows a schematic representation of the gene transfer vector and of the transgene.
  • the backbone of the gene transfer vector is an HIV-based, bicistronic lentiviral vector, pLVX-IRES-ZsGreen containing HIV-1 5' and 3' long terminal repeats (LTRs), packaging signal ( ⁇ ), EFla promoter, internal ribosome entry site (IRES), ZsGreen, a green fluorescent protein, woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), and simian virus 40 origin (SV40).
  • FIG. 20 shows cytotoxicity of the B7-H4 CAR T-cells. Cytotoxicity of the B7-H4 CAR expressing T-cells was determined using an LDH cytotoxicity kit as described in the Methods. Prior to the assay, T-cells were activated using aCD3/CD8 beads (Stem Cell Technologies, 30 ⁇ to 2 ml of media). The activated T-cells were transduced with B7-H4 lentiviral particles, following which the T cells were activated for using the aCD3/CD8 beads. Un-transduced, activated T-cells were used as a control. 3000 SKBR3 cells were plated per well. B7-H4 transduced T cells were added in ratios of 20: 1, 10: 1, 5: 1 and 1 : 1 (60,000 - 3000 cells) to the wells. Each data point represents the average of triplicate measurements.
  • FIG. 21 shows flow cytometry screening data of newly generated monoclonal antibodies to human HLA-G.
  • Subclones of positive hybridomas (3H11-12 and 4E3-1) were selected for the generation of CAR T-cells based upon these results.
  • FIGS. 22A-22D show immunohistochemistry of HLA-G reactivity in papillary thyroid cancer and normal thyroid tissue with HLA-ABC control staining.
  • FIG. 22A shows low magnification of HLA-G positive papillary thyroid carcinoma section using antibody 4E3-1 (lOOx).
  • FIG. 22B shows higher magnification of second papillary thyroid carcinoma positive for HLA-G (250X).
  • FIG. 22C shows negative reactivity of normal thyroid tissues for HLA-G (250X), and
  • FIG. 22D shows positive reactivity of normal thyroid tissue for HLA-ABC (100X).
  • FIG. 23 shows schematic diagram of the DNA sequence for, and the theoretical structure of third generation anti-HLA-G CAR in the plasma membrane.
  • FIG. 24 shows additional antibody screening, as described in FIG. 1.
  • FIG. 25 depicts a schematic of the gene-transfer vector and the transgene.
  • the backbone of the gene transfer vector is an HIV-based, bicistronic lentiviral vector, pLVX-
  • EFla promoter
  • IRES internal ribosome entry site
  • ZsGreen a green fluorescent protein
  • WPRE woodchuck hepatitis virus post-transcriptional regulatory element
  • SV40 simian virus 40 origin
  • FIG. 26 shows cytotoxicity of the HLA-G CAR T-cells. Cytotoxicity of the HLA-G CAR expressing T-cells was determined using an LDH cytotoxicity kit as described in the Methods. Prior to the assay, T-cells were activated using aCD3/CD8 beads (Stem Cell Technologies, 30 ul to 2 ml of media). The activated T-cells were transduced with HLA-G lentiviral particles, following which the T cells were activated for using the aCD3/CD8 beads. Un-transduced, activated T-cells and the TLBR-2 T lymphoma cell line were used as controls. 3,000 SKOV3 or TLBR-2 cells were plated per well. HLA-G transduced T cells were added in ratios of 20: 1, 10: 1, 5 : 1 and 1 : 1 (60,000 - 3000 cells) to the wells. Each data point represents the average of triplicate measurements.
  • FIG. 27 shows protein expression of the HLA-G CAR.
  • T-cells transduced with the HLA-G CAR lentiviral particles express protein for the HLA-G CAR.
  • the estimated size of the CAR protein is 60kDa.
  • a CD3 ⁇ antibody was used to detect the protein.
  • Fifty ⁇ g of protein was used for the western blot, ⁇ -actin was used as a loading control.
  • FIGS. 28A-28F show flow cytometric analysis of (FIG. 28A) negative control; (FIG. 28B) Lym-1 ; (FIG. 28C) Lym-1 and B l ; (FIG. 28D) B l only; (FIG. 28E) Lym-2; and (FIG. 28F) Lym-2 and B l staining reactivity with normal peripheral blood lymphocytes of patients. Both Lym-1 and Lym-2 have different profiles of binding to normal human peripheral B cells.
  • FIGS. 29A-29B show Lym-1 and Lym-2 staining of normal human tonsil
  • FIGS. 30A and 30B show immunoperoxidase staining of Lym-1 and Lym-2 monoclonal antibodies with an intermediate grade malignant B-cell lymphoma.
  • Lym-1 (FIG. 30A) and Lym-2 (FIG. 30B) monoclonal antibodies with an intermediate grade malignant B-cell lymphoma (frozen sections, x720). Note prominent membrane staining pattern of majority of cells in the section.
  • FIGS. 31A-31C show binding profiles and Scatchard Plots of (FIG. 31 A) Binding profiles of Lym-1 monoclonal antibodies to Raji cells and Lym-2 monoclonal antibodies to ARH-77 cells; (FIG. 31B) Scatchard plot analysis of Lym-1 monoclonal antibodies with Raji cells; (FIG. 31C) Scatchard plot analysis of Lym-2 monoclonal antibodies with ARH-77 cells.
  • FIGS. 32A and 32B show immunoprecipitation of 35 S-methionine and 14 C-leucine- labled Raji proteins by Lym-1 (FIG. 32A) and SC-2 anti-HLA-DR antibody (FIG. 32B).
  • FIGS. 33A and 33B show a construction schematic of (FIG. 33 A) Lym-1 and (FIG. 33B) Lym-2 CAR T-cells for immunotherapy.
  • Figure 6A and 6B disclose a flexible linker sequence.
  • FIG. 34 depicts a schematic a non-limiting exemplary Lym-1 gene-transfer vector and transgene.
  • the backbone of the gene transfer vector is an HIV-based, bicistronic lentiviral vector, pLVX-IRES-ZsGreen containing HIV-1 5' and 3' long terminal repeats (LTRs), packaging signal ( ⁇ ), EFla promoter, internal ribosome entry site (IRES), ZsGreen, a green fluorescent protein, woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), and simian virus 40 origin (SV40).
  • FIG. 35 shows expression of Lym-1 CAR on primary human T-cells. T-cells were transduced with the Lym-1 CAR and stained with Biotein-Protein L, followed by
  • Streptavidin-PE Cells were analyzed by flow cytometry.
  • FIG. 36 shows cytotoxicity of the Lym-1 -CAR T-cells. Cytotoxicity of the Lym-1
  • CAR expressing T-cells was determined using an LDH cytotoxicity kit as described in the
  • T-cells Prior to the assay, T-cells were activated using aCD3/CD8 beads (Stem Cell
  • the activated T-cells were transduced with Lym-1 CAR lentiviral particles, following which the T cells were activated using the aCD3/CD8 beads. Un-transduced, activated T-cells were used as a control. 15,000 Raji cells were plated per well. Lym-1 CAR transduced T cells were added in ratios of 20: 1, 10: 1, 5: 1 and 1 : 1 to the wells. Each data point represents the average of triplicate measurements.
  • FIG. 37 depicts a schematic a non-limiting exemplary Lym-2 gene-transfer vector and transgene.
  • the backbone of the gene transfer vector is an HIV-based, bicistronic lentiviral vector, pLVX-IRES-ZsGreen containing HIV-1 5' and 3' long terminal repeats (LTRs), packaging signal ( ⁇ ), EFla promoter, internal ribosome entry site (IRES), ZsGreen, a green fluorescent protein, woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), and simian virus 40 origin (SV40).
  • transgene comprising of a CD8 leader sequence, an scFV specific to Lym-2, a CD8 hinge and transmembrane region and CD28, 4-1BB and CD3 ⁇ signaling domain, is insured by the presence of the EF-la promoter.
  • Expression of the detection protein, ZsGreen is carried out by the IRES region. Integration of the vector can be assayed by the presence of ZsGreen in the cells, via fluorescent microscopy.
  • FIG. 38 shows expression of Lym-2 CAR on primary human T-cells. T-cells were transduced with the Lym-2 CAR and stained with Biotein-Protein L, followed by
  • Streptavidin-PE Cells were analyzed by flow cytometry.
  • FIG. 39 shows cytotoxicity of the Lym-2-CAR T-cells. Cytotoxicity of the Lym-2 CAR expressing T-cells was determined using an LDH cytotoxicity kit as described in the Methods. Prior to the assay, T-cells were activated using aCD3/CD8 beads (Stem Cell Technologies, 30 ul to 2 ml of media). The activated T-cells were transduced with Lym-2 CAR lentiviral particles, following which the T cells were activated using the aCD3/CD8 beads. Un-transduced, activated T-cells were used as a control. 15,000 Raji cells were plated per well. Lym-2 CAR transduced T cells were added in ratios of 20: 1, 10: 1, 5: 1 and 1 : 1 to the wells. Each data point represents the average of triplicate measurements.
  • FIG. 40 demonstrates that Lym-1, Lym-2, and CD 19 CAR T-cells are highly cytotoxic to human lymphoma Raji cells.
  • Raji Burkitt's lymphoma cells are positive for both HLA-Dr targeted by Lym-1 and Lym-2 and also CD 19 which acted as a positive control for CD 19 CAR T-cells.
  • Negative controls consisted of CD3+ T cells and Zsgreen cells.
  • FIG. 41 demonstrates that Lym-1, Lym-2, but not CD 19 CAR are highly cytolytic against HLA-Dr positive but CD 19 negative TLBR-2 human T lymphoma cells in vitro.
  • TLBR-2 human T-lymphoma cells derived from a breast implant associated lymphoma is positive for HLA-Dr but not CD19 (Lechner et al. (2012) Clin. Cancer Res. 18 (17):4549- 4559). These results demonstrate the specificity of the Lym-1 and Lym-2 CAR T-cells and their potency in killing HLA-Dr positive tumors.
  • the percentage of Lym-1 CAR-T and CD 19 CAR-T positive cells were adjusted to 50% using regular un-transduced primary T cells. The percentage of Lym-2 CAR-T cells was 24%.
  • FIG. 42 shows the results of FACs analysis of transfected NK cells.
  • a cell includes a plurality of cells, including mixtures thereof.
  • animal refers to living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds.
  • mammal includes both human and non-human mammals.
  • subject refers to human and veterinary subjects, for example, humans, animals, non-human primates, dogs, cats, sheep, mice, horses, and cows. In some embodiments, the subject is a human.
  • antibody collectively refers to immunoglobulins or immunoglobulin-like molecules including by way of example and without limitation, IgA, IgD, IgE, IgG and IgM, combinations thereof, and similar molecules produced during an immune response in any vertebrate, for example, in mammals such as humans, goats, rabbits and mice, as well as non-mammalian species, such as shark immunoglobulins.
  • the term “antibody” includes intact immunoglobulins and "antibody fragments” or "antigen binding fragments” that specifically bind to a molecule of interest (or a group of highly similar molecules of interest) to the substantial exclusion of binding to other molecules (for example, antibodies and antibody fragments that have a binding constant for the molecule of interest that is at least 10 3 M "1 greater, at least 10 4 M “1 greater or at least 10 5 M “1 greater than a binding constant for other molecules in a biological sample).
  • the term “antibody” also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies), heteroconjugate antibodies (such as, bispecific antibodies).
  • An "antigen binding fragment" of an antibody is a portion of an antibody that retains the ability to specifically bind to the target antigen of the antibody.
  • the term "monoclonal antibody” refers to an antibody produced by a single clone of B-lymphocytes or by a cell into which the light and heavy chain genes of a single antibody have been transfected.
  • Monoclonal antibodies are produced by methods known to those of skill in the art, for instance by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells.
  • Monoclonal antibodies include humanized monoclonal antibodies and human antibodies.
  • an immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds.
  • Each heavy and light chain contains a constant region and a variable region, (the regions are also known as "domains").
  • the heavy and the light chain variable regions specifically bind the antigen.
  • Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called “complementarity-determining regions" or "CDRs".
  • framework region and CDRs have been defined (see, Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991, which is hereby incorporated by reference).
  • the Kabat database is now maintained online.
  • the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
  • the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, largely adopts a ⁇ - sheet conformation and the CDRs form loops which connect, and in some cases form part of, the ⁇ -sheet structure.
  • framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions.
  • the CDRs are primarily responsible for binding to an epitope of an antigen.
  • the CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located.
  • a V H CDR3 is located in the variable domain of the heavy chain of the antibody in which it is found
  • a V L CDR1 is the CDR1 from the variable domain of the light chain of the antibody in which it is found.
  • An antibody that binds LHR, B7-H4, HLA-G, or HLA-DR will have a specific V H region and the V L region sequence, and thus specific CDR sequences.
  • SDRs specificity determining residues
  • antigen refers to a compound, composition, or substance that may be specifically bound by the products of specific humoral or cellular immunity, such as an antibody molecule or T-cell receptor.
  • Antigens can be any type of molecule including, for example, haptens, simple intermediary metabolites, sugars ⁇ e.g., oligosaccharides), lipids, and hormones as well as macromolecules such as complex carbohydrates ⁇ e.g.,
  • antigens include, but are not limited to, viral antigens, bacterial antigens, fungal antigens, protozoa and other parasitic antigens, tumor antigens, antigens involved in autoimmune disease, allergy and graft rejection, toxins, and other miscellaneous antigens.
  • antigen binding domain refers to any protein or polypeptide domain that can specifically bind to an antigen target.
  • chimeric antigen receptor refers to a fused protein comprising an extracellular domain capable of binding to an antigen, a transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain.
  • the "chimeric antigen receptor (CAR)” is sometimes called a “chimeric receptor", a “T-body”, or a “chimeric immune receptor (CIR) "
  • extracellular domain capable of binding to an antigen means any oligopeptide or polypeptide that can bind to a certain antigen.
  • the "intracellular domain” means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.
  • the intracellular domain may comprise, alternatively consist essentially of, or yet further comprise one or more costimulatory signaling domains in addition to the primary signaling domain.
  • the "transmembrane domain” means any oligopeptide or polypeptide known to span the cell membrane and that can function to link the extracellular and signaling domains.
  • a chimeric antigen receptor may optionally comprise a "hinge domain" which serves as a linker between the extracellular and transmembrane domains.
  • Non-limiting exemplary polynucleotide sequences that encode for components of each domain are disclosed herein, e.g.:
  • Hinge domain IgGl heavy chain hinge sequence:
  • Intracellular domain 4- IBB co-stimulatory signaling region: [0088] AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAG ACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGA AGAAGAAGGAGGATGTGAACTG
  • Intracellular domain CD28 co-stimulatory signaling region:
  • Intracellular domain CD3 zeta signaling region:
  • each exemplary domain component include other proteins that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the proteins encoded by the above disclosed nucleic acid sequences. Further, non-limiting examples of such domains are provided herein.
  • ULA-DR refers to an MHC class II cell surface receptor associated with this name and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, or alternatively at least 95% sequence identity with any ULA-DR variant, including but not limited to any one of its several variants, including but not limited to ULA-DR serotypes DR1 to DR 75 comprising a combination of ULA-DRA and ULA-DRB haplotypes.
  • Rose et al. also discloses an exemplary epitope to which an ULA-DR specific antibody may bind and therefore can serve as an immunogen for the generation of additional antibodies, monoclonal antibodies and antigen binding fragments of each thereof.
  • the sequences associated with each of the listed reference(s) and GenBank Accession Numbers that correspond to the name ULA-DR or its equivalents including but not limited to the specified ULA-DR subtypes are herein incorporated by reference as additional non-limiting examples.
  • a “composition” typically intends a combination of the active agent, e.g., a CAR T cell or a CAR NK cell, an antibody, a compound or composition, and a naturally-occurring or non-naturally-occurring carrier, inert (for example, a detectable agent or label) or active, such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include pharmaceutically acceptable carriers.
  • the active agent e.g., a CAR T cell or a CAR NK cell
  • an antibody e.g., an antibody, a compound or composition
  • a naturally-occurring or non-naturally-occurring carrier for example, a detectable agent or label
  • active such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include pharmaceutically acceptable carriers.
  • Carriers also include pharmaceutical excipients and additives proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-oligosaccharides, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination 1-99.99% by weight or volume.
  • Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like. Representative amino acid/antibody
  • components which can also function in a buffering capacity, include alanine, arginine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
  • Carbohydrate excipients are also intended within the scope of this technology, examples of which include but are not limited to monosaccharides such as fructose, maltose, galactose, glucose, D- mannose, sorbose, and the like; disaccharides, such as lactose, sucrose, trehalose, cellobiose, and the like; polysaccharides, such as raffinose, melezitose, maltodextrins, dextrans, starches, and the like; and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol) and myoinositol.
  • monosaccharides such as fructose, maltose, galactose, glucose, D- mannose, sorbose, and the like
  • disaccharides such as lactose, sucrose
  • consensus sequence refers to an amino acid or nucleic acid sequence that is determined by aligning a series of multiple sequences and that defines an idealized sequence that represents the predominant choice of amino acid or base at each corresponding position of the multiple sequences.
  • the consensus sequence for the series can differ from each of the sequences by zero, one, a few, or more substitutions. Also, depending on the sequences of the series of multiple sequences, more than one consensus sequence may be determined for the series. The generation of consensus sequences has been subjected to intensive mathematical analysis. Various software programs can be used to determine a consensus sequence.
  • LHR luteinizing hormone receptor
  • AAB 19917.2 Homo sapiens
  • AAA39432.1 Mus musculus
  • AAA41529.1 ⁇ Rattus norvegicus provide additional example sequences of LHR.
  • Non-limiting examples of usch include:
  • Luteinizing hormone receptor [Homo sapiens] :
  • Luteinizing hormone receptor [Mus musculus]:
  • Luteinizing hormone receptor [Rattus norvegicus] :
  • B7-H4 also known as VTCN1, H4, B7h.5, B7S1, B7X, or PR0129
  • B7-H4 refers to a specific molecule associated with this name and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with B7- H4. Examples of the B7-H4 sequence are provided herein.
  • GenBank Accession Nos. AY280973.1 Mus musculus
  • P_078902 Homo sapiens
  • anti-B7-H4 in reference to an antibody or receptor, refers to an antibody or receptor that specifically binds to B7-H4 and includes reference to any antibody which is generated against B7-H4.
  • novel anti-B7-H4 antibodies and methods of their use diagnostically and therapeutically.
  • an isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope of human B7-H4 comprising the amino acid sequence:
  • the antibody comprises a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope of human B7-H4 comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence
  • the HC comprises any one of the following a HC CDRHl comprising the amino acid sequence GFTFSSFG, GFTFSSYG, or GYTFTDY; and/or a HC CDRH2 comprising the amino acid sequence ISSGSSTL, ISSSNSTI, or INPNNGGT; and/or a HC CDRH3 comprising the amino acid sequence ARPLYYYGSVMDY or RPYYYGSSYDY.
  • the antibody comprises a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC) immunoglobulin variable domain sequence, wherein the antibody binds to an epitope of human B7-H4 comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence wherein the LC comprises a LC CDRL1 comprising the amino acid QSIVHRNGNTY, QSIVHSNGNTY, or ENIGSY; and/or a LC CDRL2 comprising the amino acid sequence KVS or AAT; and/or a LC CDRL3 comprising the amino acid sequence FQGSYVPPT, FQGSHVPLT, QHYYSTLVT.
  • HC heavy chain
  • LC light chain
  • HLA-G also known as B2 Microglobulin or MHC-G refers to a specific molecule associated with this name and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with HLA- G, including but not limited to any one of its several isoforms, including by not limited to membrane-bound isoforms (e.g., HLA-Gl, HLA-G2, HLA-G3, HLA-G4), soluble isoforms (e.g., HLA-G5, HLA-G6, HLA-G7) , and soluble forms generated by proteolytic cleavage of membrane-bound isoforms (e.g. sHLA-Gl).
  • membrane-bound isoforms e.g., HLA-Gl, HLA-G2, HLA-G3, HLA-G4
  • soluble isoforms e.g., HLA-G5, HLA-G6, HLA-G
  • M_002127.5 XM_006715080.1 XM 006725041.1 XM_006725700.1 XM 006725909.1.
  • An example is M_002127.5 Sequence: MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQ
  • CD8 a hinge domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD8 a hinge domain sequence as shown herein.
  • the example sequences of CD8 a hinge domain for human, mouse, and other species are provided in Pinto, R.D. et al. (2006) Vet. Immunol. Immunopathol. 110: 169-177. Non-limiting examples of such include:
  • CD8 a transmembrane domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the
  • CD8 a transmembrane domain sequence as shown herein.
  • CD8 alpha chain (NCBI Reference Sequence: NP 001759.3), or the amino acid positions 197 to 217 of the mouse T-cell surface glycoprotein CD8 alpha chain (NCBI Reference Sequence: P 001074579.1), and the amino acid positionsl90 to 210 of the rat T-cell surface glycoprotein CD8 alpha chain(NCBI Reference Sequence: P_ 113726.1) provide additional example sequences of the CD8 a transmembrane domain.
  • the sequences associated with each of the listed NCBI are provided as follows:
  • CD28 transmembrane domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, at least 90% sequence identity, or alternatively at least 95% sequence identity with the CD28 transmembrane domain sequence as shown herein.
  • GenBank Accession Nos: XM_006712862.2 and XM_009444056.1 provide additional, non-limiting, example sequences of the CD28 transmembrane domain.
  • the sequences associated with each of the listed accession numbers are incorporated herein.
  • the term "4- IBB costimulatory signaling region" refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the 4- IBB costimulatory signaling region sequence as shown herein.
  • the example sequence of the 4- IBB costimulatory signaling region is provided in U.S. App. No. US 13/826,258.
  • the sequence of the 4-1BB costimulatory signaling region associated disclosed in the U.S. App. No. US 13/826,258 is listed as follows:
  • CD28 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80%> amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD28 costimulatory signaling region sequence shown herein.
  • Exemplary CD28 costimulatory signaling domains are provided in U.S. Pat. No. 5,686,281; Geiger, T. L. et al., Blood 98: 2364-2371 (2001); Hombach, A.
  • Non-limiting examples include residues 114-220 of the below CD28 Sequence: MLRLLLALNL FPSIQVTGNK
  • ICOS costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the ICOS costimulatory signaling region sequence as shown herein.
  • Non-limiting example sequences of the ICOS costimulatory signaling region are provided in U.S.
  • OX40 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or duley 90% sequence identity, or alternatively at least 95% sequence identity with the OX40 costimulatory signaling region sequence as shown herein.
  • Non- limiting example sequences of the OX40 costimulatory signaling region are disclosed in U.S. Publication 2012/20148552A1, and include the exemplary sequence provided below.
  • CD3 zeta signaling domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD3 zeta signaling domain sequence as shown herein.
  • the example sequences of the CD3 zeta signaling domain are provided in U.S. Pub. No. US 2013/0266551A1.
  • the sequence associated with the CD3 zeta signaling domain is listed as follows:
  • B cell refers to a type of lymphocyte in the humoral immunity of the adaptive immune system. B cells principally function to make antibodies, serve as antigen presenting cells, release cytokines, and develop memory B cells after activation by antigen interaction. B cells are distinguished from other lymphocytes, such as T cells, by the presence of a B-cell receptor on the cell surface. B cells may either be isolated or obtained from a commercially available source.
  • Non-limiting examples of commercially available B cell lines include lines AHH-1 (ATCC® CRL-8146TM), BC-1 (ATCC® CRL- 2230TM), BC-2 (ATCC® CRL-2231TM), BC-3 (ATCC® CRL-2277TM), CA46 (ATCC® CRL-1648TM), DG-75 [D.G-75] (ATCC® CRL-2625TM), DS-1 (ATCC® CRL-11102TM), EB-3 [EB3] (ATCC® CCL-85TM), Z-138 (ATCC #CRL-3001), DB (ATCC CRL-2289), Toledo (ATCC CRL-2631), Pfiffer (ATCC CRL-2632), SR (ATCC CRL-2262), JM-1 (ATCC CRL-10421), NFS-5 C-l (ATCC CRL-1693); NFS-70 CIO (ATCC CRL-1694), FS-25 C-3 (ATCC CRL-1695), AND SUP-B15 (ATCC CRL-1929).
  • cell lines derived from anaplastic and large cell lymphomas e.g., DEL, DL-40, FE-PD, JB6, Karpas 299, Ki-JK, Mac-2A Plyl, SR-786, SU-DHL-1, -2, - 4,-5,-6,-7,-8,-9,-10, and -16, DOHH-2, NU-DHL-1, U-937, Granda 519, USC-DHL-1, RL; Hodgkin's lymphomas, e.g., DEV, HD-70, HDLM-2, HD-MyZ, HKB-1, KM-H2, L 428, L 540, LI 236, SBH-1, SUP-HD1, SU/RH-HD-1.
  • Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures
  • T cell refers to a type of lymphocyte that matures in the thymus. T cells play an important role in cell-mediated immunity and are distinguished from other lymphocytes, such as B cells, by the presence of a T-cell receptor on the cell surface. T-cells may either be isolated or obtained from a commercially available source. “T cell” includes all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T-cells (CD8+ cells), natural killer T-cells, T-regulatory cells (Treg) and gamma- delta T cells.
  • CD4+ cells T-helper cells
  • CD8+ cells cytotoxic T-cells
  • Reg T-regulatory cells
  • gamma- delta T cells gamma- delta T cells.
  • a "cytotoxic cell” includes CD8+ T cells, natural-killer (NK) cells, and neutrophils, which cells are capable of mediating cytotoxicity responses.
  • T-cell lines include lines BCL2 (AAA) Jurkat (ATCC® CRL-2902TM), BCL2 (S70A) Jurkat (ATCC® CRL-2900TM), BCL2 (S87A) Jurkat (ATCC® CRL-2901TM), BCL2 Jurkat (ATCC® CRL-2899TM), Neo Jurkat (ATCC® CRL-2898TM), TALL-104 cytotoxic human T cell line (ATCC # CRL-11386).
  • T-cell lines e.g., such as Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-1 and T34; and immature T- cell lines, e.g., ALL-SIL, Bel3, CCRF-CEM, CML-T1, DND-41, DU.528, EU-9, HD- Mar, HPB-ALL, H-SB2, HT-1, JK-Tl, Jurkat, Karpas 45, KE-37, KOPT-Kl, K-Tl, L-KAW, Loucy, MAT, MOLT-1, MOLT 3, MOLT-4, MOLT 13, MOLT- 16, MT-1, MT-ALL, P12/Ichikawa, Peer, PER0117, PER-255, PF-382, PFI-285, RPMI-8402, ST-4, SUP-T1
  • mature T-cell lines e
  • Null leukemia cell lines including but not limited to REH, NALL-1, KM-3, L92-221, are a another commercially available source of immune cells, as are cell lines derived from other leukemias and lymphomas, such as K562 erythroleukemia, THP-1 monocytic leukemia, U937 lymphoma, HEL erythroleukemia, HL60 leukemia, HMC-1 leukemia, KG-1 leukemia, U266 myeloma.
  • Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/).
  • NK cell also known as natural killer cell, refers to a type of lymphocyte that originates in the bone marrow and play a critical role in the innate immune system. NK cells provide rapid immune responses against viral-infected cells, tumor cells or other stressed cell, even in the absence of antibodies and major
  • NK cells may either be isolated or obtained from a commercially available source.
  • NK cell lines include lines NK-92 (ATCC® CRL-2407TM), NK-92MI (ATCC® CRL-2408TM). Further examples include but are not limited to NK lines HANKl, KHYG-1, NKL, NK-YS, NOI-90, and YT.
  • Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/).
  • nucleic acid sequence and “polynucleotide” are used interchangeably to refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
  • this term includes, but is not limited to, single-, double-, or multi- stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
  • encode refers to a nucleic acid sequence
  • polynucleotide which is said to "encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof.
  • the antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
  • signal peptide or signal polypeptide intends an amino acid sequence usually present at the N-terminal end of newly synthesized secretory or membrane polypeptides or proteins. It acts to direct the polypeptide across or into a cell membrane and is then subsequently removed. Examples of such are well known in the art. Non-limiting examples are those described in U.S. Patent Nos. 8,853,381 and 5,958,736.
  • the term "vector” refers to a nucleic acid construct deigned for transfer between different hosts, including but not limited to a plasmid, a virus, a cosmid, a phage, a BAC, a YAC, etc.
  • plasmid vectors may be prepared from commercially available vectors.
  • viral vectors may be produced from baculoviruses, retroviruses, adenoviruses, AAVs, etc. according to techniques known in the art.
  • the viral vector is a lentiviral vector.
  • promoter refers to any sequence that regulates the expression of a coding sequence, such as a gene. Promoters may be constitutive, inducible, repressible, or tissue-specific, for example.
  • a "promoter” is a control sequence that is a region of a polynucleotide sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
  • isolated cell generally refers to a cell that is substantially separated from other cells of a tissue.
  • immuno cells includes, e.g., white blood cells (leukocytes) which are derived from hematopoietic stem cells (HSC) produced in the bone marrow, lymphocytes (T cells, B cells, natural killer (NK) cells), myeloid-derived cells (neutrophil, eosinophil, basophil, monocyte, macrophage, dendritic cells), as well as precursors thereof committed to immune lineages.
  • Precursors of T-cells are lineage restricted stem and progenitor cells capable of differentiating to produce a mature T-cell.
  • Precursors of T-cells include HSCs, long term HSCs, short term HSCs, multipotent progenitor cells (MPPs), lymphoid primed multipotent progenitor cells (LMPPs), early lymphoid progenitor cells (ELPs), common lymphoid progenitor cells (CLPs), Pro-T-cells (ProT), early T-lineage progenitors / double negative 1 cells (ETPs/DNl), double negative (DN) 2a, DN2b, DN3a, DN3b, DN4, and double positive (DP) cells.
  • Markers of such T-cell precursors in humans include but are not limited to: HSCs: CD34+ and, optionally, CD38-; long term HSCs:
  • CD34+ CD38- and lineage negative wherein lineage negative means negative for one or more lineage specific markers selected from the group of TERl 19, Macl, Grl, CD45R/B220, CD3, CD4, and CD8; MPPs: CD34+ CD38- CD45RA- CD90- and, optionally, lineage negative; CLP: CD34+ CD38+ CD10+ and, optionally, lineage negative; LMPP/ELP:
  • DN1 CDl 17- CD34+ CD38- CDla-
  • DN2 CDl 17+ CD34+ CD38+ CDla-
  • DN3 CD34+ CD38+ CDla+
  • DN4 CD4+ CD3-
  • DP CD4+ CD8+ and, optionally, CD3+.
  • Precursors of K cells are lineage restricted stem and progenitor cells capable of differentiating to produce a mature NK cell.
  • NK precursors include HSCs, long term HSCs, short term HSCs, multipotent progenitor cells (MPPs), common myeloid progenitors (CMP), granulocyte-macrophage progenitors (GMP), pro-NK, pre-NK, and immature NK (iNK).
  • MPPs multipotent progenitor cells
  • CMP common myeloid progenitors
  • GMP granulocyte-macrophage progenitors
  • pro-NK pre-NK
  • immature NK immature NK
  • Markers of such NK precursors include but are not limited to: CMP: CD56- CD36- CD33+ CD34+ NKG2D- NKp46-; GMP: CD56- CD36- CD33+ CD34+ NKG2D- NKp46-; pro-NK: CD34+ CD45RA+ CD10+ CDl 17- CD161-; pre-NK: CD34+ CD45RA+ CDIO- CDl 17+ CD161+/-; and iNK: CD34- CDl 17+ CD161+ NKp46- CD94/NKG2A-.
  • markers of NK cell precursors include but are not limited to CDl 17+ CD161+ CD244+ CD33+ CD56- NCR- CD94/NKG2A- and LFA-1-.
  • Phenotyping reagents to detect precursor cell surface markers are available from, for example, BD Biosciences (San Jose, CA) and BioLegend (San Diego, CA).
  • T cell includes all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T- cells (CD8+ cells), natural killer T-cells, T-regulatory cells (Treg) and gamma-delta T cells.
  • a "cytotoxic cell” includes CD8+ T cells, natural-killer (NK) cells, and neutrophils, which cells are capable of mediating cytotoxicity responses.
  • transduce or “transduction” as it is applied to the production of chimeric antigen receptor cells refers to the process whereby a foreign nucleotide sequence is introduced into a cell. In some embodiments, this transduction is done via a vector.
  • CRISPR refers to a technique of sequence specific genetic manipulation relying on the clustered regularly interspaced short palindromic repeats pathway (CRISPR).
  • CRISPR can be used to perform gene editing and/or gene regulation, as well as to simply target proteins to a specific genomic location.
  • Gene editing refers to a type of genetic engineering in which the nucleotide sequence of a target polynucleotide is changed through introduction of deletions, insertions, or base substitutions to the polynucleotide sequence.
  • CRISPR-mediated gene editing utilizes the pathways of nonhomologous end-joining (NHEJ) or homologous recombination to perform the edits.
  • NHEJ nonhomologous end-joining
  • Gene regulation refers to increasing or decreasing the production of specific gene products such as protein or RNA.
  • guide RNA refers to the guide RNA sequences used to target the CRISPR complex to a specific nucleotide sequence such as a specific region of a cell's genome.
  • Techniques of designing gRNAs and donor therapeutic polynucleotides for target specificity are well known in the art. For example, Doench, J., et al. Nature biotechnology 2014; 32(12): 1262-7, Mohr, S. et al. (2016) FEBS Journal 283 : 3232-38, and Graham, D., et al. Genome Biol. 2015; 16: 260.
  • gRNA comprises or alternatively consists essentially of, or yet further consists of a fusion polynucleotide comprising CRISPR RNA (crRNA) and trans-activating CRIPSPR RNA (tracrRNA); or a polynucleotide comprising CRISPR RNA (crRNA) and trans-activating CRIPSPR RNA (tracrRNA).
  • a gRNA is synthetic (Kelley, M. et al. (2016) J of
  • inhibitory RNA refers to an RNA molecule capable of RNA interference, a mechanism whereby an inhibitory RNA molecule targets a messenger RNA (mRNA) molecule, resulting in inhibition gene expression and/or translation.
  • mRNA interference is also known as post-transcriptional gene silencing.
  • Exemplary inhibitory RNAs include but are not limited to antisense RNAs, microRNAs (miRNA), small interfering RNAs (siRNA), short hairpin RNAs (shRNA), double stranded RNA (dsRNA) and intermediates thereof.
  • miRNA microRNAs
  • siRNA small interfering RNAs
  • shRNA short hairpin RNAs
  • dsRNA double stranded RNA
  • RNAi kits are commercially available (e.g. GeneAssistTM Custom siRNA Builder, ThermoFisher Scientific, Waltham, MA).
  • autologous in reference to cells refers to cells that are isolated and infused back into the same subject (recipient or host).
  • Allogeneic refers to non-autologous cells.
  • An " effective amount” or “efficacious amount” refers to the amount of an agent, or combined amounts of two or more agents, that, when administered for the treatment of a mammal or other subject, is sufficient to effect such treatment for the disease. The “effective amount” will vary depending on the agent(s), the disease and its severity and the age, weight, etc., of the subject to be treated.
  • a "solid tumor” is an abnormal mass of tissue that usually does not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors include sarcomas, carcinomas, and lymphomas.
  • ovarian cancer refers to a type of cancer that forms in issues of the ovary, and has undergone a malignant transformation that makes the cells within the cancer pathological to the host organism with the ability to invade or spread to other parts of the body.
  • the ovarian cancer herein comprises type I cancers of low histological grade and type II cancer of higher histological grade.
  • the ovarian cancer includes but is not limited to epithelial carcinoma, serous carcinoma, clear-cell carcinoma, sex cord stromal tumor, germ cell tumor, dysgerminoma, mixed tumors, secondary ovarian cancer, low malignant potential tumors.
  • prostate cancer refers to a type of cancer that develops in the prostate, a gland in the male reproductive system.
  • the prostate cancer herein includes but is not limited to adenocarcinoma, sarcomas, small cell carcinomas, neuroendocrine tumors, transitional cell carcinomas.
  • B cell lymphoma or leukemia refers to a type of cancer that forms in issues of the lymphatic system or bone marrow, and has undergone a malignant
  • thyroid cancer refers to a type of cancer that develops in the thyroid.
  • compositions and methods include the recited elements, but do not exclude others.
  • Consisting essentially of when used to define compositions and methods shall mean excluding other elements of any essential significance to the combination for the intended use.
  • a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives and the like.
  • Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions disclosed herein. Aspects defined by each of these transition terms are within the scope of the present disclosure.
  • the term "detectable marker” refers to at least one marker capable of directly or indirectly, producing a detectable signal.
  • a non-exhaustive list of this marker includes enzymes which produce a detectable signal, for example by colorimetry,
  • luminescence such as horseradish peroxidase, alkaline phosphatase, ⁇ - galactosidase, glucose-6-phosphate dehydrogenase, chromophores such as fluorescent, luminescent dyes, groups with electron density detected by electron microscopy or by their electrical property such as conductivity, amperometry, voltammetry, impedance, detectable groups, for example whose molecules are of sufficient size to induce detectable modifications in their physical and/or chemical properties, such detection may be accomplished by optical methods such as diffraction, surface plasmon resonance, surface variation , the contact angle change or physical methods such as atomic force spectroscopy, tunnel effect, or radioactive molecules such as 32 P, 35 S or 125 1.
  • optical methods such as diffraction, surface plasmon resonance, surface variation , the contact angle change or physical methods such as atomic force spectroscopy, tunnel effect, or radioactive molecules such as 32 P, 35 S or 125 1.
  • purification marker refers to at least one marker useful for purification or identification.
  • a non-exhaustive list of this marker includes His, lacZ, GST, maltose-binding protein, NusA, BCCP, c-myc, CaM, FLAG, GFP, YFP, cherry, thioredoxin, poly(NANP), V5, Snap, HA, chitin-binding protein, Softag 1, Softag 3, Strep, or S-protein.
  • Suitable direct or indirect fluorescence marker comprise FLAG, GFP, YFP, RFP, dTomato, cherry, Cy3, Cy 5, Cy 5.5, Cy 7, DNP, AMCA, Biotin, Digoxigenin, Tamra, Texas Red, rhodamine, Alexa fluors, FITC, TRITC or any other fluorescent dye or hapten.
  • the term "expression” refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is
  • expression may include splicing of the mRNA in a eukaryotic cell.
  • the expression level of a gene may be determined by measuring the amount of mRNA or protein in a cell or tissue sample.
  • the expression level of a gene from one sample may be directly compared to the expression level of that gene from a control or reference sample.
  • the expression level of a gene from one sample may be directly compared to the expression level of that gene from the same sample following administration of a compound.
  • switch refers to a mechanism by which the expression, activation, or stability of a CAR or a component of a CAR is controlled (i.e. a mechanism to turn CARs "on” or “off).
  • Switch mechanisms include but are not limited to CAR expression systems that require co-expression of more than one construct to be activated, suicide switches, safety switches, and CARs that require multimerization for activation. In some embodiments, a switch is inducible.
  • a "Kozak consensus sequence” or “Kozak sequence” is an mRNA sequence that is recognized by a ribosome as a translation start site.
  • a Kozak sequence comprises a start codon (also known as an initiation codon) for initiation of translation and additional flanking nucleotides. The start codon specifies a methionine amino acid at the N-terminus of a translated polypeptide.
  • the Kozak consensus sequence for vertebrates is known in the art (e.g. Kozak, M. 1987 Nucleic Acids Res. 15(20): 8125-48).
  • Kozak sequences can be modified to be "strong", meaning that the nucleotide sequence closely matches the consensus sequence, particularly at nucleotides +4 and -3 relative to the number one nucleotide.
  • An "adequate" Kozak sequence has just one of these matching nucleotides while a “weak” Kozak sequence has neither matching nucleotide.
  • the strength of a Kozak sequence directly correlates with the amount of polypeptides translated from an expressed mRNA. In general, strong Kozak sequences result in greater efficiency of translation of an expressed mRNA while fewer polypeptides are transcribed from mRNAs with weak Kozak sequences.
  • homology or “identical”, percent “identity” or “similarity”, when used in the context of two or more nucleic acids or polypeptide sequences, refers to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, e.g., at least 60% identity, preferably at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region (e.g., nucleotide sequence encoding an antibody described herein or amino acid sequence of an antibody described herein).
  • Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences.
  • the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
  • default parameters are used for alignment.
  • a preferred alignment program is BLAST, using default parameters.
  • the terms also include sequences that have deletions and/or additions, as well as those that have substitutions.
  • the preferred algorithms can account for gaps and the like.
  • identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is at least 50-100 amino acids or nucleotides in length.
  • An "unrelated” or “non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences disclosed herein.
  • first line or “second line” or “third line” refers to the order of treatment received by a patient.
  • First line therapy regimens are treatments given first, whereas second or third line therapy are given after the first line therapy or after the second line therapy, respectively.
  • the National Cancer Institute defines first line therapy as "the first treatment for a disease or condition.
  • primary treatment can be surgery, chemotherapy, radiation therapy, or a combination of these therapies.
  • First line therapy is also referred to those skilled in the art as "primary therapy and primary treatment.” See National Cancer Institute website at www.cancer.gov, last visited on May 1, 2008.
  • a patient is given a subsequent chemotherapy regimen because the patient did not show a positive clinical or sub-clinical response to the first line therapy or the first line therapy has stopped.
  • the term “equivalent” or “biological equivalent” of an antibody means the ability of the antibody to selectively bind its epitope protein or fragment thereof as measured by ELISA or other suitable methods.
  • Biologically equivalent antibodies include, but are not limited to, those antibodies, peptides, antibody fragments, antibody variant, antibody derivative and antibody mimetics that bind to the same epitope as the reference antibody.
  • an equivalent intends at least about 70% homology or identity, or at least 80 % homology or identity and alternatively, or at least about 85 %, or alternatively at least about 90 %, or alternatively at least about 95 %, or alternatively 98 % percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
  • an equivalent thereof is a polynucleotide that hybridizes under stringent conditions to the reference polynucleotide or its complement.
  • a polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%, or 95%) of "sequence identity" to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
  • the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
  • default parameters are used for alignment.
  • a preferred alignment program is BLAST, using default parameters.
  • Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
  • the hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein binding, or in any other sequence-specific manner.
  • the complex may comprise two strands forming a duplex structure, three or more strands forming a multi- stranded complex, a single self-hybridizing strand, or any combination of these.
  • a hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PCR reaction, or the enzymatic cleavage of a polynucleotide by a ribozyme.
  • Examples of stringent hybridization conditions include: incubation temperatures of about 25°C to about 37°C; hybridization buffer concentrations of about 6x SSC to about lOx SSC; formamide concentrations of about 0% to about 25%; and wash solutions from about 4x SSC to about 8x SSC.
  • Examples of moderate hybridization conditions include: incubation temperatures of about 40°C to about 50°C; buffer concentrations of about 9x SSC to about 2x SSC; formamide concentrations of about 30% to about 50%; and wash solutions of about 5x SSC to about 2x SSC.
  • Examples of high stringency conditions include: incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O.
  • a "normal cell corresponding to the tumor tissue type” refers to a normal cell from a same tissue type as the tumor tissue.
  • a non-limiting example is a normal lung cell from a patient having lung tumor, or a normal colon cell from a patient having colon tumor.
  • isolated refers to molecules or biologicals or cellular materials being substantially free from other materials.
  • isolated refers to nucleic acid, such as DNA or RNA, or protein or polypeptide (e.g., an antibody or derivative thereof), or cell or cellular organelle, or tissue or organ, separated from other DNAs or RNAs, or proteins or polypeptides, or cells or cellular organelles, or tissues or organs, respectively, that are present in the natural source.
  • isolated also refers to a nucleic acid or peptide that is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
  • an "isolated nucleic acid” is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state.
  • isolated is also used herein to refer to polypeptides which are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides.
  • isolated is also used herein to refer to cells or tissues that are isolated from other cells or tissues and is meant to encompass both cultured and engineered cells or tissues.
  • the term "monoclonal antibody” refers to an antibody produced by a single clone of B-lymphocytes or by a cell into which the light and heavy chain genes of a single antibody have been transfected.
  • Monoclonal antibodies are produced by methods known to those of skill in the art, for instance by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells.
  • Monoclonal antibodies include humanized monoclonal antibodies.
  • protein protein
  • peptide and “polypeptide” are used interchangeably and in their broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics.
  • the subunits may be linked by peptide bonds.
  • the subunit may be linked by other bonds, e.g., ester, ether, etc.
  • a protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein's or peptide's sequence.
  • amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics.
  • polynucleotide and “oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or
  • Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown.
  • polynucleotides a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, RNAi, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers.
  • a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
  • the sequence of nucleotides can be interrupted by non-nucleotide components.
  • a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
  • the term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any aspect of this technology that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
  • a purified nucleic acid, peptide, protein, biological complexes or other active compound is one that is isolated in whole or in part from proteins or other contaminants.
  • substantially purified peptides, proteins, biological complexes, or other active compounds for use within the disclosure comprise more than 80% of all macromolecular species present in a preparation prior to admixture or formulation of the peptide, protein, biological complex or other active compound with a pharmaceutical carrier, excipient, buffer, absorption enhancing agent, stabilizer, preservative, adjuvant or other co-ingredient in a complete pharmaceutical formulation for therapeutic administration. More typically, the peptide, protein, biological complex or other active compound is purified to represent greater than 90%, often greater than 95% of all
  • the purified preparation may be essentially homogeneous, wherein other macromolecular species are not detectable by conventional techniques.
  • the term "specific binding” means the contact between an antibody and an antigen with a binding affinity of at least 10 ⁇ 6 M.
  • antibodies bind with affinities of at least about 10 "7 M, and preferably 10 "8 M, 10 "9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • recombinant protein refers to a polypeptide which is produced by recombinant DNA techniques, wherein generally, DNA encoding the polypeptide is inserted into a suitable expression vector which is in turn used to transform a host cell to produce the heterologous protein.
  • treating or “treatment” of a disease in a subject refers to (1) preventing the symptoms or disease from occurring in a subject that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or arresting its development; or (3) ameliorating or causing regression of the disease or the symptoms of the disease.
  • treatment is an approach for obtaining beneficial or desired results, including clinical results.
  • beneficial or desired results can include one or more, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition (including disease), states and remission (whether partial or total), whether detectable or undetectable.
  • the disease is cancer
  • the following clinical end points are non-limiting examples of treatment: reduction in tumor burden, slowing of tumor growth, longer overall survival, longer time to tumor progression, inhibition of metastasis or a reduction in metastasis of the tumor.
  • the term “overexpress" with respect to a cell, a tissue, or an organ expresses a protein to an amount that is greater than the amount that is produced in a control cell, a control issue, or an organ.
  • a protein that is overexpressed may be endogenous to the host cell or exogenous to the host cell.
  • endogenous refers to a gene or gene product that is naturally present within a cell and was not introduced through genetic engineering such as transfection or transduction of genetic material.
  • linker sequence relates to any amino acid sequence comprising from 1 to 10, or alternatively, 8 amino acids, or alternatively 6 amino acids, or alternatively 5 amino acids that may be repeated from 1 to 10, or alternatively to about 8, or alternatively to about 6, or alternatively about 5, or 4 or alternatively 3, or alternatively 2 times.
  • the linker may comprise up to 15 amino acid residues consisting of a pentapeptide repeated three times.
  • the linker sequence is a (Glycine4Serine)3 flexible polypeptide linker comprising three copies of gly-gly-gly-gly-ser, or equivalents thereof.
  • Non-limiting examples of linker sequences are known in the art, e.g.,
  • GGGGSGGGGSGGGG (and equivalents thereof); the tripeptide EFM; or Glu-Phe-Gly-Ala- Gly-Leu-Val-Leu-Gly-Gly-Gln-Phe-Met, and equivalents of each thereof.
  • matrix refers to a composition such as a gel electrophoresis gel or a matrix commonly used for western blotting (such as membranes made of
  • solid support refers to a material, composite material, surface, or functionalized surface capable of supporting a peptide and/or peptide synthesis.
  • Exemplary solid supports include but are not limited to stable beaded gel resins, end group acryloylated long-chain
  • solution refers to a liquid phase mixture or composition.
  • the term “enhancer”, as used herein, denotes sequence elements that augment, improve or ameliorate transcription of a nucleic acid sequence irrespective of its location and orientation in relation to the nucleic acid sequence to be expressed.
  • An enhancer may enhance transcription from a single promoter or simultaneously from more than one promoter. As long as this functionality of improving transcription is retained or substantially retained (e.g., at least 70%, at least 80%, at least 90% or at least 95% of wild- type activity, that is, activity of a full-length sequence), any truncated, mutated or otherwise modified variants of a wild-type enhancer sequence are also within the above definition.
  • WPRE Woodchuck Hepatitis Virus
  • HTP Woodchuck Hepatitis Virus
  • CAR chimeric antigen receptor
  • HLA histocompatibility lymphocyte antigen
  • IRES internal ribosomal entry site
  • LHR leuteinizing hormone receptor
  • MOI multiplicity of infection
  • PBMC peripheral blood mononuclear cells
  • PBS phosphate buffered saline
  • WPRE woodchuck hepatitis virus post-transcriptional regulatory element
  • CAR T-cells are genetically engineered autologous T-cells in which single chain antibody fragments (scFv) or ligands are attached to the T-cell signaling domain capable of facilitating T-cell activation (Maher, J. (2012) ISRN Oncol. 2012:278093; Curran, K.J. et al. (2012) J. Gene Med. 14:405-415; Fedorov, V.D. et al. (2014) Cancer J. 20: 160-165; Barrett, D M. et al. (2014) Annu. Rev. Med. 65:333-347).
  • CARs combine HLA-independent targeting specificity of a monoclonal antibody with the cytolytic activity and homing properties of activated T-cells.
  • CAR modified T-cells to human solid tumors have been constructed against the a-folate receptor, mesothelin, and MUC-CD, PSMA, and other targets but most have some off-target expression of antigen in normal tissues. These constructs have not shown the same exceptional results in patients emphasizing the need for additional studies to identify new targets and methods of CAR T-cell construction that can be used against solid tumors.
  • this disclosure provides antibodies specific to LHR, B7-H4, HLA-G, HLA-DR and methods and compositions relating to the use and production thereof.
  • this disclosure provides as a chimeric antigen receptor (CAR) comprising an antigen binding domain specific to LHR, B7-H4, HLA-G, HLA-DR, that in some aspects, is the antigen binding domain of an anti- LHR, B7-H4, HLA-G, HLA-DR antibody and methods and compositions relating to the use and production thereof.
  • CAR chimeric antigen receptor
  • a chimeric antigen receptor comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-luteinizing hormone receptor (“LHR”) antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • LHR anti-luteinizing hormone receptor
  • the two or more costimulatory signaling regions are selected from CD27, CD28, 4- IBB (CD 137), OX40, CD30, CD40, PD- 1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, CD27, LIGHT, KG2C, and B7-H3.
  • the antigen binding domain of the anti-LHR antibody of the CAR comprises, consists of, or consists essentially of an anti-LHR heavy chain (HC) variable region and an anti-LHR light chain (LC) variable region.
  • the CAR further comprises, consists of, or consists essentially of a linker polypeptide located between the anti-LHR HC variable region and the anti-LHR LC variable region.
  • the HC of the anti-LHR antibody of the CAR comprises, consists of, or consists essentially of a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of GYSITSGYG or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of IHYSGST or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of ARSLRY or an equivalent of each thereof.
  • the LC comprises, consists of, or consists essentially of a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of SSVNY or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of DTS or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of HQWSSYPYT or an equivalent of each thereof.
  • the HC of the anti-LHR antibody of the CAR comprises, consists of, or consists essentially of a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of GFSLTTYG or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IWGDGST or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of AEGSSLFAY or an equivalent of each thereof.
  • the LC comprises, consists of, or consists essentially of a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of QSLLNSGNQKNY or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of WAS or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of Q DYSYPLT or an equivalent of each thereof.
  • the HC of the anti-LHR antibody of the CAR comprises, consists of, or consists essentially of a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of GYSFTGYY or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of IYPYNGVS or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of ARERGLYQLRAMDY or an equivalent of each thereof.
  • the LC comprises, consists of, or consists essentially of a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of QSISNN or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of NAS or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of QQSNSWPYT or an equivalent of each thereof.
  • the HC variable region of the anti-LHR antibody of the CAR comprises, consists of, or consists essentially of a polypeptide selected from a sequence disclosed herein or an equivalent of each thereof.
  • the anti-LHR light chain variable region comprises, consists of, or consists essentially of a polypeptide selected from a sequence disclosed herein or an equivalent of each thereof.
  • the anti-LHR heavy chain variable region comprises, consists of, or consists essentially of a polypeptide with a consensus sequence selected from a sequence disclosed herein or an equivalent of each thereof.
  • the anti-LHR light chain variable region comprises, consists of, or consists essentially of a polypeptide with a consensus sequence selected from a sequence disclosed herein or an equivalent of each thereof.
  • an equivalent of a polypeptide comprises, consists of, or consists essentially of an polypeptide having at least 80% amino acid identity to the polypeptide or a polypeptide that is encoded by a polynucleotide that hybridizes under conditions of high stringency to the complement of a polynucleotide encoding the polypeptide.
  • the CAR further comprises, consists of, or consists essentially of a detectable marker or a purification marker.
  • an isolated nucleic acid sequence encoding a chimeric antigen receptor comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-luteinizing hormone receptor (“LHR") antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • the isolated nucleic acid sequence comprises, consists of, or consists essentially of a sequence selected from any one of a sequence disclosed herein, or an equivalent of each thereof.
  • the isolated nucleic acid sequence further comprises, consists of, or consists essentially of a Kozak consensus sequence located upstream of the antigen binding domain of the anti-LHR antibody or an enhancer. [0207] In some embodiments, the isolated nucleic acid sequence further comprises, consists of, or consists essentially of an antibiotic resistance polynucleotide.
  • the isolated nucleic acid sequence further comprises, consists of, or consists essentially of a switch mechanism for controlling expression and/or activation of the CAR.
  • a vector comprising, consisting of, or consisting essentially of an isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-luteinizing hormone receptor (“LHR”) antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • the vector is a plasmid.
  • the vector is selected from a group of a retroviral vector, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector.
  • the vector is a CRISPR vector or a vector comprising CRISPR.
  • a chimeric antigen receptor comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-luteinizing hormone receptor (“LHR”) antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • CAR chimeric antigen receptor
  • an isolated cell comprising, consisting of, or consisting essentially of an; an isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-luteinizing hormone receptor (“LHR”) antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • CAR chimeric antigen receptor
  • an isolated cell comprising, consisting of, or consisting essentially of a vector comprising, consisting of, or consisting essentially of an isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-luteinizing hormone receptor
  • CAR chimeric antigen receptor
  • the isolated cell comprises, consists of, or consists essentially of one or more of the CAR, isolated nucleic acid, or vector.
  • the isolated cell is an immune cell.
  • the immune cell is a T-cell or a natural killer (NK) cell.
  • the isolated cell is a T-cell precursor or an NK cell precursor.
  • composition comprising, consisting of, or consisting essentially of a carrier and one or more of: a CAR comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-luteinizing hormone receptor ("LHR") antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain, an isolated nucleic acid encoding the CAR, a vector comprising, consisting of, or consisting essentially of the isolated nucleic acid, or an isolated cell comprising the CAR, isolated nucleic acid, and/or vector.
  • LHR anti-luteinizing hormone receptor
  • the composition further comprises, consists of, or consists essentially of an antigen binding fragment capable of binding a peptide, wherein the peptide comprises an LHR protein or a fragment thereof.
  • the peptide is associated with a cell.
  • the peptide is bound to a solid support.
  • the peptide is disposed in a solution.
  • the peptide is associated with a matrix.
  • Also provided herein is a method of producing anti-LHR CAR expressing cells comprising, consisting of, or consisting essentially of: (i) introducing a population of immune cells with a nucleic acid sequence encoding a CAR comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-luteinizing hormone receptor
  • LHR antibody (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and (ii) selecting a subpopulation of immune cells that have been successfully transduced with said nucleic acid sequence of step (i) thereby producing anti-LHR CAR expressing cells.
  • the immune cells are T-cells.
  • the population of T-cells have been modified to reduce or eliminate expression of endogenous T-cell receptors.
  • the population of T-cells were modified using a method that employs RNA interference or CRISPR.
  • Also provided herein is a method of inhibiting the growth of a tumor and/or treating a cancer in a subject in need thereof, comprising, consisting of, or consisting essentially of administering to the subject an effective amount of isolated anti-LHR CAR expressing cells according to any of the embodiments provided herein.
  • the anti-LHR CAR expressing cells are autologous or allogenic to the subject being treated.
  • the tumor or cancer expresses or overexpresses LHR.
  • the tumor is a solid tumor, optionally an ovarian tumor or a prostate cancer tumor and/or the cancer is and ovarian cancer or a prostate cancer.
  • the subject in need thereof is a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
  • a chimeric antigen receptor comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-B7-H4 antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • the two or more costimulatory signaling regions are selected from CD27, CD28, 4- IBB (CD 137), OX40, CD30, CD40, PD- 1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, CD27, LIGHT, KG2C, and B7-H3.
  • the antigen binding domain of the anti-B7-H4 antibody of the CAR comprises, consists of, or consists essentially of an anti-B7-H4 heavy chain (HC) variable region and an anti-B7-H4 light chain (LC) variable region.
  • the CAR further comprises a linker polypeptide located between the anti-B7-H4 HC variable region and the anti-B7-H4 LC variable region.
  • the HC of the anti-B7-H4 antibody comprises, consists of, or consists essentially of: a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of GXTF or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) ISSXXXT, (ii) INPNNGGT, or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of ARPXYY or an equivalent of each thereof; and/or the LC comprises, consists of, or consists essentially of a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) QSIVHXNGTY, (ii) ENIGSY, or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of (i)
  • the HC of the anti-B7-H4 antibody comprises, consists of, or consists essentially of, consists of, or consists essentially of: a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) GFTFSSFG, (ii) GFTFSSYG, (iii) GYTFTDY or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) ISSGSSTL, (ii) ISSSNSTI, or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) ARPLYYYGSVMDY, (ii) ARPYYYGSSYDY, or an equivalent of each thereof; and/or the LC comprises, consists of, or consists essentially of a CDR1 comprising, consisting of, or consisting essentially of the amino acid
  • FQGSYVPPT (ii) FQGSHVPLT, or an equivalent of each thereof.
  • the anti-B7-H4 heavy chain variable region of the CAR comprises, consists of, or consists essentially of a polypeptide selected from a sequence disclosed herein or an equivalent of each thereof.
  • the anti-B7-H4 light chain variable region of the CAR comprises, consists of, or consists essentially of a polypeptide selected from a sequence disclosed herein or an equivalent of each thereof.
  • the anti-B7-H4 heavy chain variable region of the CAR comprises, consists of, or consists essentially of a polypeptide with a consensus sequence selected from a sequence disclosed herein or an equivalent of each thereof.
  • the anti- B7-H4 light chain variable region comprises, consists of, or consists essentially of a polypeptide with a consensus sequence selected from a sequence disclosed herein or an equivalent of each thereof.
  • the CAR further comprises, consists of, or consists essentially of a detectable marker or a purification marker.
  • an isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-B7-H4 antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • the isolated nucleic acid sequence comprises a sequence selected from any one of a sequence disclosed herein, or an equivalent of each thereof.
  • the isolated nucleic acid sequence further comprises, consists of, or consists essentially of a Kozak consensus sequence located upstream of the antigen binding domain of the anti-B7-H4 antibody or an enhancer.
  • the isolated nucleic acid sequence further comprises, consists of, or consists essentially of an antibiotic resistance polynucleotide.
  • the isolated nucleic acid sequence further comprises, consists of, or consists essentially of a switch mechanism for controlling expression and/or activation of the CAR.
  • a vector comprising, consisting of, or consisting essentially of an isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-B7-H4 antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • CAR chimeric antigen receptor
  • the vector is a plasmid. In some embodiments, the vector is selected from a retroviral vector, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector. In some embodiments, the vector is a CRISPR vector.
  • an isolated cell comprising, consisting of, or consisting essentially of, a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-B7-H4 antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and/or an isolated nucleic acid encoding the
  • the isolated cell is an immune cell.
  • the immune cell is a T-cell or a natural killer (NK) cell.
  • the isolated cell is a T-cell precursor or an NK cell precursor.
  • composition comprising, consisting of, or consisting essentially of a carrier and one or more of: a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-B7-H4 antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; an isolated nucleic acid sequence encoding the CAR; a vector comprising the isolated nucleic acid sequence; and/or an isolated cell comprising the CAR, vector, or isolated nucleic acid sequence.
  • CAR chimeric antigen receptor
  • the composition further comprises an antigen binding fragment capable of binding a peptide, wherein the peptide comprises an B7-H4 protein or a fragment thereof.
  • the peptide is associated with a cell.
  • the peptide is bound to a solid support.
  • the peptide is disposed in a solution.
  • the peptide is associated with a matrix.
  • a method of producing anti-B7-H4 CAR expressing cells comprising: (i) introducing a population of immune cells with a nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-B7-H4 antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and (ii) selecting a subpopulation of immune cells that have been successfully transduced with said nucleic acid sequence of step (i) thereby producing anti-B7-H4 CAR expressing cells.
  • CAR chimeric antigen receptor
  • the immune cells are T-cells.
  • the population of T-cells have been modified to reduce or eliminate expression of endogenous T-cell receptors.
  • the population of T-cells were modified using a method that employs RNA interference or CRISPR.
  • CAR chimeric antigen receptor
  • the anti-B7-H4 CAR expressing cells are autologous or allogenic to the subject being treated.
  • the tumor or cancer expresses or overexpresses B7-H4.
  • the tumor is a solid tumor, optionally, a breast, colon, or choriocarcinoma tumor and/or the cancer is a breast, color or a chorio-carcinoma.
  • the subject is a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
  • a chimeric antigen receptor comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-G antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • the two or more costimulatory signaling regions are selected from CD27, CD28, 4- IBB (CD 137), OX40, CD30, CD40, PD- 1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, CD27, LIGHT, KG2C, and B7-H3.
  • the antigen binding domain of the anti-HLA-G antibody comprises, consists of, or consists essentially of an anti-HLA-G heavy chain (HC) variable region and an anti-HLA-G light chain (LC) variable region.
  • the CAR further comprises, consists of, or consists essentially of a linker polypeptide located between the anti-HLA-G HC variable region and the anti-HLA-G LC variable region.
  • the HC of the anti-HLA-G antibody comprises, consists of, or consists essentially of: a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) GFNIKDTY, (ii) GFTFNTYA, or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) IDPANGNT, (ii) IRSKSNNYAT, or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) ARSYYGGFAY, (ii) VRGGYWSFDV, or an equivalent of each thereof; and/or the LC comprises, consists of, or consists essentially of a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) KSVSTSGYSY, (ii)
  • KSLLHSNGNTY or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) LVS, (ii) RMS, or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) QHSRELPRT, (ii) MQHLEYPYT, or an equivalent of each thereof.
  • the anti-HLA-G heavy chain variable region of the CAR comprises, consists of, or consists essentially of a polypeptide selected from a sequence disclosed herein or an equivalent of each thereof.
  • the anti-HLA-G light chain variable region comprises, consists of, or consists essentially of a polypeptide selected from a sequence disclosed herein or an equivalent of each thereof.
  • the anti-HLA-G heavy chain variable region comprises, consists of, or consists essentially of a polypeptide with a consensus sequence selected from a sequence disclosed herein or an equivalent of each thereof.
  • the anti-HLA-G light chain variable region comprises, consists of, or consists essentially of a polypeptide with a consensus sequence selected from a sequence disclosed herein or an equivalent of each thereof.
  • the CAR further comprises a detectable marker or a purification marker.
  • nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-G antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • the nucleic acid sequence comprises a sequence selected from any one of a sequence disclosed herein, or an equivalent of each thereof.
  • the isolated nucleic acid further comprises, consists of, or consists essentially of a Kozak consensus sequence located upstream of the antigen binding domain of the anti-HLA-G antibody or an enhancer. In some embodiments, the isolated nucleic acid further comprises, consists of, or consists essentially of an antibiotic resistance polynucleotide. In some embodiments, the isolated nucleic acid further comprises, consists of, or consists essentially of a switch mechanism for controlling expression and/or activation of the CAR.
  • a vector comprising, consisting of, or consisting essentially of an isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-G antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • CAR chimeric antigen receptor
  • the vector is a plasmid.
  • the vector is selected from a group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, and an adeno- associated viral vector.
  • the vector is a CRISPR vector or a vector comprising CRISPR.
  • an isolated cell comprising, consisting of, or consisting essentially of a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-G antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and/or an isolated nucleic acid sequence encoding the CAR; and/or a vector comprising, consisting of, or consisting essentially of the isolated nucleic acid sequence.
  • the isolated cell is an immune cell.
  • the isolated cell is a T-cell or a natural killer (NK) cell.
  • the isolated cell is a T-cell precursor or an NK cell precursor.
  • composition comprising, consisting of, or consisting essentially of a carrier and one or more of: a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-G antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and/or an isolated nucleic acid sequence encoding the CAR; and/or a vector comprising, consisting of, or consisting essentially of the isolated nucleic acid sequence; and/or an isolated cell comprising, consisting of, or consisting essentially of the CAR, isolated nucleic acid sequence, or vector.
  • CAR chimeric antigen receptor
  • the composition further comprises, consists of, or consists essentially of an antigen binding fragment capable of binding a peptide, wherein the peptide comprises an HLA-G protein or a fragment thereof.
  • the peptide is associated with a cell.
  • the peptide is bound to a solid support.
  • the peptide is disposed in a solution.
  • the peptide is associated with a matrix.
  • a method of producing anti-HLA-G CAR expressing cells comprising, consisting of, or consisting essentially of: (i) introducing a population of immune cells with a nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-G antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and (ii) selecting a subpopulation of immune cells that have been successfully transduced with said nucleic acid sequence of step (i) thereby producing anti-HLA-G CAR expressing cells.
  • CAR chimeric antigen receptor
  • the immune cells are T-cells.
  • the population of T-cells have been modified to reduce or eliminate expression of endogenous T-cell receptors.
  • the population of T-cells were modified using a method that employs RNA interference or CRISPR.
  • Also provided herein is a method of inhibiting the growth of a tumor and/or treating a cancer in a subject in need thereof, comprising, consisting of, or consisting essentially of administering to the subject an effective amount of anti-HLA-G CAR expressing cells comprising, consisting of, or consisting essentially of a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-G antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and/or an isolated nucleic acid sequence encoding the CAR; and/or a vector comprising, consisting of, or consisting essentially of the isolated nucleic acid sequence.
  • the anti-HLA-G CAR expressing cells are autologous or allogenic to the subject
  • the tumor or cancer expresses or overexpresses HLA-G.
  • the tumor is a solid tumor, optionally a thyroid tumor, an ovarian tumor or a prostate cancer tumor and/or the cancer is a thyroid cancer, ovarian cancer, or prostate cancer.
  • the subject is a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
  • a chimeric antigen receptor comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-DR antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • the two or more costimulatory signaling regions are selected from CD27, CD28, 4- IBB (CD 137), OX40, CD30, CD40, PD- 1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, CD27, LIGHT, KG2C, and B7-H3.
  • the antigen binding domain of the anti-HLA-DR antibody comprises, consists of, or consists essentially of an anti-HLA-DR heavy chain (HC) variable region and an anti-HLA-DR light chain (LC) variable region.
  • the CAR further comprises, consists of, or consists essentially of a linker polypeptide located between the anti-HLA-DR HC variable region and the anti-HLA-DR LC variable region.
  • the HC of the anti-HLA-DR antibody of the CAR comprises, consists of, or consists essentially of: a CDR1 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) a CDRHl of a Lym-1 antibody, (ii) a CDRHl of a Lym-2 antibody, or an equivalent of each thereof; and/or a CDR2 comprising, consisting of, or consisting essentially of the amino acid sequence of (i) a CDRH2 of a Lym-1 antibody, (ii) a CDRH2 of a Lym-2 antibody, or an equivalent of each thereof; and/or a CDR3 comprising, consisting of, or consisting essentially of the amino acid sequence of (i(i) a CDRH3 of a Lym-1 antibody, (ii) a CDRHl of a Lym-2 antibody, or an equivalent of each thereof; and/or the LC comprises, consists of, or consists essentially of:
  • the anti-HLA-DR heavy chain variable region comprises a polypeptide selected from a sequence disclosed herein or an equivalent of each thereof. In some embodiments, the anti-HLA-DR light chain variable region comprises a polypeptide selected from a sequence disclosed herein or an equivalent of each thereof. In some embodiments, the anti-HLA-DR heavy chain variable region comprises a polypeptide with a consensus sequence selected from a sequence disclosed herein or an equivalent of each thereof. In some embodiments, the anti-HLA-DR light chain variable region comprises a polypeptide with a consensus sequence selected from a sequence disclosed herein or an equivalent of each thereof.
  • the CAR further comprises, consists of, or consists essentially of a detectable marker or a purification marker.
  • nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-DR antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • the nucleic acid sequence comprises a sequence selected from any one of a sequence disclosed herein, or an equivalent of each thereof.
  • the isolated nucleic acid further comprises, consists of, or consists essentially of a Kozak consensus sequence located upstream of the antigen binding domain of the anti-HLA-DR antibody or an enhancer.
  • the isolated nucleic acid further comprises, consists of, or consists essentially of an antibiotic resistance polynucleotide.
  • the isolated nucleic acid further comprises, consists of, or consists essentially of a switch mechanism for controlling expression and/or activation of the CAR.
  • a vector comprising, consisting of, or consisting essentially of a isolated isolated nucleic acid sequence encoding a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-DR antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain.
  • the vector is a plasmid.
  • the vector is selected from a group consisting of a retroviral vector, a lentiviral vector, an adenoviral vector, and an adeno- associated viral vector.
  • the vector is a CRISPR vector or a vector comprising CRISPR.
  • an isolated cell comprising a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-DR antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and/or an isolated nucleic acid encoding the CAR; and/or a vector of comprising, consisting of, or consisting essentially of the isolated nucleic acid encoding the CAR.
  • the isolated cell is an immune cell.
  • the immune cell is a T-cell or a natural killer (NK) cell.
  • the isolated cell is a T-cell or K-cell precursor.
  • composition comprising a carrier and one or more of: a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-DR antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and/or an isolated nucleic acid encoding the CAR; and/or a vector of comprising, consisting of, or consisting essentially of the isolated nucleic acid sequence encoding the CAR; and/or an isolated cell comprising at least one of the CAR, isolated nucleic acid sequence, and vector.
  • CAR chimeric antigen receptor
  • the composition further comprises, consists of, or consists essentially of an antigen binding fragment capable of binding a peptide, wherein the peptide comprises an HLA-DR protein or a fragment thereof.
  • the peptide is associated with a cell.
  • the peptide is bound to a solid support.
  • the peptide is disposed in a solution.
  • the peptide is associated with a matrix.
  • a method of producing anti-HLA-DR CAR expressing cells comprising, consisting of, or consisting essentially of a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-DR antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and/or an isolated nucleic acid encoding the CAR; and/or a vector of comprising, consisting of, or consisting essentially of the isolated nucleic acid encoding the CAR, the method comprising: (i) introducing a population of immune cells with a nucleic acid sequence encoding the CAR of any one of claims 119 to 129; and (ii) selecting a subpopulation of immune cells that have been successfully transduced with said nucle
  • the immune cells are T-cells.
  • the population of T-cells have been modified to reduce or eliminate expression of endogenous T-cell receptors.
  • the population of T-cells were modified using a method that employs RNA interference or CRISPR.
  • Also provided herein is a method of inhibiting the growth of a tumor and/or treating a cancer in a subject in need thereof, comprising administering to the subject an effective amount of the anti-HLA-DR CAR expressing cells comprising, consisting of, or consisting essentially of a chimeric antigen receptor (CAR) comprising, consisting of, or consisting essentially of: (a) an antigen binding domain of an anti-HLA-DR antibody, (b) a CD8 a hinge domain; (c) a CD8 a transmembrane domain; (d) two or more costimulatory signaling regions; and (e) a CD3 zeta signaling domain; and/or an isolated nucleic acid encoding the CAR; and/or a vector of comprising, consisting of, or consisting essentially of the isolated nucleic acid encoding the CAR.
  • the anti-HLA-DR CAR expressing cells are autologous or allogenic to the subject being treated.
  • the tumor or cancer expresses or overexpresses HLA-DR as compared to a normal, non-cancerous counterpart cell.
  • the tumor is a B-cell lymphoma tumor or a leukemia tumor and/or the cancer is a B-cell lymphoma or a leukemia.
  • the subject is a human, an animal, a non-human primate, a dog, cat, a sheep, a mouse, a horse, or a cow.
  • a kit comprising one or more of a CAR, isolated nucleic acid sequence, vector, isolated cell, and composition disclosed herein and instructions for use according to one or more methods disclosed herein.
  • An immunoglobulin monomer comprises two heavy chains and two light chains connected by disulfide bonds. Each heavy chain is paired with one of the light chains to which it is directly bound via a disulfide bond. Each heavy chain comprises a constant region (which varies depending on the isotype of the antibody) and a variable region.
  • the variable region comprises three hypervariable regions (or complementarity determining regions) which are designated CDRH1, CDRH2 and CDRH3 and which are supported within framework regions.
  • Each light chain comprises a constant region and a variable region, with the variable region comprising three hypervariable regions (designated CDRL1, CDRL2 and CDRL3) supported by framework regions in an analogous manner to the variable region of the heavy chain.
  • the hypervariable regions of each pair of heavy and light chains mutually cooperate to provide an antigen binding site that is capable of binding a target antigen.
  • the binding specificity of a pair of heavy and light chains is defined by the sequence of CDRl, CDR2 and CDR3 of the heavy and light chains.
  • the disclosure provides an isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC)
  • immunoglobulin variable domain sequence wherein the antibody binds to an epitope of a luteinizing hormone receptor (LHR), B7-H4, HLA-G, or HLA-DR.
  • LHR luteinizing hormone receptor
  • B7-H4 HLA-G
  • HLA-DR HLA-DR
  • LHR is a potent target for CAR T-cell therapy.
  • Table 1 and FIG. 1 flow cytometric studies utilizing 9 well established human ovarian cell lines showed LHR to be an excellent target compared to mesothelin and MUC16, which were only positive on half or less of the cell lines tested. These targets were also tested on a multi -block slide of human ovarian cancers by immunohistochemistry as shown in Table 2. Consistent with the flow cytometric results, LHR positivity was more consistently seen than mesothelin and MUC16 positivity by these methods regardless of the stage or grade of tumor tested. As shown in FIG.
  • the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GYSITSGYG or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IHYSGST or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARSLRY or an equivalent of each thereof; and/or the LC comprises the antibody of comprises or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of SSVNY or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of DTS or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of HQWSSYPYT or an equivalent of each thereof.
  • the antibody comprises a HC that comprises, or alternatively consists essentially of, or yet further consists of a one or more of: a CDR1 comprising the amino acid sequence of GFSLTTYG or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IWGDGST or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of AEGSSLFAY or an equivalent of each thereof; and/or the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSLLNSGNQKNY or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of WAS or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of Q DYSYPLT or an equivalent of each thereof.
  • the HC of the antibody comprises, or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of GYSFTGYY or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IYPYNGVS or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARERGLYQLRAMDY or an equivalent of each thereof; and/or the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSISNN or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of NAS or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of
  • the disclosure provides an isolated anti-LHR antibody which is generated against a LHR fragment.
  • the LHR fragment is part of LHR G protein with the following amino acid sequence:
  • the LHR fragment is the N-terminal of LHR protein with the following amino acid sequence:
  • the antibody is a monoclonal antibody comprising an anti- LHR heavy chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected from those disclosed herein or an equivalent of each thereof, and an anti-LHR light chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected from those disclosed herein or an equivalent of each thereof.
  • the antibody is a chimeric antibody or a humanized antibody.
  • the disclosed antibodies possess a binding affinity of at least 10 ⁇ 6 M. In certain aspects, antibodies bind with affinities of at least about 10 ⁇ 7 M, and preferably 10 "8 M, 10 "9 M, 10 "10 M, 10 "11 M, or 10 "12 M.
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from disclosed herein
  • an anti-LHR light chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from those disclosed herein.
  • the disclosure provides an isolated nucleic acid encoding the isolated anti-LHR antibody.
  • the isolated nucleic acid comprising, or alternatively consisting essentially of, or yet further consisting of a nucleic acid sequence selected from those disclosed herein, or an equivalent of each therefore.
  • the HC of the antibody comprises or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of GYSITSGYG or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IHYSGST or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARSLRY or an equivalent of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy- terminus.
  • the light chain variable regions of the antibodies comprises or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of SSVNY or an equivalent of each thereof; and/or a
  • CDR2 comprising the amino acid sequence of DTS or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of HQWSSYPYT or an equivalent of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy -terminus.
  • the HC of the antibody comprises, or alternatively consists essentially of, or yet further consists of one or more of a CDR1 comprising the amino acid sequence of GFSLTTYG or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IWGDGST or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of AEGSSLFAY or an equivalent of each thereof; and/or the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSLLNSGNQKNY or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of WAS or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of QNDYSYPLT or an equivalent of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10
  • the HC of the antibody comprises, or alternatively consists essentially of, or yet further consists of one or more of: a CDR1 comprising the amino acid sequence of GYSFTGYY or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of IYPYNGVS or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of ARERGLYQLRAMDY or an equivalent of each thereof; and/or the LC of the antibody comprises, or alternatively consists essentially of, or yet further consists of a CDR1 comprising the amino acid sequence of QSISNN or an equivalent of each thereof; and/or a CDR2 comprising the amino acid sequence of NAS or an equivalent of each thereof; and/or a CDR3 comprising the amino acid sequence of
  • the disclosure provides an isolated anti-LHR antibody which is generated against a LHR fragment.
  • the LHR fragment against which the antibody is raised is part of LHR protein with the following amino acid sequence:
  • the LHR fragment is the N-terminal of LHR protein with the following amino acid sequence:
  • the antibody is a monoclonal antibody comprising an anti- LHR heavy chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected from those disclosed herein or an equivalent of each thereof.
  • the antibody is a monoclonal antibody comprising an anti- LHR light chain variable region comprising, or alternatively consisting essentially of, or yet further consisting of a polypeptide selected from those disclosed herein or an equivalent of each thereof.
  • the anti-LHR antibody is a chimeric antibody, human or a humanized antibody.
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from those disclosed herein, and an anti-LHR light chain variable region comprises, or alternatively consists essentially of, or yet further consists of a polypeptide with a consensus sequence selected from those disclosed herein, or equivalents of each thereof.
  • the isolated antibody includes one or more of the following characteristics:
  • the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences;
  • the heavy chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences;
  • the light chain immunoglobulin variable domain sequence is at least 85% identical to a light chain variable domain of any of the disclosed light chain sequences;
  • the HC immunoglobulin variable domain sequence is at least 85% identical to a heavy chain variable domain of any of the disclosed light chain sequences;
  • the antibody binds an epitope that overlaps with an epitope bound by any of the disclosed sequences.
  • the present disclosure provides an isolated antibody that is at least 85% identical to the anti-LHR antibodies, e.g., 5F4-21, 4A7-4, 8B7-3 or 138-2, as disclosed herein.
  • the antibody binds human LHR with a dissociation constant (K D ) of less than 10 "4 M, 10 "5 M, 10 "6 M, 10 “7 M, 10 “8 M, 10 “9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • K D dissociation constant
  • the antigen binding site specifically binds to human LHR.
  • the present disclosure provides an isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC)
  • the antibodies possess a binding affinity of at least 10 ⁇ 6 M. In certain aspects, antibodies bind with affinities of at least about 10 ⁇ 7 M, and preferably 10 "8 M, 10 "9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • the heavy chain variable region comprises a CDRHl sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with GXTF followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the CDRH1 sequence comprises, or alternatively consists essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences: (i) GFTFSSFG, (ii) GFTFSSYG, (iii) GYTFTDY, or equivalents thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the heavy chain variable region comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with ISSXXXT followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the CDRH2 sequence comprises, or alternatively consists essentially of, or yet further consists of, an amino acid sequence beginning with any one of the following sequences: (i) ISSGSSTL, (ii) ISSSNSTI, or equivalents thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy- terminus.
  • the heavy chain variable region comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with INPNNGGT or an equivalent thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the heavy chain variable region comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with ARPXYY followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the CDRH3 sequence comprises, or alternatively consists essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences: (i) ARPLYYYGSVMDY, (ii) ARPYYYGSSYDY, or equivalents thereof, followed by followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequences:
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequences:
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequences:
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the light chain variable region comprises a CDRLl sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with QSIVHXNGTY followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the CDRLl sequence comprises, or alternatively consists essentially of, or yet further consists of, an amino acid sequence beginning with any one of the following sequences: (i) QSIVHRNGNTY, (ii) QSIVHSNGNTY, or equivalents thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises a CDRLl sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with ENIGSY or an equivalent thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy- terminus.
  • the light chain variable region comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with KVS followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with AAT or an equivalent thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy- terminus.
  • the light chain variable region comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with FQGSXVPXT followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the CDRL1 sequence comprises, or alternatively consists essentially of, or yet further consists of, an amino acid sequence beginning with any one of the following sequences: (i) FQGSYVPPT, (ii) FQGSHVPLT, or equivalents thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with QHYYSTLVT or an equivalent thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the
  • ACTGAAA antigen binding fragment thereof or an equivalent of each thereof.
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • DIQMTQSPASLSASVGETVTITCRASENIGSYLAWYQQKQGKSPQLLVYAATLLADG VPSRFSGSGSGTQFSLKINSLQSEDVARYYCQHYYSTLVTFGAGTKLELK (B7-H4 #36-1 Light Variable) or an antigen binding fragment thereof or an equivalent of each thereof.
  • the isolated antibody includes one or more of the following characteristics:
  • the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences;
  • the heavy chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences;
  • the light chain immunoglobulin variable domain sequence is at least 85% identical to a light chain variable domain of any of the disclosed light chain sequences;
  • the HC immunoglobulin variable domain sequence is at least 85% identical to a heavy chain variable domain of any of the disclosed light chain sequences;
  • the antibody binds an epitope that overlaps with an epitope bound by any of the disclosed sequences.
  • the present disclosure provides an isolated antibody that is at least 85% identical to an antibody selected from the group consisting of B7H4 5F6, B7H4 # 33-14, and B7H4 #36-1.
  • the antibodies identified above possess a binding affinity of at least 10 ⁇ 6 M.
  • antibodies bind with affinities of at least about 10 ⁇ 7 M, and preferably 10 "8 M, 10 "9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • the present disclosure provides an isolated antibody comprising the CDRs of B7H4 5F6. In one aspect, the present disclosure provides an isolated antibody that is at least 85% identical to B7H4 5F6.
  • the present disclosure provides an isolated antibody comprising the CDRs of B7H4 # 33-14. In one aspect, the present disclosure provides an isolated antibody that is at least 85% identical to B7H4 # 33-14.
  • the present disclosure provides an isolated antibody comprising the CDRs of B7H4 #36-1. In one aspect, the present disclosure provides an isolated antibody that is at least 85% identical to B7H4 #36-1.
  • the HC variable domain sequence comprises a variable domain sequence of B7H4 5F6 and the LC variable domain sequence comprises a variable domain sequence of B7H4 5F6.
  • the HC variable domain sequence comprises a variable domain sequence of B7H4 # 33-14 and the LC variable domain sequence comprises a variable domain sequence of B7H4 # 33-14.
  • the HC variable domain sequence comprises a variable domain sequence of B7H4 #36-1 and the LC variable domain sequence comprises a variable domain sequence of B7H4 #36-1.
  • the antibody binds human B7-H4 with a dissociation constant (K D ) of less than 10 "4 M, 10 "5 M, 10 "6 M, 10 "7 M, 10 “8 M, 10 "9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • K D dissociation constant
  • the antigen binding site specifically binds to human B7-H4.
  • the antibody binds to the epitope bound by B7H4 5F6, B7H4 # 33-14, and B7H4 #36-1 antibodies.
  • the B7-H4-specific antibody competes for binding to human B7-H4 with B7H4 5F6, B7H4 # 33-14, and B7H4 #36-1.
  • Anti-HLA-G Antibodies are provided herein.
  • the present disclosure provides an isolated antibody comprising a heavy chain (HC) immunoglobulin variable domain sequence and a light chain (LC)
  • immunoglobulin variable domain sequence wherein the heavy chain and light chain immunoglobulin variable domain sequences form an antigen binding site that binds to an epitope of human HL A-G.
  • the heavy chain variable region comprises a CDRHl sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences: (i) GFNIKDTY, (ii) GFTFNTYA (, or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the heavy chain variable region comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences: (i) IDPANGNT, (ii) IRSKSNNYAT, or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the heavy chain variable region comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences: (i) ARSYYGGFAY, (ii) VRGGYWSFDV, or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequences: CAGGTGCAGCTGCAGGAGTCAGGGGCAGAGCTTGTGAAGCCAGGGGCCTCAGTC AAGTTGTCCTGCACAGCTTCTGGCTTCAACATTAAAGACACCTATATGCACTGGG TGAAGCAGAGGCCTGAACAGGGCCTGGAGTGGATTGGAAGGATTGATCCTGCGA ATGGTAATACTAAATATGACCCGAAGTTCCAGGGCAAGGCCACTATAACAGCAG ACACATCCTCCAACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACA CTGCCGTCTATTACTGTGCTAGGAGTTACTACGGGGGGTTTGCTTACTGGGGCCA AGGGACTCTGGTCACTGTCTCTGCA or an antigen binding fragment thereof or an equivalent of each thereof.
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • VTVSA (3H11 Heavy Variable Chain) or an antigen binding fragment thereof or an equivalent of each thereof.
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequences:
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the light chain variable region comprises a CDRL1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences: (i) KSVSTSGYSY, (ii) KSLLHSNGNTY, or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with LVS, or an equivalent thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy- terminus.
  • the light chain variable region comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with RMS or an equivalent thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy- terminus.
  • the light chain variable region comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences: (i) QHSRELPRT, (ii) MQHLEYPYT, or equivalent of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the
  • AAATAAAA or an antigen binding fragment thereof or an equivalent of each thereof.
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the isolated antibody includes one or more of the following characteristics:
  • the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences;
  • the heavy chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences;
  • the light chain immunoglobulin variable domain sequence is at least 85% identical to a light chain variable domain of any of the disclosed light chain sequences;
  • the HC immunoglobulin variable domain sequence is at least 85% identical to a heavy chain variable domain of any of the disclosed light chain sequences;
  • the antibody binds an epitope that overlaps with an epitope bound by any of the disclosed sequences.
  • Exemplary antibodies comprising the disclosed CDR sequences and heavy and light chain variable sequences are disclosed in Table 1 and Table 2, respectively.
  • the present disclosure provides an isolated antibody that is at least 85% identical to an antibody selected from the group consisting of 3H11 and HLA-G 4E3.
  • the present disclosure provides an isolated antibody comprising the CDRs of 3H11. In one aspect, the present disclosure provides an isolated antibody that is at least 85% identical to 3H11.
  • the present disclosure provides an isolated antibody comprising the CDRs of HLA-G 4E3. In one aspect, the present disclosure provides an isolated antibody that is at least 85% identical to HLA-G 4E3.
  • the HC variable domain sequence comprises a variable domain sequence of 3H11 and the LC variable domain sequence comprises a variable domain sequence of 3H11.
  • the HC variable domain sequence comprises a variable domain sequence of HLA-G 4E3 and the LC variable domain sequence comprises a variable domain sequence of HLA-G 4E3.
  • the antibody binds human HLA-G with a dissociation constant (K D ) of less than 10 "4 M, 10 "5 M, 10 "6 M, 10 “7 M, 10 “8 M, 10 “9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • K D dissociation constant
  • the antigen binding site specifically binds to human HLA-G.
  • the heavy chain variable region comprises a CDRHl sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences (i) GFSLTSYG, (ii) GFTFSNYW, or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the heavy chain variable region comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences: (i) IWSDGST, (ii) IRFKSHNYAT, or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the heavy chain variable region comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences: (i) ASHYGSTLAFAS, (ii) TRRIGNSDYDWWYFDV, or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy- terminus.
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequence:
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the below noted polynucleotide sequence:
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • FDVWGAGTSVTVSSAS (Lym-2 Heavy Variable Chain), or an antigen binding fragment thereof or an equivalent of each thereof.
  • the light chain variable region comprises a CDRL1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with any one of the following sequences (i) VNIYSY, (ii)
  • QNVGNN or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with (i) NAK, (ii) SAS, or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning (i) QHHYGTFT, (ii) QQYNTYPFT, or equivalents of each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the
  • polynucleotide sequence GACATCCAGATGACTCAGTCTCCAGCCTCCCTATCTGCATCTGTGGGAGAAACTG
  • Variable Chain or an antigen binding fragment thereof or an equivalent of each thereof.
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by the
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the amino acid sequence:
  • the isolated antibody includes one or more of the following characteristics:
  • the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences;
  • the heavy chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 85% identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences;
  • the light chain immunoglobulin variable domain sequence is at least 85% identical to a light chain variable domain of any of the disclosed light chain sequences;
  • the HC immunoglobulin variable domain sequence is at least 85% identical to a heavy chain variable domain of any of the disclosed light chain sequences;
  • the antibody binds an epitope that overlaps with an epitope bound by any of the disclosed sequences.
  • the present disclosure provides an isolated antibody that is at least 85% identical to an antibody selected from the group consisting of Lym-1 and Lym-2.
  • the present disclosure provides an isolated antibody comprising the CDRs of Lym-1. In one aspect, the present disclosure provides an isolated antibody that is at least 85%) identical to Lym-1.
  • the present disclosure provides an isolated antibody comprising the CDRs of Lym-2. In one aspect, the present disclosure provides an isolated antibody that is at least 85%) identical to Lym-2.
  • the HC variable domain sequence comprises, or consists essentially of, or yet further consists of, a variable domain sequence of Lym-1 and the LC variable domain sequence comprises, or consists essentially of, or yet further consists of a variable domain sequence of Lym-1.
  • the HC variable domain sequence comprises, or consists essentially of, or yet further consists of, a variable domain sequence of
  • Lym-2 and the LC variable domain sequence comprises, or consists essentially of, or yet further consists of a variable domain sequence of Lym-2.
  • the antibody binds human HLA-DR with a dissociation constant (K D ) of less than 10 "4 M, 10 "5 M, 10 "6 M, 10 "7 M, 10 “8 M, 10 "9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • K D dissociation constant
  • the antigen binding site specifically binds to human HLA-DR.
  • the antibody is soluble Fab.
  • the HC and LC variable domain sequences are components of the same polypeptide chain. In some of the aspects of the antibodies provided herein, the HC and LC variable domain sequences are components of different polypeptide chains.
  • the antibody is a full-length antibody. In other aspect, antigen binding fragments of the antibodies are provided.
  • the antibody is a monoclonal antibody.
  • the antibody is chimeric or humanized.
  • the antibody fragment is selected from the group consisting of Fab, F(ab)'2, Fab', scF v , and F v .
  • the antibody antibody comprises an Fc domain. In some of the aspects of the antibodies provided herein, the antibody is a rabbit antibody. In some of the aspects of the antibodies provided herein, the antibody is a human or humanized antibody or is non-immunogenic in a human. In some of the aspects of the antibodies provided herein comprise a human antibody framework region.
  • one or more amino acid residues in a CDR of the antibodies provided herein are substituted with another amino acid.
  • the substitution may be "conservative" in the sense of being a substitution within the same family of amino acids.
  • the naturally occurring amino acids may be divided into the following four families and conservative substitutions will take place within those families:
  • Amino acids with basic side chains lysine, arginine, histidine
  • Amino acids with acidic side chains aspartic acid, glutamic acid
  • Amino acids with nonpolar side chains glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, cysteine.
  • one or more amino acid residues are added to or deleted from one or more CDRs of an antibody. Such additions or deletions occur at the N or C termini of the CDR or at a position within the CDR.
  • antibodies of the present disclosure comprising such varied CDR sequences still bind LHR, B7-H4, HLA-G, or HLA-DR with similar specificity and sensitivity profiles as the disclosed antibodies. This may be tested by way of the binding assays.
  • the constant regions of antibodies may also be varied.
  • antibodies may be provided with Fc regions of any isotype: IgA (IgAl, IgA2), IgD, IgE, IgG (IgGl, IgG2, IgG3, IgG4) or IgM.
  • IgA IgAl, IgA2
  • IgD IgAl, IgA2
  • IgE IgG
  • IgM immunoglobulG sequences
  • IgGl IgAl, IgA2, IgG3, IgG4
  • IgM immunoglobulG sequences
  • constant region sequences include:
  • the antibodies comprise a heavy chain constant region that is at least 80% identical to any one of those disclosed herein.
  • the antibodies comprise a light chain constant region that is at least 80% identical to any one of those disclosed herein.
  • the antibody contains structural modifications to facilitate rapid binding and cell uptake and/or slow release.
  • the LHR, B7-H4, HLA-G, or HLA-DR antibody contains a deletion in the CH2 constant heavy chain region of the antibody to facilitate rapid binding and cell uptake and/or slow release.
  • a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release.
  • a F(ab)'2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
  • the antibodies, fragments, and equivalents thereof can be combined with a carrier, e.g., a pharmaceutically acceptable carrier or other agents to provide a formulation for use and/or storage.
  • a carrier e.g., a pharmaceutically acceptable carrier or other agents to provide a formulation for use and/or storage.
  • an isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, the amino acid sequence of LHR, B7-H4, HLA-G, or HLA-DR or a fragment thereof, that are useful to generate antibodies that bind to LHR, B7-H4, HLA-G, or HLA-DR, as well as isolated polynucleotides that encode them.
  • the isolated polypeptides or polynucleotides further comprise a label or selection marker and/or contiguous polypeptide sequences (e.g., keyhole limpet haemocyanin (KLH) carrier protein) or in the case of polynucleotides, polynucleotides encoding the sequence, operatively coupled to polypeptide or polynucleotide.
  • KLH keyhole limpet haemocyanin
  • the polypeptides or polynucleotides can be combined with various carriers, e.g., phosphate buffered saline.
  • host cells e.g., prokaryotic or eukaryotic cells, e.g., bacteria, yeast, mammalian (rat, simian, hamster, or human), comprising the isolated polypeptides or polynucleotides.
  • the host cells can be combined with a carrier.
  • nucleic acids encoding the antibodies and fragments thereof as disclosed herein. They can be combined with a vector or appropriate host cell, and /or a suitable carrier for diagnostic or therapeutic use.
  • the nucleic acids are contained with a host cell for recombinant production of polypeptides and proteins.
  • the host cells can be eukaryotic or prokaryotic.
  • Antibodies their manufacture and uses are well known and disclosed in, for example, Harlow, E. and Lane, D., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999.
  • the antibodies may be generated using standard methods known in the art. Examples of antibodies include (but are not limited to) monoclonal, single chain, and functional fragments of antibodies. Methods for generating such antibodies are known in the art; see, e.g. Collarini et al. (2009) J. Immunol. 183(10):6338-6345.
  • Antibodies may be produced in a range of hosts, for example goats, rabbits, rats, mice, humans, and others. They may be immunized by injection with a target antigen or a fragment or oligopeptide thereof which has immunogenic properties, such as a C-terminal fragment of LHR or B-7-H4, HLA-G, or HLA-DR an isolated polypeptide thereof.
  • a target antigen or a fragment or oligopeptide thereof which has immunogenic properties, such as a C-terminal fragment of LHR or B-7-H4, HLA-G, or HLA-DR an isolated polypeptide thereof.
  • adjuvants may be added and used to increase an immunological response.
  • adjuvants include, but are not limited to, Freund's, mineral gels such as aluminum hydroxide, and surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol.
  • BCG Bacille Calmette-Guerin
  • Corynebacterium parvum are particularly useful. This this disclosure also provides the isolated polypeptide and an adjuvant.
  • the antibodies of the present disclosure are polyclonal, i.e., a mixture of plural types of anti-LHR, B7-H4, HLA-G, or HLA-DR antibodies having different amino acid sequences.
  • the polyclonal antibody comprises a mixture of plural types of anti-LHR, B7-H4, HLA-G, or HLA-DR antibodies having different CDRs.
  • a mixture of cells which produce different antibodies is cultured, and an antibody purified from the resulting culture can be used (see WO 2004/061104).
  • Monoclonal antibodies to LHR, B7-H4, HLA-G, or HLA-DR may be prepared using any technique which provides for the production of antibody molecules by continuous cell lines in culture. Such techniques include, but are not limited to, the hybridoma technique ⁇ see, e.g., Kohler & Milstein, Nature 256: 495-497 (1975)); the trioma technique; the human B-cell hybridoma technique ⁇ see, e.g., Kozbor, et al, Immunol.
  • Human monoclonal antibodies can be utilized in the practice of the present technology and can be produced by using human hybridomas ⁇ see, e.g., Cote, et al, Proc. Natl. Acad. Sci.
  • Amplified sequences can then be expressed and further selected or isolated based, e.g., on the affinity of the expressed antibody or fragment thereof for an antigen or epitope present on the LHR, B7-H4, HLA-G, or HLA-DR polypeptide.
  • hybridomas expressing anti- LHR, B7-H4, HLA-G, or HLA-DR monoclonal antibodies can be prepared by immunizing a subject, e.g., with an isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, the amino acid sequence of LHR, B7-H4, HLA-G, or HLA- DR or a fragment thereof, and then isolating hybridomas from the subject's spleen using routine methods. See, e.g., Milstein et al. , (Galfire and Milstein, Methods Enzymol 73 : 3-46 (1981)).
  • a selected monoclonal antibody with the desired properties can be (i) used as expressed by the hybridoma, (ii) bound to a molecule such as polyethylene glycol (PEG) to alter its properties, or (iii) a cDNA encoding the monoclonal antibody can be isolated, sequenced and manipulated in various ways.
  • PEG polyethylene glycol
  • the anti- LHR, B7-H4, HLA-G, or HLA-DR monoclonal antibody is produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
  • Hybridoma techniques include those known in the art and taught in Harlow et al, Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., 349 (1988); Hammerling et al, Monoclonal Antibodies And T- Cell Hybridomas, 563-681 (1981).
  • the antibodies of the present disclosure can be produced through the application of recombinant DNA and phage display technology.
  • anti-LHR, B7-H4, HLA-G, or HLA-DR antibodies can be prepared using various phage display methods known in the art.
  • phage display methods functional antibody domains are displayed on the surface of a phage particle which carries
  • Phage with a desired binding property is selected from a repertoire or combinatorial antibody library (e.g., human or murine) by selecting directly with an antigen, typically an antigen bound or captured to a solid surface or bead.
  • Phage used in these methods are typically filamentous phage including fd and Ml 3 with Fab, F v or disulfide stabilized F v antibody domains are recombinantly fused to either the phage gene III or gene VIII protein.
  • Fab expression libraries see, e.g., Huse, et al, Science 246: 1275-1281, 1989
  • methods can be adapted for the construction of Fab expression libraries (see, e.g., Huse, et al, Science 246: 1275-1281, 1989) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for a LUR, B7-H4, ULA-G, or ULA-DR polypeptide, e.g., a polypeptide or derivatives, fragments, analogs or homologs thereof.
  • Other examples of phage display methods that can be used to make the isolated antibodies of the present disclosure include those disclosed in Huston et al, Proc. Natl. Acad. Sci. U.S.A., 85: 5879-5883 (1988); Chaudhary et al, Proc. Natl.
  • Fab, Fab' and F(ab') 2 fragments can also be employed using methods known in the art such as those disclosed in WO 92/22324; Mullinax et al., BioTechniques 12: 864-869 (1992); Sawai et al, AJRI 34: 26-34 (1995); and Better et al, Science 240: 1041-1043 (1988).
  • hybrid antibodies or hybrid antibody fragments that are cloned into a display vector can be selected against the appropriate antigen in order to identify variants that maintained good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
  • a display vector can be selected against the appropriate antigen in order to identify variants that maintained good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
  • Other vector formats could be used for this process, such as cloning the antibody fragment library into a lytic phage vector (modified T7 or Lambda Zap systems) for selection and/or screening.
  • Antibodies may also be produced by inducing in vivo production in the lymphocyte population or by screening recombinant immunoglobulin libraries or panels of highly specific binding reagents (Orlandi et al, PNAS 86: 3833-3837 (1989); Winter, G. et al, Nature, 349: 293-299 (1991)).
  • Single chain antibodies comprise a heavy chain variable region and a light chain variable region connected with a linker peptide (typically around 5 to 25 amino acids in length).
  • linker peptide typically around 5 to 25 amino acids in length.
  • the variable regions of the heavy chain and the light chain may be derived from the same antibody or different antibodies.
  • scF v s may be synthesized using recombinant techniques, for example by expression of a vector encoding the scF v in a host organism such as E. coli.
  • DNA encoding scF v can be obtained by performing amplification using a partial DNA encoding the entire or a desired amino acid sequence of a DNA selected from a DNA encoding the heavy chain or the variable region of the heavy chain of the above- mentioned antibody and a DNA encoding the light chain or the variable region of the light chain thereof as a template, by PCR using a primer pair that defines both ends thereof, and further performing amplification combining a DNA encoding a polypeptide linker portion and a primer pair that defines both ends thereof, so as to ligate both ends of the linker to the heavy chain and the light chain, respectively.
  • An expression vector containing the DNA encoding scF v and a host transformed by the expression vector can be obtained according to conventional methods known in the art.
  • Antigen binding fragments may also be generated, for example the F(ab') 2 fragments which can be produced by pepsin digestion of the antibody molecule and the Fab fragments which can be generated by reducing the disulfide bridges of the F(ab') 2 fragments.
  • Fab expression libraries may be constructed to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity (Huse et al, Science, 256: 1275-1281 (1989)).
  • the antibodies of the present disclosure may be multimerized to increase the affinity for an antigen.
  • the antibody to be multimerized may be one type of antibody or a plurality of antibodies which recognize a plurality of epitopes of the same antigen.
  • binding of the IgG CH3 domain to two scFy molecules, binding to streptavidin, introduction of a helix-turn-helix motif and the like can be exemplified.
  • the antibody compositions disclosed herein may be in the form of a conjugate formed between any of these antibodies and another agent (immunoconjugate).
  • the antibodies disclosed herein are conjugated to radioactive material.
  • the antibodies disclosed herein can be bound to various types of molecules such as polyethylene glycol (PEG).
  • Antibody Screening Various immunoassays may be used for screening to identify antibodies having the desired specificity. Numerous protocols for competitive binding or immunoradiometric assays using either polyclonal or monoclonal antibodies with established specificities are well known in the art. Such immunoassays typically involve the
  • LHR, B7-H4, HLA-G, or HLA-DR any fragment or oligopeptide thereof and its specific antibody.
  • a two-site, monoclonal-based immunoassay utilizing monoclonal antibodies specific to two non-interfering LHR, B7-H4, HLA-G, or HLA-DR epitopes may be used, but a competitive binding assay may also be employed (Maddox et al., J. Exp. Med., 158: 1211-1216 (1983)).
  • IHC immunohistochemistry screening of potential anti-LHR, B7-H4, HLA-G, or HLA-DR antibodies
  • VMSI Ventana Medical Systems, Inc
  • Discovery XT formalin-fixed, paraffin-embedded human tissue on glass slides.
  • Tissue samples first undergo deparaffinization, antigen retrieval, followed by the addition of the potential anti-LHR, B7-H4, HLA-G, or HLA-DR antibody and a detection antibody.
  • the detection antibody is visualized using a chromogen detection reagent from VMSI. Stained slides are manually screened under a microscope. Samples having a correct primary antibody staining pattern are selected as potential anti-LHR, B7-H4, HLA-G, or HLA-DR candidates.
  • the separation and purification of the antibodies can be performed by employing conventional protein separation and purification methods.
  • the antibody can be separated and purified by appropriately selecting and combining use of chromatography columns, filters, ultrafiltration, salt precipitation, dialysis, preparative polyacrylamide gel electrophoresis, isoelectric focusing electrophoresis, and the like.
  • Strategies for Protein Purification and Characterization A Laboratory Course Manual, Daniel R. Marshak et al. eds., Cold Spring Harbor Laboratory Press (1996); Antibodies: A Laboratory Manual . Ed Harlow and David Lane, Cold Spring Harbor Laboratory (1988).
  • chromatography examples include affinity chromatography, ion exchange chromatography, hydrophobic chromatography, gel filtration chromatography, reverse phase chromatography, and adsorption chromatography.
  • chromatography can be performed by employing liquid chromatography such as HPLC or FPLC.
  • a Protein A column or a Protein G column may be used in affinity chromatography.
  • Other exemplary columns include a Protein A column, Hyper D, POROS, Sepharose F. F. (Pharmacia) and the like.
  • the antibodies disclosed herein are useful in methods known in the art relating to the localization and/or quantitation of a LHR, B7-H4, HLA-G, or HLA-DR polypeptide ⁇ e.g., for use in measuring levels of the LHR, B7-H4, HLA-G, or HLA-DR polypeptide within appropriate physiological samples, for use in diagnostic methods, for use in imaging the polypeptide, and the like).
  • the antibodies disclosed herein are useful in isolating a LHR, B7-H4, HLA-G, or HLA-DR polypeptide by standard techniques, such as affinity chromatography or immunoprecipitation.
  • a LHR, B7-H4, HLA-G, or HLA-DR antibody disclosed herein can facilitate the purification of natural LHR, B7-H4, HLA-G, or HLA-DR polypeptides from biological samples, e.g., mammalian sera or cells as well as recombinantly-produced LHR, B7-H4, HLA-G, or HLA-DR polypeptides expressed in a host system.
  • LHR, B7-H4, HLA-G, or HLA-DR antibody can be used to detect a LHR, B7-H4, HLA-G, or HLA-DR polypeptide (e.g., in plasma, a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the polypeptide.
  • the LHR, B7-H4, HLA-G, or HLA-DR antibodies disclosed herein can be used
  • LHR, B7-H4, HLA-G, or HLA-DR levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
  • the detection can be facilitated by coupling (i.e., physically linking) the LHR, B7-H4, HLA-G, or HLA-DR antibodies disclosed herein to a detectable substance.
  • compositions comprising an antibody or antigen binding fragment as disclosed herein bound to a peptide comprising, for example, a human LHR, B7-H4, HLA-G, or HLA-DR protein or a fragment thereof.
  • the peptide is associated with a cell.
  • the composition may comprise a disaggregated cell sample labeled with an antibody or antibody fragment as disclosed herein, which composition is useful in, for example, affinity chromatography methods for isolating cells or for flow cytometry-based cellular analysis or cell sorting.
  • the composition may comprise a fixed tissue sample or cell smear labeled with an antibody or antibody fragment as disclosed herein, which composition is useful in, for example, immunohistochemistry or cytology analysis.
  • the antibody or the antibody fragment is bound to a solid support, which is useful in, for example: ELISAs; affinity chromatography or immunoprecipitation methods for isolating LHR, B7-H4, HLA-G, or HLA-DR proteins or fragments thereof, LHR, B7-H4, HLA-G, or HLA-DR-positive cells, or complexes containing LHR, B7-H4, HLA-G, or HLA-DR and other cellular components.
  • the peptide is bound to a solid support.
  • the peptide may be bound to the solid support via a secondary antibody specific for the peptide, which is useful in, for example, sandwich ELISAs.
  • the peptide may be bound to a
  • the peptide is disposed in a solution, such as a lysis solution or a solution containing a sub-cellular fraction of a fractionated cell, which is useful in, for example, ELISAs and affinity chromatography or immunoprecipitation methods of isolating LHR, B7-H4, HLA-G, or HLA-DR proteins or fragments thereof or complexes containing LHR, B7-H4, HLA-G, or HLA-DR and other cellular components.
  • a solution such as a lysis solution or a solution containing a sub-cellular fraction of a fractionated cell, which is useful in, for example, ELISAs and affinity chromatography or immunoprecipitation methods of isolating LHR, B7-H4, HLA-G, or HLA-DR proteins or fragments thereof or complexes containing LHR, B7-H4, HLA-G, or HLA-DR and other cellular components.
  • the peptide is associated with a matrix, such as, for example, a gel electrophoresis gel or a matrix commonly used for western blotting (such as membranes made of nitrocellulose or polyvinylidene difluoride), which compositions are useful for electrophoretic and/or immunoblotting techniques, such as Western blotting.
  • a matrix such as, for example, a gel electrophoresis gel or a matrix commonly used for western blotting (such as membranes made of nitrocellulose or polyvinylidene difluoride), which compositions are useful for electrophoretic and/or immunoblotting techniques, such as Western blotting.
  • An exemplary method for detecting the level of LHR, B7-H4, HLA-G, or HLA-DR polypeptides in a biological sample involves obtaining a biological sample from a subject and contacting the biological sample with a LHR, B7-H4, HLA-G, or HLA-DR antibody disclosed herein which is capable of detecting the LHR, B7-H4, HLA-G, or HLA-DR polypeptides.
  • the disclosed antibodies e.g., 5F4-21, 4A7-4, 8B7-3, 138-2, B7-H4 5F6, B7-H4 #33-14, B7-H4 #36-1, HLA-G 4E3, 3H11, Lym-1, or Lym-2) or fragments thereof are detectably labeled.
  • the term "labeled", with regard to the antibody is intended to encompass direct labeling of the antibody by coupling ⁇ i.e., physically linking) a detectable substance to the antibody, as well as indirect labeling of the antibody by reactivity with another compound that is directly labeled.
  • Non-limiting examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently- labeled streptavidin.
  • the detection method of the present disclosure can be used to detect expression levels of LHR, B7-H4, HLA-G, or HLA-DR polypeptides in a biological sample in vitro as well as in vivo.
  • In vitro techniques for detection of LHR, B7-H4, HLA-G, or HLA-DR polypeptides include enzyme linked immunosorbent assays (ELISAs), Western blots, flow cytometry, immunoprecipitations, radioimmunoassay, and immunofluorescence ⁇ e.g., IHC).
  • in vivo techniques for detection of LHR, B7-H4, HLA-G, or HLA-DR polypeptides include introducing into a subject a labeled anti-LHR, B7-H4, HLA-G, or HLA- DR antibody.
  • the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
  • the biological sample contains polypeptide molecules from the test subject.
  • a LHR, B7-H4, HLA-G, or HLA-DR antibody disclosed herein can be used to assay LHR, B7-H4, HLA-G, or HLA-DR polypeptide levels in a biological sample ⁇ e.g. human plasma) using antibody-based techniques.
  • protein expression in tissues can be studied with classical immunohistochemical (IHC) staining methods. Jalkanen, M. et al., J. Cell. Biol. 101 : 976-985 (1985); Jalkanen, M. et al, J. Cell. Biol. 105: 3087-3096 (1987).
  • antibody-based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
  • ELISA enzyme linked immunosorbent assay
  • RIA radioimmunoassay
  • Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes or other
  • radioactive agents such as iodine ( I, I, I), carbon ( C), sulfur ( S), tritium ( H), indium ( 112 In), and technetium ( 99 mTc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
  • LHR, B7-H4, HLA-G, or HLA-DR polypeptide levels can also be detected in vivo by imaging.
  • Labels that can be incorporated with anti- LHR, B7-H4, HLA-G, or HLA-DR antibodies for in vivo imaging of LHR, B7-H4, HLA-G, or HLA-DR polypeptide levels include those detectable by X-radiography, MR or ESR.
  • suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject.
  • Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which can be incorporated into the LHR, B7-H4, HLA-G, or HLA-DR antibody by labeling of nutrients for the relevant scF v clone.
  • a LHR, B7-H4, HLA-G, or HLA-DR antibody which has been labeled with an appropriate detectable imaging moiety such as a radioisotope (e.g., 131 l, 112 In, 99 mTc), a radio- opaque substance, or a material detectable by nuclear magnetic resonance, is introduced (e.g., parenterally, subcutaneously, or intraperitoneally) into the subject.
  • a radioisotope e.g., 131 l, 112 In, 99 mTc
  • a radio- opaque substance e.g., a radio- opaque substance, or a material detectable by nuclear magnetic resonance
  • the quantity of imaging moiety needed to produce diagnostic images.
  • the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of "mTc.
  • the labeled LHR, B7-H4, HLA-G, or HLA-DR antibody will then preferentially accumulate at the location of cells which contain the specific target
  • LHR, B7-H4, HLA-G, or HLA-DR antibodies containing structural modifications that facilitate rapid binding and cell uptake and/or slow release are useful in in vivo imaging detection methods.
  • the LHR, B7-H4, HLA-G, or HLA-DR antibody contains a deletion in the CH2 constant heavy chain region of the antibody to facilitate rapid binding and cell uptake and/or slow release.
  • a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release.
  • a F(ab)'2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
  • LHR, B7-H4, HLA-G, or HLA-DR antibodies are useful in diagnostic and prognostic methods.
  • the present disclosure provides methods for using the antibodies disclosed herein in the diagnosis of LHR, B7-H4, HLA-G, or HLA-DR-related medical conditions in a subject.
  • Antibodies disclosed herein may be selected such that they have a high level of epitope binding specificity and high binding affinity to the LHR, B7-H4, HLA-G, or HLA-DR polypeptide.
  • LHR, B7-H4, HLA-G, or HLA-DR antibodies of the present technology useful in diagnostic assays usually have binding affinities of at least 10 "6 , 10 "7 , 10 "8 , 10 "9 , 10 "10 , 10 "11 , or 10 "12 M.
  • LHR, B7-H4, HLA-G, or HLA-DR antibodies used as diagnostic reagents have a sufficient kinetic on -rate to reach equilibrium under standard conditions in at least 12 hours, at least 5 hours, at least 1 hour, or at least 30 minutes.
  • Some methods of the present technology employ polyclonal preparations of anti- LHR, B7-H4, HLA-G, or HLA-DR antibodies and polyclonal anti-LHR, B7-H4, HLA-G, or HLA-DR antibody compositions as diagnostic reagents, and other methods employ monoclonal isolates.
  • the preparation typically contains an assortment of LHR, B7-H4, HLA-G, or HLA-DR
  • antibodies e.g., antibodies, with different epitope specificities to the target polypeptide.
  • the monoclonal anti-LHR, B7-H4, HLA-G, or HLA-DR antibodies of the present disclosure are useful for detecting a single antigen in the presence or potential presence of closely related antigens.
  • the LHR, B7-H4, HLA-G, or HLA-DR antibodies of the present disclosure can be used as diagnostic reagents for any kind of biological sample.
  • the LHR, B7- H4, HLA-G, or HLA-DR antibodies disclosed herein are useful as diagnostic reagents for human biological samples.
  • LHR, B7-H4, HLA-G, or HLA-DR antibodies can be used to detect LHR, B7-H4, HLA-G, or HLA-DR polypeptides in a variety of standard assay formats. Such formats include immunoprecipitation, Western blotting, ELISA,
  • Bio samples can be obtained from any tissue (including biopsies), cell or body fluid of a subject.
  • Prognostic Uses of LHR, B7-H4, HLA-G, or HLA-DR antibodies The present disclosure also provides for prognostic (or predictive) assays for determining whether a subject is at risk of developing a medical disease or condition associated with increased LHR, B7-H4, HLA-G, or HLA-DR polypeptide expression or activity ⁇ e.g., detection of a precancerous cell). Such assays can be used for prognostic or predictive purpose to thereby prophylactically treat an individual prior to the onset of a medical disease or condition characterized by or associated with LHR, B7-H4, HLA-G, or HLA-DR polypeptide expression.
  • Another aspect of the present disclosure provides methods for determining LHR, B7- H4, HLA-G, or HLA-DR expression in a subject to thereby select appropriate therapeutic or prophylactic compounds for that subject.
  • the prognostic assays can be utilized to identify a subject having or at risk for developing cancer and/or solid tumors.
  • the cancer and/or tumor is of the thyroid, breast, colon, prostate, ovary or more specifically a chrio-carcinoma or the caner and/or tumor is a B-cell lymphoma or leukemia.
  • the present disclosure provides a method for identifying a disease or condition associated with increased LHR, B7- H4, HLA-G, or HLA-DR polypeptide expression levels in which a test sample is obtained from a subject and the LHR, B7-H4, HLA-G, or HLA-DR polypeptide detected, wherein the presence of increased levels of LHR, B7-H4, HLA-G, or HLA-DR polypeptides compared to a control sample is predictive for a subject having or at risk of developing a disease or condition associated with increased LHR, B7-H4, HLA-G, or HLA-DR polypeptide expression levels.
  • the disease or condition associated with increased LHR, B7-H4, HLA-G, or HLA-DR polypeptide expression levels is selected from the group consisting of cancer and/or solid tumors.
  • the cancer and/or tumor is of the thyroid, breast, colon, prostate, ovary, or a chrio-carcinoma or a B-cell lymphoma or leukemia.
  • the present disclosure provides methods for determining whether a subject can be effectively treated with a compound for a disorder or condition associated with increased LHR, B7-H4, HLA-G, or HLA-DR polypeptide expression wherein a biological sample is obtained from the subject and the LHR, B7-H4, HLA-G, or HLA-DR polypeptide is detected using the LHR, B7-H4, HLA-G, or HLA-DR antibody.
  • the expression level of the LHR, B7-H4, HLA-G, or HLA-DR polypeptide in the biological sample obtained from the subject is determined and compared with the LHR, B7-H4, HLA-G, or HLA-DR expression levels found in a biological sample obtained from a subject or Isolated from a patient population who is free of the disease. Elevated levels of the LHR, B7-H4, HLA-G, or HLA-DR polypeptide in the sample obtained from the subject suspected of having the disease or condition compared with the sample obtained from the healthy subject is indicative of the LHR, B7-H4, HLA-G, or HLA-DR-associated disease or condition in the subject being tested.
  • samples include, e.g., any body fluid including, but not limited to, e.g., sputum, serum, plasma, lymph, cystic fluid, urine, stool, cerebrospinal fluid, ascite fluid or blood and including biopsy samples of body tissue.
  • the samples are also a tumor cell.
  • the test sample used in the above-described method will vary based on the assay format, nature of the detection method and the tissues, cells or extracts used as the sample to be assayed.
  • the present disclosure relates to methods for determining if a patient is likely to respond or is not likely to LHR, B7-H4, HLA-G, or HLA-DR CAR therapy.
  • this method comprises contacting a tumor sample isolated from the patient with an effective amount of an LHR, B7-H4, HLA-G, or HLA-DR binding agent, e.g., an LHR, B7-H4, HLA-G, or HLA-DR antibody and detecting the presence of any agent or antibody bound to the tumor sample.
  • an LHR, B7-H4, HLA-G, or HLA-DR binding agent e.g., an LHR, B7-H4, HLA-G, or HLA-DR antibody
  • the presence of agent or antibody bound to the tumor sample indicates that the patient is likely to respond to the LHR, B7-H4, HLA-G, or HLA-DR CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the LHR, B7-H4, HLA-G, or HLA-DR therapy.
  • samples include, e.g., any body fluid including, but not limited to, e.g., sputum, serum, plasma, lymph, cystic fluid, urine, stool, cerebrospinal fluid, ascite fluid or blood and including biopsy samples of body tissue.
  • the samples are also a tumor cell.
  • the method comprises the additional step of administering an effective amount of the LHR, B7-H4, HLA-G, or HLA- DR CAR therapy to a patient that is determined likely to respond to the LHR, B7-H4, HLA- G, or HLA-DR CAR therapy.
  • the patient a LHR, B7-H4, HLA-G, or HLA-DR expressing tumor and/or cancer.
  • B7-H4, HLA-G, or HLA-DR polypeptides is known to be indicative of whether a subject with the disease is likely to respond to a particular type of therapy or treatment.
  • Non-limiting examples of such disease states include cancer, e.g., a carcinoma, a sarcoma or a leukemia.
  • the method of detecting a LHR, B7-H4, HLA-G, or HLA-DR polypeptide in a biological sample can be used as a method of prognosis, e.g., to evaluate the likelihood that the subject will respond to the therapy or treatment.
  • the level of the LHR, B7-H4, HLA-G, or HLA-DR polypeptide in a suitable tissue or body fluid sample from the subject is determined and compared with a suitable control, e.g., the level in subjects with the same disease but who have responded favorably to the treatment.
  • samples include, e.g., any body fluid including, but not limited to, e.g., sputum, serum, plasma, lymph, cystic fluid, urine, stool, cerebrospinal fluid, ascite fluid or blood and including biopsy samples of body tissue.
  • the samples are also a tumor cell.
  • the test sample used in the above-described method will vary based on the assay format, nature of the detection method and the tissues, cells or extracts used as the sample to be assayed. Methods for preparing protein extracts or membrane extracts of cells are known in the art and can be readily adapted in order to obtain a sample which is compatible with the system utilized.
  • the present disclosure provides for methods of monitoring the influence of agents (e.g., drugs, compounds, or small molecules) on the expression of LHR, B7-H4, HLA-G, or HLA-DR polypeptides.
  • agents e.g., drugs, compounds, or small molecules
  • Such assays can be applied in basic drug screening and in clinical trials.
  • the effectiveness of an agent to decrease LHR, B7-H4, HLA- G, or HLA-DR polypeptide levels can be monitored in clinical trials of subjects exhibiting elevated expression of LHR, B7-H4, HLA-G, or HLA-DR, e.g., patients diagnosed with cancer.
  • polypeptides can be identified by administering the agent and observing a response.
  • the expression pattern of the LHR, B7-H4, HLA-G, or HLA-DR polypeptide can serve as a marker, indicative of the physiological response of the subject to the agent. Accordingly, this response state may be determined before, and at various points during, treatment of the subject with the agent.
  • the method further comprises the additional step of administering an effective amount of the LHR, B7-H4, HLA-G, or HLA-DR CAR therapy to a patient that is determined to require additional therapy.
  • this method comprises contacting a tumor sample isolated from the patient with an effective amount of an LHR, B7-H4, HLA-G, or HLA-DR antibody and detecting the presence of any antibody bound to the tumor sample.
  • the presence of antibody bound to the tumor sample indicates that the patient is likely to respond to the LHR, B7-H4, HLA-G, or HLA-DR CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the LHR, B7- H4, HLA-G, or HLA-DR therapy.
  • the method comprises the additional step of administering an effective amount of the LHR, B7-H4, HLA-G, or HLA- DR CAR therapy to a patient that is determined likely to respond to the LHR, B7-H4, HLA- G, or HLA-DR CAR therapy.
  • the patient a B7-H4 expressing tumor and/or cancer.
  • the tumor and/or cancer is a solid tumor, e.g., breast, colon, prostate, thyroid, or chorio-carcinoma.
  • the cancer/tumor is a B- cell lymphoma or leukemia.
  • the present disclosure provides diagnostic methods for
  • kits for performing these methods as well as instructions for carrying out the methods of the present disclosure such as collecting tissue and/or performing the screen, and/or analyzing the results.
  • the kit comprises, or alternatively consists essentially of, or yet further consists of, a LHR, B7-H4, HLA-G, or HLA-DR antibody composition ⁇ e.g., monoclonal antibodies) disclosed herein, and instructions for use.
  • the kits are useful for detecting the presence of LHR, B7-H4, HLA-G, or HLA-DR polypeptides in a biological sample e.g., any bodily fluid including, but not limited to, e.g., sputum, serum, plasma, lymph, cystic fluid, urine, stool, cerebrospinal fluid, acitic fluid or blood and including biopsy samples of body tissue.
  • test samples may also be a tumor cell, a normal cell adjacent to a tumor, a normal cell corresponding to the tumor tissue type, a blood cell, a peripheral blood lymphocyte, or combinations thereof.
  • the test sample used in the above-described method will vary based on the assay format, nature of the detection method and the tissues, cells or extracts used as the sample to be assayed. Methods for preparing protein extracts or membrane extracts of cells are known in the art and can be readily adapted in order to obtain a sample which is compatible with the system utilized.
  • the kit can comprise: one or more LHR, B7-H4, HLA-G, or HLA- DR antibodies capable of binding a LHR, B7-H4, HLA-G, or HLA-DR polypeptide in a biological sample (e.g., an antibody or antigen-binding fragment thereof having the same antigen-binding specificity of LHR, B7-H4, HLA-G, or HLA-DR antibody B7H4 5F6, B7H4 # 33-14, or B7H4 #36-1); means for determining the amount of the LHR, B7-H4, HLA-G, or HLA-DR polypeptide in the sample; and means for comparing the amount of the LHR, B7- H4, HLA-G, or HLA-DR polypeptide in the sample with a standard.
  • a biological sample e.g., an antibody or antigen-binding fragment thereof having the same antigen-binding specificity of LHR, B7-H4, HLA-G, or HLA-DR antibody B7
  • kits can be packaged in a suitable container.
  • the kit can further comprise instructions for using the kit to detect the LHR, B7-H4, HLA-G, or HLA-DR polypeptides.
  • the kit comprises a first antibody, e.g., attached to a solid support, which binds to a LHR, B7-H4, HLA-G, or HLA-DR polypeptide; and, optionally; 2) a second, different antibody which binds to either the LHR, B7-H4, HLA-G, or HLA-DR polypeptide or the first antibody and is conjugated to a detectable label.
  • a first antibody e.g., attached to a solid support, which binds to a LHR, B7-H4, HLA-G, or HLA-DR polypeptide
  • a second, different antibody which binds to either the LHR, B7-H4, HLA-G, or HLA-DR polypeptide or the first antibody and is conjugated to a detectable label.
  • the kit can also comprise, e.g., a buffering agent, a preservative or a protein- stabilizing agent.
  • the kit can further comprise components necessary for detecting the detectable-label, e.g., an enzyme or a substrate.
  • the kit can also contain a control sample or a series of control samples, which can be assayed and compared to the test sample.
  • Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package, along with instructions for interpreting the results of the assays performed using the kit.
  • the kits of the present disclosure may contain a written product on or in the kit container. The written product describes how to use the reagents contained in the kit.
  • these suggested kit components may be packaged in a manner customary for use by those of skill in the art.
  • these suggested kit components may be provided in solution or as a liquid dispersion or the like.
  • the antibodies of the present disclosure also can be bound to many different carriers.
  • this disclosure also provides compositions containing the antibodies and another substance, active or inert.
  • examples of well-known carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses and magnetite.
  • the nature of the carrier can be either soluble or insoluble for purposes of the disclosure. Those skilled in the art will know of other suitable carriers for binding antibodies, or will be able to ascertain such, using routine
  • the present disclosure provides chimeric antigen receptors (CAR) that bind to LHR, B7-H4, HLA-G, or HLA-DR comprising, consisting, or consisting essentially of, a cell activation moiety comprising an extracellular, transmembrane, and intracellular domain.
  • the extracellular domain comprises a target-specific binding element otherwise referred to as the antigen binding domain.
  • the intracellular domain or cytoplasmic domain comprises, at least one costimulatory signaling region and a zeta chain portion.
  • the CAR may optionally further comprise a spacer domain of up to 300 amino acids, preferably 10 to 100 amino acids, more preferably 25 to 50 amino acids.
  • the spacer may be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids.
  • a spacer domain may comprises, for example, a portion of a human Fc domain, a CH3 domain, or the hinge region of any immunoglobulin, such as IgA, IgD, IgE, IgG, or IgM, or variants thereof.
  • some embodiments may comprise an IgG4 hinge with or without a S228P, L235E, and/or N297Q mutation (according to Kabat numbering).
  • Additional spacers include, but are not limited to, CD4, CD8, and CD28 hinge regions.
  • the present disclosure provides a CAR that comprises, consists, or alternatively consists essentially thereof of an antigen binding domain specific to LFIR, B7-H4, HLA-G, or HLA-DR.
  • the antigen binding domain comprises, or alternatively consists essentially thereof, or yet consists of the antigen binding domain of an anti-LHR, B7-H4, HLA-G, or HLA-DR antibody.
  • the heavy chain variable region and light chain variable region of an anti-LHR, B7-H4, HLA-G, or HLA-DR antibody comprises, or alternatively consists essentially thereof, or yet consists of the antigen binding domain the anti-LHR, B7-H4, HLA-G, or HLA-DR antibody.
  • the antigen binding domain comprises, consists, or consists essentially of a fragment of the target-specific antibody (i.e. an anti-LHR, B7-H4, HLA-G, or HLA-DR antibody), for example, an scFv.
  • An scFv region can comprise the variable regions of the heavy (V H ) and light chains (V L ) of immunoglobulins, connected with a short linker peptide.
  • the linker peptide may be from 1 to 50 amino acids, for instance, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids.
  • the linker is glycine rich, although it may also contain serine or threonine.
  • the heavy chain variable region of the antibody comprises, or consists essentially thereof, or consists of those disclosed herein or an equivalent of each thereof and/or comprises one or more CDR regions comprising those disclosed herein or an equivalent of each thereof.
  • the light chain variable region of the antibody comprises, or consists essentially thereof, or consists of those disclosed herein or an equivalent of each thereof and/or comprises one or more CDR regions comprising those disclosed herein or an equivalent of each thereof.
  • the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions of particular use in this disclosure may be derived from CD8, CD28, CD3, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154, TCR.
  • the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
  • a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
  • a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
  • a glycine-serine doublet provides a particularly suitable linker.
  • Cytoplasmic Domain The cytoplasmic domain or intracellular signaling domain of the CAR is responsible for activation of at least one of the traditional effector functions of an immune cell in which a CAR has been placed.
  • the intracellular signaling domain refers to a portion of a protein which transduces the effector function signal and directs the immune cell to perform its specific function. An entire signaling domain or a truncated portion thereof may be used so long as the truncated portion is sufficient to transduce the effector function signal.
  • Cytoplasmic sequences of the T-cell receptor (TCR) and co-receptors, as well as derivatives or variants thereof, can function as intracellular signaling domains for use in a CAR.
  • Intracellular signaling domains of particular use in this disclosure may be derived from FcR, TCR, CD3, CDS, CD22, CD79a, CD79b, CD66d.
  • the signaling domain of the CAR can comprise a CD3 ⁇ signaling domain.
  • the intracellular region of at least one co-stimulatory signaling molecule including but not limited to CD27, CD28, 4- IBB (CD 137), OX40, CD30, CD40, PD- 1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, LIGHT, KG2C, B7-H3, or a ligand that specifically binds with CD83, may also be included in the cytoplasmic domain of the CAR.
  • CARs of the present disclosure can comprise one or more co-stimulatory domain.
  • a CAR may comprise one, two, or more co-stimulatory domains, in addition to a signaling domain (e.g., a CD3 ⁇ signaling domain).
  • the cell activation moiety of the chimeric antigen receptor is a T-cell signaling domain comprising, or alternatively consisting essentially of, or yet further consisting of, one or more proteins or fragments thereof selected from the group consisting of CD 8 protein, CD28 protein, 4-1BB protein, OX40, CD30, CD40, PD-1, ICOS, LFA-1, CD2, CD7, CD27, LIGHT, KG2C, B7-H3 and CD3-zeta protein.
  • the CAR comprises, or alternatively consists essentially thereof, or yet consists of an antigen binding domain of an anti-LHR, B7-H4, HLA-G, or HLA-DR antibody or fragment (e.g., scFv) thereof, a CD8 a hinge domain, a CD8 a transmembrane domain, at least one costimulatory signaling region, and a CD3 zeta signaling domain.
  • the costimulatory signaling region comprises either or both a CD28 costimulatory signaling region and a 4- IBB costimulatory signaling region.
  • the CAR can further comprise a detectable marker or purification marker.
  • the CAR may also comprise a switch mechanism for controlling expression and/or activation of the CAR.
  • a CAR may comprise, consist, or consist essentially of an extracellular, transmembrane, and intracellular domain, in which the extracellular domain comprises a target-specific binding element that comprises a label, binding domain, or tag that is specific for a molecule other than the target antigen that is expressed on or by a target cell.
  • the specificity of the CAR is provided by a second construct that comprises, consists, or consists essentially of a target antigen binding domain (e.g., an anti-LUR, B7-H4, ULA-G, or HLA- DR antibody or fragment thereof or a bispecific antibody that binds LHR, B7-H4, HLA-G, or HLA-DR and the label or tag on the CAR) and a domain that is recognized by or binds to the label, binding domain, or tag on the CAR.
  • a target antigen binding domain e.g., an anti-LUR, B7-H4, ULA-G, or HLA- DR antibody or fragment thereof or a bispecific antibody that binds LHR, B7-H4, HLA-G, or HLA-DR and the label or tag on the CAR.
  • a T-cell that expresses the CAR can be administered to a subject, but it cannot bind its target antigen (i.e., LHR, B7-H4, HLA-G, or HLA-DR) until the second composition comprising an LHR, B7-H4, HLA-G, or HLA-DR-specific binding domain is administered.
  • its target antigen i.e., LHR, B7-H4, HLA-G, or HLA-DR
  • CARs of the present disclosure may likewise require multimerization in order to activate their signaling function (see, e.g., US 2015/0368342, US 2016/0175359, US
  • the disclosed CARs can comprise a "suicide switch” or “safety switch” to induce cell death of the CAR T-cells following treatment (Buddee et al., PLoS One, 2013) or to downregulate expression of the CAR following binding to the target antigen (WO 2016/011210).
  • CARs can be modified with a suicide gene that confers sensitivity to an antibody or prodrug that can be administered to cease CAR activity.
  • the antibody or prodrug is administered to a subject that has received CAR therapy upon the occurrence of an adverse event.
  • Exemplary suicide genes include but are not limited to herpes simplex virus-thymidine kinase (HSV-TK) which renders cells susceptible to ganciclovir (Bonini et al. Science 276: 1719-1724 (1997)), inducible Caspase 9 which allows for dimerization and activation of apoptosis when activated by a dimerizer drug (Gargett et al., Front Pharmacol, 2014 5 :235), and truncated EGFR which renders cells susceptible to cetuximab (Wang et al. Blood 1 18: 1255-63 (201 1)).
  • HSV-TK herpes simplex virus-thymidine kinase
  • this disclosure provides complex comprising an HLA-DR CAR cell bound to its target cell.
  • the complex is detectably labeled. Detectable labels are known in the art and briefly described herein.
  • the isolated cells are selected from a group consisting of T-cells and K-cells.
  • aspects of the present disclosure relate to an isolated cell comprising a LHR, B7-H4, HLA-G, or HLA-DR-specific CAR and methods of producing such cells.
  • the cell is a prokaryotic or a eukaryotic cell.
  • the cell is a T cell or an NK cell.
  • the eukaryotic cell can be from any preferred species, e.g., an animal cell, a mammalian cell such as a human, a feline or a canine cell.
  • the population of isolated cells transduced with the nucleic acid sequence encoding the CAR as described herein is a population of NK precursor cells and/or T-cell precursor cells. Transduction of precursor cells results in a long- lived population of cells capable of differentiating into CAR T-cells and/or CAR NK cells.
  • T-cell precursors include but are not limited to HSCs; long term HSCs; MPPs; CLPs;
  • NK precursors include but are not limited to HSCs, long term HSCs, MPPs, CMPs, GMPs, pro- K, pre- K, and i K cells.
  • the population of isolated cells includes both mature T-cells and T-cell precursors to provide both short lived effector CAR T-cells and long lived CAR T-cell precursors for transplant into the subject.
  • the population of isolated cells includes both mature NK cells and NK precursors to provide both short lived effector CAR NK cells and long lived CAR NK precursors for transplant into the subject.
  • the isolated cell comprises, or alternatively consists essentially of, or yet further consists of an exogenous CAR comprising, or alternatively consisting essentially of, or yet further consisting of, an antigen binding domain of an anti- LHR, B7-H4, HLA-G, or HLA-DR antibody, a CD 8 a hinge domain, a CD 8 a
  • transmembrane domain a CD28 costimulatory signaling region and/or a 4- IBB
  • the isolated cell is a T-cell, e.g., an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell.
  • the isolated cell is an NK-cell, e.g., an animal NK-cell, a mammalian NK-cell, a feline NK-cell, a canine NK-cell or a human NK-cell.
  • methods of producing LHR, B7-H4, HLA-G, or HLA-DR CAR expressing cells comprising, or alternatively consisting essentially of: (i) transducing a population of isolated cells with a nucleic acid sequence encoding a LHR, B7- H4, HLA-G, or HLA-DR CAR and (ii) selecting a subpopulation of cells that have been successfully transduced with said nucleic acid sequence of step (i).
  • the isolated cells are T-cells, an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T- cell or a human T-cell, thereby producing LHR, B7-H4, HLA-G, or HLA-DR CAR T-cells.
  • the isolated cell is an NK-cell, e.g., an animal NK-cell, a mammalian NK-cell, a feline NK-cell, a canine NK-cell or a human NK-cell, thereby producing LHR, B7-H4, HLA-G, or HLA-DR CAR NK-cells.
  • T-cells expressing the disclosed CARs may be further modified to reduce or eliminate expression of endogenous TCRs. Reduction or elimination of endogenous TCRs can reduce off-target effects and increase the effectiveness of the T cells.
  • T cells stably lacking expression of a functional TCR may be produced using a variety of approaches. T cells internalize, sort, and degrade the entire T cell receptor as a complex, with a half-life of about 10 hours in resting T cells and 3 hours in stimulated T cells (von Essen, M. et al. 2004. J. Immunol. 173 :384-393). Proper functioning of the TCR complex requires the proper stoichiometric ratio of the proteins that compose the TCR complex.
  • TCR function also requires two functioning TCR zeta proteins with ITAM motifs.
  • the activation of the TCR upon engagement of its MHC -peptide ligand requires the engagement of several TCRs on the same T cell, which all must signal properly.
  • the T cell will not become activated sufficiently to begin a cellular response.
  • TCR expression may eliminated using RNA interference (e.g., shRNA, siRNA, miRNA, etc.), CRISPR, or other methods that target the nucleic acids encoding specific TCRs (e.g., TCR-a and TCR- ⁇ ) and/or CD3 chains in primary T cells.
  • RNA interference e.g., shRNA, siRNA, miRNA, etc.
  • CRISPR CRISPR
  • TCR-a and TCR- ⁇ CD3 chains in primary T cells.
  • the RNA e.g., shRNA, siRNA, miRNA, etc.
  • shRNA siRNA
  • miRNA miRNA
  • RNAs e.g., shRNA, siRNA, miRNA, etc.
  • expression of inhibitory RNAs in primary T cells can be achieved using any conventional expression system, e.g., a lentiviral expression system.
  • lentiviruses are useful for targeting resting primary T cells, not all T cells will express the shRNAs. Some of these T cells may not express sufficient amounts of the RNAs to allow enough inhibition of TCR expression to alter the functional activity of the T cell.
  • T cells that retain moderate to high TCR expression after viral transduction can be removed, e.g., by cell sorting or separation techniques, so that the remaining T cells are deficient in cell surface TCR or CD3, enabling the expansion of an isolated population of T cells deficient in expression of functional TCR or CD3.
  • CRISPR in primary T cells can be achieved using conventional CRISPR/Cas sytems and guide RNAs specific to the target TCRs. Suitable expression systems, e.g. lentiviral or adenoviral expression systems are known in the art. Similar to the delivery of inhibitor RNAs, the CRISPR system can be use to specifically target resting primary T cells or other suitable immune cells for CAR cell therapy. Further, to the extent that CRISPR editing is unsuccessful, cells can be selected for success according to the methods disclosed above.
  • T cells that retain moderate to high TCR expression after viral transduction can be removed, e.g., by cell sorting or separation techniques, so that the remaining T cells are deficient in cell surface TCR or CD3, enabling the expansion of an isolated population of T cells deficient in expression of functional TCR or CD3.
  • a CRISPR editing construct may be useful in both knocking out the endogenous TCR and knocking in the CAR constructs disclosed herein. Accordingly, it is appreciated that a CRISPR system can be designed for to accomplish one or both of these purposes.
  • cells Prior to expansion and genetic modification of the cells disclosed herein, cells may be obtained from a subject - for instance, in embodiments involving autologous therapy - or a commercially available culture, that are available from the American Type Culture Collection (ATCC), for example.
  • ATCC American Type Culture Collection
  • Cells can be obtained from a number of sources in a subject, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • Isolation methods for use in relation to this disclosure include, but are not limited to Life Technologies Dynabeads® system; STEMcell Technologies EasySepTM, RoboSepTM, RosetteSepTM, SepMateTM; Miltenyi Biotec MACSTM cell separation kits, and other commercially available cell separation and isolation kits.
  • Particular subpopulations of immune cells and precursors may be isolated through the use of fluorescence-activated cell sorting (FACS), beads, or other binding agents available in such kits specific to unique cell surface markers.
  • FACS fluorescence-activated cell sorting
  • MACSTM CD4+ and CD8+ MicroBeads may be used to isolate CD4+ and CD8+ T-cells.
  • cells may be obtained through commercially available cell cultures, including but not limited to, for T-cells, lines BCL2 (AAA) Jurkat (ATCC® CRL-2902TM), BCL2 (S70A) Jurkat (ATCC® CRL-2900TM), BCL2 (S87A) Jurkat (ATCC® CRL-2901TM), BCL2 Jurkat (ATCC® CRL-2899TM), Neo Jurkat (ATCC® CRL-2898TM); and, for NK cells, lines NK-92 (ATCC® CRL-2407TM), NK-92MI (ATCC® CRL-2408TM).
  • the subject may be administered a conditioning regimen to induce precursor cell mobilization into the peripheral blood prior to obtaining the cells from the subject.
  • a subject may be administered an effective amount of at least one of granulocyte colony-stimulating factor (G-CSF), filgrastim (Neupogen), sargramostim (Leukine), pegfilgrastim (Neulasta), and mozobil (Plerixafor) up to two weeks prior to or concurrently with isolation of cells from the subject.
  • G-CSF granulocyte colony-stimulating factor
  • Nepogen filgrastim
  • Leukine sargramostim
  • Nelasta pegfilgrastim
  • mozobil mozobilized precursor cells
  • Mobilized precursor cells can be obtained from the subject by any method known in the art, including, for example, leukapheresis 1-14 days following administration of the conditioning regimen.
  • specific precursor cell populations are further isolated by
  • CARs may be prepared using vectors. Aspects of the present disclosure relate to an isolated nucleic acid sequence encoding a LUR, B7-H4, ULA-G, or ULA-DR CAR and vectors comprising, or alternatively consisting essentially of, or yet further consisting of, an isolated nucleic acid sequence encoding the CAR and its complement and equivalents of each thereof.
  • exemplary vectors The preparation of exemplary vectors and the generation of CAR expressing cells using said vectors is discussed in detail in the examples below.
  • expression of natural or synthetic nucleic acids encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector.
  • the vectors can be suitable for replication and integration eukaryotes.
  • the isolated nucleic acid sequence encodes for a CAR comprising, or alternatively consisting essentially of, or yet further consisting of an antigen binding domain of an anti-LUR, B7-H4, ULA-G, or ULA-DR antibody, a CD8 a hinge domain, a CD8 a transmembrane domain, a CD28 costimulatory signaling region and/or a 4- 1BB costimulatory signaling region, and a CD3 zeta signaling domain.
  • the isolated nucleic acid sequence comprises, or alternatively consisting essentially thereof, or yet further consisting of, sequences encoding (a) an antigen binding domain of an anti-LHR, B7-H4, HLA-G, or HLA-DR antibody followed by (b) a CD 8 a hinge domain, (c) a CD8 a transmembrane domain followed by (d) a CD28 costimulatory signaling region and/or a 4- IBB costimulatory signaling region followed by (e) a CD3 zeta signaling domain.
  • the isolated nucleic acid sequence comprises, or alternatively consists essentially thereof, or yet further consists of, a Kozak consensus sequence upstream of the sequence encoding the antigen binding domain of the anti-LHR, B7-H4, HLA-G, or HLA-DR antibody.
  • the isolated nucleic acid comprises a
  • the isolated nucleic acid sequence is comprised in a vector.
  • the vector is a plasmid.
  • the vector is a viral vector.
  • the vector is a lentiviral vector.
  • nucleic acid encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector.
  • the vectors can be suitable for replication and integration eukaryotes. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York).
  • the term "vector” intends a recombinant vector that retains the ability to infect and transduce non-dividing and/or slowly-dividing cells and integrate into the target cell's genome.
  • the vector is derived from or based on a wild-type virus.
  • the vector is derived from or based on a wild-type lentivirus. Examples of such, include without limitation, human immunodeficiency virus (HIV), equine infectious anemia vims (EIAV), simian immunodeficiency virus (SIV) and feline immunodeficiency virus (FIV).
  • retrovirus can be used as a basis for a vector backbone such murine leukemia virus (MLV).
  • MLV murine leukemia virus
  • a viral vector according to the disclosure need not be confined to the components of a particular virus.
  • the viral vector may comprise components derived from two or more different viruses, and may also comprise synthetic components. Vector components can be manipulated to obtain desired characteristics, such as target cell specificity.
  • the recombinant vectors of this disclosure may be derived from primates and non- primates.
  • primate lentiviruses include the human immunodeficiency virus (HIV), the causative agent of human acquired immunodeficiency syndrome (AIDS), and the simian immunodeficiency virus (SIV).
  • the non-primate lentiviral group includes the prototype "slow virus” visna/maedi virus (VMV), as well as the related caprine arthritis- encephalitis virus (CAEV), equine infectious anemia virus (EIAV) and the more recently described feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV).
  • VMV visna/maedi virus
  • CAEV caprine arthritis- encephalitis virus
  • EIAV equine infectious anemia virus
  • FV feline immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • U.S. Patent No. 6,924, 123 discloses that certain retroviral sequence facilitate integration into the target cell genome.
  • each retroviral genome comprises genes called gag, pol and env which code for virion proteins and enzymes. These genes are flanked at both ends by regions called long terminal repeats (LTRs).
  • LTRs are responsible for proviral integration, and transcription. They also serve as enhancer-promoter sequences. In other words, the LTRs can control the expression of the viral genes.
  • Encapsidation of the retroviral RNAs occurs by virtue of a psi sequence located at the 5' end of the viral genome.
  • the LTRs themselves are identical sequences that can be divided into three elements, which are called U3, R and U5.
  • U3 is derived from the sequence unique to the 3' end of the RNA.
  • R is derived from a sequence repeated at both ends of the RNA
  • U5 is derived from the sequence unique to the 5'end of the RNA.
  • the sizes of the three elements can vary considerably among different retroviruses.
  • the site of poly (A) addition (termination) is at the boundary between R and U5 in the right hand side LTR.
  • U3 contains most of the transcriptional control elements of the provirus, which include the promoter and multiple enhancer sequences responsive to cellular and in some cases, viral transcriptional activator proteins.
  • gag encodes the internal structural protein of the virus.
  • Gag protein is proteolytically processed into the mature proteins MA (matrix), CA (capsid) and NC (nucleocapsid).
  • the pol gene encodes the reverse transcriptase (RT), which contains DNA polymerase, associated RNase H and integrase (IN), which mediate replication of the genome.
  • RT reverse transcriptase
  • I integrase
  • the vector RNA genome is expressed from a DNA construct encoding it, in a host cell.
  • the components of the particles not encoded by the vector genome are provided in trans by additional nucleic acid sequences (the "packaging system", which usually includes either or both of the gag/pol and env genes) expressed in the host cell.
  • the set of sequences required for the production of the viral vector particles may be introduced into the host cell by transient transfection, or they may be integrated into the host cell genome, or they may be provided in a mixture of ways. The techniques involved are known to those skilled in the art.
  • Retroviral vectors for use in this disclosure include, but are not limited to Invitrogen's pLenti series versions 4, 6, and 6.2 "ViraPower" system. Manufactured by Lentigen Corp.; pHIV-7-GFP, lab generated and used by the City of Hope Research Institute; "Lenti-X” lentiviral vector, pLVX, manufactured by Clontech; pLKO. l-puro, manufactured by Sigma- Aldrich; pLemiR, manufactured by Open Biosystems; and pLV, lab generated and used by Charite Medical School, Institute of Virology (CBF), Berlin, Germany.
  • assays include, for example, "molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR;
  • CARs can be packaged into a lentiviral or retroviral packaging system by using a packaging vector and cell lines.
  • the packaging plasmid includes, but is not limited to retroviral vector, lentiviral vector, adenoviral vector, and adeno-associated viral vector.
  • the packaging vector contains elements and sequences that facilitate the delivery of genetic materials into cells.
  • the retroviral constructs are packaging plasmids comprising at least one retroviral helper DNA sequence derived from a replication-incompetent retroviral genome encoding in trans all virion proteins required to package a replication incompetent retroviral vector, and for producing virion proteins capable of packaging the replication-incompetent retroviral vector at high titer, without the production of replication-competent helper virus.
  • the retroviral DNA sequence lacks the region encoding the native enhancer and/or promoter of the viral 5' LTR of the virus, and lacks both the psi function sequence responsible for packaging helper genome and the 3' LTR, but encodes a foreign polyadenylation site, for example the SV40 polyadenylation site, and a foreign enhancer and/or promoter which directs efficient transcription in a cell type where virus production is desired.
  • the retrovirus is a leukemia virus such as a Moloney Murine Leukemia Virus (MMLV), the Human Immunodeficiency Virus (HIV), or the Gibbon Ape Leukemia virus (GALV).
  • the foreign enhancer and promoter may be the human cytomegalovirus (HCMV) immediate early (IE) enhancer and promoter, the enhancer and promoter (U3 region) of the Moloney Murine Sarcoma Virus (MMSV), the U3 region of Rous Sarcoma Virus (RSV), the U3 region of Spleen Focus Forming Virus (SFFV), or the HCMV IE enhancer joined to the native Moloney Murine Leukemia Virus (MMLV) promoter.
  • HCMV human cytomegalovirus
  • IE immediate early
  • IE Enhancr and promoter
  • U3 region of the Moloney Murine Sarcoma Virus
  • RSV Rous Sarcoma Virus
  • SFFV Spleen Focus Forming Virus
  • HCMV IE enhancer joined to the native Moloney Murine Leukemia Virus
  • the retroviral packaging plasmid may consist of two retroviral helper DNA sequences encoded by plasmid based expression vectors, for example where a first helper sequence contains a cDNA encoding the gag and pol proteins of ecotropic MMLV or GALV and a second helper sequence contains a cDNA encoding the env protein.
  • the Env gene which determines the host range, may be derived from the genes encoding xenotropic, amphotropic, ecotropic, polytropic (mink focus forming) or 10A1 murine leukemia virus env proteins, or the Gibbon Ape Leukemia Virus (GALV env protein, the Human
  • Immunodeficiency Virus env (gpl60) protein the Vesicular Stomatitus Virus (VSV) G protein, the Human T cell leukemia (HTLV) type I and II env gene products, chimeric envelope gene derived from combinations of one or more of the aforementioned env genes or chimeric envelope genes encoding the cytoplasmic and transmembrane of the aforementioned env gene products and a monoclonal antibody directed against a specific surface molecule on a desired target cell.
  • VSV Vesicular Stomatitus Virus
  • HTLV Human T cell leukemia
  • the packaging plasmids and retroviral vectors expressing the LHR, B7-H4, HLA-G, or HLA-DR are transiently co-transfected into a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells (ATCC No. CRL1573, ATCC, Rockville, Md.) to produce high titer recombinant retrovirus-containing supernatants.
  • this transiently transfected first population of cells is then co-cultivated with mammalian target cells, for example human lymphocytes, to transduce the target cells with the foreign gene at high efficiencies.
  • the supernatants from the above described transiently transfected first population of cells are incubated with mammalian target cells, for example human lymphocytes or hematopoietic stem cells, to transduce the target cells with the foreign gene at high efficiencies.
  • mammalian target cells for example human lymphocytes or hematopoietic stem cells
  • the packaging plasmids are stably expressed in a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells.
  • Retroviral or lentiviral vectors are introduced into cells by either cotransfection with a selectable marker or infection with pseudotyped virus. In both cases, the vectors integrate.
  • vectors can be introduced in an episomally
  • the cells can be activated and expanded using generally known methods such as those described in U.S. Patent Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681 ; 7, 144,575; 7,067,318; 7, 172,869; 7,232,566; 7, 175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041.
  • Stimulation with the LHR, B7-H4, HLA-G, or HLA-DR antigen ex vivo can activate and expand the selected CAR expressing cell subpopulation.
  • the cells may be activated in vivo by interaction with LHR, B7-H4, HLA-G, or HLA-DR antigen.
  • PhosflowTM activation kits Miltenyi Biotec MACSTM activation/expansion kits, and other commercially available cell kits specific to activation moieties of the relevant cell.
  • Particular subpopulations of immune cells may be activated or expanded through the use of beads or other agents available in such kits .
  • a-CD3/a-CD28 Dynabeads® may be used to activate and expand a population of isolated T-cells
  • the CAR T-cells of the present disclosure may be used to treat tumors and cancers.
  • the CAR-T cells of the present invention may be administered either alone or in combination with diluents, known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunostimulatory.
  • the tumor is a solid tumor or a B-cell lymphoma or leukemia.
  • the tumors/cancer is thyroid, breast, colon, chiro-carcinoma, ovarian or prostate tumors/cancer or a B-cell lymphoma or leukemia.
  • the tumor or cancer expresses or overexpresses LHR, B7-H4, HLA-G, or HLA-DR.
  • these methods comprise, or alternatively consist essentially of, or yet further consist of, administering to the subject or patient an effective amount of the isolated cell.
  • this isolated cell comprises a LHR, B7-H4, HLA-G, or HLA-DR CAR.
  • the isolated cell is a T-cell or an K cell.
  • the isolated cell is autologous to the subject or patient being treated.
  • the tumor expresses LHR, B7-H4, HLA-G, or HLA-DR antigen and the subject has been selected for the therapy by a diagnostic, such as the one described herein.
  • the CAR cells as disclosed herein may be administered either alone or in
  • diluents known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunostimulatory. They may be administered as a first line therapy, a second line therapy, a third line therapy, or further therapy.
  • the disclosed CARs may be combined with other therapies (e.g., chemotherapy, radiation, etc.).
  • additional therapies include chemotherapeutics or biologies. Appropriate treatment regimens will be determined by the treating physician or veterinarian.
  • the disclosed CARs may be delivered or administered into a cavity formed by the resection of tumor tissue (i.e. intracavity delivery) or directly into a tumor prior to resection (i.e. intratumoral delivery).
  • the disclosed CARs may be administered intravenously, intrathecally, intraperitoneally, intramuscularly, subcutaneously, or by other suitable means of administration.
  • compositions of the present invention may be administered in a manner appropriate to the disease to be treated or prevented.
  • the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
  • compositions comprising a carrier and one or more of the products - e.g., an isolated cell comprising a LHR, B7-H4, HLA-G, or HLA-DR CAR, an isolated nucleic acid, a vector, an isolated cell of any anti-LHR, B7-H4, HLA-G, or HLA-DR antibody or CAR cell, an anti-LHR, B7-H4, HLA-G, or HLA-DR - described in the embodiments disclosed herein.
  • compositions of the present invention including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
  • compositions of the present disclosure may be formulated for oral, intravenous, topical, enteral, and/or parenteral administration.
  • the compositions of the present disclosure are formulated for intravenous administration.
  • Administration of the cells or compositions can be effected in one dose, continuously or intermittently throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician. Suitable dosage formulations and methods of administering the agents are known in the art.
  • the cells and composition of the invention can be administered in combination with other treatments.
  • the cells and populations of cell are administered to the host using methods known in the art and described, for example, in PCT/US2011/064191.
  • This administration of the cells or compositions of the invention can be done to generate an animal model of the desired disease, disorder, or condition for experimental and screening assays.
  • compositions comprising a carrier and one or more of the products - e.g., an isolated cell comprising a LHR, B7-H4, HLA-G, or HLA-DR CAR, an isolated nucleic acid, a vector, an isolated cell of any anti-LHR, B7-H4, HLA-G, or HLA-DR antibody or CAR cell, an anti-LHR, B7-H4, HLA-G, or HLA-DR - described in the embodiments disclosed herein.
  • compositions of the present invention including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
  • Compositions of the present disclosure may be formulated for oral, intravenous, topical, enteral, and/or parenteral administration. In certain embodiments, the compositions of the present disclosure are formulated for intravenous administration.
  • compositions of the present invention including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
  • Compositions of the present invention are preferably formulated for intravenous administration.
  • compositions of the present disclosure may be administered in a manner appropriate to the disease to be treated or prevented.
  • the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
  • Antibodies against the lysine rich extracellular hormone binding domain of LHR were generated by repeated immunization of 4 week-old-BALB/c and NIH Swiss mice with genetically engineered LHR-Fc. As shown below in FIG. 3, the leader sequence and first part of the human LHR G-protein was used to generate the LHR-Fc used in the immunization and screening methods to generate and identify high binding antibodies. Since flow cytometry has previously been shown to be the best predictor of functional antibodies for CAR generation, this method was used to identify potential candidate antibodies from over 7 fusions performed in the laboratory. A typical flow cytometry screen of hybridomas positive by initial ELISA screen using LHR-Fc coated plates is shown below in FIG.
  • LHR has significant advantages over other targets due to its common expression on ovarian cancers and its lack of expression on normal human tissues.
  • LHR CAR T-cells are produced in vitro and in vivo to identify a potential clinical candidate for subsequent clinical trials or use with dual targeting CAR modified T-cells.
  • third generation CAR vectors were constructed consisting of the following tandem genes: a kozak consensus sequence; the CD8 signal peptide; the anti-LHR heavy chain variable region; a (Glycine4Serine)3 flexible polypeptide linker; the respective anti-LHR light chain variable region; CD8 hinge and transmembrane domains; and the CD28, 4-1BB, and ⁇ 3 ⁇ intracellular co-stimulatory signaling domains.
  • Hinge, transmembrane, and signaling domain DNA sequences were known in the art (see US Patent Application No. 20130287748 Al).
  • Anti-LHR CAR genes can be synthesized within a pUC57 vector backbone containing a beta-lactamase ("bla") gene, which confers ampicillin resistance to the vector host.
  • the pUC57 vector sequence is disclosed herein by referring to GeneBank accession No. Y14837 with the sequence of the beta-lactamase gene disclosed in the listed GeneBank accession No. The sequence associated with the listed GeneBank Accession number is herein incorporated by reference.
  • NovaBlue SinglesTM chemically-competent E. coli cells were transformed with anti- LHR plasmid cDNA. Following growth of the transformed E. coli cells, the CAR plasmids were purified and digested with the appropriate restriction enzymes inserted into an HIV-1- based lentiviral vector containing HIV-1 long terminal repeats (LTRs), packaging signal ( ⁇ ), EFla promoter, internal ribosome entry site (IRES), and woodchuck hepatitis virus post- transcriptional regulatory element (WPRE) via overnight T 4 DNA ligase reaction (New England Biosciences; Ipswich, MA). NovaBlue SinglesTM chemically-competent E. coli cells are then transformed with the resulting anti-LHR containing lentiviral plasmid.
  • LTRs HIV-1 long terminal repeats
  • packaging signal
  • IRS internal ribosome entry site
  • WPRE woodchuck hepatitis virus post- transcriptional regulatory element
  • HEK293T cells Prior to transfection, HEK293T cells were seeded at 4.0 ⁇ 10 6 cells/100 mm tissue- culture-treated plate in 10 mL complete-Tet-DMEM and incubated overnight at 37°C in a humidified 5% C0 2 incubator. Once 80-90% confluent, HEK293T cells were co-transfected with CAR-gene lentiviral plasmids and lentiviral packaging plasmids containing genes necessary to form lentiviral envelope and capsid components to facilitate the formation of plasmid-containing nanoparticles that bind HEK293T cells.
  • transfection medium was replaced with 10 mL fresh complete Tet DMEM.
  • HEK293T cells are then incubated for an additional 48 hours, after which cell supematants are harvested and tested for lentiviral particles via sandwich ELISA against p24, the main lentiviral capsid protein. Lentivirus-containing supematants were aliquoted and stored at -80°C until use for transduction of target CD4 + and CD8 + T cells.
  • PBMCs Peripheral blood mononuclear cells enriched by density gradient centrifugation with Ficoll-Paque Plus (GE Healthcare; Little Chalfont, Buckinghamshire,
  • MACS CD4 + and CD8 + MicroBeads can be used to isolate these human T-cell subsets using magnetically activated LS columns to positive select for CD4 + and CD8 + T-cells. Magnetically-bound T- cells were then removed from the magnetic MACS separator, flushed from the LS column, and washed in fresh complete medium.
  • CD4 + and CD8 + T-cell populations were assessed by flow cytometry using Life Technologies Acoustic Attune® Cytometer, and were enriched by Fluorescence-Activated Cell Sorting performed at USC's flow cytometry core facilities if needed.
  • CD4 + and CD8 + T-cells were maintained at a density of 1.0 ⁇ 10 cells/mL in complete medium supplemented with 100 IU/mL IL-2 in a suitable cell culture vessel, to which a-CD3/a-CD28 Human T-cell Dynabeads (Life Technologies; Carlsbad, CA) were added to activate cultured T cells.
  • T-cells were incubated at 37°C in a 5% C0 2 incubator for 2 days prior to transduction with CAR-lentiviral particles.
  • Activated T-cells are collected and dead cells were removed by Ficoll-Hypaque density gradient centrifugation or the use of MACS Dead Cell Removal Kit (Miltenyi Biotec; San Diego, CA). In a 6-well plate, activated T-cells were plated at a concentration of 1.0 ⁇ 10 6 cells/ mL complete medium. To various wells, LHR CAR-containing lentiviral particles were added to cell suspensions at varying multiplicity of infections (MOIs), such as 1, 5, 10, and 50. Polybrene, a cationic polymer that aids transduction by facilitating interaction between lentiviral particles and the target cell surface, was added at a final concentration of 4 ⁇ g/mL.
  • MOIs multiplicity of infections
  • LHR CAR modified T-cells are assessed by flow cytometry and southern blot analysis to demonstrate successful transduction procedures. Prior to in vitro and in vivo assays, LHR CAR T-cells were enriched by FACS and mixed 1 : 1 for the in vivo studies.
  • LHR CAR T-cells was added to the plate in complete medium at effector-to-target cell ratios of 50: 1, 5: 1, and 1 : 1.
  • Dyed-target cells suspended in complete medium and complete medium with 2% triton X-100 serves as spontaneous and maximal release controls, respectively.
  • the plates were centrifuged at 365 x g and 20°C for 2 minutes before being placed back in the incubator for 3 hours. The plates were then centrifuged for 10 minutes and cell supernatants were aliquoted to respective wells on a black polystyrene 96-well plate and assessed for fluorescence on a Bio-Tek® SynergyTM HT microplate reader at excitation and emissions of 485/20 nm and 528/20 nm, respectively.
  • LHR CAR T-cells are further evaluated in vivo using two different human ovarian cell xenograft tumor models.
  • solid human ovarian tumors are established subcutaneously in nude mice by injection of 5 x 10 6 LHR positive ovarian cancer cell lines or LHR negative solid tumor cell lines.
  • MUCl 6 a mucin family member is over expressed on most ovarian cancers and is an established surrogate serum marker (CA125) for the progression and detection of ovarian cancers.
  • MUC16 is composed of CA125, a large domain that gets cleaved, and a retained domain
  • MUC-CD which contains an extracellular fragment, a transmembrane domain and cytoplasmic tail
  • MUCl 6 is also expressed at low levels in the uterus, endometrium, fallopian, tubes, ovaries and serosa of the abdominal and thoracic cavities.
  • T cells exhibited efficient MUC-CD specific cytolytic activity against human ovarian cancer cell lines in vitro as well as successful eradication of established peritoneal ovarian tumors in
  • MUC-CD is a viable target for CAR therapy and an excellent choice for dual targeting CAR modified T-cells to reduce the potential on-target off-tumor effects.
  • Both MUC-CD and mesothelin CAR modified T-cells have been shown to be effective, and in combination with LHR, may provide a safer alternative if required for optimal clinical use.
  • the percent of target cells lysed are compared using a one-way ANOVA, followed by an appropriate multiple comparisons test if significance (p ⁇ 0.05) is found in the one-way ANOVA.
  • significance p ⁇ 0.05
  • Kaplan Meier plots are constructed and a log rank test used to test for significance (p ⁇ 0.05).
  • an ANOVA is used to compare tumor volume curves, followed by an appropriate multiple comparison test if significance (p ⁇ 0.05) is found in the ANOVA.
  • the CAR consists of an extracellular antigen binding moiety or scFV which binds LHR.
  • the scFV is connected via a CD8 hinge region to the cytoplasmic signaling domain, comprised of the CD8 transmembrane region, and the signaling domains from CD28, 4- IBB and CD3z.
  • the entire CAR sequence including the signaling domains, were synthetically synthesized by Genewiz Gene Synthesis Services (Piscataway, NJ) (FIG. 10).
  • the plasmids are purified and digested with the appropriate restriction enzymes to be inserted into an HIV- 1 -based, bicistronic lentiviral vector (pLVX-IRES-ZsGreen, Clontech, Signal Hill, CA) containing HIV-1 5' and 3' long terminal repeats (LTRs), packaging signal ( ⁇ ), EFla promoter, internal ribosome entry site (IRES), woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), and simian virus 40 origin (SV40) via overnight T 4 DNA ligase reaction (New England Biosciences; Ipswich, MA). NovaBlue SinglesTM chemically- competent E. coli cells are then transformed with the resulting LHR-CAR-containing lentiviral plasmid.
  • LTRs long terminal repeats
  • IVS internal ribosome entry site
  • WPRE woodchuck hepatitis virus post-transcriptional regulatory element
  • SV40 simian virus 40 origin
  • HEK 293T cells Prior to transfection, HEK 293T cells are seeded at 4.0 ⁇ 10 6 cells/150 cm 2 tissue- culture-treated flask in 20 mL DMEM supplemented with 10% dialyzed FCS and incubated overnight at 37°C in a humidified 5% C0 2 incubator. Once 80-90% confluent, HEK 293 T cells are incubated in 20 ml DMEM supplemented with 1-% dialyzed FCS without penicillin/streptamycin for two hours in a 37°C humidified 5% C0 2 incubator.
  • HEK293T cells are co-transfected with the specific pLVX-CAR plasmid and lentiviral packaging plasmids containing genes necessary to form the lentiviral envelope & capsid components.
  • a proprietary reaction buffer and polymer to facilitate the formation of plasmid-containing nanoparticles that bind HEK 293T cells are also added. After incubating the transfected- HEK 293T cell cultures for 24 hours at 37°C, the transfection medium is replaced with 20 mL fresh complete DMEM.
  • Lentivirus supernatants are collected every 24 hours for three days and the supernatants will be spun down at 1,250 rpm for 5 minutes at 4°C, followed by filter sterilization and centrifugation in an ultracentrifuge at 20,000 g for 2 hrs at 4°C.
  • the concentrated lentivirus is re-suspended in PBS containing 7% trehalose and 1% BSA for long term storage.
  • the lentivirus is aliquoted and stored at -80°C until use for transduction of target CD4 + and CD8 + T cells.
  • the cell supernatants harvested after 24 hours are tested for lentiviral particles via sandwich ELISA against p24, the main lentiviral capsid protein.
  • Transfection efficiency as determined by the expression of the protein marker ZsGreen was estimated between 20%-50%, by visualization under a fluorescent microscope.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Endocrinology (AREA)
  • Biomedical Technology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Hematology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Neurology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Oncology (AREA)
  • Urology & Nephrology (AREA)
  • Reproductive Health (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2017/052974 2016-09-23 2017-09-22 Chimeric antigen receptors and compositions and methods of use thereof Ceased WO2018057904A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
CN201780071631.4A CN110225766A (zh) 2016-09-23 2017-09-22 嵌合抗原受体和组合物及其使用方法
JP2019515810A JP2020501512A (ja) 2016-09-23 2017-09-22 キメラ抗原受容体およびその組成物ならびにそれらの使用の方法
US16/335,570 US20200016201A1 (en) 2016-09-23 2017-09-22 Chimeric antigen receptors and compositions and methods of use thereof
CA3037528A CA3037528A1 (en) 2016-09-23 2017-09-22 Chimeric antigen receptors and compositions and methods of use thereof
AU2017330423A AU2017330423A1 (en) 2016-09-23 2017-09-22 Chimeric antigen receptors and compositions and methods of use thereof
EP17853995.3A EP3515493A4 (en) 2016-09-23 2017-09-22 CHEMERICAL ANTIGEN RECEPTORS, COORESPONDENT COMPOSITIONS AND METHODS OF USE
IL265438A IL265438B2 (en) 2016-09-23 2017-09-22 Chimeric antigen receptors and compositions and methods of use thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662399244P 2016-09-23 2016-09-23
US62/399,244 2016-09-23

Publications (1)

Publication Number Publication Date
WO2018057904A1 true WO2018057904A1 (en) 2018-03-29

Family

ID=61689763

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/052974 Ceased WO2018057904A1 (en) 2016-09-23 2017-09-22 Chimeric antigen receptors and compositions and methods of use thereof

Country Status (8)

Country Link
US (1) US20200016201A1 (https=)
EP (1) EP3515493A4 (https=)
JP (1) JP2020501512A (https=)
CN (1) CN110225766A (https=)
AU (1) AU2017330423A1 (https=)
CA (1) CA3037528A1 (https=)
IL (1) IL265438B2 (https=)
WO (1) WO2018057904A1 (https=)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109111525A (zh) * 2018-05-24 2019-01-01 卢英 一种hla-g嵌合抗原受体、编码序列和表达载体以及应用
EP3623010A1 (en) * 2018-09-17 2020-03-18 China Medical University Hospital Chimeric antigen receptor, nucleic acid, chimeric antigen receptor expression plasmid, chimeric antigen receptor expressing cell, use thereof, and pharmaceutical composition for treating cancer
CN110903399A (zh) * 2018-09-17 2020-03-24 中国医药大学附设医院 嵌合抗原受体、其核酸、表达质体、细胞、用途及组合物
CN111718957A (zh) * 2019-03-22 2020-09-29 南京安锐生物科技有限公司 一种嵌合抗原受体重组腺相关病毒颗粒及其应用
EP3568469A4 (en) * 2017-02-21 2020-11-11 Eutilex Co., Ltd. COMPOSITIONS OF CAR-T CELLS DIRECTED AGAINST HLA-DR AND THEIR MANUFACTURING AND USE PROCEDURES
JP2021065219A (ja) * 2019-10-24 2021-04-30 中國醫藥大學附設醫院China Medical University Hospital Hla−g特異的キメラ抗原受容体、核酸、hla−g特異的キメラ抗原受容体発現プラスミド、hla−g特異的キメラ抗原受容体発現細胞及び癌治療用の医薬組成物
US11013765B2 (en) 2018-08-10 2021-05-25 Eutilex Co., Ltd. Chimeric antigen receptor that binds HLA-DR and CAR-T cell
US11396555B2 (en) 2014-03-05 2022-07-26 Eutilex Co., Ltd. Monoclonal antibody which specifically recognizes B cell lymphoma and use thereof

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2019328677A1 (en) 2018-08-31 2021-04-01 Invectys SA Chimeric antigen receptors against multiple HLA-G isoforms
WO2025220659A1 (ja) * 2024-04-16 2025-10-23 国立大学法人大阪大学 Nk前駆細胞及びそれを用いたnk細胞の製造方法

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7892753B1 (en) * 2004-04-15 2011-02-22 Subhasis Banerjee Diagnostic and therapeutic applications of soluble LHCGR protein
US20150118202A1 (en) * 2010-12-09 2015-04-30 The Trustees Of The University Of Pennsylvania Methods for Treatment of Cancer
WO2016160618A2 (en) * 2015-03-27 2016-10-06 University Of Southern California Car t-cell therapy directed to lhr for the treatment of solid tumors

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1711527A4 (en) * 2003-12-15 2008-09-03 Dendreon Corp HLA-DR SPECIFIC ANTIBODIES, COMPOSITIONS AND METHODS
JP6850528B2 (ja) * 2012-02-13 2021-03-31 シアトル チルドレンズ ホスピタル ドゥーイング ビジネス アズ シアトル チルドレンズ リサーチ インスティテュート 二重特異性キメラ抗原受容体およびその治療的使用
US20140348744A1 (en) * 2013-05-24 2014-11-27 Jacek K. Pinski Compositions and methods for regulating cancer-related signaling pathways
KR102339240B1 (ko) * 2013-10-15 2021-12-15 더 스크립스 리서치 인스티튜트 펩타이드 키메라 항원 수용체 t 세포 스위치 및 이의 용도
KR20170137079A (ko) * 2015-03-11 2017-12-12 셀렉티스 그것들의 지속을 증가시키기 위한 동종이계 t 세포의 조작 및/또는 환자들 내로 이식 방법들
CN105949316B (zh) * 2016-04-12 2019-07-02 上海优卡迪生物医药科技有限公司 抗EGFRvIII嵌合抗原受体、编码基因、重组表达载体及其构建方法和应用

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7892753B1 (en) * 2004-04-15 2011-02-22 Subhasis Banerjee Diagnostic and therapeutic applications of soluble LHCGR protein
US20150118202A1 (en) * 2010-12-09 2015-04-30 The Trustees Of The University Of Pennsylvania Methods for Treatment of Cancer
WO2016160618A2 (en) * 2015-03-27 2016-10-06 University Of Southern California Car t-cell therapy directed to lhr for the treatment of solid tumors

Cited By (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11396555B2 (en) 2014-03-05 2022-07-26 Eutilex Co., Ltd. Monoclonal antibody which specifically recognizes B cell lymphoma and use thereof
EP3568469A4 (en) * 2017-02-21 2020-11-11 Eutilex Co., Ltd. COMPOSITIONS OF CAR-T CELLS DIRECTED AGAINST HLA-DR AND THEIR MANUFACTURING AND USE PROCEDURES
CN109111525A (zh) * 2018-05-24 2019-01-01 卢英 一种hla-g嵌合抗原受体、编码序列和表达载体以及应用
CN109111525B (zh) * 2018-05-24 2021-10-29 卢英 一种hla-g嵌合抗原受体、编码序列和表达载体以及应用
US11951130B2 (en) 2018-08-10 2024-04-09 Eutilex Co., Ltd. Chimeric antigen receptor that binds HLA-DR and CAR-T cell
US11013765B2 (en) 2018-08-10 2021-05-25 Eutilex Co., Ltd. Chimeric antigen receptor that binds HLA-DR and CAR-T cell
EP3623010A1 (en) * 2018-09-17 2020-03-18 China Medical University Hospital Chimeric antigen receptor, nucleic acid, chimeric antigen receptor expression plasmid, chimeric antigen receptor expressing cell, use thereof, and pharmaceutical composition for treating cancer
CN110903399A (zh) * 2018-09-17 2020-03-24 中国医药大学附设医院 嵌合抗原受体、其核酸、表达质体、细胞、用途及组合物
JP2020043848A (ja) * 2018-09-17 2020-03-26 中國醫藥大學附設醫院China Medical University Hospital キメラ抗原受容体、核酸、キメラ抗原受容体発現プラスミド、キメラ抗原受容体発現細胞、その使用及びがん治療用の医薬組成物
AU2019206018B2 (en) * 2018-09-17 2021-02-25 China Medical University Hospital Chimeric Antigen Receptor, Nucleic Acid, Chimeric Antigen Receptor Expression Plasmid, Chimeric Antigen Receptor Expressing Cell, Use Thereof, and Pharmaceutical Composition for Treating Cancer
US11554140B2 (en) 2018-09-17 2023-01-17 China Medical University Hospital Nucleic acid, chimeric antigen receptor expression plasmid, chimeric antigen receptor expressing cell, use thereof, and pharmaceutical composition for treating cancer
CN110903399B (zh) * 2018-09-17 2022-02-01 台湾中国医药大学附设医院 嵌合抗原受体、其核酸、表达质体、细胞、用途及组合物
CN111718957A (zh) * 2019-03-22 2020-09-29 南京安锐生物科技有限公司 一种嵌合抗原受体重组腺相关病毒颗粒及其应用
WO2020192803A1 (zh) * 2019-03-22 2020-10-01 南京安锐生物科技有限公司 一种嵌合抗原受体重组腺相关病毒颗粒及其应用
US11479611B2 (en) 2019-10-24 2022-10-25 China Medical University Hospital HLA-G specific chimeric antigen receptor, nucleic acid, HLA-G specific chimeric antigen receptor expression plasmid, HLA-G specific chimeric antigen receptor expressing cell, use thereof, and pharmaceutical composition for treating cancer
JP2021065219A (ja) * 2019-10-24 2021-04-30 中國醫藥大學附設醫院China Medical University Hospital Hla−g特異的キメラ抗原受容体、核酸、hla−g特異的キメラ抗原受容体発現プラスミド、hla−g特異的キメラ抗原受容体発現細胞及び癌治療用の医薬組成物
AU2020256402B2 (en) * 2019-10-24 2023-01-19 China Medical University Hospital Hla-g specific chimeric antigen receptor, nucleic acid, hla-g specific chimeric antigen receptor expression plasmid, hla-g specific chimeric antigen receptor expressing cell, use thereof, and pharmaceutical composition for treating cancer

Also Published As

Publication number Publication date
IL265438B1 (en) 2023-06-01
CN110225766A (zh) 2019-09-10
JP2020501512A (ja) 2020-01-23
IL265438A (en) 2019-05-30
US20200016201A1 (en) 2020-01-16
EP3515493A1 (en) 2019-07-31
IL265438B2 (en) 2023-10-01
EP3515493A4 (en) 2020-08-19
AU2017330423A1 (en) 2019-04-11
CA3037528A1 (en) 2018-03-29

Similar Documents

Publication Publication Date Title
US20250129171A1 (en) Car t-cell therapy directed to lhr for the treatment of solid tumors
US20240392011A1 (en) Hla-g as a novel target for car t-cell immunotherapy
US20210147551A1 (en) Lym-1 and lym-2 targeted car cell immunotherapy
US20200016201A1 (en) Chimeric antigen receptors and compositions and methods of use thereof
US12415867B2 (en) Anti-DCLK1 antibodies and chimeric antigen receptors, and compositions and methods of use thereof
US20180118831A1 (en) Car t-cells for the treatment of b7-h4 expressing solid tumors

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17853995

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3037528

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019515810

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017330423

Country of ref document: AU

Date of ref document: 20170922

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017853995

Country of ref document: EP

Effective date: 20190423