WO2018025178A1 - Antibodies against human ctla-4 - Google Patents

Antibodies against human ctla-4 Download PDF

Info

Publication number
WO2018025178A1
WO2018025178A1 PCT/IB2017/054697 IB2017054697W WO2018025178A1 WO 2018025178 A1 WO2018025178 A1 WO 2018025178A1 IB 2017054697 W IB2017054697 W IB 2017054697W WO 2018025178 A1 WO2018025178 A1 WO 2018025178A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
binding fragment
antigen binding
seq
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2017/054697
Other languages
English (en)
French (fr)
Inventor
Hans Van Eenennaam
Andrea Van Elsas
Joost Kreijtz
David Lutje Hulsik
Paul VINK
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Aduro Biotech Holdings Europe BV
Original Assignee
Aduro Biotech Holdings Europe BV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Aduro Biotech Holdings Europe BV filed Critical Aduro Biotech Holdings Europe BV
Priority to JP2019505381A priority Critical patent/JP7214623B2/ja
Priority to CN201780060282.6A priority patent/CN110088134B/zh
Priority to EP17752494.9A priority patent/EP3494137B1/en
Priority to ES17752494T priority patent/ES3038117T3/es
Publication of WO2018025178A1 publication Critical patent/WO2018025178A1/en
Anticipated expiration legal-status Critical
Priority to JP2021166154A priority patent/JP7440473B2/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to treatments of conditions ameliorated by stimulation of an immune response, in particular by the stimulation of antigen-specific T- lymphocytes. More specifically, the present invention relates to anti-human CTLA-4 antibodies, as well as use of these antibodies in the treatment of diseases such as cancer and infectious disease.
  • T lymphocytes play a central role in the adaptive immune response to antigen.
  • Naive T cells require two signals for their full activation (Bretscher 1999, Proc Natl Acad Sci USA 96: 185-90).
  • the first signal is antigen- specific and is provided by interaction of the T- cell receptor (TCR) with MHC/peptide complex on an antigen-presenting cell (APC).
  • the second signal is a co-stimulatory signal provided by the interactions between receptors on the T cell and their ligands on the APC.
  • T-cell activation via a number of intracellular pathways, including calcium calcineurin and RAS mitogen-activated protein kinase, and subsequent activation of transcription factors for a number of effector compounds, including cytokines such as IL-2.
  • cytokines such as IL-2.
  • CD28 promotes T-cell differentiation and enhances antibody production by B cells and activation of T cells.
  • CD86 is constitutively expressed and is rapidly upregulated on APCs coincident with TCR/MHC engagement.
  • CD80 expression is very low on the resting cell, but is typically induced after prolonged T-cell stimulation.
  • CTLA-4 Cytotoxic T Lymphocyte Antigen 4
  • CD152 Cytotoxic T Lymphocyte Antigen 4
  • CTLA-4 is structurally homologous to CD28 but binds more tightly to both CD80 and CD86 ligands.
  • CTLA-4 inhibits the immune response in two principal ways - it competes with CD28 for the CD80 and CD86 ligands and thus blocks co- stimulation, and it also signals in a negative way to inhibit T cell activation (Krummel and Allison, 1995, J Exp Med 182:459-465; Walunas et al., 1994, Immunity 1:405- 413). It has further been shown that CD86 engages CD28 more than CTLA-4 at the immune synapse, while CD80 ligates more CTLA-4 than CD28 (Collins et al., 2002, Immunity 17:201-210; Jansson et al., 2005, J Immunol 175: 1575-1585).
  • CTLA-4 blockade augments T cell responses in vitro and in vivo, exacerbates antitumor immunity, and enhances an induced autoimmune disease. It has also been reported that CTLA-4 has an alternative or additional impact on the initial character of the T cell immune response. This is consistent with the observation that some autoimmune patients have autoantibodies to CTLA-4. It is possible that CTLA-4 blocking autoantibodies play a pathogenic role in these patients.
  • human antibodies against human CTLA-4 have been described as immuno stimulation modulators in a number of disease conditions, such as treating or preventing viral and bacterial infection and for treating cancer.
  • Ipilimumab is a human anti-human CTLA-4 antibody which blocks the binding of CTLA-4 to CD80 and CD86 expressed on APCs, blocking the negative
  • antitumor responses may be characterized by short-term progression followed by delayed regression, and an important, possibly unique, clinical characteristic of anti-CTLA-4 antibodies is that the duration of clinical responses and even stable disease is often quite prolonged.
  • Preclinical and early clinical studies of patients with advanced melanoma show that ipilimumab promotes antitumor activity as monotherapy and in combination with treatments such as chemotherapy, antibodies, vaccines, or cytokines (Weber, J., The
  • the present invention relates to antibodies or antigen binding fragments thereof that binds to human CTLA-4, wherein the antibody or antigen binding fragment comprises one or more, and optionally each, of: a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1 or an amino acid sequence differing from SEQ ID NO: 1 by 1, 2, 3, or more conservative substitutions, a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2 or an amino acid sequence differing from SEQ ID NO: 2 by 1, 2, 3, or more conservative substitutions, a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3 or an amino acid sequence differing from SEQ ID NO: 3 by 1, 2, 3, or more conservative substitutions, a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4 or an amino acid sequence differing from SEQ ID NO: 4 by 1, 2, 3, or more conservative substitutions, a light chain variable region CDR2 comprising the amino acid sequence of:
  • said antibody or antigen binding fragment comprises one or more and preferably each of: a. a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; b. a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; c. a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; d. a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; e. a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; f. a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6
  • said antibody has a heavy chain according to SEQ ID NO: 7. Further preferably said antibody has a light chain according to SEQ ID NO: 8. More preferably, the heavy chain is chosen from any of SEQ ID NO: 10, 12, 14, 16, 18 or 20. More preferably, the light chain is chosen from any of SEQ ID NO: 22, 24, 26, 30. [0013]
  • the invention further relates to an antibody or antigen binding fragment thereof that binds to human CTLA-4 comprising a light chain immunoglobulin, a heavy chain immunoglobulin or both a light chain and a heavy chain immunoglobulin selected from the group consisting of: a.
  • an antibody or antigen binding fragment thereof comprising a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 7 and/or a variable light chain comprising the amino acid sequence of SEQ ID NO: 8; b. an antibody or antigen binding fragment thereof comprising a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 10, 12, 14, 16, 18 or 20 and/or a variable light chain comprising the amino acid sequence of SEQ ID NO: 22, 24, 26 or 30; c.
  • an antibody or antigen binding fragment thereof comprising a variable heavy chain comprising at least 90%, 95%, 96%, 97%, 98% or 99% identity any one of SEQ ID NO: 10, 12, 14, 16, 18 or 20 and/or a variable light chain comprising at least 90%, 95%, 96%, 97%, 98% or 99% identity to any one of SEQ ID NO: 22, 24, 26 or 30; and d.
  • an antibody or antigen binding fragment thereof comprising a variable heavy chain comprising at least 90%, 95%, 96%, 97%, 98% or 99% identity any one of SEQ ID NO: 10, 12, 14, 16, 18 or 20 and/or a variable light chain comprising at least 90%, 95%, 95%, 96%, 97%, 98% or 99% identity to any one of SEQ ID NO: 22, 24, 26 or 30, wherein any sequence variations occur in the framework regions of the antibody or antigen binding fragment; e.
  • an antibody or antigen binding fragment thereof comprising a variable heavy chain comprising 1, 2, 3, 4, 5,6, 7, 8, 9 or 10 amino acid substitution with respect to any one of SEQ ID NO: 10, 12, 14, 16, 18 or 20 and/or a variable light chain 1, 2, 3, 4, 5,6, 7, 8, 9 or 10 amino acid substitution with respect to any one of SEQ ID NO: 22, 24, 26 or 30; and f.
  • an antibody or antigen binding fragment thereof comprising a variable heavy chain comprising 1, 2, 3, 4, 5,6, 7, 8, 9 or 10 amino acid substitution with respect to any one of SEQ ID NO: 10, 12, 14, 16, 18 or 20 and/or a variable light chain 1, 2, 3, 4, 5,6, 7, 8, 9 or 10 amino acid substitution with respect to any one of SEQ ID NO: 22, 24, 26 or 30, wherein any said substitutions occur in the framework regions of the antibody or antigen binding fragment.
  • said antibody or antigen binding fragment has at least one of the following characteristics: a) binds to human CTLA-4 with a KD value of at least about 1 x 10 ⁇ 9 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET); b) blocks the binding of hCTLA-4 to hCD80 with an IC 50 of about 100 nM or lower; c) blocks the binding of hCTLA-4 to hCD86 with an IC 50 of about 100 nM or lower; d) binds to a different CTLA-4 epitope than ipilimumab or tremelimumab.
  • a KD value of at least about 1 x 10 ⁇ 9 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET)
  • the invention further comprises an antibody or antigen binding fragment thereof that binds to an epitope of human CTLA-4 wherein said antibody or antigen binding fragment does not bind to the mouse-human chimeric CTLA-4 molecule of SEQ ID NO: 44.
  • a further aspect of the invention is an antibody or antigen binding fragment thereof that binds to the same epitope of human CTLA-4 as an antibody comprising the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 8, wherein the antibody or fragment thereof does not bind to the mouse-human chimeric CTLA-4 molecule of SEQ ID NO: 44 and has one, two, three, or all four of the following
  • g. binds to human CTLA-4 with a KD value of at least about 1 x 10 "9 M as
  • h blocks the binding of hCTLA-4 to hCD80 with an IC 50 of about 100 nM or lower; i. blocks the binding of hCTLA-4 to hCD86 with an IC 5 o of about 100 nM or lower; j. binds to a different CTLA-4 epitope than ipilimumab or tremelimumab.
  • a further aspect of the invention is an antibody or antigen binding fragment thereof that binds to human CTLA-4, wherein the antibody or antigen binding fragment binds to an epitope of human CTLA4 comprising at least 8 contiguous residues of
  • S FVCE Y AS PGKAT SEQ ID NO: 53.
  • An antibody or antigen binding fragment thereof according to claim 34, wherein the epitope consists of S F VCE Y AS PGKAT (SEQ ID NO: 53).
  • An antibody or antigen binding fragment thereof that binds to human CTLA-4, wherein one or more mutations in human CTLA-4 within the sequence SFVCEYASPGKAT (SEQ ID NO: 53) prevent binding of the antibody to human CTLA4.
  • the antibody or antigen binding fragment of the present invention is a humanized antibody comprising two heavy chains and two light chains.
  • the present invention relates to an isolated polypeptide comprising the amino acid sequence of any one of SEQ ID NOs: 1-8, 10, 12, 14, 16, 18, 20, 22, 24, 26 or 30.
  • the invention is directed to an isolated nucleic acid encoding: any one of the antibodies or antigen binding fragments of the invention, or any one of the polypeptides as defined above.
  • the invention also encompasses an expression vector comprising such an isolated nucleic acid.
  • the invention also comprises a host cell comprising the antibody, binding fragment, polypeptide, polynucleotide or expression vector of the invention.
  • Said host cell preferably is a Pichia cell or a Chinese hamster ovary cell.
  • an antibody or antigen binding fragment of the invention is used in association with one or more cyclic dinucleotides or other STING pathway agonists.
  • STING stimulation of interferon genes, also known as TMEM173, MITA, ERIS, and MPYS
  • CDNs cyclic dinucleotides
  • the STING pathway in tumor-resident host antigen presenting cells is involved in the induction of a spontaneous CD8+ T cell response against tumor-derived antigens. Activation of this pathway and the subsequent production of IFN- ⁇ also reportedly contributes to the anti-tumor effect of radiation.
  • STING agonists and their uses are described in, for example, US20060040887, US20080286296, US20120041057, US20140205653, WO2014179335, WO 2014179760, US20150056224, WO 2016096174, WO 2017011444, WO 2017027645, and WO 2017027646. wherein the compound is administered as a pharmaceutical composition comprising a pharmaceutically acceptable carrier.
  • Sting agonists may be administered by one or more non-parenteral or parenteral routes.
  • the administration is subcutaneous, intramuscular, intradermal, mucosal, vaginal, cervical, peri-tumoral, intra-tumoral, or directly into the tumor-draining lymph node(s).
  • the STING agonist and an antibody or antigen binding fragment of the invention are administered as separate administrations, e.g., at different times and/or by different routes of administration.
  • compositions comprising the antibody or antigen binding fragment of the invention and a pharmaceutically acceptable carrier, diluent, excipient or stabilizer.
  • said composition further comprises an agent selected from the group consisting of: k. an anti-PDl antibody or an antigen binding fragment thereof;
  • an anti-LAG3 antibody or an antigen binding fragment thereof m. an anti-TIGIT antibody or an antigen binding fragment thereof; n. an anti- VISTA antibody or an antigen binding fragment thereof; o. an anti-BTLA antibody or an antigen binding fragment thereof; p. an anti-TIM3 antibody or an antigen binding fragment thereof; q. an anti-CD27 antibody or an antigen binding fragment thereof; r. an anti-HVEM antibody or an antigen binding fragment thereof; s. an anti-CD70 antibody or an antigen binding fragment thereof; t. an anti-CD 137 antibody or an antigen binding fragment thereof; u. an anti-OX40 antibody or an antigen binding fragment thereof; v.
  • an anti-CD28 antibody or an antigen binding fragment thereof w. an anti-PDLl antibody or an antigen binding fragment thereof; jc. an anti-PDL2 antibody or an antigen binding fragment thereof; y. an anti-GITR antibody or an antigen binding fragment thereof; z. an anti-ICOS antibody or an antigen binding fragment thereof ; aa. an anti-SIRPa antibody or an antigen binding fragment thereof; bb. an anti-ILT2 antibody or an antigen binding fragment thereof; cc. an anti-ILT3 antibody or an antigen binding fragment thereof; dd. an anti-ILT4 antibody or an antigen binding fragment thereof; ee. an anti-ILT5 antibody or an antigen binding fragment thereof; ff.
  • an anti-4-lBB antibody or an antigen binding fragment thereof gg. an anti-NK2GA antibody or an antigen binding fragment thereof; hh. an anti-NK2GC antibody or an antigen binding fragment thereof; ii. an anti-NK2GE antibody or an antigen binding fragment thereof; jj. an anti-TSLP antibody or an antigen binding fragment thereof, kk. a STING agonist, and;
  • the anti-PDl antibody or an antigen binding fragment thereof is selected from the group consisting of: pembrolizumab or an antigen binding fragment thereof and nivolumab or an antigen binding fragment thereof.
  • composition of the invention further comprises a compound selected from the group of ADU-S 100, melphalan, vincristine, fludarabine, chlorambucil, bendamustine, etoposide, doxorubicin, cyclophosphamide, cisplatin, immune modulating agents such as corticosteroids, for example dexamethasone or prednisolone, thalidomide analogs, for example thalidomide, lenalidomide or pomalidomide, kinase inhibitors, for example ibrutinib, idealisib, antibody targeting CD20, for example rituximab, ofatumab or obinotuzumab, antibody targeting CD52, for example alemtuzumab, antibody targeting CD38, for example daratumumab, antibody targeting IL-6 or IL-6 receptor, for example sarilumab or tocilizumab, antibody targeting CS-1, for example e
  • ADU-S 100
  • the present invention also relates to a method of producing an antibody or antigen binding fragment comprising: mm. culturing a host cell comprising a polynucleotide encoding the heavy chain and/or the light chain of any one of the antibodies or antigen binding fragments of the invention under conditions favorable to expression of the polynucleotide; and nn. optionally, recovering the antibody or antigen binding fragment from the host cell and/or culture medium.
  • the host cell comprises an expression vector comprising such a polynucleotide, wherein the expression vector comprises control sequences operably linked to the polynucleotide which drive expression of the antibody or antigen binding fragment.
  • the polynucleotide comprises a secretion signal sequence which mediates secretion of the antibody or antigen binding fragment by the host cell.
  • a further aspect of the present invention is a method of treating cancer in a subject, preferably a human subject, comprising administering to the subject an effective amount of the antibody or antigen binding fragment of the invention, or of an expression vector which mediates expression of the antibody or antigen binding fragment within the subject, optionally in association with a further therapeutic agent or therapeutic procedure.
  • Also part of the invention is a method of treating an infection or infectious disease in a human subject, comprising administering to the subject an effective amount of the antibody or antigen binding fragment according to the invention, optionally in association with a further therapeutic agent or therapeutic procedure.
  • the invention further comprises a vaccine comprising the antibody or antigen binding fragment according to the invention and an antigen.
  • the invention comprises a method for detecting the presence of a CTLA-4 peptide or a fragment thereof in a sample comprising contacting the sample with an antibody or fragment of the invention and detecting the presence of a complex between the antibody or fragment and the peptide; wherein detection of the complex indicates the presence of the CTLA-4 peptide.
  • the invention also relates to a method of increasing the activity of an immune cell, comprising administering to a subject in need thereof an effective amount of an antibody or antigen binding fragment according to the invention, or of an expression vector which mediates expression of the antibody or antigen binding fragment within the subject.
  • Preferably said method is used for: oo. the treatment of cancer; pp. the treatment of an infection or infectious disease; or qq. as a vaccine adjuvant.
  • the invention is directed to an antibody or antigen binding fragment according the invention, or an expression vector which mediates expression of the antibody or antigen binding fragment within the subject for use in the preparation of a medicament to: rr. increase immune cell activation; ss. treat cancer; or tt. treat an infection or infectious disease.
  • the invention comprises, in a following aspect, the use of the antibody or antigen binding fragment of the present invention for the manufacture of a medicament for the treatment of cancer for: increasing immune cell activation; treating cancer; or treating an infection or infectious disease.
  • the invention also comprises an antibody or antigen binding fragment thereof of the invention, wherein the fragment is a Fab, F(ab')2, Fv or a single chain Fv fragment (scFV).
  • the antibody or antigen binding fragment thereof of the invention comprises a heavy chain constant region selected from IgGl, IgG2, IgG3 and IgG4, preferably IgGl or IgG4, and a light chain constant region chosen from the light chain constant regions kappa or lambda.
  • said IgG4 sequence preferably has a Ser ⁇ Pro mutation at position 228, as depicted in SEQ ID NO: 50.
  • the invention is also directed to a method of stimulating an immune response in a subject, comprising administering to a subject in need thereof the antibody or antigen binding fragment thereof of the invention in an amount effective to stimulate the immune response.
  • the antibody molecule is administered in combination with an agonist of one or more costimulatory molecules for example one or more molecules selected from the group consisting of OX40, CD2, CD27, CDS, ICAM-1, LFA-1 (CDl la/CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD30, CD40, BAFFR, HVEM, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3 or CD83 ligand.
  • the antibody molecule is administered in combination with one or more inhibitors of an immune checkpoint molecule, for example one or more inhibitors selected from the group consisting of PD-1, PD-L1, PD-L2, TIM-3, LAG-3, CEACAM-1, CEACAM-5, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 or TGFR
  • one or more inhibitors of an immune checkpoint molecule for example one or more inhibitors selected from the group consisting of PD-1, PD-L1, PD-L2, TIM-3, LAG-3, CEACAM-1, CEACAM-5, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 or TGFR
  • the invention comprises a method of treating cancer wherein the cancer is selected from the group consisting of a lung cancer, a melanoma, a renal cancer, a liver cancer, a myeloma, a prostate cancer, a breast cancer, a colorectal cancer, a gastric cancer, a pancreatic cancer, a thyroid cancer, a hematological cancer, a lymphoma, a myeloma, or a leukemia, or a metastatic lesion of the cancer.
  • the cancer is selected from the group consisting of a lung cancer, a melanoma, a renal cancer, a liver cancer, a myeloma, a prostate cancer, a breast cancer, a colorectal cancer, a gastric cancer, a pancreatic cancer, a thyroid cancer, a hematological cancer, a lymphoma, a myeloma, or a leukemia, or a metastatic lesion of the cancer.
  • the invention also is directed to a method wherein the antibody molecule is administered in combination with one or more second therapeutic agents or procedures, for example wherein the second therapeutic agent or procedure is selected from the group consisting of chemotherapy, a targeted anti-cancer therapy, an oncolytic drug, a cytotoxic agent, an immune-based therapy, a cytokine, surgical procedure, a radiation procedure, an activator of a costimulatory molecule, an inhibitor of an inhibitory molecule, a vaccine, or a cellular immunotherapy.
  • the second therapeutic agent or procedure is selected from the group consisting of chemotherapy, a targeted anti-cancer therapy, an oncolytic drug, a cytotoxic agent, an immune-based therapy, a cytokine, surgical procedure, a radiation procedure, an activator of a costimulatory molecule, an inhibitor of an inhibitory molecule, a vaccine, or a cellular immunotherapy.
  • Figure 1 Functionality of hCTLA4.27A antibody in the Jurkat-based reporter assay.
  • Figure 2 Differential hCD80 blocking profile of hCTLA4.27 antibodies.
  • Figure 3 Induction of IL2 production by hCTLA4.27 antibodies in the PBMC SEB assay.
  • Figure 4A hCTLA4.27 and control antibodies: effector function in the ADCC assay.
  • Figure 4B hCTLA4.27 and control antibodies: effector function in the CDC assay.
  • Figure 5 Unique binding profile of hCTLA4.27A chimeric hIgG4 to
  • Figure 6 depicts epitope mapping results of hCTLA4.27A binding to rhCTLA- 4/Fc.
  • Crosslinked peptides detected by different proteolysis approaches are SEQ ID NO: 54- 57.
  • hCTLA-4 residues 46-76 are shown for reference.
  • ELISA Enzyme-linked immunosorbent FR Antibody framework region the immunoglobulin variable regions excluding the CDR regions.
  • V region The segment of IgG chains which is variable in sequence between different antibodies. It extends to Kabat residue 109 in the light chain and 113 in the heavy chain.
  • X10 L, V hCTLA4.27VHl GAGGTGCAGCTGCTGCAGTCTGGCGCTGTGCTGGCCAGACCTGGC (nucleotide sequence) ACCAGCGTGAAGATCAGCTGCAAGGCCAGCGGCTACAGCTTCACC
  • hCTLA4.27VH2 11 GAGGTGCAGCTGGTGCAGTCTGGCGCTGTGCTCGTGAAACCTGGC (nucleotide sequence) GCCTCCGTGAAGGTGTCCTGCAAGGCCAGCGGCTACAGCTTCACC
  • hCTLA4.27VH2 12 EVQLVQSGAVLVKPGASVKVSCKASGYSFTTYWMNWVRQRPGKGL (amino acid EWIGMIHPSDSETSLNQAFKDKVTITADESTSTAYMQLSSLRSED
  • hCTLA4.27VH3 13 GAGGTGCAGCTGGTGCAGTCTGGCGCCGTGGTGGCCAAGCCTGGC (nucleotide sequence) AGCAGCGTGAAGGTGTCCTGTAAAGCCAGCGGCTACAGCTTCACC
  • hCTLA4.27VH3 14 EVQLVQSGAVVAKPGSSVKVSCKASGYSFTTYWMNWVRQAPGQGL (amino acid EWMGMIHPSDSETSLNQAFKDRVTITADKSTSTAYMELSSLTSED
  • hCTLA4.27VH4 15 GAGGTGCAGCTGGTGCAGTCTGGCGCCGAAGTGAAGAAACCAGGC (nucleotide sequence) GCCAGCGTGAAGGTGTCCTGCAAGGCCAGCGGCTACAGCTTCACC
  • hCTLA4.27VH5 17 GAGGTGCAGCTGCTGCAGGCTGGCGCTGTGCTGGCTAGACCTGGC (nucleotide sequence) ACCAGCGTGAAGATCAGCTGCAAGGCCAGCGGCTACAGCTTCACC
  • hCTLA4.27VH6 19 GAGGTGCAGCTGCTGGAATCTGGCCCTGAACTCGTGCGGCCTGGC (nucleotide sequence) AGCAGCGTGAAGATCAGCTGTAAAGCCAGCGGCTACAGCTTCACC
  • hCTLA4.27VH6 20 EVQLLESGPELVRPGSSVKI SCKASGYSFTTYWMNWVKQRPGKGL (amino acid EWIGMIHPSDSETSLNQAFKDKVKLTAATSAS IAYLEFSSLRNED
  • hCTLA4.27VLl 21 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGTCTGCCAGCGTG (nucleotide sequence) GGCGACAGAGTGACCATCACCTGTCGGCCCAGCGAGAACCTGTAC
  • hCTLA4.27VL2 23 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGTCTGCCAGCGTG (nucleotide sequence) GGCGACAGAGTGACCATCACCTGTCGGCCCAGCGAGAACCTGTAC
  • hCTLA4.27VL3 25 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGTCTGCCAGCGTG (nucleotide sequence) GGCGATACCGTGACCATCACCTGTCGGCCCAGCGAGAACCTGTAC
  • hCTLA4.27VL4 27 GACATCCAGATGACCCAGAGCCCCAGCAGCCTGTCTGCCAGCGTG (nucleotide sequence) GGCGACAGAGTGACCATCACCTGTCGGCCCAGCGAGAACCTGTAC
  • hCTLA4.27VL5 29 GACATCCAGATGACCCAGGCCCCTAGCAGCCTGTCTGCCAGCGTG (nucleotide sequence) GGCGACAGAGTGACCATCACCTGTCGGCCCAGCGAGAACCTGTAC
  • hCTLA4.27VL5 30 DIQMTQAPSSLSASVGDRVTITCRPSENLYTNLAWYQQKPGKAPK (amino acid LLLYGATNLADGVPSRFSGSGSGTDYTLTI SSLQAEDFATYYCQH
  • hCTLA-4 NCBI PPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL Reference Sequence: LTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIP IN NM_005214.
  • hCTLA-4 cDNA 37 atggcttgccttggatttcagcggcacaaggctcagctgaacctg (Y166G and Y183G) gctaccaggacctggccctgcactctcctgttttttcttcttc atccctgtcttctgcaaagcaatgcacgtggcccagcctgctgtgtg (Nucleotide gtactggccagcagccgaggcatcgccagctttgtgtgtgtgagtat sequence) gcatctccaggcaaagccactgaggtccgggtgacagtgcttcgg caggctgacagccaggtgactgaagtctgtgcggcaacctacatg atggggaatgagttgacctcctagatgat
  • CTLA-4 human- 42 MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAV mouse chimeric VLASSRGIASFVCEYASPHNTDEVRVTVLRQTNDQMTEVCATTFT
  • CTLA-4 human- 44 MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCEAIQVTQPSV mouse chimeric VLASSHGVASFPCEYSPSGKATEVRVTVLRQADSQVTEVCAATYM
  • CTLA-4 46-76 VLASSRGIASFVCEYASPGKATEVRVTVLRQ
  • Treating means to administer a therapeutic agent, such as a composition containing any of the antibodies or antigen-binding fragments of the present invention, internally or externally to a subject or patient having one or more disease symptoms, or being suspected of having a disease, for which the agent has therapeutic activity.
  • the agent is administered in an amount effective to alleviate one or more disease symptoms in the treated subject or population, whether by inducing the regression of or inhibiting the progression of such symptom(s) by any clinically measurable degree.
  • the amount of a therapeutic agent that is effective to alleviate any particular disease symptom may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the drug to elicit a desired response in the subject. Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom.
  • the present invention includes anti-CTLA-4 antibodies and methods of use thereof.
  • antibody refers to any form of antibody that exhibits the desired biological activity. Thus, it is used in the broadest sense and specifically covers, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies comprising two light chains and two heavy chains), polyclonal antibodies, multispecific antibodies (e.g. , bispecific antibodies), humanized antibodies, fully human antibodies, chimeric antibodies and camelized single domain antibodies.
  • the present invention includes anti- CTLA-4 antigen-binding fragments and methods of use thereof.
  • antibody fragment or "antigen-binding fragment” refers to antigen -binding fragments of antibodies, i.e. antibody fragments that retain the ability to bind specifically to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions.
  • antigen-binding fragments include, but are not limited to, Fab, Fab', F(ab') 2 , and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules, e.g. , sc-Fv; nanobodies and multispecific antibodies formed from antibody fragments.
  • the present invention includes anti- CTLA-4 Fab fragments and methods of use thereof.
  • a "Fab fragment” is comprised of one light chain and the CRI and variable regions of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
  • An "Fab fragment” can be the product of papain cleavage of an antibody.
  • the present invention includes anti- CTLA-4 antibodies and antigen-binding fragments thereof which comprise an Fc region and methods of use thereof.
  • An "Fc" region contains two heavy chain fragments comprising the CR2 and CR3 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the CH3 domains.
  • the present invention includes anti- CTLA-4 Fab' fragments and methods of use thereof.
  • a "Fab' fragment” contains one light chain and a portion or fragment of one heavy chain that contains the V H domain and the C H 1 domain and also the region between the C R I and C R 2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab' fragments to form a F(ab') 2 molecule.
  • the present invention includes anti- CTLA-4 F(ab') 2 fragments and methods of use thereof.
  • a "F(ab') 2 fragment” contains two light chains and two heavy chains containing a portion of the constant region between the C H I and C R2 domains, such that an interchain disulfide bond is formed between the two heavy chains.
  • a F(ab') 2 fragment thus is composed of two Fab' fragments that are held together by a disulfide bond between the two heavy chains.
  • An "F(ab') 2 fragment” can be the product of pepsin cleavage of an antibody.
  • the present invention includes anti- CTLA-4 Fv fragments and methods of use thereof.
  • the "Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
  • the present invention includes anti- CTLA-4 scFv fragments and methods of use thereof.
  • the term "single-chain Fv” or “scFv” antibody refers to antibody fragments comprising the V H and V L domains of an antibody, wherein these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the scFv to form the desired structure for antigen-binding.
  • scFv see Pluckthun (1994) THE PHARMACOLOGY OF MONOCLONAL ANTIBODIES, vol. 113, Rosenburg and Moore eds. Springer- Verlag, New York, pp. 269-315. See also, International Patent Application Publication No. WO 88/01649 and U.S. Pat. Nos. 4,946, 778 and 5,260,203.
  • the present invention includes anti- CTLA-4 domain antibodies and methods of use thereof.
  • a "domain antibody” is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain.
  • two or more V H regions are covalently joined with a peptide linker to create a bivalent domain antibody.
  • the two V H regions of a bivalent domain antibody may target the same or different antigens.
  • the present invention includes anti-CTLA-4 bivalent antibodies and methods of use thereof.
  • a "bivalent antibody” comprises two antigen-binding sites. In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific (see below).
  • the present invention includes anti-CTLA-4 camelized single domain antibodies and methods of use thereof.
  • antibodies herein also include camelized single domain antibodies. See, e.g., Muyldermans et al. (2001) Trends Biochem. Sci. 26:230; Reichmann et al. (1999) J. Immunol. Methods 231:25; WO 94/04678; WO 94/25591; U.S. Pat. No. 6,005,079).
  • the present invention provides single domain antibodies comprising two V H domains with modifications such that single domain antibodies are formed.
  • the present invention includes anti-CTLA-4 diabodies and methods of use thereof.
  • diabodies refers to small antibody fragments with two antigen- binding sites, which fragments comprise a heavy chain variable domain (V H ) connected to a light chain variable domain (V L ) in the same polypeptide chain (V R -V L or V L -V R ).
  • V H heavy chain variable domain
  • V L light chain variable domain
  • V R -V L or V L -V R the same polypeptide chain
  • the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
  • Diabodies are described more fully in, e.g., EP 404,097; WO
  • an antibody or antigen-binding fragment of the invention which is modified in some way retains at least 10% of its binding activity (when compared to the parental antibody) when that activity is expressed on a molar basis.
  • an antibody or antigen-binding fragment of the invention retains at least 20%, 50%, 70%, 80%, 90%, 95% or 100% or more of the CTLA-4 binding affinity as the parental antibody.
  • an antibody or antigen-binding fragment of the invention can include conservative or non-conservative amino acid substitutions (referred to as "conservative variants" or "function conserved variants" of the antibody) that do not substantially alter its biologic activity.
  • the present invention includes isolated anti- CTLA-4 antibodies and antigen- binding fragments thereof and methods of use thereof.
  • isolated antibodies or antigen- binding fragments thereof are at least partially free of other biological molecules from the cells or cell cultures in which they are produced. Such biological molecules include nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium.
  • An isolated antibody or antigen-binding fragment may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof.
  • the term “isolated” is not intended to refer to a complete absence of such biological molecules or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the antibodies or fragments.
  • the present invention includes anti-CTLA-4 chimeric antibodies (e.g. , human constant domain/mouse variable domain) and methods of use thereof.
  • a "chimeric antibody” is an antibody having the variable domain from a first antibody and the constant domain from a second antibody, where the first and second antibodies are from different species.
  • variable domains are obtained from an antibody from an experimental animal (the "parental antibody”), such as a rodent, and the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g. , mouse) antibody.
  • parental antibody an antibody from an experimental animal
  • the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g. , mouse) antibody.
  • the present invention includes anti-CTLA-4 humanized antibodies and antigen- binding fragments thereof (e.g. , rat or mouse antibodies that have been humanized) and methods of use thereof.
  • the invention includes any humanized version of the hCTLA4.27A antibody as shown in the Examples.
  • 27 antibody and hCTLA4.27 are used interchangeably to refer to an antibody comprising the VH region of SEQ ID NO: 7 and the VL region of SEQ ID NO: 8 more preferably, the VH region of any of SEQ ID NO: 10, 12, 14, 16, 18 or 20 and the VL region of any of SEQ ID NO: 22, 24, 26 or 30.
  • humanized antibody refers to forms of antibodies that contain sequences from both human and non-human (e.g. , mouse or rat) antibodies.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence.
  • the humanized antibody may optionally comprise at least a portion of a human immunoglobulin constant region (Fc).
  • the basic antibody structural unit comprises a tetramer.
  • Each tetramer includes two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy” chain (about 50-70 kDa).
  • the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
  • the carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function.
  • human light chains are classified as kappa and lambda light chains.
  • human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids.
  • variable regions of each light/heavy chain pair form the antibody binding site.
  • an intact antibody has two binding sites.
  • the two binding sites are, in general, the same.
  • variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), located within relatively conserved framework regions (FR).
  • CDRs complementarity determining regions
  • FR framework regions
  • the CDRs are usually aligned by the framework regions, enabling binding to a specific epitope.
  • both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • the assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md. ; 5 th ed.; NIH Publ. No.
  • hypervariable region refers to the amino acid residues of an antibody or antigen -binding fragment thereof that are responsible for antigen -binding.
  • the hypervariable region comprises amino acid residues from a "complementarity
  • CDR determining region
  • isolated nucleic acid molecule or isolated polynucleotide means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature.
  • a nucleic acid molecule comprising a particular nucleotide sequence does not encompass intact chromosomes.
  • Isolated nucleic acid molecules "comprising" specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty or more other proteins or portions or fragments thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.
  • control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
  • the control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
  • Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.
  • a nucleic acid or polynucleotide is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is
  • the expressions "cell,” “cell line,” and “cell culture” are used interchangeably and all such designations include progeny.
  • the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that not all progeny will have precisely identical DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
  • germline sequence refers to a sequence of unrearranged immunoglobulin DNA sequences. Any suitable source of unrearranged immunoglobulin sequences may be used.
  • Human germline sequences may be obtained, for example, from JOINSOLVER germline databases on the website for the National Institute of Arthritis and Musculoskeletal and Skin Diseases of the United States National Institutes of Health.
  • Mouse germline sequences may be obtained, for example, as described in Giudicelli et al. (2005) Nucleic Acids Res. 33:D256-D261.
  • the antibodies of the present invention may comprise any combination of the heavy and light chains as defined in the present application and which are presented in SEQ ID NO: 7 and 8 and more preferably the heavy chains as presented in SEQ ID NO: 10, 12, 14, 16, 18 or 20 and the light chain as presented in SEQ ID NO: 22, 24, 26 and 30.
  • An antibody with a heavy chain of SEQ ID NO: 20 and a light chain of SEQ ID NO: 30 An antibody with a heavy chain of SEQ ID NO: 20 and a light chain of SEQ ID NO: 30.
  • the present invention provides anti-CTLA-4 antibodies and antigen-binding fragments thereof having specified structural and functional features, and methods of use of the antibodies or antigen-binding fragments thereof in the treatment or prevention of disease (e.g., cancer or infectious disease).
  • disease e.g., cancer or infectious disease.
  • This antibody and the humanize antibodies derived therefrom are characterized because they bind to human CTLA-4 (hCTLA-4) with an EC50 of less than 20 nM, preferably less than 1 nM and they are able to block the binding of hCTLA-4 to hCD80 or hCD86 with an IC50 of less than 100 nM, preferably less than 10 nM for hCD80 blocking and preferably less than 10 nM, more preferably less than 2.5nM for hCD86 blocking.
  • the hCD80 blocking profile of the antibodies of the present invention lies in between the hCD80 blocking profiles of 10D1 (ipilimumab) and CP-675,206 (tremelimumab) (see Fig. 2). It differs from ipilimumab and tremelimumab because it binds to a different epitope on the CTLA-4 molecule.
  • the antibody or antigen binding fragment of the invention does not bind to the chimeric mouse-human CTLA4 molecule of which the sequence is provided in SEQ ID NO: 44 (see also Fig. 5), while 10D1 and CP-675,206 do bind
  • HDX Hydrogen Deuterium Exchange
  • proteolysis and mass spectrometry can be used to determine the epitope of an antibody on a specific antigen Y.
  • HDX-MS relies on the accurate measurement and comparison of the degree of deuterium incorporation by an antigen when incubated in D 2 0 on its own and in presence of its antibody at various time intervals. Deuterium is exchanged with hydrogen on the amide backbone of the proteins in exposed areas whereas regions of the antigen bound to the antibody will be protected and will show less or no exchange after analysis by LC-MS/MS of proteolytic fragments.
  • the invention also comprises anti-CTLA-4 antibodies which bind to an epitope of human CTLA-4 but which do not bind to the mouse-human chimera CTLA-4 molecule of SEQ ID NO: 44.
  • the invention provides antibodies or antigen-binding fragment thereof that bind human CTLA-4 (e.g. , humanized antibodies) and has VL domains and V H domains with at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with the amino acid sequences of SEQ ID NOs: 7-30, preferably with at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with SEQ ID NOs: 10, 12, 14, 16, 18, 20, 22, 24, 26 or 30; wherein the variant exhibits the desired binding and properties, being the ability to bind to CTLA-4 and the ability to block CTLA-4 binding to CD80 and/or CD86.
  • human CTLA-4 e.g. , humanized antibodies
  • VL domains and V H domains with at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with the amino acid sequences of SEQ ID NOs: 7-30, preferably with at least 80%, 85%, 90%
  • the invention provides antibodies or antigen-binding fragment thereof that bind human CTLA-4 (e.g. , humanized antibodies) and have V L domains and V H domains with at least 95% sequence identity with the amino acid sequences of SEQ ID NOs: 7-30, preferably with at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with SEQ ID NOs: 10, 12, 14, 16, 18, 20, 22, 24, 26 or 30.
  • the invention provides antibodies or antigen-binding fragment thereof that bind human CTLA-4 (e.g.
  • humanized antibodies and have V L domains and V H domains with at least 97% sequence identity with the amino acid sequences of SEQ ID NOs: 7-30, preferably with at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with SEQ ID NOs: 10, 12, 14, 16, 18, 20, 22, 24, 26 or 30.
  • the invention provides antibodies or antigen-binding fragment thereof that bind human CTLA-4 (e.g.
  • humanized antibodies and have VL domains and VH domains with at least 99% sequence identity with the amino acid sequences of SEQ ID NOs: 7-30, preferably with at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with SEQ ID NOs: 10, 12, 14, 16, 18, 20, 22, 24, 26 or 30.
  • Constantly modified variants or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity of the protein.
  • Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g. , Watson et al. (1987) Molecular Biology of the Gene, The
  • Function-conservative variants of the antibodies of the invention are also contemplated by the present invention.
  • “Function-conservative variants,” as used herein, refers to antibodies or fragments in which one or more amino acid residues have been changed without altering a desired property, such an antigen affinity and/or specificity. Such variants include, but are not limited to, replacement of an amino acid with one having similar properties, such as the conservative amino acid substitutions of Table 2.
  • isolated polypeptides comprising the VL domains of the anti-CTLA-4 antibodies of the invention e.g. , SEQ ID NOs: 22, 24, 26, 30
  • isolated polypeptides comprising the VH domains of the anti- CTLA-4 antibodies of the invention e.g. , SEQ ID NOs: 10, 12, 14, 16, 18, 20 having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid substitutions.
  • an antibody or antigen-binding fragment thereof that binds human CTLA-4 and has VL domains and VH domains with at least 99% 98%, 97%, 96%, 95%, 90%, 85%, 80% or 75% sequence identity to one or more of the V L domains or V H domains described herein, and exhibits specific binding to CTLA-4.
  • the binding antibody or antigen-binding fragment thereof of the present invention comprises VL and VH domains (with and without signal sequence) having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more amino acid substitutions, and exhibits specific binding to CTLA-4.
  • the present invention further comprises the polynucleotides encoding any of the polypeptides or immunoglobulin chains of anti-CTLA-4 antibodies and antigen-binding fragments thereof of the invention.
  • the present invention includes the polynucleotides encoding the amino acids described in any one of SEQ ID NOs: 1-30.
  • an isolated polynucleotide for example DNA, encoding the polypeptide chains of the isolated antibodies or antigen-binding fragments set forth herein is provided.
  • the isolated polynucleotide encodes an antibody or antigen- binding fragment thereof comprising at least one mature immunoglobulin light chain variable (VL) domain according to the invention and/or at least one mature immunoglobulin heavy chain variable (VH) domain according to the invention.
  • VL immunoglobulin light chain variable
  • VH immunoglobulin heavy chain variable
  • the isolated polynucleotide encodes both a light chain and a heavy chain on a single polynucleotide molecule, and in other embodiments the light and heavy chains are encoded on separate polynucleotide molecules.
  • the polynucleotides further encodes a signal sequence.
  • the invention comprises an isolated polynucleotide encoding an antibody heavy variable (V H ) domain or an antigen-binding fragment thereof comprising HCDR-1 (SEQ ID NO: 1), HCDR-2 (SEQ ID NO: 2) and HCDR-3 (SEQ ID NO: 3).
  • the invention comprises an isolated polynucleotide encoding an antibody light chain variable (V L ) domain or an antigen-binding fragment thereof comprising LCDR-1 (SEQ ID NO: 4), LCDR-2 (SEQ ID NO: 5) and LCDR-3 (SEQ ID NO: 6).
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V H ) domain of SEQ ID NO: 7.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin light chain variable (VL) domain of SEQ ID NO: 8.
  • the invention comprises an isolated polynucleotide according to any of SEQ ID NO: 9, 11, 13, 15, 17 or 19 encoding a humanized heavy chain
  • the invention comprises an isolated polynucleotide according to any of SEQ ID NO: 21, 23, 25 or 29 encoding a humanized light chain.
  • an isolated polynucleotide is comprised which comprises an isolated polynucleotide according to any of SEQ ID NO: 9, 11, 13, 15, 17 or 19 encoding a humanized heavy chain and an isolated polynucleotide according to any of SEQ ID NO: 21, 23, 25 or 29 encoding a humanized light chain. All possible combinations of these are included.
  • the invention comprises a polynucleotide comprising SEQ ID NO: 9 and SEQ ID NO: 21, a polynucleotide comprising SEQ ID NO: 11 and SEQ ID NO: 21, a polynucleotide comprising SEQ ID NO: 13 and SEQ ID NO: 21, a polynucleotide comprising SEQ ID NO: 15 and SEQ ID NO: 21, a polynucleotide comprising SEQ ID NO: 17 and SEQ ID NO: 21, a polynucleotide comprising SEQ ID NO: 19 and SEQ ID NO: 21, a polynucleotide comprising SEQ ID NO: 9 and SEQ ID NO: 23.
  • a polynucleotide comprising SEQ ID NO: 11 and SEQ ID NO: 23 a polynucleotide comprising SEQ ID NO: 13 and SEQ ID NO: 23, a polynucleotide comprising SEQ ID NO: 15 and SEQ ID NO: 23, a
  • polynucleotide comprising SEQ ID NO: 9 and SEQ ID NO: 29, a polynucleotide comprising SEQ ID NO: 11 and SEQ ID NO: 29, a polynucleotide comprising SEQ ID NO: 13 and SEQ ID NO: 29, a polynucleotide comprising SEQ ID NO: 15 and SEQ ID NO: 29, a
  • polynucleotide comprising SEQ ID NO: 17 and SEQ ID NO: 29, and/or a polynucleotide comprising SEQ ID NO: 19 and SEQ ID NO: 29.
  • This present invention also provides vectors, e.g. , expression vectors, such as plasmids, comprising the isolated polynucleotides of the invention, wherein the
  • polynucleotide is operably linked to control sequences that are recognized by a host cell when the host cell is transfected with the vector.
  • host cells comprising a vector of the present invention and methods for producing the antibody or antigen-binding fragment thereof or polypeptide disclosed herein comprising culturing a host cell harboring an expression vector or a nucleic acid encoding the immunoglobulin chains of the antibody or antigen-binding fragment thereof in culture medium, and isolating the antigen or antigen- binding fragment thereof from the host cell or culture medium.
  • polypeptides e.g., immunoglobulin polypeptides, comprising amino acid sequences that are at least about 75% identical, 80% identical, more preferably at least about 90% identical and most preferably at least about 95% identical (e.g., 95%, 96%, 97%, 98%, 99%, 100%) to the amino acid sequences of the antibodies provided herein when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g. expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1 ; conditional compositional score matrix adjustment).
  • BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g. expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence
  • Sequence identity refers to the degree to which the amino acids of two
  • polypeptides are the same at equivalent positions when the two sequences are optimally aligned.
  • BLAST ALGORITHMS Altschul et al. (2005) FEBS J. 272(20): 5101-5109; Altschul, S.F., et al, (1990) J. Mol. Biol. 215:403-410; Gish, W., et al, (1993) Nature Genet. 3:266-272; Madden, T.L., et al, (1996) Meth. Enzymol. 266: 131-141; Altschul, S.F., et al, (1997) Nucleic Acids Res. 25:3389-3402; Zhang, J., et al, (1997) Genome Res.
  • the antibodies and antigen-binding fragments disclosed herein may bind human CTLA-4 (NCBI Accession No. NM_005214.4) comprising the following amino acid sequence: (SEQ ID NO: 36):
  • MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLR QADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIY VIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIP IN
  • K D value of at least about 1 x 10 "9 M (i.e, a K D value of 1 x 10 "9 M or lower) as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the antibodies or antigen binding fragments of the invention increase the activity of an immune cell.
  • the increase of the activity of an immune cell can be detected using any method known in the art.
  • the increase in activity of an immune cell can be detected by measuring the proliferation of the immune cell.
  • an increase in activity of a T cell can be detected by measuring the proliferation of the T cell or signal transduction events such as tyrosine phosphorylation of immune receptors or downstream kinases that transmit signals to transcriptional regulators.
  • the increase in activity of an immune cell can be detected by measuring CTL or NK cell cytotoxic function on specific target cells or IFNy cytokine responses, which are associated with stimulation of anti-tumor immunity.
  • the increase in activity of an immune cell can be detected by measuring T cell activation ex vivo in a sample derived from the subject.
  • the increase in T cell activity is determined by: (i) measuring SEB (Staphylococcus Enterotoxin B) induced production of one or more pro-inflammatory cytokines selected from the group consisting of: IL-2, TNFa, IL-17, ⁇ , IL- ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL-13 or upregulation of membrane activation markers from a group consisting of: CD25 and CD69 or induction of proliferation using detection of blast formation by flow cytometry or 3H-incorportationor (ii) measuring mixed lymphocyte reactions or direct anti-CD3 mAb stimulation of T cell receptor (TCR) signaling to induce production of a cytokine selected from the group consisting of: IL- 2, TNFa, IL-17, IFNy, IL- ⁇ , GM-
  • TCR T cell receptor
  • the anti-CTLA-4 antibody or antigen binding fragment thereof of the present invention will stimulate CD3+ T cells, when these are presented to Raji cells expressing CD80 and CD86, to produce pro-inflammatory cytokines selected from the group consisting of: IL-2, TNFa, IL-17, IFNy, IL- ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL- 13 or upregulation of membrane activation markers from a group consisting of: CD25 and CD69 or induction of proliferation using detection of blast formation by flow cytometry or 3H-incorportation.
  • pro-inflammatory cytokines selected from the group consisting of: IL-2, TNFa, IL-17, IFNy, IL- ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL- 13
  • upregulation of membrane activation markers from a group consisting of: CD25 and CD69 or induction of proliferation using detection of blast formation by flow cytometry or 3H
  • the anti- CTLA4 antibody or antigen binding fragment thereof of the present invention will stimulate production of IL-2 and/or IFNy by activated T cells by at least 1.5 fold.
  • the T-cell activating characteristics of the antibodies of the present invention is about equal to the T-cell stimulating characteristics of the known prior art anti-hCTLA4 antibodies ipilimumab and tremelimumab.
  • the anti-CTLA-4 antibodies or antigen binding fragments of the invention can deplete CTLA-4+ regulatory T cells.
  • the ability of the antibodies to exert such an effector function can be determined using any method known in the art.
  • the ability of the antibodies to induce Antibody-Dependent Cell-mediated Cytoxicity is determined using natural killer cells as effector cells and a cell line that stably expresses human CTLA-4.
  • the hCTLA-4 antibodies with a human IgGl Fc portion are able to induce ADCC on CTLA-4+ cells.
  • the ability of the antibodies to induce Complement- Dependent Cytoxicity is determined using human complement and a cell line that stably expresses human CTLA-4. As shown in the experimental section, the hCTLA-4 antibodies with a human IgGl Fc portion are able to induce CDC on CTLA-4+ cells.
  • the ability of the antibodies to induce cell-mediated lysis can be determined using Nonclassical CD14+CD16++ Monocytes that induce FcyRIIIA- Dependent Lysis of CTLA-4+ Tregs in the context of an hlgGl CTLA-4 antibody such as ipilimumab (Romano et al; PNAS; 2015; 6140-6145; doi: 10.1073/pnas.1417320112)
  • the anti-CTLA-4 antibodies or antigen binding fragments of the invention are able to block binding of human CTLA-4 to human CD 80 and/or human CD86.
  • the ability to block binding of human CTLA-4 to human CD80 and/or human CD86 can be determined using any method known in the art.
  • the ability of the antibodies to block binding of human CTLA-4 to human CD80 and/or human CD86 is determined using an ELISA assay.
  • the potency of blocking of CTLA-4 binding to human CD80 and/or human CD86 resembles the activities of the known anti- CTLA-4 antibodies ipilimumab and tremelimumab. It should be highlighted that the anti- CTLA-4 antibodies of the invention showed an intermediary efficacy in between the effects of ipilimumab and tremelimumab with respect to blocking of hCD80 (see Figure 2).
  • the present invention includes methods for making an anti-CTLA-4 antibody or antigen-binding fragment thereof of the present invention comprising culturing a hybridoma cell that expresses the antibody or fragment under condition favorable to such expression and, optionally, isolating the antibody or fragment from the hybridoma and/or the growth medium (e.g. cell culture medium).
  • the growth medium e.g. cell culture medium
  • Monoclonal antibodies derived from animals other than rats and mice offer unique advantages. Many protein targets relevant to signal transduction and disease are highly conserved between mice, rats and humans, and can therefore be recognized as self-antigens by a mouse or rat host, making them less immunogenic. This problem may be avoided when using rabbit as a host animal. See, e.g., Rossi et al., Am. J. Clin. Pathol., 124, 295-302, 2005.
  • mice can be immunized with an antigen of interest or a cell expressing such an antigen. Once an immune response is detected, e.g., antibodies specific for the antigen are detected in the mouse serum, the mouse spleen is harvested and splenocytes isolated. B-cells were cultured, as described by Steenbakkers et al, 1994, Mol. Biol. Rep. 19: 125-134.
  • B-cell clones from reactive supernatants are then immortalized, e.g. by mini- electrofusion following published procedures (Steenbakkers et al., 1992, J. Immunol. Meth. 152: 69-77; Steenbakkers et al., 1994, Mol. Biol. Rep. 19:125-34).
  • Hybridomas are selected and cloned by limiting dilution.
  • hybridoma clones are then assayed by methods known in the art for cells that secrete antibodies capable of binding the antigen.
  • Ascites fluid which generally contains high levels of antibodies, can be generated by inoculating mice intraperitoneally with positive hybridoma clones.
  • Adjuvants that can be used in the methods of antibody generation include, but are not limited to, protein adjuvants; bacterial adjuvants, e.g., whole bacteria (BCG,
  • adjuvants e.g., aluminum hydroxide, iodoacetate and cholesteryl hemisuccinateor; naked DNA adjuvants.
  • Other adjuvants that can be used in the methods of the invention include, Cholera toxin, paropox proteins, MF-59 (Chiron Corporation; See also Bieg et al. (1999) "GAD65 And Insulin B Chain Peptide (9-23) Are Not Primary Autoantigens In The Type 1 Diabetes Syndrome Of The BB Rat," Autoimmunity, 31(1): 15-24, which is incorporated herein by reference), MPL® (Corixa Corporation; See also Lodmell et al.
  • MPL Monophosphoryl Lipid A
  • RC-529 adjuvant Corixa Corporation; the lead compound from Corixa's aminoalkyl glucosaminide 4- phosphate (AGP) chemical library, see also www.corixa.com
  • DETOXTM adjuvant Corixa Corporation; DETOXTM adjuvant includes MPL® adjuvant (monophosphoryl lipid A) and mycobacterial cell wall skeleton; See also Eton et al.
  • phage display technology to produce and screen libraries of polypeptides for binding to a selected analyte. See, e.g, Cwirla et al., Proc. Natl. Acad. Sci. USA 87, 6378-82, 1990; Devlin et al., Science 249, 404-6, 1990, Scott and Smith, Science 249, 386-88, 1990; and Ladner et al., U.S. Pat. No. 5,571,698.
  • a basic concept of phage display methods is the establishment of a physical association between DNA encoding a polypeptide to be screened and the polypeptide.
  • This physical association is provided by the phage particle, which displays a polypeptide as part of a capsid enclosing the phage genome which encodes the polypeptide.
  • the establishment of a physical association between polypeptides and their genetic material allows simultaneous mass screening of very large numbers of phage bearing different polypeptides.
  • Phages displaying a polypeptide with affinity to a target bind to the target and these phages are enriched by affinity screening to the target.
  • the identity of polypeptides displayed from these phages can be determined from their respective genomes.
  • a polypeptide identified as having a binding affinity for a desired target can then be synthesized in bulk by conventional means. See, e.g., U.S. Patent No.
  • the antibodies that are generated by these methods may then be selected by first screening for affinity and specificity with the purified polypeptide of interest and, if required, comparing the results to the affinity and specificity of the antibodies with polypeptides that are desired to be excluded from binding.
  • the screening procedure can involve immobilization of the purified polypeptides in separate wells of microtiter plates. The solution containing a potential antibody or groups of antibodies is then placed into the respective microtiter wells and incubated for about 30 min to 2 h.
  • microtiter wells are then washed and a labeled secondary antibody (for example, an anti-mouse antibody conjugated to alkaline phosphatase if the raised antibodies are mouse antibodies) is added to the wells and incubated for about 30 min and then washed. Substrate is added to the wells and a color reaction will appear where antibody to the immobilized polypeptide(s) are present.
  • a labeled secondary antibody for example, an anti-mouse antibody conjugated to alkaline phosphatase if the raised antibodies are mouse antibodies
  • the antibodies so identified may then be further analyzed for affinity and specificity in the assay design selected.
  • the purified target protein acts as a standard with which to judge the sensitivity and specificity of the immunoassay using the antibodies that have been selected. Because the binding affinity of various antibodies may differ; certain antibody pairs (e.g., in sandwich assays) may interfere with one another sterically, etc., assay performance of an antibody may be a more important measure than absolute affinity and specificity of an antibody.
  • Antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes.
  • the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells.
  • the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes.
  • the mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the JH region prevents endogenous antibody production.
  • the modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice.
  • the chimeric mice are then bred to produce homozygous offspring which express human antibodies.
  • the transgenic mice are immunized using conventional methodologies with a selected antigen, e.g., all or a portion of a polypeptide of the invention.
  • Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology.
  • the human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation.
  • Abgenix/Amgen(Freemont, Calif.) and Medarex/BMS (Princeton, N.J.), Kymab (Cambridge, UK) and Merus (Utrecht, Netherlands) can be engaged to provide human antibodies directed against a selected antigen using technology similar to that described above.
  • the anti-CTLA-4 antibodies disclosed herein may also be produced recombinantly (e.g., in an E. coliill expression system, a mammalian cell expression system or a lower eukaryote expression system).
  • nucleic acids encoding the antibody immunoglobulin molecules of the invention e.g., V H or V L
  • V H or V L may be inserted into a pET -based plasmid and expressed in the E. coliill system.
  • the present invention includes methods for expressing an antibody or antigen-binding fragment thereof or immunoglobulin chain thereof in a host cell (e.g., bacterial host cell such as E.coli such as BL21 or BL21DE3) comprising expressing T7 RNA polymerase in the cell which also includes a polynucleotide encoding an immunoglobulin chain that is operably linked to a T7 promoter.
  • a host cell e.g., bacterial host cell such as E.coli such as BL21 or BL21DE3
  • a bacterial host cell such as a E. coli, includes a
  • polynucleotide encoding the T7 RNA polymerase gene operably linked to a lac promoter and expression of the polymerase and the chain is induced by incubation of the host cell with IPTG (isopropyl-beta-D-thiogalactopyranoside).
  • Monoclonal antibody preparations can be produced using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
  • monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow et al., ANTIBODIES: A LABORATORY MANUAL, (Cold Spring Harbor
  • the term "monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology.
  • the term “monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
  • One example of a method for recombinant production of antibodies is disclosed in U.S. Patent No. 4,816,567.
  • the present invention includes recombinant methods for making an anti- CTLA-4 antibody or antigen-binding fragment thereof of the present invention, or an immunoglobulin chain thereof, comprising introducing a polynucleotide encoding one or more immunoglobulin chains of the antibody or fragment (e.g., heavy and/or light immunoglobulin chain); culturing the host cell (e.g., CHO or Pichia or Pichia pastoris) under condition favorable to such expression and, optionally, isolating the antibody or fragment or chain from the host cell and/or medium in which the host cell is grown.
  • a polynucleotide encoding one or more immunoglobulin chains of the antibody or fragment (e.g., heavy and/or light immunoglobulin chain)
  • the host cell e.g., CHO or Pichia or Pichia pastoris
  • Anti-CTLA-4 antibodies can also be synthesized by any of the methods set forth in U.S. Patent No. 6,331,415.
  • Eukaryotic and prokaryotic host cells including mammalian cells as hosts for expression of the antibodies or fragments or immunoglobulin chains disclosed herein are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines.
  • Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells.
  • Cell lines of particular preference are selected through determining which cell lines have high expression levels.
  • Other cell lines that may be used are insect cell lines, such as Sf9 cells, amphibian cells, bacterial cells, plant cells and fungal cells.
  • Fungal cells include yeast and filamentous fungus cells including, for example, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces
  • Pichia sp. any Saccharomyces sp., Hansenula polymorpha, any Kluyveromyces sp., Candida albicans, any Aspergillus sp., Trichoderma reesei,
  • the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody or fragment or chain in the host cells or secretion of the into the culture medium in which the host cells are grown.
  • host-expression vector systems may be utilized to express the antibodies of the invention.
  • Such host-expression systems represent vehicles by which the coding sequences of the antibodies may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express the antibodies of the invention in situ.
  • These include, but are not limited to, microorganisms such as bacteria (e.g., E. coli and B.
  • subtilis transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing immunoglobulin coding sequences; yeast (e.g., Saccharomyces, Pichia) transformed with recombinant yeast expression vectors containing immunoglobulin coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing the immunoglobulin coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus (CaMV) and tobacco mosaic virus (TMV)) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing immunoglobulin coding sequences; or mammalian cell systems (e.g., COS, CHO, BHK, 293, 293T, 3T3 cells, lymphotic cells (see U.S.
  • mammalian cell systems e.g., COS
  • Per C.6 cells rat retinal cells developed by Crucell harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the vaccinia virus 7.5K promoter).
  • mammalian cells e.g., metallothionein promoter
  • mammalian viruses e.g., the adenovirus late promoter; the vaccinia virus 7.5K promoter.
  • a number of expression vectors may be advantageously selected depending upon the use intended for the antibody being expressed. For example, when a large quantity of such a protein is to be produced, for the generation of pharmaceutical compositions of an antibody, vectors which direct the expression of high levels of fusion protein products that are readily purified may be desirable.
  • vectors include, but are not limited, to the E. coli expression vector pUR278 (Ruther et al. (1983) "Easy Identification Of cDNA Clones," EMBO J.
  • pGEX vectors may also be used to express foreign polypeptides as fusion proteins with glutathione S-transferase (GST).
  • fusion proteins are soluble and can easily be purified from lysed cells by adsorption and binding to a matrix glutathione- agarose beads followed by elution in the presence of free gluta-thione.
  • the pGEX vectors are designed to include thrombin or factor Xa protease cleavage sites so that the cloned target gene product can be released from the GST moiety.
  • Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes.
  • the virus grows in Spodoptera frugiperda cells.
  • the antibody coding sequence may be cloned individually into non-essential regions (e.g., the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (e.g., the polyhedrin promoter).
  • a number of viral-based expression systems may be utilized.
  • the antibody coding sequence of interest may be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence.
  • This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non-essential region of the viral genome (e.g., region El or E3) will result in a recombinant virus that is viable and capable of expressing the immunoglobulin molecule in infected hosts, (see e.g., see Logan et al.
  • a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function of the protein.
  • Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed.
  • eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used.
  • Such mammalian host cells include but are not limited to CHO, VERY, BHK, Hela, COS, MDCK, 293, 293T, 3T3, WI38, BT483, Hs578T, HTB2, BT20 and T47D, CRL7030 and Hs578Bst.
  • cell lines which stably express an antibody of the invention may be engineered.
  • host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
  • appropriate expression control elements e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.
  • engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media.
  • the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines.
  • This method may advantageously be used to engineer cell lines which express the antibodies of the invention. Such engineered cell lines may be particularly useful in screening and evaluation of compounds that interact directly or indirectly with the antibodies of the invention.
  • a number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase (Wigler et al. (1977) "Transfer Of Purified Herpes Virus Thymidine Kinase Gene To Cultured Mouse Cells," Cell 11:223-232), hypoxanthine- guanine phosphoribosyltransferase (Szybalska et al. (1962) "Genetics Of Human Cess Line. rV. DNA-Mediated Heritable Transformation Of A Biochemical Trait," Proc. Natl. Acad. Sci. (U.S.A.) 48:2026-2034), and adenine phosphoribosyltransferase (Lowy et al. (1980)
  • the expression levels of an antibody of the invention can be increased by vector amplification (for a review, see Bebbington and Hentschel, "The Use Of Vectors Based On Gene Amplification For The Expression Of Cloned Genes In Mammaian Cells," in DNA CLONING, Vol. 3. (Academic Press, New York, 1987)).
  • vector amplification for a review, see Bebbington and Hentschel, "The Use Of Vectors Based On Gene Amplification For The Expression Of Cloned Genes In Mammaian Cells," in DNA CLONING, Vol. 3. (Academic Press, New York, 1987)
  • increase in the level of inhibitor present in culture of host cell will increase the number of copies of the marker gene. Since the amplified region is associated with the nucleotide sequence of the antibody, production of the antibody will also increase (Crouse et al. (1983) "Expression And Amplification Of Engineered Mouse
  • the host cell may be co-transfected with two expression vectors of the invention, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide.
  • the two vectors may contain identical selectable markers which enable equal expression of heavy and light chain polypeptides.
  • a single vector may be used which encodes both heavy and light chain polypeptides.
  • the light chain should be placed before the heavy chain to avoid an excess of toxic free heavy chain (Proudfoot (1986) "Expression And Amplification Of Engineered Mouse Dihydrofolate Reductase Minigenes," Nature 322:562-565; Kohler (1980) "Immunoglobulin Chain Loss In Hybridoma Lines," Proc. Natl. Acad. Sci. (U.S.A.) 77:2197-2199).
  • the coding sequences for the heavy and light chains may comprise cDNA or genomic DNA.
  • Antibodies and antigen-binding fragments thereof and immunoglobulin chains can be recovered from the culture medium using standard protein purification methods. Further, expression of antibodies and antigen-binding fragments thereof and immunoglobulin chains of the invention (or other moieties therefrom) from production cell lines can be enhanced using a number of known techniques. For example, the glutamine synthetase gene expression system (the GS system) is a common approach for enhancing expression under certain conditions. The GS system is discussed in whole or part in connection with European Patent Nos. 0 216 846, 0 256 055, and 0 323 997 and European Patent Application No. 89303964.4.
  • the mammalian host cells e.g., CHO
  • the polynucleotide encoding the immunoglobulin chain comprises a glutamine synthetase gene which complements the lack of the gene in the host cell.
  • the present invention includes methods for purifying an anti-CTLA-4 antibody or antigen-binding fragment thereof of the present invention comprising introducing a sample comprising the antibody or fragment to a purification medium (e.g., cation exchange medium, anion exchange medium, hydrophobic exchange medium, affinity purification medium (e.g. , protein-A, protein-G, protein- A/G, protein-L)) and either collecting purified antibody or fragment from the flow-through fraction of said sample that does not bind to the medium; or, discarding the flow-through fraction and eluting bound antibody or fragment from the medium and collecting the eluate.
  • a purification medium e.g., cation exchange medium, anion exchange medium, hydrophobic exchange medium, affinity purification medium (e.g. , protein-A, protein-G, protein- A/G, protein-L)
  • the medium is in a column to which the sample is applied.
  • the purification method is conducted following recombinant expression of the antibody or fragment in a host cell, e.g., wherein the host cell is first lysed and, optionally, the lysate is purified of insoluble materials prior to purification on a medium.
  • glycoproteins produced in a particular cell line or transgenic animal will have a glycosylation pattern that is characteristic for glycoproteins produced in the cell line or transgenic animal. Therefore, the particular glycosylation pattern of an antibody will depend on the particular cell line or transgenic animal used to produce the antibody.
  • antibodies encoded by the nucleic acid molecules provided herein, or comprising the amino acid sequences provided herein comprise the instant invention, independent of the glycosylation pattern the antibodies may have.
  • antibodies with a glycosylation pattern comprising only non-fucosylated N- glycans may be advantageous, because these antibodies have been shown to typically exhibit more potent efficacy than their fucosylated counterparts both in vitro and in vivo (See for example, Shinkawa et ah, J. Biol. Chem. 278: 3466-3473 (2003); U.S. Patent Nos. 6,946,292 and 7,214,775).
  • These antibodies with non-fucosylated N-glycans are not likely to be immunogenic because their carbohydrate structures are a normal component of the population that exists in human serum IgG.
  • the present invention includes bispecific and bifunctional antibodies and antigen- binding fragments having a binding specificity for CTLA-4 and another antigen such as, for example and antigen that plays a role in immune stimulation, such as, PD-1, PD-L1, TSLP, IL-10, 4-IBB, SIRP-alpha, ICOS, NKG2C, NKG2A, KR2DL and KIR3DL antigens, OX40, CD40, ITL-1 to ITL-8, GITR, CD137, CS 1, CD27, APRIL, or LAG-3, or antigens that play a role in targeting to and recognition of cancer cells, such as EGFR (ERBB l), HER2 (ERBB2), ERBB3, CD19, CD20, CD30, CD33, CD52, CEA, alpha-fetoprotein, CC49, VEGF.
  • another antigen such as, for example and antigen that plays a role in immune stimulation, such as, PD-1, PD-L1, TSLP
  • the anti-CTLA-4 chains comprise any one of the VH/VL sequences provided in SEQ ID NOs: 7-30 (or an antigen binding fragment of any of said sequences, such as provided in SEQ ID NOs: 1-6).
  • a bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites. Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments.
  • bispecific antibodies may be formed as "diabodies” (Holliger, et al, (1993) PNAS USA 90:6444-6448) or as "Janusins” (Traunecker, et al., (1991) EMBO J. 10:3655-3659 and Traunecker, et al, (1992) Int. J. Cancer Suppl. 7:51-52).
  • bispecific antibodies may be formed as "Duobodies” (Labrijn et al, PNAS
  • the present invention further includes anti-CTLA-4 antigen -binding fragments of the anti-CTLA-4 antibodies disclosed herein.
  • the antibody fragments include F(ab) 2 fragments, which may be produced by enzymatic cleavage of an IgG by, for example, pepsin.
  • Fab fragments may be produced by, for example, reduction of F(ab) 2 with dithiothreitol or mercaptoethylamine.
  • Immunoglobulins may be assigned to different classes depending on the amino acid sequences of the constant domain of their heavy chains. In some embodiments, different constant domains may be appended to humanized V L and V H regions derived from the CDRs provided herein. There are at least five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgGl, IgG2, IgG3 and IgG4; IgAl and IgA2.
  • the invention comprises antibodies and antigen-binding fragments of any of these classes or subclasses of antibodies.
  • the antibody or antigen-binding fragment comprises a heavy chain constant region, e.g. a human constant region, such as ⁇ , ⁇ 2, ⁇ 3, or ⁇ 4 human heavy chain constant region or a variant thereof.
  • the antibody or antigen- binding fragment comprises a light chain constant region, e.g. a human light chain constant region, such as lambda or kappa human light chain region or variant thereof.
  • the human heavy chain constant region can be ⁇ 4 and the human light chain constant region can be kappa.
  • the Fc region of the antibody is ⁇ 4 with a Ser228Pro mutation ⁇ Angal S. et al, 1993, Mol Immunol.
  • the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgGl subtype. In one embodiment, the antibody or antigen- binding fragment comprises a heavy chain constant region of the IgG2 subtype. In one embodiment, the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG4 subtype.
  • the anti-CTLA-4 antibodies and antigen-binding fragments thereof are engineered antibodies to include modifications to framework residues within the variable domains of the parental hCTLA4.27A monoclonal antibody, e.g. to improve the properties of the antibody or fragment.
  • framework modifications are made to decrease the immunogenicity of the antibody or fragment. This is usually accomplished by replacing non-CDR residues in the variable domains (i.e. framework residues) in a parental (e.g. rodent) antibody or fragment with analogous residues from the immune repertoire of the species in which the antibody is to be used, e.g. human residues in the case of human therapeutics.
  • Such an antibody or fragment is referred to as a "humanized" antibody or fragment.
  • an engineered (e.g. humanized) antibody In some cases it is desirable to increase the affinity, or alter the specificity of an engineered (e.g. humanized) antibody.
  • One approach is to "backmutate" one or more framework residues to the corresponding germline sequence. More specifically, an antibody or fragment that has undergone somatic mutation can contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody or fragment framework sequences to the germline sequences from which the antibody or fragment is derived.
  • Another approach is to revert to the original parental (e.g. , rodent) residue at one or more positions of the engineered (e.g. humanized) antibody, e.g. to restore binding affinity that may have been lost in the process of replacing the framework residues.
  • the engineered (e.g. humanized) antibody e.g. to restore binding affinity that may have been lost in the process of replacing the framework residues.
  • the anti-CTLA-4 antibodies and antigen-binding fragments thereof are engineered (e.g. humanized) to include modifications to in the framework and/or CDRs to improve their properties.
  • engineered changes can be based on molecular modelling.
  • a molecular model for the variable region for the parental (non- human) antibody sequence can be constructed to understand the structural features of the antibody and used to identify potential regions on the antibody that can interact with the antigen.
  • Conventional CDRs are based on alignment of immunoglobulin sequences and identifying variable regions. Kabat et al., (1991) Sequences of Proteins of Immunological Interest, Kabat, et al; National Institutes of Health, Bethesda, Md.
  • the molecular model for the variable region of the non-human antibody can be used to guide the selection of regions that can potentially bind to the antigen. In practice the potential antigen binding regions based on model differ from the conventional "CDR"s or "hyper variable” loops.
  • Commercial scientific software such as Discovery Studio (BIO VIA, Dassault Systemes) can be used for molecular modeling. Human frameworks can be selected based on best matches with the non-human sequence both in the frameworks and in the CDRs.
  • FR4 (framework 4) in VH VJ regions for the human germlines are compared with the corresponding non-human region.
  • FR4 (framework 4) in VL J-kappa and J-Lambda regions of human germline sequences are compared with the corresponding non-human region.
  • the CDRs are grafted into the selected human frameworks.
  • certain residues in the VL-VH interface can be retained as in the non-human (parental) sequence.
  • Molecular models can also be used for identifying residues that can potentially alter the CDR conformations and hence binding to antigen. In some cases, these residues are retained as in the non-human (parental) sequence.
  • Molecular models can also be used to identify solvent exposed amino acids that can result in unwanted effects such as glycosylation, deamidation and oxidation. Developability filters can be introduced early on in the design stage to eliminate/minimize these potential problems.
  • Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as "deimmunization" and is described in further detail in U.S. Patent No. 7,125,689. [00144] In particular embodiments, it will be desirable to change certain amino acids containing exposed side-chains to another amino acid residue in order to provide for greater chemical stability of the final antibody, so as to avoid deamidation or isomerization.
  • the deamidation of asparagine may occur on NG, DG, NG, NS, NA, NT, QG or QS sequences and result in the creation of an isoaspartic acid residue that introduces a kink into the polypeptide chain and decreases its stability (isoaspartic acid effect). Isomerization can occur at DG, DS, DA or DT sequences.
  • the antibodies of the present disclosure do not contain deamidation or asparagine isomerism sites.
  • an asparagine (Asn) residue may be changed to Gin or Ala to reduce the potential for formation of isoaspartate at any Asn-Gly sequences, particularly within a CDR.
  • a similar problem may occur at a Asp-Gly sequence. Reissner and Aswad (2003) Cell. Mol. Life Sci. 60: 1281. Isoaspartate formation may debilitate or completely abrogate binding of an antibody to its target antigen. See, Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734.
  • the asparagine is changed to glutamine (Gin).
  • any methionine residues may be changed to Lys, Leu, Ala, or Phe or other amino acids in order to reduce the possibility that the methionine sulfur would oxidize, which could reduce antigen-binding affinity and also contribute to molecular heterogeneity in the final antibody preparation. Id.
  • the antibodies (e.g. , humanized antibodies) and antigen-binding fragments thereof disclosed herein can also be engineered to include modifications within the Fc region, typically to alter one or more properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or effector function (e.g. , antigen-dependent cellular cytotoxicity).
  • the antibodies and antigen-binding fragments thereof disclosed herein can be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more properties of the antibody or fragment.
  • the numbering of residues in the Fc region is that of the EU index of Kabat.
  • the antibodies and antigen-binding fragments thereof disclosed herein also include antibodies and fragments with modified (or blocked) Fc regions to provide altered effector functions. See, e.g. , U.S. Pat. No. 5,624,821 ; WO2003/086310; WO2005/120571 ; WO2006/0057702. Such modifications can be used to enhance or suppress various reactions of the immune system, with possible beneficial effects in diagnosis and therapy. Alterations of the Fc region include amino acid changes (substitutions, deletions and insertions), glycosylation or deglycosylation, and adding multiple Fc regions.
  • the antibody or antigen-binding fragment of the invention is an IgG4 isotype antibody or fragment comprising a Serine to Proline mutation at a position corresponding to position 228 (S228P; EU index) in the hinge region of the heavy chain constant region. This mutation has been reported to abolish the heterogeneity of inter-heavy chain disulfide bridges in the hinge region (Angal S. et ah, 1993, Mol Immunol. 30: 105-108; position 241 is based on the Kabat numbering system).
  • the hinge region of CHI is modified such that the number of cysteine residues in the hinge region is increased or decreased. This approach is described further in U.S. Patent No. 5,677,425.
  • the number of cysteine residues in the hinge region of CHI is altered, for example, to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
  • the Fc hinge region of an antibody or antigen-binding fragment of the invention is mutated to decrease the biological half-life of the antibody or fragment. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc- hinge fragment such that the antibody or fragment has impaired Staphylococcyl protein A (SpA) binding relative to native Fc -hinge domain SpA binding.
  • SpA Staphylococcyl protein A
  • the antibody or antigen-binding fragment of the invention is modified to increase its biological half-life.
  • the antibody or antigen-binding fragment of the invention e.g., antibody 27A and humanized versions thereof
  • the antibody or antigen-binding fragment of the invention is modified to increase its biological half-life.
  • Various approaches are possible. For example, one or more of the following mutations can be introduced: T252L, T254S, T256F, as described in U.S. Patent No.
  • the antibody can be altered within the CHI or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Patent Nos. 5,869,046 and 6,121,022.
  • the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody or antigen-binding fragment.
  • one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand and retains the antigen-binding ability of the parent antibody.
  • the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C 1 component of complement. This approach is described in further detail in U.S. Patent Nos. 5,624,821 and 5,648,260.
  • one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered C lq binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
  • CDC complement dependent cytotoxicity
  • one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351.
  • the Fc region is modified to decrease the ability of the antibody or antigen-binding fragment of the invention (e.g. , antibody 27A and humanized versions thereof) to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to decrease the affinity of the antibody or fragment for an Fey receptor by modifying one or more amino acids at the following positions: 238, 239, 243, 248, 249, 252, 254, 255, 256, 258, 264, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 301, 303, 305, 307, 309, 312, 315, 320, 322, 324, 326, 327, 329, 330, 331, 333, 334, 335, 337, 338, 340, 360, 373, 376, 378, 382, 388, 389, 398, 414, 416
  • ADCC antibody dependent cellular
  • the Fc region is modified to decrease the ability of the antibody of the invention (e.g. , antibody 27 A and humanized versions thereof) to mediate effector function and/or to increase anti-inflammatory properties by modifying residues 243 and 264.
  • the Fc region of the antibody or fragment is modified by changing the residues at positions 243 and 264 to alanine.
  • the Fc region is modified to decrease the ability of the antibody or fragment to mediate effector function and/or to increase anti-inflammatory properties by modifying residues 243, 264, 267 and 328.
  • the Fc region of an anti-CTLA-4 antibody is modified to increase the ability of the antibody or antigen-binding fragment to mediate effector function and/or to increase their binding to the Fcgamma receptors (FcyRs).
  • FcyRs Fcgamma receptors
  • ADCC Antibody Dependent Cell-mediated Cytotoxic activity
  • CDC Complement-dependent cytotoxic activity
  • ADCP antibody dependent cellular phagocytosis
  • FcR FcgammaRI
  • CD64 FcgammaRII
  • CD32 FcgammaRII
  • FcgammaRIII (CD16) is believed to mediate the effector functions, such as ADCC and CDC, of the antigen binding protein.
  • the Fc receptor is also important for antibody cross-linking, which can be important for anti-tumor immunity.
  • Effector function can be measured in a number of ways including for example via binding of the FcgammaRIII to Natural Killer cells or via FcgammaRI to
  • monocytes/macrophages to measure for ADCC effector function.
  • an antigen binding protein of the present invention can be assessed for ADCC effector function in a Natural Killer cell assay. Examples of such assays can be found in Shields et al, 2001 J. Biol. Chem., Vol. 276, p 6591-6604; Chappel et al, 1993 J. Biol. Chem., Vol 268, p 25124-25131; Lazar et al, 2006 PNAS, 103; 4005-4010.
  • ADCC or CDC properties of antibodies of the present invention, or their cross-linking properties may be enhanced in a number of ways.
  • such mutations are in one or more of positions selected from 239, 332 and 330 (IgGl), or the equivalent positions in other IgG isotypes. Examples of suitable mutations are S239D and I332E and A330L.
  • the antigen binding protein of the invention herein described is mutated at positions 239 and 332, for example S239D and I332E or in a further embodiment it is mutated at three or more positions selected from 239 and 332 and 330, for example S239D and I332E and A330L (EU index numbering).
  • an antibody comprising a heavy chain constant region with an altered glycosylation profile such that the antigen binding protein has enhanced effector function.
  • the antibody has enhanced ADCC or enhanced CDC or wherein it has both enhanced ADCC and CDC effector function.
  • suitable methodologies to produce antigen binding proteins with an altered glycosylation profile are described in WO2003011878,
  • the present invention provides "non-fucosylated" or
  • Non-fucosylated antibodies harbour a tri-mannosyl core structure of complex-type N-glycans of Fc without fucose residue.
  • These glycoengineered antibodies that lack core fucose residue from the Fc N-glycans may exhibit stronger ADCC than fucosylated equivalents due to enhancement of FcgammaRIIIa binding capacity.
  • the present invention also provides a method for the production of an antibody according to the invention comprising the steps of: a) culturing a recombinant host cell comprising an expression vector comprising the isolated nucleic acid as described herein, wherein the recombinant host cell does not comprise an alpha- 1,6-fucosyltransferase; and b) recovering the antigen binding protein.
  • the recombinant host cell may be not normally contain a gene encoding an alpha- 1,6-fucosyltransferase (for example yeast host cells such as Pichia sp.) or may have been genetically modified to inactive an alpha- 1,6-fucosyltransferase.
  • Recombinant host cells which have been genetically modified to inactivate the FUT8 gene encoding an alpha- 1,6-fucosyltransferase are available. See, e.g., the POTELLIGENTTM technology system available from BioWa, Inc. (Princeton, N.J.) in which CHOK1SV cells lacking a functional copy of the FUT8 gene produce monoclonal antibodies having enhanced antibody dependent cell mediated cytotoxicity (ADCC) activity that is increased relative to an identical monoclonal antibody produced in a cell with a functional FUT8 gene. Aspects of the POTELLIGENTTM technology system are described in US7214775, US6946292, WO0061739 and WO0231240. Those of ordinary skill in the art will also recognize other appropriate systems.
  • ADCC antibody dependent cell mediated cytotoxicity
  • the antibodies or antigen-binding fragments of the invention comprise a particular glycosylation pattern.
  • an afucosylated or an aglycosylated antibody or fragment can be made (i.e., the antibody lacks fucose or glycosylation, respectively).
  • the glycosylation pattern of an antibody or fragment may be altered to, for example, increase the affinity or avidity of the antibody or fragment for a CTLA-4 antigen. Such modifications can be accomplished by, for example, altering one or more of the glycosylation sites within the antibody or fragment sequence.
  • one or more amino acid substitutions can be made that result removal of one or more of the variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
  • Such aglycosylation may increase the affinity or avidity of the antibody or fragment for antigen. See, e.g., U.S. Patent Nos. 5,714,350 and 6,350,861.
  • Antibodies and antigen-binding fragments disclosed herein may further include those produced in lower eukaryote host cells, in particular fungal host cells such as yeast and filamentous fungi have been genetically engineered to produce glycoproteins that have mammalian- or human-like glycosylation patterns (See for example, Choi et al, (2003) Proc. Natl. Acad. Sci.
  • a particular advantage of these genetically modified host cells over currently used mammalian cell lines is the ability to control the glycosylation profile of glycoproteins that are produced in the cells such that compositions of glycoproteins can be produced wherein a particular N-glycan structure predominates (see, e.g., U.S. Patent No. 7,029,872 and U.S. Patent No. 7,449,308).
  • These genetically modified host cells have been used to produce antibodies that have predominantly particular N-glycan structures (See for example, Li et ah, (2006) Nat. Biotechnol. 24: 210-215).
  • the antibodies and antigen-binding fragments thereof disclosed herein further include those produced in lower eukaryotic host cells and which comprise fucosylated and non-fucosylated hybrid and complex N-glycans, including bisected and multiantennary species, including but not limited to N-glycans such as GlcNAc(i_ 4 )Man 3 GlcNAc 2 ; Gal(i_ 4 )GlcNAc(i_ 4 )Man GlcNAc 2 ; NANA(i_ 4 )Gal(i_ 4 )GlcNAc(i_ 4 )Man 3 GlcNAc 2 .
  • N-glycans such as GlcNAc(i_ 4 )Man 3 GlcNAc 2 ; Gal(i_ 4 )GlcNAc(i_ 4 )Man GlcNAc 2 ; NANA(i_ 4 )Gal(i_ 4 )GlcNAc(i_ 4 )Man 3 GlcNAc 2
  • the antibodies and antigen-binding fragments thereof provided herein may comprise antibodies or fragments having at least one hybrid N-glycan selected from the group consisting of GlcNAcMan 5 GlcNAc 2 ; GalGlcNAcMan 5 GlcNAc 2 ; and
  • the hybrid N-glycan is the predominant N-glycan species in the composition.
  • the antibodies and antigen-binding fragments thereof provided herein comprise antibodies and fragments having at least one complex N-glycan selected from the group consisting of GlcNAcMan 3 GlcNAc 2 ; GalGlcNAcMan 3 GlcNAc 2 ; NANAGalGlcNAcMan 3 GlcNAc 2 ;
  • the complex N-glycan are the predominant N-glycan species in the composition.
  • the complex N-glycan is a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N- glycans in the composition.
  • the antibody and antigen binding fragments thereof provided herein comprise complex N-glycans, wherein at least 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans in comprise the structure NANA 2 Gal 2 GlcNAc 2 Man 3 GlcNAc 2 , wherein such structure is afucosylated.
  • complex N-glycans comprising the structure NANA 2 Gal 2 GlcNAc 2 Man 3 GlcNAc 2 , wherein such structure is afucosylated.
  • Such structures can be produced, e.g., in engineered Pichia pastoris host cells.
  • the N-glycan is fucosylated.
  • the fucose is in an al,3-linkage with the GlcNAc at the reducing end of the N-glycan, an al,6-linkage with the GlcNAc at the reducing end of the N-glycan, an al,2-linkage with the Gal at the non- reducing end of the N-glycan, an al,3-linkage with the GlcNac at the non-reducing end of the N-glycan, or an al,4-linkage with a GlcNAc at the non-reducing end of the N-glycan.
  • the glycoform is in an al,3-linkage or al ,6-linkage fucose to produce a glycoform selected from the group consisting of Man 5 GlcNAc 2 (Fuc), GlcNAcMan 5 GlcNAc 2 (Fuc),
  • the antibodies e.g. , humanized antibodies
  • antigen-binding fragments thereof comprise high mannose N-glycans, including but not limited to,
  • Man 8 GlcNAc 2 Man 7 GlcNAc 2 , Man 6 GlcNAc 2 , Man 5 GlcNAc 2 , Man 4 GlcNAc 2 , or N-glycans that consist of the Man3GlcNAc2 N-glycan structure.
  • the complex N-glycans further include fucosylated and non-fucosylated bisected and multiantennary species.
  • N-glycan and “glycoform” are used interchangeably and refer to an N-linked oligosaccharide, for example, one that is attached by an asparagine- N-acetylglucosamine linkage to an asparagine residue of a polypeptide.
  • N-linked oligosaccharide for example, one that is attached by an asparagine- N-acetylglucosamine linkage to an asparagine residue of a polypeptide.
  • glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein.
  • the predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, ⁇ -acetylgalactosamine (GalNAc), N-acetylglucos amine (GlcNAc) and sialic acid (e.g. , N-acetyl-neuraminic acid (NANA)).
  • the processing of the sugar groups occurs co-translationally in the lumen of the ER and continues post- translationally in the Golgi apparatus for N-linked glycoproteins.
  • N-glycans have a common pentasaccharide core of Man 3 GlcNAc 2 ("Man” refers to mannose; “Glc” refers to glucose; and “NAc” refers to N-acetyl; GlcNAc refers to N- acetylglucosamine).
  • Man refers to mannose
  • Glc refers to glucose
  • NAc refers to N-acetyl
  • GlcNAc refers to N- acetylglucosamine
  • N-glycan structures are presented with the non-reducing end to the left and the reducing end to the right.
  • the reducing end of the N-glycan is the end that is attached to the Asn residue comprising the glycosylation site on the protein.
  • N-glycans differ with respect to the number of branches (antennae) comprising peripheral sugars (e.g.
  • Man3 Man 3 GlcNAc 2
  • Man3 Man 3 GlcNAc 2
  • trimannose core the "pentasaccharide core” or the "paucimannose core”.
  • N-glycans are classified according to their branched constituents (e.g. , high mannose, complex or hybrid).
  • a "high mannose” type N-glycan has five or more mannose residues.
  • a "complex" type N-glycan typically has at least one GlcNAc attached to the 1,3 mannose arm and at least one GlcNAc attached to the 1,6 mannose arm of a
  • N-glycans may also have galactose (“Gal”) or N- acetylgalactosamine (“GalNAc”) residues that are optionally modified with sialic acid or derivatives (e.g. , "NANA” or “NeuAc”, where “Neu” refers to neuraminic acid and “Ac” refers to acetyl).
  • Gal galactose
  • GalNAc N- acetylgalactosamine
  • Complex N-glycans may also have intrachain substitutions comprising "bisecting" GlcNAc and core fucose ("Fuc").
  • Complex N-glycans may also have multiple antennae on the "trimannose core,” often referred to as “multiple antennary glycans.”
  • a “hybrid” N-glycan has at least one GlcNAc on the terminal of the 1,3 mannose arm of the trimannose core and zero or more mannoses on the 1,6 mannose arm of the trimannose core.
  • the various N-glycans are also referred to as "glycoforms.”
  • G-2 refers to an N-glycan structure that can be characterized as Man3GlcNAc2
  • G- l refers to an N-glycan structure that can be characterized as GlcNAcMan3GlcNAc2
  • GO refers to an N-glycan structure that can be characterized as GlcNAc2Man3GlcNAc2
  • Gl refers to an N-glycan structure that can be characterized as GalGlcNAc2Man3GlcNAc2
  • G2 refers to an N-glycan structure that can be characterized as GalGlcNAc2Man3GlcNAc2
  • G2 refers to an
  • N-glycan structure that can be characterized as Gal2GlcNAc2Man3GlcNAc2; the term "Al " refers to an N-glycan structure that can be characterized as
  • N-glycan further includes a fucose residue attached to the GlcNAc residue at the reducing end of the N-glycan.
  • Lower eukaryotes such as yeast and filamentous fungi do not normally produce N-glycans that produce fucose.
  • multiantennary N-glycan refers to N-glycans that further comprise a GlcNAc residue on the mannose residue comprising the non-reducing end of the 1,6 arm or the 1,3 arm of the N-glycan or a GlcNAc residue on each of the mannose residues comprising the non-reducing end of the 1,6 arm and the 1,3 arm of the N-glycan.
  • multiantennary N- glycans can be characterized by the formulas GlcNAc(2-4)Man3GlcNAc2, Gal(i _4)GlcNAc(2-4)Man3GlcNAc2, or NANA(i . 4)Gal(i _4)GlcNAc(2-4)Man3GlcNAc2-
  • the term " 1-4" refers to 1, 2, 3, or 4 residues.
  • bisected N-glycan refers to N- glycans in which a GlcNAc residue is linked to the mannose residue at the reducing end of the N-glycan.
  • a bisected N-glycan can be characterized by the formula GlcNAc 3 Man3GlcNAc2 wherein each mannose residue is linked at its non-reducing end to a GlcNAc residue.
  • a multiantennary N-glycan is characterized as GlcNAc3Man3GlcNAc2
  • the formula indicates that two GlcNAc residues are linked to the mannose residue at the non- reducing end of one of the two arms of the N-glycans and one GlcNAc residue is linked to the mannose residue at the non-reducing end of the other arm of the N-glycan.
  • the antibodies and antigen-binding fragments thereof disclosed herein may further contain one or more glycosylation sites in either the light or heavy chain immunoglobulin variable region. Such glycosylation sites may result in increased immunogenicity of the antibody or fragment or an alteration of the pK of the antibody due to altered antigen-binding (Marshall et al.
  • Each antibody or antigen-binding fragment (e.g., 21 ⁇ or humanized versions thereof) will have a unique isoelectric point (pi), which generally falls in the pH range between 6 and 9.5.
  • the pi for an IgGl antibody typically falls within the pH range of 7-9.5 and the pi for an IgG4 antibody typically falls within the pH range of 6-8.
  • Each antibody or antigen -binding fragment (e.g., 21 ⁇ or humanized versions thereof) will have a characteristic melting temperature, with a higher melting temperature indicating greater overall stability in vivo (Krishnamurthy R and Manning MC (2002) Curr Pharm Biotechnol 3:361-71).
  • the T M i (the temperature of initial unfolding) may be greater than 60°C, greater than 65°C, or greater than 70°C.
  • the melting point of an antibody or fragment can be measured using differential scanning calorimetry (Chen et al (2003) Pharm Res 20: 1952-60; Ghirlando et al (1999) Immunol Lett 68:47-52) or circular dichroism (Murray et al. (2002) J. Chromatogr Sci 40:343-9).
  • antibodies and antigen-binding fragments thereof are selected that do not degrade rapidly. Degradation of an antibody or fragment can be measured using capillary electrophoresis (CE) and MALDI-MS (Alexander AJ and Hughes DE (1995) Anal Chem 67:3626-32).
  • antibodies e.g., antibody 27 A and humanized versions thereof
  • antigen-binding fragments thereof are selected that have minimal aggregation effects, which can lead to the triggering of an unwanted immune response and/or altered or unfavorable pharmacokinetic properties.
  • antibodies and fragments are acceptable with aggregation of 25% or less, 20% or less, 15% or less, 10% or less, or 5% or less.
  • Aggregation can be measured by several techniques, including size-exclusion column (SEC), high performance liquid chromatography (HPLC), and light scattering.
  • SEC size-exclusion column
  • HPLC high performance liquid chromatography
  • light scattering can be measured by several techniques, including size-exclusion column (SEC), high performance liquid chromatography (HPLC), and light scattering.
  • the anti-CTLA-4 antibodies and antigen-binding fragments thereof disclosed herein may also be conjugated to a chemical moiety.
  • the chemical moiety may be, inter alia, a polymer, a radionuclide or a cytotoxic factor.
  • the chemical moiety is a polymer which increases the half-life of the antibody or fragment in the body of a subject.
  • Suitable polymers include, but are not limited to, hydrophilic polymers which include but are not limited to polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2kDa, 5 kDa, 10 kDa, 12kDa, 20 kDa, 30kDa or 40kDa), dextran and monomethoxypolyethylene glycol (mPEG).
  • PEG polyethylene glycol
  • mPEG monomethoxypolyethylene glycol
  • the antibodies and antigen-binding fragments thereof disclosed herein ⁇ e.g., antibody 27A and humanized versions thereof) may also be conjugated with labels such as "Tc, 90 Y, m In, 32 P, 14 C, 125 I, 3 ⁇ 4 131 I, n C, 15 0, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, 234 Th, and 40 K, 157 Gd, 55 Mn, 52 Tr, and 56 Fe.
  • labels such as "Tc, 90 Y, m In, 32 P, 14 C, 125 I, 3 ⁇ 4 131 I, n C, 15 0, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb, 47 Sc
  • the antibodies and antigen-binding fragments disclosed herein ⁇ e.g., antibody 27A and humanized versions thereof) may also be PEGylated, for example to increase its biological ⁇ e.g., serum) half-life.
  • PEG polyethylene glycol
  • the antibody or fragment typically is reacted with a reactive form of polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
  • PEG polyethylene glycol
  • the PEGylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
  • polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (CI -CIO) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
  • the antibody or fragment to be PEGylated is an aglycosylated antibody or fragment. Methods for PEGylating proteins are known in the art and can be applied to the antibodies of the invention. See, e.g., EP 0 154 316 and EP 0 401 384.
  • antibodies and antigen-binding fragments disclosed herein may also be conjugated with fluorescent or
  • chemilluminescent labels including fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate, phycoerythrin, phycocyanin, allophycocyanin, o-phthaladehyde, fluorescamine, 152 Eu, dansyl, umbelliferone, luciferin, luminal label, isoluminal label, an aromatic acridinium ester label, an imidazole label, an acridimium salt label, an oxalate ester label, an aequorin label, 2,3-dihydrophthalazinediones, biotin/avidin, spin labels and stable free radicals.
  • fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate, phycoerythrin, phycocyanin, allophycocyanin, o
  • the antibodies and antigen-binding fragments thereof of the invention may also be conjugated to a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain , ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (e.g., fatty acids), dianthin proteins, Phytolacca americana proteins PAPI, PAPII, and PAP-S, momordica charantia inhibitor, curcin, crotin, saponaria officinalis inhibitor, mitogellin, restrictocin, phenomycin, and enomycin.
  • a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain , ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds
  • any method known in the art for conjugating the antibodies and antigen-binding fragments thereof of the invention e.g., antibody 27 A and humanized versions thereof
  • conjugating the antibodies and antigen-binding fragments thereof of the invention e.g., antibody 27 A and humanized versions thereof
  • moieties including those methods described by Hunter, et ah, (1962) Nature 144:945; David, et ah, (1974) Biochemistry 13: 1014; Pain, et ah, (1981) J. Immunol. Meth. 40:219; and Nygren, J., (1982) Histochem. and Cytochem. 30:407.
  • Methods for conjugating antibodies and fragments are conventional and very well known in the art.
  • Antibodies or other polypeptides may be immobilized onto a variety of solid supports for use in assays.
  • Solid phases that may be used to immobilize specific binding members include those developed and/or used as solid phases in solid phase binding assays.
  • suitable solid phases include membrane filters, cellulose-based papers, beads (including polymeric, latex and paramagnetic particles), glass, silicon wafers, microparticles, nanoparticles, TentaGels, AgroGels, PEGA gels, SPOCC gels, and multiple-well plates.
  • An assay strip could be prepared by coating the antibody or a plurality of antibodies in an array on solid support.
  • Antibodies or other polypeptides may be bound to specific zones of assay devices either by conjugating directly to an assay device surface, or by indirect binding. In an example of the later case, antibodies or other polypeptides may be immobilized on particles or other solid supports, and that solid support immobilized to the device surface.
  • Biological assays require methods for detection, and one of the most common methods for quantitation of results is to conjugate a detectable label to a protein or nucleic acid that has affinity for one of the components in the biological system being studied.
  • Detectable labels may include molecules that are themselves detectable (e.g., fluorescent moieties, electrochemical labels, metal chelates, etc.) as well as molecules that may be indirectly detected by production of a detectable reaction product (e.g., enzymes such as horseradish peroxidase, alkaline phosphatase, etc.) or by a specific binding molecule which itself may be detectable (e.g., biotin, digoxigenin, maltose, oligohistidine, 2,4-dinitrobenzene, phenylarsenate, ssDNA, dsDNA, etc.).
  • a detectable reaction product e.g., enzymes such as horseradish peroxidase, alkaline phosphatase, etc.
  • a specific binding molecule which itself may be detectable (e.g., biotin, digoxigenin, maltose, oligohistidine, 2,4-dinitrobenzene, phenylarsenate
  • Cross-linking reagents contain at least two reactive groups, and are divided generally into homofunctional cross-linkers (containing identical reactive groups) and heterofunctional cross-linkers (containing non-identical reactive groups). Homobifunctional cross-linkers that couple through amines, sulfhydryls or react non- specifically are available from many commercial sources. Maleimides, alkyl and aryl halides, alpha-haloacyls and pyridyl disulfides are thiol reactive groups.
  • Imidoesters are also very useful for protein-protein cross-links. A variety of
  • heterobifunctional cross-linkers each combining different attributes for successful conjugation, are commercially available.
  • the isolated antibodies or antigen-binding fragments thereof disclosed herein e.g. , antibody 27A and humanized versions thereof.
  • such subject suffers from an infection or an infectious disease.
  • such subject suffers from cancer.
  • the cancer is , e.g.
  • the invention provides methods for treating subjects using an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g., antibody 27A and humanized versions thereof), wherein the subject suffers from a viral infection.
  • the viral infection is infection with a virus selected from the group consisting of human immunodeficiency virus (HIV), hepatitis virus (A, B, or C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus or arbovi
  • HCV human immunodefici
  • the invention provides methods for treating subjects using an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a bacterial infection.
  • the bacterial infection is infection with a bacteria selected from the group consisting of Chlamydia trachomatis, rickettsial bacteria such as Ehrlichia, Orientia and Ricekettsia, mycobacteria, such as Mycobacterium leprae, or Mycobacterium lepromatosis, staphylococci, such as
  • Staphylococcus aureus streptococci, pneumonococci, meningococci and gonococci, Klebsiella, Proteus, Serratia, Pseudomonas, Legionella, Corynebacterium diphtheriae, Salmonella, bacilli, Vibrio cholerae, Clostridium tetan, Clostridium botulinum, Bacillus anthracis, Yersinia pestis, Haemophilus influenza, Actinomyces, Leptospira, Treponema, Shigella, Chlamydophila psittaci and Borriella.
  • the invention provides methods for treating subjects using an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a fungal infection.
  • the fungal infection is infection with a fungus selected from the group consisting of Candida (albicans, krusei, glabrata, tropicalis, etc.), Cryptococcus neoformans, Aspergillus (fumigatus, niger, etc.), Genus Mucorales (mucor, absidia, rhizopus), Sporothrix schenkii, Blastomyces dermatitidis , Paracoccidioides brasiliensis , Coccidioides immitis and Histoplasma capsulatum.
  • Candida albicans, krusei, glabrata, tropicalis, etc.
  • Cryptococcus neoformans Aspergillus (fumigatus, niger, etc.)
  • Genus Mucorales micor, absidia,
  • the invention provides methods for treating subjects using an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a parasitic infection.
  • the parasitic infection is infection with a parasite selected from the group consisting of Entamoeba histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba, Giardia lambia, Cryptosporidium, Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei,
  • a "subject” may be a mammal such as a human, dog, cat, horse, cow, mouse, rat, monkey ⁇ Macaca fascicularis (cynomolgus monkey)) or rabbit.
  • the subject is a human subject.
  • the methods and compositions described herein are administered in combination with one or more of other antibody molecules, STING agonists, chemotherapy, other anti-cancer therapy (e.g., targeted anti-cancer therapies, gene therapy, viral therapy, RNA therapy bone marrow transplantation, nanotherapy, or oncolytic drugs), cytotoxic agents, immune-based therapies (e.g., cytokines or cell-based immune therapies), surgical procedures (e.g., lumpectomy or mastectomy) or radiation procedures, or a combination of any of the foregoing.
  • the additional therapy may be in the form of adjuvant or neoadjuvant therapy.
  • the additional therapy is an enzymatic inhibitor (e.g., a small molecule enzymatic inhibitor) or a metastatic inhibitor.
  • exemplary cytotoxic agents that can be administered in combination with include antimicrotubule agents, topoisomerase inhibitors, anti-metabolites, mitotic inhibitors, alkylating agents,
  • anthracyclines vinca alkaloids
  • intercalating agents agents capable of interfering with a signal transduction pathway, agents that promote apoptosis, proteosome inhibitors, and radiation (e.g., local or whole body irradiation (e.g., gamma irradiation).
  • radiation e.g., local or whole body irradiation (e.g., gamma irradiation).
  • the additional therapy is surgery or radiation, or a combination thereof.
  • the additional therapy is a therapy targeting one or more of PI3K/AKT/mTOR pathway, an HSP90 inhibitor, or a tubulin inhibitor.
  • an immunomodulator e.g., an activator of a
  • costimulatory molecule or an inhibitor of an inhibitory molecule e.g., an immune checkpoint molecule
  • a vaccine e.g., a therapeutic cancer vaccine
  • other forms of cellular immunotherapy
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with other, further therapeutic agents and/or therapeutic procedures, for treating or preventing any disease such as cancer, e.g. , as discussed herein, in a subject in need of such treatment or prevention.
  • Compositions e.g. , pharmaceutical compositions comprising a pharmaceutically acceptable carrier, comprising such antibodies and fragments in association with further therapeutic agents are also part of the present invention.
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with tumor vaccines.
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with chemotherapeutic agents.
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with radiation therapy.
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with targeted therapies.
  • targeted therapies include: hormone therapies, signal transduction inhibitors (e.g., EGFR inhibitors, such as cetuximab (Erbitux) and erlotinib (Tarceva)); HER2 inhibitors (e.g., trastuzumab (Herceptin) and pertuzumab (Perjeta)); BCR-ABL inhibitors (such as imatinib (Gleevec) and dasatinib (Sprycel)); ALK inhibitors (such as crizotinib (Xalkori) and ceritinib (Zykadia)); BRAF inhibitors (such as vemurafenib (Zelboraf) and dabrafenib (Tafinlar)), gene expression modulators, apoptosis inducer
  • EGFR inhibitors such as cetuximab (Erbitux) and erlotin
  • the anti-CTLA-4 antibodies or antigen-binding fragments thereof of the invention may be used in combination with an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g. , an antibody or antigen-binding fragment thereof that specifically binds to the receptor.
  • an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g. , an antibody or antigen-binding fragment thereof that specifically binds to the receptor.
  • the present invention includes compositions comprising an anti-CTLA-4 antibody or antigen-binding fragment thereof of the present invention (e.g. , antibody 27A and humanized versions thereof) in association with one or more of PD-1/PD-L1 blocking antibodies: pembrolizumab, nivolumab, pidilizumab, REGN2810, MEDI-0680, PDR-001, SHR-1210, BGB-A317, PF-06801591, TSR-042, atezoluzimab, durvalumab, BMS-936559; as well as methods for treating or preventing cancer in a subject comprising administering an effective amount of the anti-CTLA-4 antibody or antigen-binding fragment thereof and one or more of pembrolizumab, nivolumab, pidilizumab, REGN2810 to the subject.
  • the subject is also administered a further therapeutic agent.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the present invention e.g. , antibody 27A and humanized versions thereof
  • an anti-CTLA-4 antibody) or antigen -binding fragment thereof of the present invention is in association with an isolated antibody encoding the heavy and light chain of nivolumab.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is in association with one or more of: anti-PDl antibody (e.g. , pembrolizumab, nivolumab, pidilizumab (CT-011)), anti-PDLl antibody, anti-TIGIT antibody, anti-CD27 antibody, anti- CS 1 antibody (e.g.
  • anti-KIR2DL 1/2/3 antibody e.g., lirilumab
  • anti-CD137 antibody e.g., urelumab
  • anti-GITR antibody e.g., TRX5178
  • anti-PD-Ll antibody e.g., BMS-936559, MSB0010718C or MPDL3280A
  • anti-PD-L2 antibody anti-ILTl antibody
  • anti-ILT2 antibody anti-ILT3 antibody
  • anti-ILT4 antibody anti-ILT5 antibody
  • anti-ILT6 antibody anti-ILT7 antibody
  • anti-ILT8 antibody anti-CD40 antibody, anti-OX40 antibody, anti-ICOS, anti-SIRPa
  • anti-KIR2DLl antibody anti-KIR2DL2/3 antibody
  • anti-KIR2DL4 antibody anti-KIR2DL5A antibody, anti-KIR2DL5B antibody
  • anti-KIR3DLl antibody anti- KIR3DL2 antibody
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-PDl antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention e.g. , antibody 27A or a humanized version thereof
  • an anti-PDLl antibody e.g. , BMS-936559, MSB0010718C or
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-CD27 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27 A or a humanized version thereof) is in association with an anti-CS 1 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27 A or a humanized version thereof) is in association with an anti-KIR2DLl/2/3 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention e.g. , antibody 27 A or a humanized version thereof
  • an anti-CD 137 e.g. , urelumab
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is in association with an anti-GITR (e.g. , TRX518) antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g., antibody 27 A or a humanized version thereof) is in association with an anti-PD-L2 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-ITLl antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-ITL2 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-ITL3 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-ITL4 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-ITL5 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-ITL6 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-ITL7 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-ITL8 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention e.g. , antibody 27 A or a humanized version thereof
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is in association with an anti-OX40 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-KIR2DLl antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-KIR2DL2/3 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-KIR2DL4 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-KIR2DL5A antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-KIR2DL5B antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-KIR3DLl antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-KIR3DL2 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention e.g. , antibody 27 A or a humanized version thereof
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is in association with an anti-NKG2A antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-NKG2C antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-ICOS antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g., antibody 27 A or a humanized version thereof) is in association with an anti-SIRPa antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-4-lBB antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-IL- 10 antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with an anti-TSLP antibody.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with IL- 10 or PEGylated IL-10.
  • an anti-CTKLA-4 antibody or antigen-binding fragment thereof of the invention is in association with a Tim-3 pathway antagonist, preferably as part of a pharmaceutical composition.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is in association with a Vista pathway antagonist, preferably as part of a pharmaceutical composition.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is in association with a BTLA pathway antagonist, preferably as part of a pharmaceutical composition.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is in association with a LAG-3 pathway antagonist, preferably as part of a pharmaceutical composition.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is in association with a TIGIT pathway antagonist, preferably as part of a pharmaceutical composition.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is in association with a STING agonist, preferably as part of a pharmaceutical composition.
  • the cyclic-di-nucleotides (CDNs) cyclic-di-AMP (produced by Listeria monocytogenes and other bacteria) and its analogs cyclic-di-GMP and cyclic - GMP-AMP are recognized by the host cell as a pathogen associated molecular pattern (PAMP), which bind to the pathogen recognition receptor (PRR) known as Stimulator of INterferon Genes (STING).
  • PAMP pathogen associated molecular pattern
  • PRR pathogen recognition receptor
  • STING is an adaptor protein in the cytoplasm of host mammalian cells which activates the TANK binding kinase (TBK1)— IRF3 and the NF-kappaB signaling axis, resulting in the induction of IFN- ⁇ and other gene products that strongly activate innate immunity. It is now recognized that STING is a component of the host cytosolic surveillance pathway (Vance et al., 2009), that senses infection with intracellular pathogens and in response induces the production of IFN- ⁇ , leading to the development of an adaptive protective pathogen-specific immune response consisting of both antigen- specific CD4+ and CD8+ T cells as well as pathogen- specific antibodies. Examples of cyclic purine
  • dinucleotides are described in some detail in, for example: U.S. Patents 7,709458 and 7,592,326; patent applications WO2007/054279, WO2014/093936, and WO2014/189805; and Yan et al., Bioorg. Med. Chem Lett. 18: 5631 (2008).
  • the antibodies or antigen binding fragments of the invention increase the activity of an immune cell.
  • the increase of the activity of an immune cell can be detected using any method known in the art.
  • the increase in activity of an immune cell can be detected by measuring the proliferation of the immune cell.
  • an increase in activity of a T cell can be detected by measuring the proliferation of the T cell or signal transduction events such as tyrosine phosphorylation of immune receptors or downstream kinases that transmit signals to transcriptional regulators.
  • the increase in activity of an immune cell can be detected by measuring CTL or NK cell cytotoxic function on specific target cells or IFNy cytokine responses, which are associated with stimulation of anti-tumor immunity.
  • the increase in activity of an immune cell can be detected by measuring T cell activation ex vivo in a sample derived from the subject.
  • the increase in T cell activity is determined by: (i) measuring SEB (Staphylococcus Enterotoxin B) induced production of one or more proinflammatory cytokines selected from the group consisting of: IL-2, TNFa, IL-17, IFNy, IL- 1 ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL-13; or (ii) measuring mixed lymphocyte reactions or direct anti-CD3 mAb stimulation of T cell receptor (TCR) signaling to induce production of a cytokine selected from the group consisting of: IL-2, TNFa, IL-17, IFNy, IL- 1 ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL-13.
  • SEB Staphylococcus Enterotoxin B
  • the anti-CTLA- 4 antibody or antigen binding fragment thereof of the present invention will stimulate antigen- specific T-cell production of IL-2 and/or IFNy and/or upregulation of CD25 and/or CD69 by at least 1.5 fold.
  • the anti-CTLA-4 antibody or antigen binding fragment thereof of the present invention will stimulate CD3+ T cells, when these are presented to Raji cells expressing CD80 and CD86, to produce pro -inflammatory cytokines selected from the group consisting of: IL-2, TNFa, IL-17, IFNy, IL- ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL-13.
  • Additional agents which are beneficial to raising a cytolytic T cell response may be used in combination with the anti-CTLA-4 antibody or antigen binding fragment thereof of the present invention.
  • these include, without limitation, B7 costimulatory molecule, interleukin-2, interferon- ⁇ , GM-CSF, PD-1 antagonists, OX-40/OX-40 ligand, CD40/CD40 ligand, sargramostim, levamisol, vaccinia virus, Bacille Calmette-Guerin (BCG), liposomes, alum, Freund's complete or incomplete adjuvant, detoxified endotoxins, mineral oils, surface active substances such as lipolecithin, pluronic polyols, polyanions, peptides, and oil or hydrocarbon emulsions.
  • BCG Bacille Calmette-Guerin
  • compositions for inducing a T cell immune response which preferentially stimulate a cytolytic T cell response versus an antibody response are preferred, although those that stimulate both types of response can be used as well.
  • the agent is a polypeptide
  • the polypeptide itself or a polynucleotide encoding the polypeptide can be administered.
  • the carrier can be a cell, such as an antigen presenting cell (APC) or a dendritic cell.
  • APC antigen presenting cell
  • Antigen presenting cells include such cell types as macrophages, dendritic cells and B cells.
  • Facultative antigen-presenting cells include monocytes, marginal zone Kupffer cells, microglia, Langerhans' cells, interdigitating dendritic cells, follicular dendritic cells, and T cells. Facultative antigen-presenting cells can also be used. Examples of facultative antigen-presenting cells include astrocytes, follicular cells, endothelium and fibroblasts.
  • the composition can comprise a bacterial cell that is transformed to express the polypeptide or to deliver a polynucleoteide which is subsequently expressed in cells of the vaccinated individual.
  • Adjuvants such as aluminum hydroxide or aluminum phosphate, can be added to increase the ability of the vaccine to trigger, enhance, or prolong an immune response.
  • the composition can comprise a bacterial cell that is transformed to express the polypeptide or to deliver a polynucleotide which is subsequently expressed in cells of the vaccinated individual.
  • a number of bacterial species have been developed for use as vaccines and can be used as a vaccine platform in present invention, including, but not limited to, Shigella flexneri, Escherichia coli, Listeria monocytogenes, Yersinia enterocolitica,
  • Salmonella typhimurium Salmonella typhi or mycobacterium species. This list is not meant to be limiting.
  • the present invention contemplates the use of attenuated, commensal, and/or killed but metabolically active bacterial strains as vaccine platforms. In preferred
  • the bacterium is Listeria monocytogenes.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention with an inactivated tumor cell vaccine.
  • inactivated tumor cell vaccine is meant a tumor cell (either “autologous” or “allogeneic” to the patient) which has been treated to prevent division of the cells.
  • tumor cells preserve their immunogenicity and their metabolic activity.
  • tumor cells are genetically modified to express a transgene which is expressed within a patient as part of cancer therapy.
  • a composition or vaccine of the invention comprises neoplastic (e.g., tumor) cells that are autologous or allogeneic to the patient undergoing treatment and is most preferably the same general type of tumor cell as is afflicting the patient.
  • a patient suffering from melanoma will typically be administered a genetically modified cell derived from a melanoma.
  • Methods for inactivating tumor cells for use in the present invention such as the use of irradiation, are well known in the art.
  • the inactivated tumor cells of the present invention are modified to express and secrete one or more heat shock proteins.
  • gp96-Ig fusion proteins can be expressed and secreted to stimulate an immune response (Yamazaki et al., The Journal of Immunology, 1999, 163:5178-5182; Strbo et al., Immunol Res. 2013 Dec;57(l-3):311-25).
  • the inactivated tumor cells are modified to express and secrete a gp96-Ig fusion protein.
  • the inactivated tumor cells of the present invention are administered to the patient together with one or more costimulatory molecules or agents.
  • a preferred costimulatory agent comprises one or more cytokines which stimulate dendritic cell induction, recruitment, and/or maturation. Methods for assessing such costimulatory agents are well known in the literature. Induction and maturation of DCs is typically assessed by increased expression of certain membrane molecules such as CD80 and CD86, and/or secretion of pro-inflammatory cytokines, such as IL-12 and type I interferons following stimulation.
  • the inactivated tumor cells themselves are modified to express and secrete one or more cytokines which stimulate dendritic cell induction, recruitment, and/or maturation.
  • the present invention is described in exemplary terms with regard to the use of GM-CSF.
  • the tumor cell may express a transgene encoding GM-CSF as described in U.S. Pat. Nos. 5,637,483, 5,904,920, 6,277,368 and 6,350,445, as well as in US Patent Publication No. 20100150946.
  • a form of GM-CSF- expressing genetically modified cancer cells or a "cytokine-expressing cellular vaccine" for the treatment of pancreatic cancer is described in U.S. Pat. Nos. 6,033,674 and 5,985,290.
  • Suitable cytokines which may be expressed by such inactivated tumor cells and/or bystander cells instead of, or together with, GM-CSF include, but are not limited to, one or more of CD40 ligand, FLT-3 ligand, IL-12, CCL3, CCL20, and CCL21. This list is not meant to be limiting.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is administered in conjunction with one or more vaccines intended to stimulate an immune response to one or more predetermined antigens.
  • the antigen(s) may be administered directly to the individual, or may be expressed within the individual from, for example, a tumor cell vaccine (e.g., GVAX) which may be autologous or allogenic, a dendritic cell vaccine, a DNA vaccine, an RNA vaccine, a viral-based vaccine, a bacterial or yeast vaccine (e.g., a Listeria monocytogenes or Saccharomyces cerevisiae), etc. See, e.g., Guo et al., Adv. Cancer Res.
  • target antigens examples include a fragment or fusion polypeptide comprising an immunologically active portion of the antigens listed in the table. This list is not meant to be limiting.
  • Table 4 List of antigens for use in combination with the anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention as described herein
  • Wilms' tumor- 1 WT-1 isoform A (GenBank Acc. Nos. NM 000378; NP 000369). associated protein (Wt-1), WT-1 isoform B (GenBank Acc. Nos. NM 024424; NP 077742). including isoform A; WT-1 isoform C (GenBank Acc. Nos. NM 024425; NP 077743). isoform B; isoform C; WT-1 isoform D (GenBank Acc. Nos. NM 024426; NP 077744). isoform D.
  • MHC class I chain-related See, e.g., Groh, et al. (2005) Proc. Natl. Acad. Sci. USA 102:6461- protein A (MICA); 6466; GenBank Acc. Nos. NM_000247; BC_016929; AY750850; MHC class I chain-related NM_005931.
  • MICA protein A
  • Glypican-3 an antigen GenBank Acc. No. NM 004484. Nakatsura, et al. (2003) Biochem. of, e.g., hepatocellular Biophys. Res. Commun. 306: 16-25; Capurro, et al. (2003)
  • Prostate stem cell antigen GenBank Acc. No. AF043498; AR026974; AR302232 see also, e.g., (PSCA). Argani, et al. (2001) Cancer Res. 61 :4320-4324; Christiansen, et al.
  • PCTA-1 antigen-1
  • GenBank Acc. No. L78132 GenBank Acc. No. L78132.
  • Cancer- testis antigens GenBank Acc. No. NM_001327 (NY-ESO-1) (see also, e.g., Li, et al. e.g., NY-ESO-l ; SCP-l ; (2005) Clin. Cancer Res. 11 : 1809-1814; Chen, et al. (2004) Proc. SSX-l ; SSX-2; SSX-4; Natl. Acad. Sci. U S A. 101(25):9363-9368; Kubuschok, et al. (2004) GAGE, CT7; CT8; CT10; Int. J. Cancer. 109:568-575; Scanlan, et al. (2004) Cancer Immun.
  • HIP1R HIP1R
  • LMNA LNA
  • Scanlan Scanlan, et al. (2002) Cancer Res. 62:4041-4047.
  • DAM-l e.g., DAM-l ; DAM-6.
  • antigens e.g., NY-CO-8;
  • MUM-1 (melanoma Gueguen, et al. (1998) J. Immunol. 160:6188-6194; Hirose, et al. ubiquitous mutated); (2005) Int. J. Hematol. 81 :48-57; Baurain, et al. (2000) J. Immunol. MUM-2; MUM-2 Arg- 164:6057-6066; Chiari, et al. (1999) Cancer Res. 59:5785-5792. Gly mutation; MUM-3.
  • Ras e.g., wild type ras, GenBank Acc. Nos. P01112; P01116; M54969; M54968; P01111 ; ras with mutations at P01112; K00654. See also, e.g., GenBank Acc. Nos. M26261 ;
  • Histone deacetylases Waltregny, et al. (2004) Eur. J. Histochem. 48:273-290; Scanlan, et (HDAC), e.g., HDAC5. al. (2002) Cancer Res. 62:4041-4047.
  • Cyclophilin B (Cyp-B). Tamura, et al. (2001) Jpn. J. Cancer Res. 92:762-767 '. Antigen Reference
  • Alpha-fetoprotein (AFP) Grimm, et al. (2000) Gastroenterol. 119: 1104-1112.
  • CEA antigen
  • CAP1-6D e.g., Zaremba (1997) Cancer Res. 57:4570-4577
  • Sarobe, et al. (2004) enhancer agonist peptide. Curr. Cancer Drug Targets 4:443-454; Tsang, et al. (1997) Clin.
  • Annexin e.g., Annexin II. Zimmerman, et al. (2004) Virchows Arch. 445:368-374.
  • Tyrosinase-related GenBank Acc. No. NM_001922. see also, e.g., Bronte, et al. (2000) proteins 1 and 2 (TRP-1 Cancer Res. 60:253-258).
  • TARP See, e.g., Clifton, et al. (2004) Proc. Natl. Acad. Sci. USA
  • Tyrosinase-related GenBank Acc. No. NM_001922. see also, e.g., Bronte, et al. (2000) proteins 1 and 2 (TRP-1 Cancer Res. 60:253-258).
  • TRP-2 MART- 1.
  • MUC-l MUC-2. See, e.g., Davies, et al. (1994) Cancer Lett. 82: 179-184; Gambus, et al. (1995) Int. J. Cancer 60:146-148; McCool, et al. (1999) Biochem. Antigen Reference
  • CEACAM6 CAP-1. Duxbury, et al. (2004) Biochem. Biophys. Res. Commun. 317:837- 843; Morse, et al. (1999) Clin. Cancer Res. 5: 1331-1338.
  • HMGB1 (a DNA binding Brezniceanu, et al. (2003) FASEB J. 17: 1295-1297.
  • EphA2 See, e.g., U.S. Patent Publication No. 2005/0281783 Al ; Genbank
  • NM_010139 (Mouse); Genbank Accession No. AB038986 (Chicken, partial sequence); GenBank Accession Nos. NP_004422, AAH37166, and AAA53375 (human); GenBank Accession Nos. NP_034269 (mouse), AAH06954 (mouse), XP_345597 (rat), and BAB63910 (chicken).
  • EGFRvIII See, e.g., WO/2012/068360
  • Francisella tularensis antigens Francisella tularensis antigens
  • Antigenic components of F. tularensis include, e.g., 80 antigens, including 10 kDa and 60 kDa chaperonins (Havlasova, et al. (2002) Proteomics 2:857-86), nucleoside diphosphate kinase, isocitrate dehydrogenase,
  • RNA -binding protein Hfq the chaperone ClpB (Havlasova, et al. (2005) Proteomics 5:2090-2103). See also, e.g., Oyston and Quarry (2005) Antonie Van Leeuwenhoek 87:277-281 ; Isherwood, et al. (2005) Adv. Drug Deliv. Rev. 57: 1403-1414; Biagini, et al. (2005) Anal. Bioanal. Chem. 382: 1027-1034.
  • Circumsporozoite protein See, e.g., Haddad, et al. (2004) Infection Immunity 72: 1594-1602; (CSP); SSP2; HEP17; Hoffman, et al. (1997) Vaccine 15:842-845; Oliveira-Ferreira and Exp-1 orthologs found in Daniel-Ribeiro (2001) Mem. Inst. Oswaldo Cruz, Rio de Janeiro P. falciparum; and 96:221-227.
  • CSP see, e.g., GenBank Acc. No. AB 121024).
  • SSP2 LSA-1 see, e.g., GenBank Acc. No. AF249739).
  • LSA-1 see, e.g., GenBank
  • Ring-infected erythrocyte See, e.g., Stirnadel, et al. (2000) Int. J. Epidemiol. 29:579-586; survace protein (RES A); Krzych, et al. (1995) J. Immunol. 155:4072-4077. See also, Good, et merozoite surface al. (2004) Immunol. Rev. 201 :254-267; Good, et al. (2004) Ann. Rev. protein 2 (MSP2); Spf66; Immunol. 23:69-99. MSP2 (see, e.g., GenBank Acc. No. X96399; merozoite surface X96397).
  • MSP1 (see, e.g., GenBank Acc. No. X03371).
  • RESA see, protein 1(MSP1); 195A; e.g., GenBank Acc. No. X05181 ; X05182).
  • AMA1 antigen 1 (see, e.g., GenBank Acc. No. A 13; AJ494905; AJ490565).
  • Hepatitis B Complete genome (see, e.g., GenBank Acc. Nos. AB214516;
  • Hepatitis C Complete genome see, e.g., GenBank Acc. Nos. NC_004102;
  • HTLV type II see, e.g., GenBank Acc. Nos. L03561 ; African, and Y13051 ; AF139382).
  • Coronaviridae including See, e.g., Brian and Baric (2005) Curr. Top. Microbiol. Immunol. Coronaviruses, such as 287: 1-30; Gonzalez, et al. (2003) Arch. Virol. 148:2207-2235; Smits, SARS-coronavirus et al. (2003) J. Virol. 77:9567-9577; Jamieson, et al. (1998) J. Infect. (SARS-CoV), and Dis. 178: 1263-1269 (GenBank Acc. Nos. AY348314; NC_004718; Toroviruses. AY394850).
  • Mumps virus including See, e.g., Orvell, eta 1. (2002) J. Gen. Virol. 83:2489-2496. See, e.g., the genotypes A, C, D, G, GenBank Acc. Nos. AY681495; NC_002200; AY685921 ;
  • Coxsackie virus A See, e.g., Brown, et al. (2003) J. Virol. 77:8973-8984.
  • GenBank Acc. including the serotypes 1 , Nos. AY421768; AY790926: X67706.
  • enterovirus C HEV-C
  • Coxsackie virus B See, e.g., Ahn, et al. (2005) J. Med. Virol. 75:290-294; Patel, et al. including subtypes 1-6. (2004) J. Virol. Methods 120: 167-172; Rezig, et al. (2004) J. Med.
  • Human enteroviruses See, e.g., Oberste, et al. (2004) J. Virol. 78:855-867. Human including, e.g., human enterovirus A (GenBank Acc. Nos. NC_001612); human
  • enterovirus A HEV-A, enterovirus B (NC_001472); human enterovirus C (NC_001428); CAV2 to CAV8, CAV10, human enterovirus D (NC_001430).
  • Simian enterovirus A GenBank CAV12, CAV14, Acc. No. NC_003988).
  • Polioviruses including See, e.g., He, et al. (2003) J. Virol. 77:4827-4835; Hahsido, et al. PV1, PV2, and PV3. (1999) Microbiol. Immunol. 43:73-77. GenBank Acc. No. AJ132961
  • Viral encephalitides See, e.g., Hoke (2005) Mil. Med. 170:92-105; Estrada-Franco, et al. viruses, including equine (2004) Emerg. Infect. Dis. 10:2113-2121 ; Das, et al. (2004) Antiviral encephalitis, Venezuelan Res. 64:85-92; Aguilar, et al. (2004) Emerg. Infect. Dis. 10:880-888; equine encephalitis Weaver, et al. (2004) Arch. Virol. Suppl. 18:43-64; Weaver, et al. (VEE) (including (2004) Annu. Rev. Entomol. 49: 141-174.
  • CMV cytomegalovirus
  • JEBV Epstein-Barr virus
  • NC_001806 herpesvirus 1
  • herpesvirus 2 human herpesvirus- 1 (herpesvirus 2); X04370 and NC_001348 (herpesvirus 3);
  • HHV-1 HHV-2, NC_001345 (herpesvirus 4); NC_001347 (herpesvirus 5); X83413 HHV-3, HHV-4, HHV-5, and NC_000898 (herpesvirus 6); NC_001716 (herpesvirus 7).
  • HHV-6, HHV-7, HHV-8, Human herpesviruses types 6 and 7 are disclosed herpes B virus, herpes by, e.g., Padilla, et al. (2003) J. Med. Virol. 70 (Suppl. 1)S103-S110.
  • simplex virus types 1 and Human herpesvirus 8 (HHV-8), including subtypes A-E, are disclosed 2 (HSV-l, HSV-2), and in, e.g., Treurnicht, et al. (2002) J. Med. Virul. 66:235-240.
  • HIV-1 including group M See, e.g., Smith, et al. (1998) J. Med. Virol. 56:264-268. See also, (including subtypes A to e.g., GenBank Acc. Nos. DQ054367; NC_001802; AY968312;
  • HIV-2 AY970948; X61240; AJ006287; AJ508597; and AJ508596.
  • Epstein-Barr virus See, e.g., Peh, et al. (2002) Pathology 34:446-450. Epstein-Barr virus including subtypes A and strain B95-8 (GenBank Acc. No. V01555).
  • Reovirus including See, e.g., Barthold, et al. (1993) Lab. Anim. Sci. 43:425-430; Roner, serotypes and strains 1, 2, et al. (1995) Proc. Natl. Acad. Sci. USA 92: 12362-12366; Kedl, et al. and 3, type 1 Lang, type 2 (1995) J. Virol. 69:552-559.
  • GenBank Acc. No. K02739 Sigma-3 Jones, and type 3 gene surface protein).
  • Cytomegalovirus See, e.g., Chern, et al. (1998) J. Infect. Dis. 178: 1149-1153; Vilas Antigen Reference subtypes include Boas, et al. (2003) J. Med. Virol. 71:404-407; Trincado, et al. (2000) CMV subtypes I- VII. J. Med. Virol. 61 :481-487. GenBank Acc. No. X17403.
  • Rhinovirus including all Human rhinovirus 2 (GenBank Acc. No. X02316); Human serotypes. rhinovirus B (GenBank Acc. No. NC_001490); Human rhinovirus 89
  • Adenovirus including all AY803294; NC_004001 ; AC_000019; AC_000018; AC_000017; serotypes. AC_000015; AC_000008; AC_000007; AC_000006; AC_000005;
  • Filoviruses including See, e.g., Geisbert and Jahrling (1995) Virus Res. 39: 129-150;
  • Marburg virus and Ebola Hutchinson, et al. (2001) J. Med. Virol. 65:561-566.
  • Marburg virus virus and strains such as (see, e.g., GenBank Acc. No. NC_001608).
  • Ebola virus see, e.g., Ebola-Sudan (EBO-S), GenBank Acc. Nos. NC_006432; AY769362; NC_002549;
  • Ebola-Zaire (EBO-Z), AF272001 ; AF086833).
  • Arenaviruses including Junin virus, segment S (GenBank Acc. No. NC_005081); Junin virus, lymphocytic segment L (GenBank Acc. No. NC_005080).
  • Rabies virus See, e.g., GenBank Acc. Nos. NC_001542; AY956319; AY705373;
  • Arboviruses including Dengue virus type 1 (see, e.g., GenBank Acc. Nos. AB195673;
  • Dengue virus type 2 (see, e.g., GenBank Acc. Nos. viruses 1 to 4, Colorado NC_001474; AY702040; AY702039; AY702037).
  • Dengue virus type tick fever virus, Sindbis 3 (see, e.g., GenBank Acc. Nos. AY923865; AT858043).
  • Dengue virus, Togaviraidae, virus type 4 (see, e.g., GenBank Acc. Nos. AY947539; AY947539; Flaviviridae, AF326573). Sindbis virus (see, e.g., GenBank Acc. Nos. NC_001547;
  • Poxvirus including Viriola virus (see, e.g., GenBank Acc. Nos. NC_001611; Y16780; orthopoxvirus (variola X72086; X69198).
  • SAAV Saaremaa
  • Flaviviruses including See, e.g., Mukhopadhyay, et al. (2005) Nature Rev. Microbiol. 3: 13- Dengue virus, Japanese 22. GenBank Acc. Nos NC_001474 and AY702040 (Dengue).
  • Measles virus See, e.g., GenBank Acc. Nos. AB040874 and AY486084.
  • Human Human parainfluenza virus 2 (see, e.g., GenBank Acc. Nos.
  • parainfluenzaviruses AB 176531 ; NC003443 Human parainfluenza virus 3 (see, e.g., (HPV), including HPV GenBank Acc. No. NC_001796).
  • Influenza virus including Influenza nucleocapsid (see, e.g., GenBank Acc. No. AY626145). influenza virus types A, Influenza hemagglutinin (see, e.g., GenBank Acc. Nos. AY627885; B, and C. AY555153). Influenza neuraminidase (see, e.g., GenBank Acc. Nos.
  • Influenza matrix protein 2 see, e.g., GenBank Acc. Nos. AY626144(.
  • Influenza basic protein 1 see, e.g., Antigen Reference
  • Influenza A viruses of Hemagglutinin of H1N1 (GenBank Acc. No. S67220). Influenza A various subtypes that virus matrix protein (GenBank Acc. No. AY700216). Influenza virus originate from other A H5H1 nucleoprotein (GenBank Acc. No. AY646426). H1N1 species:, e.g., swine haemagglutinin (GenBank Acc. No. D00837). See also, GenBank influenza viruses (SIV) Acc. Nos. BD006058; BD006055; BD006052. See also, e.g., (e.g. H1N1) and avian Wentworth, et al. (1994) J. Virol. 68:2051-2058; Wells, et al. (1991) influenza virus (AIV) J.A.M.A. 265:478-481.
  • SIV GenBank influenza viruses
  • Respiratory syncytial Respiratory syncytial virus (see, e.g., GenBank Acc. Nos. virus (RSV), including AY353550; NC_001803; NC001781).
  • Rotaviruses including Human rotavirus C segment 8 (GenBank Acc. No. AJ549087); human rotaviruses A to E, Human rotavirus G9 strain outer capsid protein (see, e.g., GenBank bovine rotavirus, rhesus Acc. No. DQ056300); Human rotavirus B strain non-structural monkey rotavirus, and protein 4 (see, e.g., GenBank Acc. No. AY548957); human rotavirus human-RVV A strain major inner capsid protein (see, e.g., GenBank Acc. No. reassortments. AY601554).
  • Polyomavirus including See, e.g., Engels, et al. (2004) J. Infect. Dis. 190:2065-2069; Vilchez simian virus 40 (SV40), and Butel (2004) Clin. Microbiol. Rev. 17:495-508; Shivapurkar, et JC virus (JCV) and BK al. (2004) Cancer Res. 64:3757-3760; Carbone, et al. (2003) virus (BKV). Oncogene 2:5173-5180; Barbanti-Brodano, et al. (2004) Virology
  • Coltiviruses including Attoui, et al. (1998) J. Gen. Virol. 79:2481-2489. Segments of Eyach Colorado tick fever virus, virus (see, e.g., GenBank Acc. Nos. AF282475; AF282472;
  • NC 003703 NC 003704; NC 003705: NC 003696: NC 003697: NC 003698: NC 003699: NC 003701 : NC 003706: NC 003700: AF282471 : AF282477).
  • Calciviruses including Snow Mountain virus (see, e.g., GenBank Acc. No. AY134748). the genogroups Norwalk,
  • Parvoviridae including See, e.g., Brown (2004) Dev. Biol. (Basel) 118:71-77; Alvarez- dependovirus, parvovirus Lafuente, et al. (2005) Ann. Rheum. Dis. 64:780-782; Ziyaeyan, et al. (including (2005) Jpn. J. Infect. Dis. 58:95-97; Kaufman, et al. (2005) Virology parvovirus B19), and 332: 189-198.
  • Streptococcus agalactia Group B Strep
  • Streptococcus pneumonia Staphylococcus aureus
  • Escherichia coli Haemophilus influenzae
  • Neisseria meningitidis Neisseria gonorrheae
  • Vibrio cholerae Salmonella species (including typhi, typhimurium)
  • enterica including Helicobacter pylori Shigella flexneri and other Group D shigella species
  • Burkholderia mallei Burkholderia pseudomallei
  • Klebsiella pneumonia Clostridium species (including C. difficile), Vibrio parahaemolyticus and V. vulnificus.
  • This list is not meant to be limiting.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention ⁇ e.g., antibody 27A or a humanized version thereof
  • an inhibitor ⁇ e.g., a small organic molecule or an antibody or antigen-binding fragment thereof
  • an MTOR mimmalian target of rapamycin
  • a cytotoxic agent such as: an MTOR (mammalian target of rapamycin) inhibitor, a cytotoxic agent, a platinum agent, an EGFR inhibitor, a VEGF inhibitor, a microtubule stabilizer, a taxane, a CD20 inhibitor, a CD52 inhibitor, a CD30 inhibitor, a RANK (Receptor activator of nuclear factor kappa-B) inhibitor, a RANKL (Receptor activator of nuclear factor kappa-B ligand) inhibitor, an ERK inhibitor, a MAP Kinase inhibitor, an AKT inhibitor, a MEK inhibitor, a PI3K inhibitor, a HER
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g., antibody 27A or a humanized version thereof) is in association with any one or more of: 13-cis-retinoic acid, 3-[5-
  • cyproteroneacetate cytarabine, cytosinearabinoside, dacarbazine, dacinostat, dactinomycin, dalotuzumab, danusertib, dasatanib, daunorubicin, decatanib, deguelin, denileukin, deoxycoformycin, depsipeptide, diarylpropionitrile, diethylstilbestrol, diftitox, docetaxel, dovitinib, doxorubicin, droloxifene, edotecarin, yttrium-90 labeled-edotreotide, edotreotide, EKB-569, EMD121974, endostatin, enzalutamide, enzastaurin, epirubicin, epithilone B, ERA-923, Erbitux, erlotinib, estradiol, estramustine, etoposide, everoli
  • fluoxymesterone flutamide, FOLFOX regimen, Fulvestrant, galeterone, gefitinib,
  • gemcitabine gimatecan, goserelin, goserelin acetate, gossypol, GSK461364, GSK690693, HMR-3339, hydroxyprogesteronecaproate, hydroxyurea, IC87114, idarubicin, idoxyfene, ifosfamide, IM862, imatinib, IMC-1C11, INCB24360, INO1001, interferon, interleukin-12, ipilimumab, irinotecan, JNJ-16241199, ketoconazole, KRX-0402, lapatinib, lasofoxifene, letrozole, leucovorin, leuprolide, leuprolide acetate, levamisole, liposome entrapped paclitaxel, lomustine, lonafarnib, lucanthone, LY292223, LY292696, LY293646, LY2936
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27A or a humanized version thereof) is in association with one or more antiemetics including, but not limited to: casopitant
  • NK- 1 receptor antagonists palonosetron (sold as Aloxi by MGI Pharma), aprepitant (sold as Emend by Merck and Co.; Rahway, NJ), diphenhydramine (sold as Benadryl® by Pfizer; New York, NY), hydroxyzine (sold as Atarax® by Pfizer; New York, NY), metoclopramide (sold as Reglan® by AH Robins Co,; Richmond, VA), lorazepam (sold as Ativan® by Wyeth; Madison, NJ), alprazolam (sold as Xanax® by Pfizer; New York, NY), haloperidol (sold as Haldol® by Ortho-McNeil; Raritan, NJ), droperidol (Inapsine®), dronabinol (sold as Marinol® by Solvay Pharmaceuticals, Inc.; Marietta, GA
  • prochlorperazine sold as Compazine® by Glaxosmithkline; Research Triangle Park, NC
  • granisetron sold as Kytril® by Hoffmann-La Roche Inc.; Nutley, NJ
  • ondansetron sold as Zofran® by Glaxosmithkline; Research Triangle Park, NC
  • dolasetron sold as Anzemet® by Sanofi-Aventis; New York, NY
  • tropisetron sold as Navoban® by Novartis; East Hanover, NJ.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27 A or a humanized version thereof) is in association with an agent which treats or prevents such a deficiency, such as, e.g. , filgrastim, PEG-filgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.
  • an agent which treats or prevents such a deficiency such as, e.g. , filgrastim, PEG-filgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is administered in association with anti-cancer radiation therapy.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention e.g. , antibody 27A or a humanized version thereof
  • is administered in association with anti-cancer radiation therapy e.g., in an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention.
  • the radiation therapy is external beam therapy (EBT): a method for delivering a beam of high-energy X-rays to the location of the tumor.
  • the beam is generated outside the patient (e.g. , by a linear accelerator) and is targeted at the tumor site.
  • EBT external beam therapy
  • the radiation therapy is proton beam therapy: a type of conformal therapy that bombards the diseased tissue with protons instead of X-rays.
  • the radiation therapy is conformal external beam radiation therapy: a procedure that uses advanced technology to tailor the radiation therapy to an individual's body structures.
  • the radiation therapy is brachytherapy: the temporary placement of radioactive materials within the body, usually employed to give an extra dose— or boost— of radiation to an area.
  • a surgical procedure that can be applied in association with an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention is surgical tumorectomy.
  • the term "in association with” indicates that the components administered in a method of the present invention (e.g. , an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g. , antibody 27 A or a humanized version thereof) along with pembrolizumab) can be formulated into a single composition for simultaneous delivery or formulated separately into two or more compositions (e.g. , a kit).
  • Each component can be administered to a subject at a different time than when the other component is administered; for example, each administration may be given non-simultaneously (e.g. , separately or sequentially) at several intervals over a given period of time.
  • the separate components may be administered to a subject by the same or by a different route.
  • the anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention may be used as affinity purification agent.
  • the anti-CTLA-4 antibodies and antigen-binding fragments thereof are immobilized on a solid phase such a Sephadex, glass or agarose resin or filter paper, using methods well known in the art.
  • the immobilized antibody or fragment is contacted with a sample containing the CTLA-4 protein (or a fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the CTLA-4 protein, which is bound to the immobilized antibody or fragment. Finally, the support is washed with a solvent which elutes the bound CTLA-4 (e.g., protein A).
  • a solvent which elutes the bound CTLA-4 e.g., protein A
  • antigens for generating secondary antibodies which are useful for example for performing Western blots and other immunoassays discussed herein.
  • Anti-CTLA-4 antibodies e.g. , humanized antibodies
  • antigen-binding fragments thereof may also be useful in diagnostic assays for CTLA-4 protein, e.g., detecting its expression in specific cells, tissues, or serum, e.g. , tumor cells such as melanoma cells.
  • diagnostic methods may be useful in various disease diagnoses.
  • the present invention includes ELISA assays (enzyme-linked immunosorbent assay) incorporating the use of an anti-CTLA-4 antibody or antigen-binding fragment thereof disclosed herein (e.g., antibody 27A or a humanized version thereof).
  • such a method comprises the following steps:
  • a substrate e.g. , surface of a microtiter plate well, e.g. , a plastic plate
  • anti- CTLA-4 antibody or antigen-binding fragment thereof
  • detectably labeled antibodies e.g., enzyme-linked antibodies which are also specific to the CTLA-4 antigen
  • the labeled antibody or antigen-binding fragment thereof is labeled with peroxidase which react with ABTS (e.g. , 2,2'-azino-bis(3-ethylbenzthiazoline- 6-sulphonic acid)) or 3,3' ,5,5'-Tetramethylbenzidine to produce a color change which is detectable.
  • ABTS e.g. , 2,2'-azino-bis(3-ethylbenzthiazoline- 6-sulphonic acid)
  • 3,3' ,5,5'-Tetramethylbenzidine e.g. , 2,2'-azino-bis(3-ethylbenzthiazoline- 6-sulphonic acid)
  • 3,3' ,5,5'-Tetramethylbenzidine e.g. , 2,2'-azino-bis(3-ethylbenzthiazoline- 6-sulphonic acid)
  • 3,3' ,5,5'-Tetramethylbenzidine e.g.
  • An anti- CTLA-4 antibody or antigen-binding fragment thereof of the invention may be used in a Western blot or immune-protein blot procedure.
  • a procedure forms part of the present invention and includes e.g. :
  • Such a membrane may take the form of a nitrocellulose or vinyl-based (e.g. , polyvinylidene fluoride (PVDF)) membrane to which the proteins to be tested for the presence of CTLA-4 in a non-denaturing PAGE (polyacrylamide gel electrophoresis) gel or SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) gel have been transferred (e.g. , following electrophoretic separation in the gel).
  • PAGE polyacrylamide gel electrophoresis
  • SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
  • Detection of the bound antibody or fragment indicates that the CTLA-4 protein is present on the membrane or substrate and in the sample. Detection of the bound antibody or fragment may be by binding the antibody or fragment with a secondary antibody (an anti- immunoglobulin antibody) which is detectably labeled and, then, detecting the presence of the secondary antibody.
  • a secondary antibody an anti- immunoglobulin antibody
  • anti-CTLA-4 antibodies and antigen-binding fragments thereof disclosed herein may also be used for
  • Such a method forms part of the present invention and comprises, e.g.,
  • a cell e.g. , a tumor cell such as a melanoma cell
  • a cell e.g. , a tumor cell such as a melanoma cell
  • the antibody or fragment itself is detectably labeled, it can be detected directly. Alternatively, the antibody or fragment may be bound by a detectably labeled secondary antibody which is detected.
  • Certain anti-CTLA-4 antibodies and antigen-binding fragments thereof disclosed herein may also be used for in vivo tumor imaging.
  • Such a method may include injection of a radiolabeled anti-CTLA-4 antibody or antigen-binding fragment thereof into the body of a patient to be tested for the presence of a tumor associated with CTLA-4 expression (e.g. , which expresses CTLA-4, for example, on tumor-infiltrating lymphocytes) followed by nuclear imaging of the body of the patient to detect the presence of the labeled antibody or fragment e.g., at loci comprising a high concentration of the antibody or fragment which are bound to the tumor. The detection of the loci indicates the presence of the CTLA-4 + cells in the tumor.
  • Imaging techniques include SPECT imaging (single photon emission computed tomography) or PET imaging (positron emission tomography).
  • Labels include e.g. , iodine- 123 ( 123 I) and technetium-99m ( 99m Tc), e.g. , in conjunction with SPECT imaging or n C, 13 N,
  • O or F in conjunction with PET imaging or Indium- 111 (See e.g. , Gordon et ah, (2005) International Rev. Neurobiol. 67:385-440).
  • the antibody or antigen -binding fragment thereof is admixed with a pharmaceutically acceptable carrier or excipient. See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, PA (1984).
  • Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman 's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, NY; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, NY; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al.
  • Toxicity and therapeutic efficacy of the antibodies of the invention, administered alone or in combination with another therapeutic agent can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD 50 (the dose lethal to 50% of the population) and the ED 50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index (LD 50 / ED 50 ).
  • the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
  • the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED 50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration.
  • a further therapeutic agent that is administered to a subject in association with an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention (e.g., antibody 27A or humanized versions thereof) in accordance with the Physicians' Desk Reference 2003 (Thomson Healthcare; 57th edition (November 1, 2002)).
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof of the invention e.g., antibody 27A or humanized versions thereof
  • the mode of administration can vary. Routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra- arterial.
  • the anti-CTLA-4 antibodies or antigen-binding fragments thereof of the invention can be administered by an invasive route such as by injection.
  • an anti-CTLA-4 antibody or antigen-binding fragment thereof, or pharmaceutical composition thereof is administered intravenously, subcutaneously, intramuscularly, intraarterially, intratumorally, or by inhalation, aerosol delivery.
  • Administration by noninvasive routes e.g. , orally; for example, in a pill, capsule or tablet
  • noninvasive routes e.g. , orally; for example, in a pill, capsule or tablet
  • the present invention provides a vessel (e.g. , a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder) comprising any of the antibodies or antigen-binding fragments of the invention (e.g., antibody 27 A and humanized versions thereof) or a pharmaceutical composition thereof.
  • a vessel e.g. , a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder
  • an injection device comprising any of the antibodies or antigen-binding fragments of the invention (e.g., antibody 27A and humanized versions thereof) or a pharmaceutical composition thereof.
  • An injection device is a device that introduces a substance into the body of a patient via a parenteral route, e.g., intramuscular, subcutaneous or intravenous.
  • an injection device may be a syringe (e.g. , pre-filled with the pharmaceutical composition, such as an auto-injector) which, for example, includes a cylinder or barrel for holding fluid to be injected (e.g., antibody or fragment or a pharmaceutical composition thereof), a needle for piecing skin and/or blood vessels for injection of the fluid; and a plunger for pushing the fluid out of the cylinder and through the needle bore.
  • an injection device that comprises an antibody or antigen-binding fragment thereof of the present invention or a pharmaceutical composition thereof is an intravenous (IV) injection device.
  • Such a device includes the antibody or fragment or a pharmaceutical composition thereof in a cannula or trocar/needle which may be attached to a tube which may be attached to a bag or reservoir for holding fluid (e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KC1, CaCl 2 and optionally including glucose) introduced into the body of the patient through the cannula or trocar/needle.
  • fluid e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KC1, CaCl 2 and optionally including glucose
  • the antibody or fragment or a pharmaceutical composition thereof may, in an embodiment of the invention, be introduced into the device once the trocar and cannula are inserted into the vein of a subject and the trocar is removed from the inserted cannula.
  • the IV device may, for example, be inserted into a peripheral vein (e.g.
  • an injection device is an autoinjector; a jet injector or an external infusion pump.
  • a jet injector uses a high-pressure narrow jet of liquid which penetrate the epidermis to introduce the antibody or fragment or a pharmaceutical composition thereof to a patient' s body.
  • External infusion pumps are medical devices that deliver the antibody or fragment or a pharmaceutical composition thereof into a patient's body in controlled amounts.
  • External infusion pumps may be powered electrically or mechanically.
  • Different pumps operate in different ways, for example, a syringe pump holds fluid in the reservoir of a syringe, and a moveable piston controls fluid delivery, an elastomeric pump holds fluid in a stretchable balloon reservoir, and pressure from the elastic walls of the balloon drives fluid delivery.
  • a peristaltic pump a set of rollers pinches down on a length of flexible tubing, pushing fluid forward.
  • fluids can be delivered from multiple reservoirs at multiple rates.
  • the pharmaceutical compositions disclosed herein may also be administered with a needleless hypodermic injection device; such as the devices disclosed in U.S. Patent Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851 ; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556.
  • a needleless hypodermic injection device such as the devices disclosed in U.S. Patent Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851 ; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556.
  • Such needleless devices comprising the pharmaceutical composition are also part of the present invention.
  • the pharmaceutical compositions disclosed herein may also be administered by infusion. Examples of well-known implants and modules for administering the pharmaceutical compositions include those disclosed in: U.S. Patent No. 4,487,603, which discloses an implantable micro-
  • Patent No. 4,447,233 which discloses a medication infusion pump for delivering medication at a precise infusion rate
  • U.S. Patent No. 4,447,224 which discloses a variable flow implantable infusion apparatus for continuous drug delivery
  • U.S. Patent. No. 4,439,196 which discloses an osmotic drug delivery system having multi-chamber compartments.
  • Many other such implants, delivery systems, and modules are well known to those skilled in the art and those comprising the pharmaceutical compositions of the present invention are within the scope of the present invention.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Public Health (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oncology (AREA)
  • Cell Biology (AREA)
  • Communicable Diseases (AREA)
  • Hematology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/IB2017/054697 2016-08-02 2017-08-01 Antibodies against human ctla-4 Ceased WO2018025178A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
JP2019505381A JP7214623B2 (ja) 2016-08-02 2017-08-01 ヒトctla-4に対する抗体
CN201780060282.6A CN110088134B (zh) 2016-08-02 2017-08-01 针对人ctla-4的抗体
EP17752494.9A EP3494137B1 (en) 2016-08-02 2017-08-01 Antibodies against human ctla-4
ES17752494T ES3038117T3 (en) 2016-08-02 2017-08-01 Antibodies against human ctla-4
JP2021166154A JP7440473B2 (ja) 2016-08-02 2021-10-08 ヒトctla-4に対する抗体

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
NL2017270A NL2017270B1 (en) 2016-08-02 2016-08-02 New anti-hCTLA-4 antibodies
NL2017270 2016-08-02

Publications (1)

Publication Number Publication Date
WO2018025178A1 true WO2018025178A1 (en) 2018-02-08

Family

ID=57104133

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2017/054697 Ceased WO2018025178A1 (en) 2016-08-02 2017-08-01 Antibodies against human ctla-4

Country Status (9)

Country Link
US (1) US10808030B2 (https=)
EP (1) EP3494137B1 (https=)
JP (2) JP7214623B2 (https=)
CN (1) CN110088134B (https=)
AR (1) AR109276A1 (https=)
ES (1) ES3038117T3 (https=)
NL (1) NL2017270B1 (https=)
TW (1) TW201808997A (https=)
WO (1) WO2018025178A1 (https=)

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020020275A1 (zh) * 2018-07-25 2020-01-30 南京金斯瑞生物科技有限公司 人源化抗人ctla4单克隆抗体及其制备方法和用途
WO2020058762A1 (en) * 2018-09-20 2020-03-26 Tikcro Technologies Ltd Antibodies specific to ctla-4 and uses thereof
WO2020127377A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Bifunctional anti-pd-1/il-7 molecule
WO2020165374A1 (en) 2019-02-14 2020-08-20 Ose Immunotherapeutics Bifunctional molecule comprising il-15ra
WO2021122866A1 (en) 2019-12-17 2021-06-24 Ose Immunotherapeutics Bifunctional molecules comprising an il-7 variant
WO2022017428A1 (zh) * 2020-07-21 2022-01-27 上海君实生物医药科技股份有限公司 抗ctla-4抗体及其用途
WO2022112198A1 (en) 2020-11-24 2022-06-02 Worldwide Innovative Network Method to select the optimal immune checkpoint therapies
WO2022214653A1 (en) 2021-04-09 2022-10-13 Ose Immunotherapeutics New scaffold for bifunctional molecules with improved properties
WO2022214652A1 (en) 2021-04-09 2022-10-13 Ose Immunotherapeutics Scaffold for bifunctioanl molecules comprising pd-1 or cd28 and sirp binding domains
US20220324968A1 (en) * 2019-04-18 2022-10-13 Kymab Limited Antagonists anti-cd7 antibodies
EP3902821A4 (en) * 2018-12-27 2022-11-30 Gigagen, Inc. ANTI-CTLA-4 BINDING PROTEINS AND METHODS OF USE THEREOF
WO2024003360A1 (en) 2022-07-01 2024-01-04 Institut Curie Biomarkers and uses thereof for the treatment of neuroblastoma
WO2024028386A1 (en) 2022-08-02 2024-02-08 Ose Immunotherapeutics Multifunctional molecule directed against cd28
RU2822460C2 (ru) * 2019-07-15 2024-07-05 Интервет Интернэшнл Б.В. Канинизированные антитела против человеческого ctla-4
WO2024200820A1 (en) 2023-03-30 2024-10-03 Ose Immunotherapeutics Method of synthesis of targeted lipid nanoparticle and uses thereof
WO2024200823A1 (en) 2023-03-30 2024-10-03 Ose Immunotherapeutics Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell enhancing molecule and use thereof
US12240899B2 (en) 2020-06-22 2025-03-04 Ngm Biopharmaceuticals, Inc. LAIR-1-binding agents and methods of use thereof
WO2025061994A1 (en) 2023-09-21 2025-03-27 Domain Therapeutics Anti-ccr8 monoclonal antibodies and their therapeutic use
WO2025061993A1 (en) 2023-09-21 2025-03-27 Domain Therapeutics Anti-ccr8 monoclonal antibodies and their therapeutic use
US12331127B2 (en) 2020-03-06 2025-06-17 Regeneron Pharmaceuticals, Inc. Therapeutic uses of anti-GITR antibodies
WO2025242835A1 (en) 2024-05-22 2025-11-27 Ose Immunotherapeutics Molecules comprising masking linkers and uses thereof for the treatment of cancer
US12552864B2 (en) 2019-07-15 2026-02-17 Intervet Inc. Caninized antibodies to human CTLA-4
WO2026068705A1 (en) 2024-09-26 2026-04-02 Ose Immunotherapeutics Lipid-based nanoparticles comprising non-glycosylated fc domains and uses thereof

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017207814A1 (en) 2016-06-02 2017-12-07 Ultimovacs As A vaccine in combination with an immune checkpoint inhibitor for use in treating cancer
US12139536B2 (en) * 2017-06-08 2024-11-12 Antibody Biopharm Inc. Guided combinational therapeutic antibody
CN110272490B (zh) * 2018-03-14 2021-05-14 上海开拓者生物医药有限公司 靶向ctla-4抗体、其制备方法和用途
CN115991787A (zh) 2018-06-05 2023-04-21 江苏康宁杰瑞生物制药有限公司 二聚体及其用途
EP3617230A1 (en) 2018-09-03 2020-03-04 BioInvent International AB Novel antibodies and nucleotide sequences, and uses thereof
CN113121689B (zh) * 2020-01-16 2022-08-19 三优生物医药(上海)有限公司 Ctla-4结合分子及其用途
EP4114863A4 (en) * 2020-03-05 2024-04-24 Merck Sharp & Dohme LLC METHODS OF TREATING CANCER OR INFECTION USING A COMBINATION OF AN ANTI-PD-1 ANTIBODY, AN ANTI-CTLA4 ANTIBODY AND AN ANTI-TIGIT ANTIBODY
WO2021195472A1 (en) * 2020-03-26 2021-09-30 Aetio Biotherapy, Inc. Bi-specific fusion proteins for depletion of regulatory t cells
US12559565B2 (en) * 2020-04-13 2026-02-24 Biosion Inc. Antibodies binding CTLA4 and uses thereof
CA3184082A1 (en) * 2020-07-02 2022-01-06 David Scott Johnson Anti-ctla-4 binding proteins and methods of use thereof
CN114437228B (zh) * 2020-10-30 2024-02-06 中国科学院生物物理研究所 一种il-2与抗体亚单位构成的双功能融合蛋白
US20260053913A1 (en) * 2022-06-10 2026-02-26 Bioentre Llc Combinations of ctla4 binding proteins and methods of treating cancer

Citations (89)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4439196A (en) 1982-03-18 1984-03-27 Merck & Co., Inc. Osmotic drug delivery system
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
EP0154316A2 (en) 1984-03-06 1985-09-11 Takeda Chemical Industries, Ltd. Chemically modified lymphokine and production thereof
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
EP0216846A1 (en) 1985-04-01 1987-04-08 Celltech Ltd Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same.
EP0256055A1 (en) 1986-01-23 1988-02-24 Celltech Ltd RECOMBINANT DNA SEQUENCES, THESE VECTORS, AND METHODS OF USE THEREOF.
WO1988001649A1 (en) 1986-09-02 1988-03-10 Genex Corporation Single polypeptide chain binding molecules
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0323997A1 (en) 1987-07-23 1989-07-19 Celltech Limited Recombinant dna expression vectors
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
EP0401384A1 (en) 1988-12-22 1990-12-12 Kirin-Amgen, Inc. Chemically modified granulocyte colony stimulating factor
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
WO1994025591A1 (en) 1993-04-29 1994-11-10 Unilever N.V. PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE)
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US5413923A (en) 1989-07-25 1995-05-09 Cell Genesys, Inc. Homologous recombination for universal donor cells and chimeric mammalian hosts
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5532210A (en) 1994-06-08 1996-07-02 E. I. Du Pont De Nemours And Company High temperature superconductor dielectric slow wave structures for accelerators and traveling wave tubes
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5571698A (en) 1988-09-02 1996-11-05 Protein Engineering Corporation Directed evolution of novel binding proteins
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5637483A (en) 1991-10-04 1997-06-10 Whitehead Institute For Biomedical Research Irradiated tumor cell vaccine engineered to express GM-CSF
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5904920A (en) 1991-10-04 1999-05-18 Whitehead Institute For Biomedical Research Regulation of systemic immune responses utilizing cytokines and antigens
US5932448A (en) 1991-11-29 1999-08-03 Protein Design Labs., Inc. Bispecific antibody heterodimers
US5939598A (en) 1990-01-12 1999-08-17 Abgenix, Inc. Method of making transgenic mice lacking endogenous heavy chains
US5985290A (en) 1995-12-28 1999-11-16 Johns Hopkins University School Of Medicine Purified pancreatic tumor cell lines and related compositions and method
US6005079A (en) 1992-08-21 1999-12-21 Vrije Universiteit Brussels Immunoglobulins devoid of light chains
US6057098A (en) 1997-04-04 2000-05-02 Biosite Diagnostics, Inc. Polyvalent display libraries
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US6096002A (en) 1998-11-18 2000-08-01 Bioject, Inc. NGAS powered self-resetting needle-less hypodermic jet injection apparatus and method
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US6129914A (en) 1992-03-27 2000-10-10 Protein Design Labs, Inc. Bispecific antibody effective to treat B-cell lymphoma and cell line
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO2001014424A2 (en) * 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
US6277368B1 (en) 1996-07-25 2001-08-21 The Regents Of The University Of California Cancer immunotherapy using autologous tumor cells combined with cells expressing a membrane cytokine
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
US6329511B1 (en) 1998-12-01 2001-12-11 Protein Design Labs, Inc. Humanized antibodies to γ-interferon
WO2002031240A2 (en) 2000-10-06 2002-04-18 Milliken & Company Face plate for spun-like textured yarn
US20020086014A1 (en) 1999-08-24 2002-07-04 Korman Alan J. Human CTLA-4 antibodies and their uses
EP1229125A1 (en) 1999-10-19 2002-08-07 Kyowa Hakko Kogyo Co., Ltd. Process for producing polypeptide
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US6620135B1 (en) 1998-08-19 2003-09-16 Weston Medical Limited Needleless injectors
WO2003086310A2 (en) 2002-04-12 2003-10-23 Ramot At Tel Aviv University Ltd. Prevention of brain inflammation as a result of induced autoimmune response
US6946292B2 (en) 2000-10-06 2005-09-20 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions with increased antibody dependent cytotoxic activity
WO2005120571A2 (en) 2004-06-07 2005-12-22 Ramot At Tel Aviv University Ltd. Method of passive immunization against disease or disorder characterized by amyloid aggregation with diminished risk of neuroinflammation
WO2006014679A1 (en) 2004-07-21 2006-02-09 Glycofi, Inc. Immunoglobulins comprising predominantly a glcnac2man3glcnac2 glycoform
US20060040887A1 (en) 2004-03-15 2006-02-23 Karaolis David K Method for stimulating the immune, inflammatory or neuroprotective response
US7029872B2 (en) 2000-06-28 2006-04-18 Glycofi, Inc Methods for producing modified glycoproteins
WO2006057702A2 (en) 2004-11-24 2006-06-01 Novare Surgical Systems, Inc. Hand-actuated device for remote manipulation of a grasping tool
WO2006066568A2 (de) * 2004-12-23 2006-06-29 Tegenero Ag Monokonale agonistische anti-ctla-4 antikörper
US7125689B2 (en) 1997-05-21 2006-10-24 Biovation Limited Method for rendering streptokinase less immunogenic to a human
WO2007054279A2 (en) 2005-11-08 2007-05-18 Helmholtz-Zentrum für Infektionsforschung GmbH Cyclic-dinucleotides and its conjugates as adjuvants and their uses in pharmaceutical compositions
WO2007113648A2 (en) 2006-04-05 2007-10-11 Pfizer Products Inc. Ctla4 antibody combination therapy
US7449308B2 (en) 2000-06-28 2008-11-11 Glycofi, Inc. Combinatorial DNA library for producing modified N-glycans in lower eukaryotes
WO2009100140A1 (en) * 2008-02-04 2009-08-13 Medarex, Inc. Anti-clta-4 antibodies with reduced blocking of binding of ctla-4 to b7 and uses thereof
US7592326B2 (en) 2004-03-15 2009-09-22 Karaolis David K R Method for stimulating the immune, inflammatory or neuroprotective response
US20100150946A1 (en) 2008-08-28 2010-06-17 Cell Genesys, Inc. Methods and Compositions for Treating Prostate Cancer or Inducing a Humoral Immune Response Against Prostate Cancer
US20120041057A1 (en) 2010-08-10 2012-02-16 Jones Roger A SYNTHESIS AND CHARACTERIZATION OF C8 ANALOGS OF c-di-GMP
WO2014093936A1 (en) 2012-12-13 2014-06-19 Aduro Biotech, Inc. Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use
WO2014179760A1 (en) 2013-05-03 2014-11-06 The Regents Of The University Of California Cyclic di-nucleotide induction of type i interferon
WO2014179335A1 (en) 2013-04-29 2014-11-06 Memorial Sloan Kettering Cancer Center Compositions and methods for altering second messenger signaling
WO2014189805A1 (en) 2013-05-18 2014-11-27 Auro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
WO2016096174A1 (en) 2014-12-16 2016-06-23 Invivogen Fluorinated cyclic dinucleotides for cytokine induction
WO2017011444A1 (en) 2015-07-13 2017-01-19 The Wistar Institute Of Anatomy And Biology Methods and compositions for treating b cell cancers
WO2017027645A1 (en) 2015-08-13 2017-02-16 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB8809129D0 (en) 1988-04-18 1988-05-18 Celltech Ltd Recombinant dna methods vectors and host cells
US5351481A (en) 1992-06-26 1994-10-04 Flowmaster, Inc. Muffler assembly with balanced chamber and method
WO1996034093A1 (en) 1995-04-25 1996-10-31 Baxter International Inc. Composition containing collagenase and chymopapain for isolating hepatocytes and pancreatic islet cells
DK1141028T3 (da) 1998-12-23 2010-05-25 Pfizer Humane monoklonale antistoffer til CTLA-4
EP1261376A1 (en) 2000-01-27 2002-12-04 Genetics Institute, LLC Antibodies against ctla4(cd152), conjugates comprising same, and uses thereof
US20020150588A1 (en) 2000-09-21 2002-10-17 Allison James P. SPAS-1 cancer antigen
ES2639222T5 (es) 2000-10-06 2023-11-24 Kyowa Kirin Co Ltd Células que producen unas composiciones de anticuerpo
AU2004281834A1 (en) 2003-10-15 2005-04-28 Cerus Corporation Listeria-based EphA2 vaccines
US7968300B2 (en) 2007-11-21 2011-06-28 Li-Te Chin Method of isolating regulatory T cells from human samples
RS57630B1 (sr) 2010-11-17 2018-11-30 Aduro Biotech Inc Metode i sastavi za uzrokovanje imunog odgovora na egfrviii
JO3663B1 (ar) * 2014-08-19 2020-08-27 Merck Sharp & Dohme الأجسام المضادة لمضاد lag3 وأجزاء ربط الأنتيجين
WO2018035710A1 (en) * 2016-08-23 2018-03-01 Akeso Biopharma, Inc. Anti-ctla4 antibodies
WO2018106862A1 (en) * 2016-12-07 2018-06-14 Agenus Inc. Anti-ctla-4 antibodies and methods of use thereof

Patent Citations (103)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4439196A (en) 1982-03-18 1984-03-27 Merck & Co., Inc. Osmotic drug delivery system
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US6331415B1 (en) 1983-04-08 2001-12-18 Genentech, Inc. Methods of producing immunoglobulins, vectors and transformed host cells for use therein
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0154316A2 (en) 1984-03-06 1985-09-11 Takeda Chemical Industries, Ltd. Chemically modified lymphokine and production thereof
US5807715A (en) 1984-08-27 1998-09-15 The Board Of Trustees Of The Leland Stanford Junior University Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
EP0216846A1 (en) 1985-04-01 1987-04-08 Celltech Ltd Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same.
EP0256055A1 (en) 1986-01-23 1988-02-24 Celltech Ltd RECOMBINANT DNA SEQUENCES, THESE VECTORS, AND METHODS OF USE THEREOF.
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1988001649A1 (en) 1986-09-02 1988-03-10 Genex Corporation Single polypeptide chain binding molecules
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
EP0323997A1 (en) 1987-07-23 1989-07-19 Celltech Limited Recombinant dna expression vectors
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5571698A (en) 1988-09-02 1996-11-05 Protein Engineering Corporation Directed evolution of novel binding proteins
EP0401384A1 (en) 1988-12-22 1990-12-12 Kirin-Amgen, Inc. Chemically modified granulocyte colony stimulating factor
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US5413923A (en) 1989-07-25 1995-05-09 Cell Genesys, Inc. Homologous recombination for universal donor cells and chimeric mammalian hosts
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
US5939598A (en) 1990-01-12 1999-08-17 Abgenix, Inc. Method of making transgenic mice lacking endogenous heavy chains
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5904920A (en) 1991-10-04 1999-05-18 Whitehead Institute For Biomedical Research Regulation of systemic immune responses utilizing cytokines and antigens
US5637483A (en) 1991-10-04 1997-06-10 Whitehead Institute For Biomedical Research Irradiated tumor cell vaccine engineered to express GM-CSF
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
US5932448A (en) 1991-11-29 1999-08-03 Protein Design Labs., Inc. Bispecific antibody heterodimers
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US6350861B1 (en) 1992-03-09 2002-02-26 Protein Design Labs, Inc. Antibodies with increased binding affinity
US6129914A (en) 1992-03-27 2000-10-10 Protein Design Labs, Inc. Bispecific antibody effective to treat B-cell lymphoma and cell line
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US5399163A (en) 1992-07-24 1995-03-21 Bioject Inc. Needleless hypodermic injection methods and device
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
US6005079A (en) 1992-08-21 1999-12-21 Vrije Universiteit Brussels Immunoglobulins devoid of light chains
WO1994025591A1 (en) 1993-04-29 1994-11-10 Unilever N.V. PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE)
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5532210A (en) 1994-06-08 1996-07-02 E. I. Du Pont De Nemours And Company High temperature superconductor dielectric slow wave structures for accelerators and traveling wave tubes
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6033674A (en) 1995-12-28 2000-03-07 Johns Hopkins University School Of Medicine Method of treating cancer with a tumor cell line having modified cytokine expression
US6350445B1 (en) 1995-12-28 2002-02-26 Johns Hopkins University School Of Medicine Method of treating cancer with a tumor cell line having modified cytokine expression
US5985290A (en) 1995-12-28 1999-11-16 Johns Hopkins University School Of Medicine Purified pancreatic tumor cell lines and related compositions and method
US6277368B1 (en) 1996-07-25 2001-08-21 The Regents Of The University Of California Cancer immunotherapy using autologous tumor cells combined with cells expressing a membrane cytokine
WO1998024893A2 (en) 1996-12-03 1998-06-11 Abgenix, Inc. TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
US6057098A (en) 1997-04-04 2000-05-02 Biosite Diagnostics, Inc. Polyvalent display libraries
US7125689B2 (en) 1997-05-21 2006-10-24 Biovation Limited Method for rendering streptokinase less immunogenic to a human
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US6620135B1 (en) 1998-08-19 2003-09-16 Weston Medical Limited Needleless injectors
US6096002A (en) 1998-11-18 2000-08-01 Bioject, Inc. NGAS powered self-resetting needle-less hypodermic jet injection apparatus and method
US6329511B1 (en) 1998-12-01 2001-12-11 Protein Design Labs, Inc. Humanized antibodies to γ-interferon
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US7214775B2 (en) 1999-04-09 2007-05-08 Kyowa Hakko Kogyo Co., Ltd. Method of modulating the activity of functional immune molecules
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
US20020086014A1 (en) 1999-08-24 2002-07-04 Korman Alan J. Human CTLA-4 antibodies and their uses
WO2001014424A2 (en) * 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
EP1229125A1 (en) 1999-10-19 2002-08-07 Kyowa Hakko Kogyo Co., Ltd. Process for producing polypeptide
US7029872B2 (en) 2000-06-28 2006-04-18 Glycofi, Inc Methods for producing modified glycoproteins
US7449308B2 (en) 2000-06-28 2008-11-11 Glycofi, Inc. Combinatorial DNA library for producing modified N-glycans in lower eukaryotes
US6946292B2 (en) 2000-10-06 2005-09-20 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions with increased antibody dependent cytotoxic activity
WO2002031240A2 (en) 2000-10-06 2002-04-18 Milliken & Company Face plate for spun-like textured yarn
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
WO2003086310A2 (en) 2002-04-12 2003-10-23 Ramot At Tel Aviv University Ltd. Prevention of brain inflammation as a result of induced autoimmune response
US7592326B2 (en) 2004-03-15 2009-09-22 Karaolis David K R Method for stimulating the immune, inflammatory or neuroprotective response
US20060040887A1 (en) 2004-03-15 2006-02-23 Karaolis David K Method for stimulating the immune, inflammatory or neuroprotective response
US7709458B2 (en) 2004-03-15 2010-05-04 David K. R. Karaolis Method for inhibiting cancer cell proliferation or increasing cancer cell apoptosis
WO2005120571A2 (en) 2004-06-07 2005-12-22 Ramot At Tel Aviv University Ltd. Method of passive immunization against disease or disorder characterized by amyloid aggregation with diminished risk of neuroinflammation
WO2006014679A1 (en) 2004-07-21 2006-02-09 Glycofi, Inc. Immunoglobulins comprising predominantly a glcnac2man3glcnac2 glycoform
WO2006057702A2 (en) 2004-11-24 2006-06-01 Novare Surgical Systems, Inc. Hand-actuated device for remote manipulation of a grasping tool
WO2006066568A2 (de) * 2004-12-23 2006-06-29 Tegenero Ag Monokonale agonistische anti-ctla-4 antikörper
WO2007054279A2 (en) 2005-11-08 2007-05-18 Helmholtz-Zentrum für Infektionsforschung GmbH Cyclic-dinucleotides and its conjugates as adjuvants and their uses in pharmaceutical compositions
US20080286296A1 (en) 2005-11-08 2008-11-20 Thomas Ebensen Cyclic-Dinucleotides and Its Conjugates as Adjuvants and Their Uses in Pharmaceutical Compositions
WO2007113648A2 (en) 2006-04-05 2007-10-11 Pfizer Products Inc. Ctla4 antibody combination therapy
WO2009100140A1 (en) * 2008-02-04 2009-08-13 Medarex, Inc. Anti-clta-4 antibodies with reduced blocking of binding of ctla-4 to b7 and uses thereof
US20100150946A1 (en) 2008-08-28 2010-06-17 Cell Genesys, Inc. Methods and Compositions for Treating Prostate Cancer or Inducing a Humoral Immune Response Against Prostate Cancer
US20120041057A1 (en) 2010-08-10 2012-02-16 Jones Roger A SYNTHESIS AND CHARACTERIZATION OF C8 ANALOGS OF c-di-GMP
WO2014093936A1 (en) 2012-12-13 2014-06-19 Aduro Biotech, Inc. Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use
US20140205653A1 (en) 2012-12-13 2014-07-24 Aduro Biotech, Inc. Compositions comprising cyclic purine dinucleotides having defined stereochemistries and methods for their preparation and use
WO2014179335A1 (en) 2013-04-29 2014-11-06 Memorial Sloan Kettering Cancer Center Compositions and methods for altering second messenger signaling
WO2014179760A1 (en) 2013-05-03 2014-11-06 The Regents Of The University Of California Cyclic di-nucleotide induction of type i interferon
WO2014189805A1 (en) 2013-05-18 2014-11-27 Auro Biotech, Inc. Compositions and methods for activating "stimulator of interferon gene"-dependent signalling
US20150056224A1 (en) 2013-05-18 2015-02-26 Aduro Biotech, Inc. Compositions and methods for activating stimulator of interferon gene-dependent signalling
WO2016096174A1 (en) 2014-12-16 2016-06-23 Invivogen Fluorinated cyclic dinucleotides for cytokine induction
WO2017011444A1 (en) 2015-07-13 2017-01-19 The Wistar Institute Of Anatomy And Biology Methods and compositions for treating b cell cancers
WO2017027645A1 (en) 2015-08-13 2017-02-16 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists
WO2017027646A1 (en) 2015-08-13 2017-02-16 Merck Sharp & Dohme Corp. Cyclic di-nucleotide compounds as sting agonists

Non-Patent Citations (238)

* Cited by examiner, † Cited by third party
Title
"Amersham Pharmacia Biotech", 2001, BIODIRECTORY, pages: 384 - 391
"Antibody Engineering", 2001, SPRINGER-VERLAG
"CURRENT PROTOCOLS IN HUMAN GENETICS", 1994, JOHN WILEY & SONS
"CURRENT PROTOCOLS IN MOLECULAR BIOLOGY", 1993, JOHN WILEY & SONS
"Fundamental Immunology", 1989, RAVEN PRESS
"Human Thymus: Histopathology and Pathology", 1986, SPRINGER VERLAG
"Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases", 1993, MARCEL DEKKER
"Monoclonal Antibodies", 2000, OXFORD UNIV. PRESS
"Monoclonal Antibodies, Cytokines and Arthritis", 1991, MARCEL DEKKER
"Pharmaceutical Dosage Forms: Disperse Systems", 1990, MARCEL DEKKER
"Pharmaceutical Dosage Forms: Parenteral Medications", 1993, MARCEL DEKKER
"Pharmaceutical Dosage Forms: Tablets", 1990, MARCEL DEKKER
"Physicians' Desk Reference 2003", 1 November 2002, THOMSON HEALTHCARE
"Products for Life Science Research", 2001, SIGMA-ALDRICH, CO., pages: 45 - 89
"Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary", 1984, MACK PUBLISHING COMPANY
ALEGRE ET AL., NAT REV IMMUNOL, vol. 1, 2001, pages 220 - 228
ALEXANDER AJ; HUGHES DE, ANAL CHEM, vol. 67, 1995, pages 3626 - 3632
ALTSCHUL ET AL., FEBS J., vol. 272, no. 20, 2005, pages 5101 - 5109
ALTSCHUL, S.F. ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL, S.F. ET AL., J. MOL. EVOL., vol. 36, 1993, pages 290 - 300
ALTSCHUL, S.F. ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402
ALTSCHUL, S.F., J. MOL. BIOL., vol. 219, 1991, pages 555 - 565
ALTSCHUL, S.F.: "Theoretical and Computational Methods in Genome Research", 1997, article "Evaluating the statistical significance of multiple distinct local alignments", pages: 1 - 14
ANGAL S. ET AL., MOL IMMUNOL., vol. 30, 1993, pages 105 - 108
AUSBEL ET AL.: "Current Protocols in Molecular Biology", vol. 1-4, 2001, JOHN WILEY AND SONS, INC.
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", vol. 3, 2001, JOHN WILEY AND SONS, INC., pages: 16.0.5 - 16.22.17
AZZONI ET AL., J. IMMUNOL., vol. 161, 1998, pages 3493
BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684
BAERT ET AL., NEW ENGL. J. MED., vol. 348, 2003, pages 601 - 608
BALDRIDGE ET AL.: "Monophosphoryl Lipid A (MPL) Formulations For The Next Generation Of Vaccines", METHODS, vol. 19, 1999, pages 103 - 107, XP004466812, DOI: doi:10.1006/meth.1999.0834
BARBAS ET AL.: "Phage Display: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
BARBAS, NATURE MEDICINE, vol. 1, 1995, pages 837 - 839
BEBBINGTON; HENTSCHEL: "DNA CLONING", vol. 3, 1987, ACADEMIC PRESS, article "The Use Of Vectors Based On Gene Amplification For The Expression Of Cloned Genes In Mammaian Cells"
BENIAMINOVITZ ET AL., NEW ENGL. J. MED., vol. 342, 2000, pages 613 - 619
BENSON, D.A. ET AL., NUCLEIC ACIDS RES., vol. 41, no. D1, 2013, pages 36 - 42
BIEG ET AL.: "GAD65 And Insulin B Chain Peptide (9-23) Are Not Primary Autoantigens In The Type 1 Diabetes Syndrome Of The BB Rat", AUTOIMMUNITY, vol. 31, no. 1, 1999, pages 15 - 24
BISCHOFF; KOLBE, J. CHROMATOG., vol. 662, 1994, pages 261
BITTER ET AL.: "Expression And Secretion Vectors For Yeast", METHODS IN ENZYMOL., vol. 153, 1987, pages 516 - 544
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 - 83
BRETSCHER, PROC NATL ACAD SCI USA, vol. 96, 1999, pages 185 - 190
CARPENTER ET AL., J. IMMUNOL., vol. 165, 2000, pages 6205
CARTER, J. IMMUNOL. METHODS, vol. 248, 2001, pages 7 - 15
CHAPPEL ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 25124 - 25131
CHEN ET AL., PHARM RES, vol. 20, 2003, pages 1952 - 1960
CHOI ET AL., PROC. NATL. ACAD. SCI., vol. 100, 2003, pages 5022 - 5027
CHOTHIA ET AL., JMOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
COLBERE-GARAPIN ET AL.: "A New Dominant Hybrid Selective Marker For Higher Eukaryotic Cells", J. MOL. BIOL., vol. 150, 1981, pages 1 - 14, XP024018978, DOI: doi:10.1016/0022-2836(81)90321-1
COLIGAN ET AL.: "Current Protcols in Immunology", vol. 1, 2001, JOHN WILEY AND SONS, INC.
COLIGAN ET AL.: "Current Protocols in Immunology", vol. 4, 2001, JOHN WILEY, INC.
COLIGAN ET AL.: "Current Protocols in Protein Science", vol. 1, 2000, JOHN WILEY AND SONS, INC.
COLIGAN ET AL.: "Current Protocols in Protein Science", vol. 2, 2000, JOHN WILEY AND SONS, INC.
COLLINS ET AL., IMMUNITY, vol. 17, 2002, pages 201 - 210
CONRATH ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 7346 - 7350
CROUSE ET AL.: "Expression And Amplification Of Engineered Mouse Dihydrofolate Reductase Minigenes", MOL. CELL. BIOL., vol. 3, 1983, pages 257 - 266
CWIRLA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 6378 - 6382
DATABASE GenBank [O] retrieved from ncbi Database accession no. AB063955
DATABASE GENBANK [O] retrieved from ncbi Database accession no. AB363305
DATABASE GenBank [O] retrieved from ncbi Database accession no. DI112350
DAVID ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 1014
DAYHOFF, M.O. ET AL.: "Atlas of Protein Sequence and Structure", vol. 5, 1978, NATL. BIOMED. RES. FOUND., article "A model of evolutionary change in proteins", pages: 345 - 352
DE BRUIN ET AL., NATURE BIOTECHNOL., vol. 17, 1999, pages 397 - 399
DEMBO, A. ET AL., ANN. PROB., vol. 22, 1994, pages 2022 - 2039
DESMYTER ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 26285 - 26290
DEVLIN ET AL., SCIENCE, vol. 249, 1990, pages 404 - 406
ELVIN A. KABAT: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
ETON ET AL.: "Active Immunotherapy With Ultraviolet B-Irradiated Autologous Whole Melanoma Cells Plus DETOX In Patients With Metastatic Melanoma", CLIN. CANCER RES., vol. 4, no. 3, 1998, pages 619 - 627
EUGENE, OR: "Catalogue", 2003, MOLECULAR PROBES, INC.
EVERTS ET AL., J. IMMUNOL., vol. 168, 2002, pages 883 - 889
FOOTE; WINTER, J. MOL. BIOL., vol. 224, 1992, pages 487 - 499
GALA; MORRISON, J IMMUNOL, vol. 172, 2004, pages 5489 - 5494
GENNARO: "Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT, WILLIAMS, AND WILKINS
GHIRLANDO ET AL., IMMUNOL LETT, vol. 68, 1999, pages 47 - 52
GHOSH ET AL., NEW ENGL. J. MED., vol. 348, 2003, pages 24 - 32
GIBELLINI ET AL., J. IMMUNOL., vol. 160, 1998, pages 3891 - 3898
GISH, W. ET AL., NATURE GENET., vol. 3, 1993, pages 266 - 272
GIUDICELLI ET AL., NUCLEIC ACIDS RES., vol. 33, 2005, pages D256 - D261
GIVAN: "Flow Cytometry", 2001, WILEY-LISS
GORDON ET AL., INTERNATIONAL REV. NEUROBIOL., vol. 67, 2005, pages 385 - 440
GOTZE M ET AL., J AM SOC MASS SPECTROM, vol. 23, no. 1, January 2012 (2012-01-01), pages 76 - 87
GUO ET AL., ADV. CANCER RES., vol. 119, 2013, pages 421 - 475
GUPTA ET AL.: "Adjuvants For Human Vaccines-Current Status, Problems And Future Prospects", VACCINE, vol. 13, no. 14, 1995, pages 1263 - 1276, XP004057427, DOI: doi:10.1016/0264-410X(95)00011-O
HAMILTON ET AL., CURR OPIN BIOTECHNOL., vol. 18, no. 5, pages 387 - 92
HAMILTON ET AL., SCIENCE, vol. 301, 2003, pages 1244 - 1246
HAMILTON ET AL., SCIENCE, vol. 313, 2006, pages 1441 - 1443
HAMMERLING ET AL.: "MONOCLONAL ANTIBODIES AND T-CELL HYBRIDOMAS", 1981, ELSEVIER, pages: 563 - 681
HANCOCK, J.M. ET AL., COMPUT. APPL. BIOSCI., vol. 10, 1994, pages 67 - 70
HARDMAN ET AL.: "Goodman and Gilman's The Pharmacological Basis of Therapeutics", 2001, MCGRAW-HILL
HARLOW ET AL.: "ANTIBODIES: A LABORATORY MANUAL", 1988, COLD SPRING HARBOR LABORATORY PRESS
HARLOW; LANE: "Antibodies A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS, pages: 139 - 243
HARLOW; LANE: "Using Antibodies", 1999, COLD SPRING HARBOR LABORATORY PRESS
HE ET AL., J. IMMUNOL., vol. 160, 1998, pages 1029
HENIKOFF, S. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10915 - 10919
HEROLD ET AL., NEW ENGL. J. MED., vol. 346, 2002, pages 1692 - 1698
HIATT ET AL.: "Color Atlas of Histology", 2000, LIPPINCOTT, WILLIAMS, AND WILKINS
HODI, F.S. ET AL., NEW ENG. J. MED., vol. 363, no. 8, 2010, pages 711 - 723
HOLLIGER ET AL., PNAS USA, vol. 90, 1993, pages 6444 - 6448
HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HOLLIGER; HUDSON, NAT. BIOTECHNOL., vol. 23, 2005, pages 1126 - 1136
HOOGENBOOM; CHAMES, IMMUNOL. TODAY, vol. 21, 2000, pages 371 - 377
HSING; BISHOP, J. IMMUNOL., vol. 162, 1999, pages 2804 - 2811
HUDSON; KORTT, J. IMMUNOL. METHODS, vol. 231, 1999, pages 177 - 189
HUNTER ET AL., NATURE, vol. 144, 1962, pages 945
INOUYE ET AL.: "Up-Promoter Mutations In The Lpp Gene Of Escherichia coli", NUCLEIC ACIDS RES., vol. 13, 1985, pages 3101 - 3110, XP001316824
J. ET AL., GENOME RES., vol. 7, 1997, pages 649 - 656
JANSSON ET AL., J IMMUNOL, vol. 175, 2005, pages 1575 - 1585
JOHNSON ET AL.: "3-O-Desacyl Monophosphoryl Lipid A Derivatives: Synthesis And Immunostimulant Activities", JOURNAL OF MEDICINAL CHEMISTRY, vol. 42, 1999, pages 4640 - 4649, XP002186005, DOI: doi:10.1021/jm990222b
KABAT ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 6609 - 6616
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE, NATIONAL INSTITUTES OF HEALTH
KABAT, ADV. PROT. CHEM., vol. 32, 1978, pages 1 - 75
KABAT; KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KAITHAMANA ET AL., J. IMMUNOL., vol. 163, 1999, pages 5157 - 5164
KARLIN, S. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 2264 - 2268
KARLIN, S. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5877
KAY ET AL.: "Phage Display of Peptides and Proteins: A Laboratory Manual", 1996, ACADEMIC PRESS
KITA ET AL., J. IMMUNOL., vol. 162, 1999, pages 6901
KOHLER: "Immunoglobulin Chain Loss In Hybridoma Lines", PROC. NATL. ACAD. SCI. (U.S.A., vol. 77, 1980, pages 2197 - 2199
KOSTELNY ET AL., J IMMUNOL., vol. 148, 1992, pages 1547 - 1553
KRIEGLER: "GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL", 1990, STOCKTON PRESS
KRISHNAMURTHY R; MANNING MC, CURR PHARM BIOTECHNOL, vol. 3, 2002, pages 361 - 371
KRUMMEL; ALLISON, J EXP MED, vol. 182, 1995, pages 459 - 465
LABRIJN ET AL., PNAS, vol. 110, no. 13, 2013, pages 5145 - 5150
LARKIN, J.V. ET AL., NEW ENG. J. MED., 2015
LAZAR ET AL., PNAS, vol. 103, 2006, pages 4005 - 4010
LE DOUSSAL ET AL., J. IMMUNOL., vol. 146, 1991, pages 169 - 175
LEE ET AL., BIOCONJ. CHEM., vol. 10, 1999, pages 973 - 981
LEE ET AL., NAT COMMUN., vol. 7, 2016, pages 13354
LEFRANC, M.-P. ET AL., NUCLEIC ACID RES., vol. 27, 1999, pages 209 - 212
LI ET AL., NAT. BIOTECHNOL., vol. 24, 2006, pages 210 - 215
LIPSKY ET AL., NEW ENGL. J. MED., vol. 343, 2000, pages 1594 - 1602
LI-TE CHIN ET AL: "Immune Intervention with Monoclonal Antibodies Targeting CD152 (CTLA-4) for Autoimmune and Malignant Diseases", CHANG GUNG MED J., 1 February 2008 (2008-02-01), XP055342512, Retrieved from the Internet <URL:http://memo.cgu.edu.tw/cgmj/3101/310101.pdf> [retrieved on 20170206] *
LIU ET AL., J. NEUROL. NEUROSURG. PSYCH., vol. 67, 1999, pages 451 - 456
LODMELL ET AL.: "DNA Vaccination Of Mice Against Rabies Virus: Effects Of The Route Of Vaccination And The Adjuvant Monophosphoryl Lipid A (MPL", VACCINE, vol. 18, 2000, pages 1059 - 1066, XP002674827, DOI: doi:10.1016/S0264-410X(99)00352-7
LOGAN ET AL.: "Adenovirus Tripartite Leader Sequence Enhances Translation Of mRNAs Late After Infection", PROC. NATL. ACAD. SCI. (U.S.A., vol. 81, 1984, pages 3655 - 3659
LONBERG ET AL.: "Human Antibodies From Transgenic Mice", INT. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
LONG, ANN. REV. IMMUNOL., vol. 17, 1999, pages 875
LOUIS ET AL.: "Basic Histology: Text and Atlas", 2002, MCGRAW-HILL
LOWY ET AL.: "Isolation Of Transforming DNA: Cloning The Hamster Aprt Gene", CELL, vol. 22, 1980, pages 817 - 823, XP023912123, DOI: doi:10.1016/0092-8674(80)90558-9
MACK ET AL., PROC. NATL. ACAD. SCI. USA, vol. 92, 1995, pages 7021 - 7025
MADDEN, T.L. ET AL., METH. ENZYMOL., vol. 266, 1996, pages 131 - 141
MALECKI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 99, 2002, pages 213 - 218
MARSHALL ET AL., ANNU REV BIOCHEM, vol. 41, 1972, pages 673 - 702
MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156
MENGNAN HE ET AL: "Remarkably similar CTLA-4 binding properties of therapeutic ipilimumab and tremelimumab antibodies", ONCOTARGET, vol. 8, 1 January 2017 (2017-01-01), pages 67129 - 67139, XP055412741, DOI: 10.18632/oncotarget.18004 *
MENNE ET AL., BIOINFORMATICS APPLICATIONS NOTE, vol. 16, 2000, pages 741 - 742
MENNE ET AL., BIOINFORMATICS, vol. 16, 2000, pages 741 - 742
MERCHANT ET AL., J. BIOL. CHEM., vol. 74, 2000, pages 9115
MEYAARD ET AL., IMMUNITY, vol. 7, 1997, pages 283 - 290
MILGROM ET AL., NEW ENGL. J. MED., vol. 341, 1999, pages 1966 - 1973
MIMURA ET AL., MOL IMMUNOL, vol. 37, 2000, pages 697 - 706
MORGAN ET AL.: "Human gene therapy", ANN. REV. BIOCHEM., vol. 62, 1993, pages 191 - 217, XP002031972, DOI: doi:10.1146/annurev.bi.62.070193.001203
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
MORRISON, SCIENCE, vol. 229, 1985, pages 1202 - 1207
MULLIGAN ET AL.: "Selection For Animal Cells That Express The Escherichia coli Gene Coding For Xanthine-Guanine Phosphoribosyltransferase", PROC. NATL. ACAD. SCI. (U.S.A., vol. 78, 1981, pages 2072 - 2076
MULLIGAN: "The Basic Science Of Gene Therapy", SCIENCE, vol. 260, 1993, pages 926 - 932, XP002925334, DOI: doi:10.1126/science.8493530
MURRAY ET AL., J. CHROMATOGR SCI, vol. 40, 2002, pages 343 - 349
MUYLDERMANS ET AL., TRENDS BIOCHEM. SCI., vol. 26, 2001, pages 230
NECHANSKY ET AL., MOL IMMUNOL, vol. 44, 2007, pages 1815 - 1817
NETT ET AL., YEAST, vol. 28, no. 3, 2011, pages 237 - 52
NYGREN, J., HISTOCHEM. AND CYTOCHEM., vol. 30, 1982, pages 407
OBEID ET AL., SEMIN ONCOL., vol. 42, no. 4, August 2015 (2015-08-01), pages 549 - 561
O'HARE ET AL.: "Transformation Of Mouse Fibroblasts To Methotrexate Resistance By A Recombinant Plasmid Expressing A Prokaryotic Dihydrofolate Reductase", PROC. NATL. ACAD. SCI. (U.S.A., vol. 78, 1981, pages 1527 - 1531, XP055347309
OWENS ET AL.: "Flow Cytometry Principles for Clinical Laboratory Practice", 1994, JOHN WILEY AND SONS
PAIN ET AL., J. IMMUNOL. METH., vol. 40, 1981, pages 219
PANDEY ET AL., J. BIOL. CHEM., vol. 275, pages 38633
PAREKH ET AL., NATURE, vol. 316, 1985, pages 452 - 457
PEGGS ET AL., J EXP MED, 2009
PLUCKTHUN: "THE PHARMACOLOGY OF MONOCLONAL ANTIBODIES", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315
PORTIELJI ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 52, pages 151 - 144
PRESTA, J. ALLERGY CLIN. IMMUNOL., vol. 116, 2005, pages 731 - 736
PROPST ET AL., J. IMMUNOL., vol. 165, 2000, pages 2214
PROUDFOOT: "Expression And Amplification Of Engineered Mouse Dihydrofolate Reductase Minigenes", NATURE, vol. 322, 1986, pages 562 - 565
RAGHUNATHAN ET AL., J. MOL RECOG., vol. 25, no. 3, 2012, pages 103 - 113
RAMAGOPAL ET AL., PNAS, vol. 114, no. 21, 2017, pages E4223 - E4232
RASO ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 27623
REICHMANN ET AL., J. IMMUNOL. METHODS, vol. 231, 1999, pages 25
REISSNER; ASWAD, CELL. MOL. LIFE SCI., vol. 60, 2003, pages 1281
RIBAS, A. ET AL., J. CLIN. ONCOL., vol. 31, no. 5, 2013, pages 616 - 622
ROMANO ET AL., PNAS, 2015, pages 6140 - 6145
ROSSI ET AL., AM. J. CLIN. PATHOL., vol. 124, 2005, pages 295 - 302
RUTHER ET AL.: "Easy Identification Of cDNA Clones", EMBO J., vol. 2, 1983, pages 1791 - 1794, XP055413083, DOI: doi:10.1002/j.1460-2075.1983.tb01659.x
SAMBROOK; FRITSCH; MANIATIS: "Molecular Cloning, A Laboratory Manual", 1982, COLD SPRING HARBOR LABORATORY PRESS
SAMBROOK; RUSSELL: "Molecular Cloning", 2001, COLD SPRING HARBOR LABORATORY PRESS
SANTERRE ET AL.: "Expression Of Prokaryotic Genes For Hygromycin B And G418 Resistance As Dominant-Selection Markers In Mouse L Cells", GENE, vol. 30, 1984, pages 147 - 156, XP023538473, DOI: doi:10.1016/0378-1119(84)90115-X
SCHADENDORF, D. ET AL., J. CLIN. ONCOL., vol. 33, no. 17, 2015, pages 1889 - 1894
SCHWARTZ, R.M. ET AL.: "Atlas of Protein Sequence and Structure", vol. 5, 1978, article "Matrices for detecting distant relationships", pages: 353 - 358
SCOTT, A.M. ET AL., NATURE REVIEWS (CANCER, vol. 12, 2012, pages 278 - 287
SCOTT; SMITH, SCIENCE, vol. 249, 1990, pages 386 - 388
SEGAL ET AL., J. IMMUNOL. METHODS, vol. 248, 2001, pages 1 - 6
SELBY ET AL., CANCER IMMUNOL, 2013
SHAPIRO: "Practical Flow Cytometry", 2003, JOHN WILEY AND SONS
SHIELDS ET AL., J BIOL CHEM, vol. 276, 2001, pages 6591 - 6604
SHIELDS ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591 - 6604
SHINKAWA ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 3466 - 3473
SIGMA-ALDRICH, CATALOGUE, 2003
SIMPSON ET AL., J EXP MED, 2013
SLAMON ET AL., NEW ENGL. J. MED., vol. 344, 2001, pages 783 - 792
SONGSIVILAI ET AL., CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321
SPIRO, GLYCOBIOLOGY, vol. 12, 2002, pages 43R - 56R
STATES, D.J. ET AL., METHODS, vol. 3, 1991, pages 66 - 70
STEENBAKKERS ET AL., J. IMMUNOL. METH., vol. 152, 1992, pages 69 - 77
STEENBAKKERS ET AL., MOL. BIOL. REP., vol. 19, 1994, pages 125 - 134
STRBO ET AL., IMMUNOL RES., vol. 57, no. 1-3, December 2013 (2013-12-01), pages 311 - 325
SZYBALSKA ET AL.: "Genetics Of Human Cess Line. IV. DNA-Mediated Heritable Transformation Of A Biochemical Trait", PROC. NATL. ACAD. SCI. (U.S.A., vol. 48, 1962, pages 2026 - 2034
TACHIBANA ET AL.: "Altered Reactivity Of Immunoglobutin Produced By Human-Human Hybridoma Cells Transfected By pSV2-Neo Gene", CYTOTECHNOLOGY, vol. 6, no. 3, 1991, pages 219 - 226
TANG ET AL., J. BIOL. CHEM., vol. 274, 1999, pages 27371 - 27378
TOLSTOSHEV: "Gene Therapy, Concepts, Current Trials And Future Directions", ANN. REV. PHARMACOL. TOXICOL., vol. 32, 1993, pages 573 - 596
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 - 3659
TRAUNECKER ET AL., INT. J. CANCER SUPPL., vol. 7, 1992, pages 51 - 52
UDUPI A. RAMAGOPAL ET AL: "Structural basis for cancer immunotherapy by the first-in-class checkpoint inhibitor ipilimumab", PROCEEDINGS NATIONAL ACADEMY OF SCIENCES PNAS, vol. 114, no. 21, 8 May 2017 (2017-05-08), US, pages E4223 - E4232, XP055412753, ISSN: 0027-8424, DOI: 10.1073/pnas.1617941114 *
VAN HEEKE ET AL.: "Expression Of Human Asparagine Synthetase In Escherichia coli", J. BIOL. CHEM., vol. 24, 1989, pages 5503 - 5509, XP002438811
VAUGHAN ET AL., NATURE BIOTECHNOL., vol. 14, 1996, pages 309 - 314
VOLKEL ET AL., PROTEIN ENGINEERING, vol. 14, 2001, pages 815 - 823
VON HEIJNE, EUR. J. BIOCHEM., vol. 133, 1983, pages 17 - 21
VON HEIJNE, NUCLEIC ACIDS RES., vol. 14, 1986, pages 4683 - 4690
WALLICK ET AL., J EXP MED, vol. 168, 1988, pages 1099 - 1109
WALUNAS ET AL., IMMUNITY, vol. 1, 1994, pages 405 - 413
WATSON ET AL.: "Molecular Biology of the Gene", 1987, THE BENJAMIN/CUMMINGS PUB. CO., pages: 224
WAWRZYNCZAK: "Antibody Therapy", 1996, BIOS SCIENTIFIC PUB. LTD
WEBER, J., THE ONCOLOGIST, vol. 12, no. 7, 2007, pages 864 - 872
WEINER; KOTKOSKIE: "Excipient Toxicity and Safety", 2000, MARCEL DEKKER, INC.
WEN ET AL., BIOCONJ. CHEM., vol. 12, 2001, pages 545 - 553
WIGLER ET AL.: "Transfer Of Purified Herpes Virus Thymidine Kinase Gene To Cultured Mouse Cells", CELL, vol. 11, 1977, pages 223 - 232, XP023910928, DOI: doi:10.1016/0092-8674(77)90333-6
WIGLER ET AL.: "Transformation Of Mammalian Cells With An Amplfiable Dominant-Acting Gene", PROC. NATL. ACAD. SCI. (U.S.A., vol. 77, 1980, pages 3567 - 3570
WILLIAMS, D.G. ET AL., ANTIBODY ENGINEERING, vol. 1, 2010
WOOTTON, J.C. ET AL., COMPUT. CHEM., vol. 17, 1993, pages 149 - 163
WREN ET AL., COMPUT. METHODS PROGRAMS BIOMED., vol. 68, 2002, pages 177 - 181
WRIGHT ET AL., IMMUNITY, vol. 13, 2000, pages 233 - 242
WU: "Recombinant DNA", vol. 217, 1993, ACADEMIC PRESS
Y.J. LEE, MOL. BIOSYST., vol. 4, 2008, pages 816 - 823
YAMAZAKI ET AL., THE JOURNAL OF IMMUNOLOGY, vol. 163, 1999, pages 5178 - 5182
YAN ET AL., BIOORG. MED. CHEM LETT., vol. 18, 2008, pages 5631
YANG ET AL., NEW ENGL. J. MED., vol. 349, 2003, pages 427 - 434
YE J. ET AL., NUCLEIC ACIDS RES., vol. 41, 2013, pages 34 - 40
ZHENG ET AL., J. BIOL CHEM., vol. 276, 2001, pages 12999

Cited By (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020020275A1 (zh) * 2018-07-25 2020-01-30 南京金斯瑞生物科技有限公司 人源化抗人ctla4单克隆抗体及其制备方法和用途
WO2020058762A1 (en) * 2018-09-20 2020-03-26 Tikcro Technologies Ltd Antibodies specific to ctla-4 and uses thereof
WO2020127377A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Bifunctional anti-pd-1/il-7 molecule
EP3902821A4 (en) * 2018-12-27 2022-11-30 Gigagen, Inc. ANTI-CTLA-4 BINDING PROTEINS AND METHODS OF USE THEREOF
US12421311B2 (en) 2018-12-27 2025-09-23 Gigagen, Inc. Anti-CTLA-4 binding proteins and methods of use thereof
WO2020165374A1 (en) 2019-02-14 2020-08-20 Ose Immunotherapeutics Bifunctional molecule comprising il-15ra
US12435134B2 (en) * 2019-04-18 2025-10-07 Kymab Limited Antagonists anti-CD7 antibodies
US20220324968A1 (en) * 2019-04-18 2022-10-13 Kymab Limited Antagonists anti-cd7 antibodies
US12552864B2 (en) 2019-07-15 2026-02-17 Intervet Inc. Caninized antibodies to human CTLA-4
RU2822460C2 (ru) * 2019-07-15 2024-07-05 Интервет Интернэшнл Б.В. Канинизированные антитела против человеческого ctla-4
WO2021122866A1 (en) 2019-12-17 2021-06-24 Ose Immunotherapeutics Bifunctional molecules comprising an il-7 variant
US12331127B2 (en) 2020-03-06 2025-06-17 Regeneron Pharmaceuticals, Inc. Therapeutic uses of anti-GITR antibodies
US12240899B2 (en) 2020-06-22 2025-03-04 Ngm Biopharmaceuticals, Inc. LAIR-1-binding agents and methods of use thereof
WO2022017428A1 (zh) * 2020-07-21 2022-01-27 上海君实生物医药科技股份有限公司 抗ctla-4抗体及其用途
WO2022112198A1 (en) 2020-11-24 2022-06-02 Worldwide Innovative Network Method to select the optimal immune checkpoint therapies
WO2022214652A1 (en) 2021-04-09 2022-10-13 Ose Immunotherapeutics Scaffold for bifunctioanl molecules comprising pd-1 or cd28 and sirp binding domains
WO2022214653A1 (en) 2021-04-09 2022-10-13 Ose Immunotherapeutics New scaffold for bifunctional molecules with improved properties
WO2024003360A1 (en) 2022-07-01 2024-01-04 Institut Curie Biomarkers and uses thereof for the treatment of neuroblastoma
WO2024028386A1 (en) 2022-08-02 2024-02-08 Ose Immunotherapeutics Multifunctional molecule directed against cd28
WO2024200826A1 (en) 2023-03-30 2024-10-03 Ose Immunotherapeutics Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell inhibiting molecule and use thereof
WO2024200823A1 (en) 2023-03-30 2024-10-03 Ose Immunotherapeutics Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell enhancing molecule and use thereof
WO2024200820A1 (en) 2023-03-30 2024-10-03 Ose Immunotherapeutics Method of synthesis of targeted lipid nanoparticle and uses thereof
WO2025061993A1 (en) 2023-09-21 2025-03-27 Domain Therapeutics Anti-ccr8 monoclonal antibodies and their therapeutic use
WO2025061994A1 (en) 2023-09-21 2025-03-27 Domain Therapeutics Anti-ccr8 monoclonal antibodies and their therapeutic use
WO2025242835A1 (en) 2024-05-22 2025-11-27 Ose Immunotherapeutics Molecules comprising masking linkers and uses thereof for the treatment of cancer
WO2026068705A1 (en) 2024-09-26 2026-04-02 Ose Immunotherapeutics Lipid-based nanoparticles comprising non-glycosylated fc domains and uses thereof

Also Published As

Publication number Publication date
AR109276A1 (es) 2018-11-14
CN110088134B (zh) 2023-07-21
EP3494137A1 (en) 2019-06-12
JP7440473B2 (ja) 2024-02-28
JP7214623B2 (ja) 2023-01-30
JP2022008982A (ja) 2022-01-14
US10808030B2 (en) 2020-10-20
EP3494137B1 (en) 2025-07-02
NL2017270B1 (en) 2018-02-09
US20180037654A1 (en) 2018-02-08
TW201808997A (zh) 2018-03-16
EP3494137C0 (en) 2025-07-02
ES3038117T3 (en) 2025-10-09
CN110088134A (zh) 2019-08-02
JP2019532619A (ja) 2019-11-14

Similar Documents

Publication Publication Date Title
EP3494137B1 (en) Antibodies against human ctla-4
US10494436B2 (en) Anti-PD-1 antibodies
AU2021202360B2 (en) Anti-TIGIT antibodies
US11278620B2 (en) Anti-LAG3 antibodies and antigen-binding fragments
US20210017276A1 (en) Anti-tigit antibodies
WO2018187613A2 (en) Anti-icos agonist antibodies and uses thereof
EP3503920A1 (en) Anti-ctla4 antibodies
BR112018009972B1 (pt) Ligante de ctla4, ligante, recipiente ou dispositivo de injeção, polinucleotídeo, vetor, célula hospedeira, métodos para fabricar o ligante de ctla4 e para prevenir que ctla4 se ligue à cd80 ou cd86 e usos do referido ligante de ctla4
CN107207594A (zh) 针对tigit的抗体
AU2019361923A1 (en) Combination therapy for cancer
HK40012435A (en) Antibodies against human ctla-4
EA048356B1 (ru) МУЛЬТИСПЕЦИФИЧЕСКИЕ АНТИТЕЛА К EGFRxCD28
HK40012435B (zh) 针对人ctla-4的抗体
HK40007354A (en) Anti-ctla4 antibodies
EA051240B1 (ru) Антитела против tigit

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17752494

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2019505381

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017752494

Country of ref document: EP

Effective date: 20190304

WWG Wipo information: grant in national office

Ref document number: 2017752494

Country of ref document: EP