WO2017206898A1 - Compositions and methods for treating metabolic diseases - Google Patents
Compositions and methods for treating metabolic diseases Download PDFInfo
- Publication number
- WO2017206898A1 WO2017206898A1 PCT/CN2017/086558 CN2017086558W WO2017206898A1 WO 2017206898 A1 WO2017206898 A1 WO 2017206898A1 CN 2017086558 W CN2017086558 W CN 2017086558W WO 2017206898 A1 WO2017206898 A1 WO 2017206898A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- subject
- serum
- cmyr
- ntcp
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/162—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
- A61K9/0021—Intradermal administration, e.g. through microneedle arrays, needleless injectors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
- C12N2730/10122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
- C12N2730/10133—Use of viral protein as therapeutic agent other than vaccine, e.g. apoptosis inducing or anti-inflammatory
Definitions
- compositions and methods for treating a metabolic disease such as diabetes and hyperlipidemia.
- the disclosure relates to the treatment of a metabolic disease with a polypeptide derived from hepatitis B virus.
- Metabolic diseases are caused by an imbalance of metabolites including carbohydrates, fats, lipids, and minerals that are crucial for well-being of a living organism.
- type II diabetes and hyperlipidemia represent two most common metabolic diseases.
- the imbalance of metabolites may occur as a result of various factors including aging, behavior, genetics, and environmental influences, and often multiple factors in combination contribute the manifestation of the disease.
- Patients suffering from metabolic diseases may display a wide range of symptoms including, for example, hyperglycemia, hyperinsulinemia, hyperlipidemia, insulin resistance, and dysregulation of other metabolites such as amino acids and minerals. It is often difficult to identify the underlying cause of metabolic diseases, making them difficult to treat effectively.
- patients suffering from metabolic diseases may have a risk of developing serious complications associated with the diseases, such as hypertension, cardiovascular diseases, kidney damages, and nerve damages.
- patients suffering from metabolic diseases may require a number of different medications, targeting multiple metabolic pathways in an attempt to address multiple symptoms simultaneously.
- type II diabetic patients surveyed in the study were taking an average of 8.4 different drug compounds per day (see, e.g., Bauer et al, Diabetic Medicine, 31: 1078-85 (2014) ) .
- One of the reasons that the patients suffering from metabolic diseases have to take various different medicines is because those medicines are often specialized to address a particular symptom or pathway of the metabolic disease and thus are not capable of targeting other related symptoms. Unfortunately, taking multiple medicines can affect the life quality of the patients and ultimately worsen the course of disease progression.
- CsA cyclosporine A
- NTCP sodium taurocholate cotransporting polypeptide
- CsA can induce hyperlipidemia in patients by increasing the total cholesterol level, primarily due to an increase in the low-density lipoprotein (LDL) cholesterol level (Ballantyne et al., JAMA, 262 (1) : 53-56 (1989) ) .
- LDL low-density lipoprotein
- Various other compounds have been shown to bind to NTCP, but they do not produce a uniform effect on NTCP as some of those compounds function as an inhibitor while others function as an enhancer (Kim et al, J. Pharmacol. Exp.
- HBV viral envelope contains three surface antigen proteins: large (L) , medium (M) , and small (S) . These proteins are coded by a single open reading frame on the S gene, starting from three different translation initiating sites, i.e., L (Pre-S1 + Pre-S2 + S) , M (Pre-S2 + S) , and S (S) .
- L Pre-S1 + Pre-S2 + S
- M Pre-S2 + S
- S S
- the HBV is divided into four major serotypes (adr, adw, ayr, ayw) based on antigenic epitopes present on its envelope proteins, and into eight genotypes (A–H) according to overall nucleotide sequence variation of the genome.
- the Pre-S1 region on the L protein of HBV was shown to bind to NTCP (Yan et al, eLife, 1: e00049 (2012) ) .
- compositions and methods for treating a metabolic disease with a polypeptide derived from HBV include polypeptides derived from the pre-S1 region of any one of HBV genotypes A, B, C, D, E, F, G, and H.
- the disclosure further provides HBV-derived polypeptides that are capable of altering metabolism such as glucose and lipid metabolism in a subject, including humans as well as pharmaceutically relevant animal models.
- the disclosure provides a pharmaceutical composition comprising a polypeptide described herein, wherein when administered to a subject in need thereof, the pharmaceutical composition provides serum concentrations of the polypeptide that allow for bidirectional regulation of NTCP-mediated bile acid uptake in the subject.
- the disclosure provides methods of treating a metabolic disease in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the polypeptide described herein or a pharmaceutical composition comprising the polypeptide such that the serum concentrations of the administered polypeptide allow for bidirectional regulation of NTCP-mediated bile acid uptake in the subject, wherein the polypeptide comprises an amino acid sequence derived from Hepatitis B virus (HBV) .
- HBV Hepatitis B virus
- the disclosure relates to methods of lowering a serum lipid level in a subject in need thereof by administering to the subject a therapeutically effective amount of the polypeptide described herein or of a pharmaceutical composition comprising the polypeptide such that the serum concentrations of the administered polypeptide allow for bidirectional regulation of NTCP-mediated bile acid uptake in the subject.
- the serum lipid may include, e.g., total cholesterol ( “TC” ) , triglyceride ( “TG” ) , and LDL-C.
- the disclosure also relates to methods of lowering a blood glucose level in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of the polypeptide described herein or a pharmaceutical composition comprising such polypeptide.
- the polypeptide when the serum concentration of the administered polypeptide in the subject is at or below 93 nmol/L, the polypeptide enhances NTCP-mediated bile acid uptake in the subject. In some embodiments, when the serum concentration of the administered polypeptide in the subject is above 93 nmol/L, the polypeptide inhibits NTCP-mediated bile acid uptake in the subject. In some embodiments, the serum concentration of the polypeptide in the subject reaches a peak concentration (i.e., C max ) at about 20 minutes after the administration. Thus, in some embodiments, T max of the polypeptide described herein is about 20 minutes. In some embodiments, the peak concentration is more than 93 nmol/L.
- a subject administered with the polypeptide described herein suffers from or is at risk of developing a metabolic disease.
- the metabolic disease involves dysregulation of lipid metabolism.
- the metabolic disease is a cholesterol-related disorder.
- the metabolic disease is hyperlipidemia (e.g., hypertriglyceridemia, hypercholesterolemia, or a combination thereof) .
- the metabolic disease involves dysregulation of glucose metabolism.
- the metabolic disease is hyperglycemia.
- the metabolic disease is diabetes or obesity.
- the subject suffers from or is at risk of developing cardiovascular diseases (e.g., atherosclerotic diseases) , heart diseases, or kidney impairment.
- cardiovascular diseases e.g., atherosclerotic diseases
- the polypeptide described herein is capable of reducing or stabilizing the level or activity of one or more chemical or biological molecules associated with metabolism in the subject.
- the chemical or biological molecule associated with metabolism is chosen from glucose, cholesterol, triglyceride, free fatty acids, amino acids, hormones, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals.
- the polypeptide described herein is also capable of reducing or stabilizing the level or value of one or more physiological parameters that measure metabolic changes.
- the physiological parameter is chosen from glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index, heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index.
- the polypeptide described herein comprises an amino acid sequence derived from the pre-S1 region of HBV genotype A, B, C, D, E, F, G, or H. In certain embodiments, the polypeptide described herein comprises the sequence of amino acids 13-59 of the pre-S1 region of HBV genotype C. In additional embodiments, the polypeptide described herein comprises an amino acid sequence derived from the pre-S1 region of any other HBV genotype that corresponds to amino acids 13-59 of the pre-S1 region of HBV genotype C. In some embodiments, the polypeptide comprises an amino acid sequence selected from SEQ ID NOs: 21-40.
- one or more amino acid residues of the polypeptide described herein are deleted, substituted, or inserted while maintaining the ability to bind to NTCP and bidirectionally regulate NTCP-mediated transport of bile acid into hepatocytes.
- the polypeptide described herein comprises a native flanking amino acid sequence from the pre-S1 region of HBV genotype A, B, C, D, E, F, G, or H.
- the polypeptide described herein has at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%identity to any one of the amino acid sequences selected from SEQ ID NOs: 21-40.
- the polypeptide comprises the glycine corresponding to amino acid 13 of the pre-S1 region of HBV genotype C and/or the asparagine corresponding to amino acid 20 of the pre-S1 region of HBV genotype C.
- the polypeptide described herein comprises an N-terminal modification with a hydrophobic group and/or a C-terminal modification that is capable of stabilizing the polypeptide.
- the hydrophobic group may be chosen from, e.g., myristic acid, palmitic acid, stearic acid, oleic acid, linoleic acid, cholesterol, and arachidonic acid.
- the C-terminal modification may be chosen from, e.g., amidation (amination) , isopentanediolization, and any C-terminal modification that is capable of stabilizing the polypeptide.
- the polypeptide described herein comprises an N-terminal modification with myristic acid and/or a C-terminal modification with amination. In some embodiments, the polypeptide described herein comprises an amino acid sequence chosen from SEQ ID NOs: 21-40. In some embodiments, the polypeptide described herein comprises the amino acid sequence of SEQ ID NO: 23.
- the polypeptide described herein is capable of reducing one or more symptoms associated with the metabolic disease.
- the polypeptide described herein or the pharmaceutical composition comprising such polypeptide is administered to the subject before, concurrently with, or after the administration of a therapeutically effective amount of at least one a second agent.
- the second agent may be chosen from, e.g., an antihyperlipidemic agent, an antihyperglycemic agent, an antidiabetic agent, an antiobesity agent, and a bile acid analogue.
- the second agent may be chosen from, e.g., insulin, metformin, sitagliptin, colesevelam, glipizide, simvastatin, atorvastatin, ezetimibe, fenofibrate, nicotinic acid, orlistat, lorcaserin, phentermine, topiramate, obeticholic acid, and ursodeoxycholic acid.
- the polypeptide described herein or the pharmaceutical composition comprising such polypeptide is administered to the subject by at least one mode including, e.g., parenteral, intrapulmonary, intranasal, intralesional, intramuscular, intravenous, intraarterial, intraperitoneal, and subcutaneous administration. In some embodiments, the polypeptide described herein or the pharmaceutical composition comprising such polypeptide is administered to the subject subcutaneously.
- Fig. 1A shows an exemplary graph depicting the purity of Cmyr-47 as measured by high pressure liquid chromatography (HPLC) .
- Fig. 1B shows an exemplary graph depicting the molecular weight of Cmyr-47 as confirmed by Mass Spectrometry.
- Fig. 2A shows that Cmyr-47 labeled with FIFC binds to tupaia primary hepatocytes.
- Fig. 2B shows that Cmyr-47 labeled with FIFC binds to HepG2 cells, a human hepatocyte derived cell line.
- Fig. 3 illustrates that Cmyr-47 labeled with FIFC binds to NTCP expressing L02 cells ( “NTCP-L02” ) but does not bind to control L02 cells ( “BLANK-L02” ) .
- Fig. 4 shows that Cmyr-47 labeled with FIFC binds to NTCP expressing HEK293 cells ( “NTCP-293” ) but does to bind to control HEK293 cells ( “BLANK-293” ) .
- Fig. 5A shows the effect of Cmyr-47 on bile acids uptake in vitro. Cyclosporine A ( “CsA” ) was used as a positive control.
- Fig. 5B illustrates the bidirectional effect of Cmyr-47 on bile acids uptake.
- Figs. 5C and 5D show the effect of CsA on bile acids uptake in vitro and confirm the inhibitory effect of CsA.
- Figs. 5A shows the effect of Cmyr-47 on bile acids uptake in vitro.
- 5E and 5F show the effect of HBV-derived polypeptides on bile acids uptake in vitro at a low concentration molarly equivalent to 62.5 ng/ml (11.58 nmol/L) Cmyr-47 and at a high concentration molarly equivalent to 1 ⁇ g/ml (185.23 nmol/L) Cmyr-47, respectively.
- Fig. 6 shows the changes of serum total cholesterol ( “TC” ) in hyperlipidemic golden hamsters treated with Cmyr-47 or CsA for 4 weeks.
- Golden hamsters fed with regular diet were treated with PBS and used as a “Normal Control” while hyperlipidemic golden hamsters treated with PBS were used as a “Model Control. ”
- Hyperlipidemic golden hamsters treated with Fenofibrate “Positive Treatment”
- Fig. 7A shows the level of serum TC prior to treatments with polypeptides derived from HBV.
- Fig. 7B shows the level of serum TC after 4 weeks of the treatments.
- Fig. 8 depicts the changes of serum triglycerides ( “TG” ) of hyperlipidemic golden hamsters during 4 weeks of Cmyr-47 treatment.
- Fig. 9A shows the level of serum TG prior to treatments with polypeptides derived from HBV.
- Fig. 9B shows the level of serum TG after 4 weeks of the treatments.
- Fig. 10 depicts the level of serum LDL-C of hyperlipidemic golden hamsters after 4 weeks of Cmyr-47 treatment.
- Fig. 11A shows the level of serum LDL-C before being treated with polypeptides derived from HBV.
- Fig. 11B shows the level of serum LDL-C after 4 weeks of the treatments.
- Fig. 12 shows the level of serum HDL-C of hyperlipidemic golden hamsters after 4 weeks of Cmyr-47 treatment.
- Fig. 13 depicts atherosclerosis index ( “AI” ) of hyperlipidemic golden hamsters after 4 weeks of Cmyr-47 treatment.
- Fig. 14 shows the changes of serum total bile acids (TBA) of hyperlipidemic golden hamsters after 4 weeks of Cmyr-47 treatment. Fenofibrate and CsA were also tested for comparison.
- TAA serum total bile acids
- Fig. 15 shows the changes of serum TC of hyperlipidemic golden hamsters treated with three different doses (1 mg/kg, 3 mg/kg, and 10 mg/kg) of Cmyr-47 for 4 weeks.
- Golden hamsters fed with regular diet were treated with PBS and used as a “Normal Control, ” while hyperlipidemic golden hamsters treated with PBS were used as a “Model Control. ”
- Fig. 16 shows the changes of serum TG of hyperlipidemic golden hamsters treated with 1 mg/kg, 3 mg/kg, or 10 mg/kg of Cmyr-47 for 4 weeks.
- Fig. 17 shows the changes of serum glucose ( “GLU” ) in Zucker diabetic fatty rats during 4 weeks of Cmyr-47 or CsA treatment.
- GLU serum glucose
- Zucker lean rats treated with PBS were used as a “Normal Control” while Zucker diabetic fatty rats treated with PBS were used as a “Model Control. ”
- Zucker diabetic fatty rats treated with metformin were used as a positive control.
- Fig. 18A shows the level of serum GLU before being treated with polypeptides derived from HBV.
- Fig. 18B shows the level of serum GLU after 4 weeks of the treatments.
- Fig. 19 shows the changes of HbA1c of Zucker diabetic fatty rats during 4 weeks of Cmyr-47 treatment.
- Fig. 20A shows the level of HbA1c prior to treatments with polypeptides derived from HBV.
- Fig. 20B shows the level of HbA1c after 4 weeks of the treatments.
- Fig. 21 shows the changes of insulin in Zucker diabetic fatty rats during 4 weeks of Cmyr-47 treatment.
- Fig. 22 shows the changes of serum TC in Zucker diabetic fatty rats during 4 weeks of Cmyr-47 treatment.
- Fig. 23A shows the level of serum TC prior to treatments with polypeptides derived from HBV.
- Fig. 23B shows the level of serum TC after 4 weeks of the treatments.
- Fig. 24 shows the changes of serum TG in Zucker diabetic fatty rats during 4 weeks of Cmyr-47 treatment.
- Fig. 25A shows the level of serum TG prior to treatments with polypeptides derived from HBV.
- Fig. 25B shows the level of serum TG after 4 weeks of the treatments.
- Fig. 26 shows the level of blood urea nitrogen ( “BUN” ) in Zucker diabetic fatty rats after 4 weeks of Cmyr-47 treatment.
- Figs. 27A-C depict heart index, kidney index, and total fat index of Zucker diabetic fatty rats after 4 weeks of Cmyr-47 treatment.
- “Cmyr-47 (L) ” indicates the dose of 10 mg/kg/d of Cmyr-47 while “Cmyr-47 (Hi) ” indicates the dose of 30 mg/kg/d of Cmyr-47.
- Fig. 28 shows the level of serum TBA in Zucker diabetic fatty rats after 4 weeks of Cmyr-47 treatment.
- an element means one element or more than one element.
- the term “about” means a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight, or length that varies by as much as 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1%to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.
- the term “about” is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. In general, the term “about” is intended to modify a numerical value above and below the stated value by a variance of ⁇ 10%.
- polypeptides derived from HBV for treating a metabolic disease including, e.g., diabetes and hyperlipidemia.
- the polypeptides may be derived from the pre-S1 region of HBV and may be capable of binding to NTCP in vitro, such as, e.g., in a solution or a cell-free system (e.g., a cell lysate or in a reconstituted system) , or in a cell, such as, e.g., ex vivo in a cell in culture (e.g., a cell expressing NTCP, or a hepatocyte) , or in vivo in a cell within a subject.
- the subject may be a mammal. In some embodiments, the subject may be a human.
- polypeptide, ” “peptide, ” and “protein” are used interchangeably and encompass full-length proteins and fragments, as well as variants of the full-length proteins and the fragments. Such fragments and variants of the polypeptide described herein retain at least the biological activities of the polypeptide to bind to NTCP and bidirectionally regulate NTCP-mediated transport of bile acid into hepatocytes.
- the “polypeptide, ” “peptide, ” and “protein” can include natural and/or non-natural amino acid residues. Those terms also include post-translationally modified proteins, including, e.g., glycosylated, sialylated, acetylated, and/or phosphorylated proteins.
- the terms also include chemically modified proteins at one or more amino acid residues, such as, e.g., at the N-terminus and/or at the C-terminus.
- the N-terminus of the polypeptide disclosed herein can be modified by a hydrophobic group such as, e.g., myristic acid, palmitic acid, stearic acid, oleic acid, linoleic acid, cholesterol, and arachidonic acid.
- the C-terminus of the polypeptide disclosed herein can be modified to stabilize the polypeptide.
- the C-terminus modification may be chosen from amidation (amination) , isopentanediolization, and any other C-terminal modification capable of stabilizing the polypeptide.
- polypeptide derived from HBV or “HBV-derived polypeptide” refers to the origin or source of the polypeptide as being from HBV, and may include native, recombinant, synthesized, or purified polypeptides.
- polypeptide derived from HBV or “HBV-derived polypeptide” refers to a full-length native HBV polypeptide or fragments thereof, as well as variants of the full-length native polypeptide or its fragments.
- the fragment may consist of at least 3-5 amino acids, at least 5-10 amino acids, at least 10-20 amino acids, at least 20-30 amino acids, at least 30-50 amino acids, or the entire amino acids of the native sequence, or may be otherwise identifiable to one of ordinary skill in the art as having its origin in the native sequence.
- the polypeptide described herein may be derived from the pre-S1 region of the L protein of any HBV subtype. In some embodiment, the polypeptide described herein may comprise the entire pre-S1 region of the L protein of any HBV subtype.
- the polypeptide described herein may be derived from the pre-S1 region of the L protein of any one of HBV genotypes A, B, C, D, E, F, G, and H.
- the genomic sequences of these HBV genotypes can be found in GenBank Accession Nos.
- polypeptide described herein may be derived from the pre-S1 region of the L protein of HBV genotype C.
- the polypeptide derived from HBV described herein retains one or more biological activities described herein of the corresponding native HBV polypeptide, including at least the biological activities of the polypeptide to bind to NTCP and bidirectionally regulate NTCP-mediated transport of bile acid into hepatocytes.
- a polypeptide derived from HBV, or an HBV-derived polypeptide means a polypeptide that differs from a given polypeptide (i.e., the polypeptide described herein, the polypeptide derived from HBV, or the HBV-derived polypeptide) in amino acid sequence, but retains one or more biological activities described herein of the given polypeptide.
- the variant polypeptide described herein retains at least at least the biological activities of the polypeptide to bind to NTCP and bidirectionally regulate NTCP-mediated transport of bile acid into hepatocytes.
- the variant polypeptide described herein may have one or more amino acid additions (e.g., insertion) , deletions, or substitutions from the given polypeptide.
- the variant polypeptide described herein may have 1-30, 1-20, 1-10, 1-8, 1-5, or 1-3 amino acid additions (e.g., insertion) , deletions, or substitutions from the given polypeptide, including all integers in between these ranges.
- the polypeptide sequence may contain conservative substitution of amino acids.
- a conservative substitution of an amino acid typically involves a minor change and therefore does not significantly alter the biological activity of the polypeptide.
- These minor changes can be identified, in part, by considering the hydropathic index of amino acids based on a consideration of the hydrophobicity and charge of the amino acid.
- Amino acids of similar hydropathic indexes and hydrophilicity values can be substituted and still retain protein function. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.
- variant also includes a polypeptide that has certain identity, such as, e.g., at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%identity to the given polypeptide.
- variant as used herein also includes a polypeptide comprising the portion of the given polypeptide that corresponds to a native sequence of HBV proteins. “Variant” may also refer to a fusion protein or chimeric protein, comprising polypeptides derived from two or more different sources.
- Non-limiting examples of the fusion protein described herein may include, e.g., a fusion protein of one polypeptide derived from HBV and another polypeptide derived from a non-HBV protein, a fusion protein of two polypeptides derived from different HBV subtypes, and a fusion protein of two polypeptides derived from different regions of the L protein of any one of HBV subtypes, or from different sequences within the pre-S1 region of the L protein of any one of HBV subtypes.
- variant also includes a polypeptide that comprises the same amino acid sequence of a given polypeptide (i.e., the polypeptide described herein, the polypeptide derived from HBV, or the HBV-derived polypeptide) and retains one or more biological activities of the given polypeptide, but chemically and/or post-translationally modified in a manner different from the given polypeptide.
- Variant can also be used to describe a polypeptide or a fragment thereof that has been differentially processed, such as by proteolysis, phosphorylation, or other post-translational modification, yet retains its biological activity of binding to NTCP and bidirectionally regulating NTCP-mediated transport of bile acid into hepatocytes.
- variant herein is intended to encompass fragments of a variant unless otherwise contradicted by context.
- variant also encompasses the homologous polypeptide sequences found in the different viral species, strains, or subtypes of the hepadnavirus genus. HBV is divided into four major serotypes (adr, adw, ayr, ayw) based on antigenic epitopes present on its envelope proteins, and into eight genotypes (A–H) according to overall nucleotide sequence variation of the genome. The term “variant” therefore includes homologous polypeptides found in any of these HBV subtypes. “Variant” can also include polypeptides having native flanking amino acid sequences from any of these HBV subtypes added to the N and/or C terminus.
- conservative amino acid substitutions and “conservative substitutions” are used interchangeably herein to refer to intended amino acid swaps within a group of amino acids wherein an amino acid is exchanged with a different amino acid of similar size, structure, charge, and/or polarity.
- Families of amino acid residues having similar side chains are known in the art, including basic side chains (e.g., lysine, arginine, histidine) , acidic side chains (e.g., aspartic acid, glutamic acid) , uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine) , nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan) , beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine) .
- basic side chains e.g., lysine, arginine, histidine
- acidic side chains
- an amino acid residue in a polypeptide can be replaced with another amino acid residue from the same side chain family.
- a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
- mutations can be introduced randomly along all or part of the polypeptide.
- conservative amino acid substitutions include, e.g., exchange of one of the aliphatic or hydrophobic amino acids Ala, Val, Leu, and Ile for one of the other amino acids in that group of four; exchange between the hydroxyl-containing residues Ser and Thr; exchange between the acidic residues Asp and Glu; exchange between the amide residues Asn and Gln; exchange between the basic residues Lys, Arg, and His; exchange between the aromatic residues Phe, Tyr, and Trp; and exchange between the small-sized amino acids Ala, Ser, Thr, Met, and Gly.
- Conservative substitutions, such as substituting a conserved amino acid with a similar, structurally related amino acid would not be reasonably expected to impose a substantial influence on the biological activity of the polypeptide.
- sequence identity refers to the extent that a sequence is identical on an amino acid-by-amino acid basis over a window of comparison.
- the polypeptide described herein may comprise an amino acid sequence at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%identical to the sequence of a given polypeptide and still retain one or more biological activities of the given polypeptide.
- a “percentage identity” may be calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical amino acids occur in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison, and multiplying the result by 100 to yield the percentage of sequence identity.
- Optimal alignment of sequences for aligning a comparison window may be conducted by computerized implementations of algorithms available in the art, such as, e.g., the family of programs, or by visual inspection and the best alignment (i.e., resulting in the highest percentage homology over the comparison window) generated by any of the various methods selected.
- sequence comparison For sequence comparison, one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates may be designed, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the present sequence identity for the test sequences relative to the reference sequence, based on the designated program parameters.
- sequence algorithm program parameters is well within the knowledge in the art.
- the window of comparison may be designated as over the entire length of either or both comparison sequences, such as, e.g., over the entire length of the reference sequence, and gaps of up to 5%of the total number of amino acids in the reference sequence may be allowed.
- the “biological activity” of the polypeptides described herein encompasses the ability of the polypeptides to bind to NTCP and bidirectionally regulate NTCP-mediated bile acid uptake in hepatocytes.
- “bidirectional regulation” of a molecule or pathway means that the HBV-derived polypeptides described herein enhances the activity of the molecule or pathway (i.e., functions as an enhancer) at or below a certain concentration, and inhibits the activity of the molecule or pathway (i.e., functions as an inhibitor) above the concentration.
- the polypeptide described herein may bind to NTCP and promote NTCP-mediated bile acid uptake in hepatocytes (i.e., functions as an “enhancer” of NTCP) at or below a certain concentration.
- the same polypeptide may also bind to NTCP but inhibit NTCP-mediated bile acid uptake (i.e., functions as an “inhibitor” of NTCP) above that concentration.
- the polypeptide described herein may function as an enhancer of NTCP at or below 93 nmol/L and as an inhibitor of NTCP above 93 nmol/L.
- the Cmyr-47 polypeptide described herein may function as an enhancer of NTCP at or below 500 ng/ml and as an inhibitor of NTCP above 500 ng/ml.
- the polypeptide described herein may bidirectionally regulate NTCP-mediated uptake of bile acids into hepatocytes in vitro.
- the polypeptide described herein may promote in vitro NTCP-mediated bile acid uptake at or below a certain concentration, while the polypeptide may inhibit in vitro NTCP-mediated bile acid uptake above that concentration.
- the polypeptide described herein may promote in vitro NTCP-mediated bile acid uptake at or below 93 nmol/L, while the polypeptide may inhibit in vitro NTCP-mediated bile acid uptake above 93 nmol/L.
- the Cmyr-47 polypeptide described herein may promote in vitro NTCP-mediated bile acid uptake at or below 500 ng/ml and inhibit in vitro NTCP-mediated bile acid uptake above 500 ng/ml.
- the polypeptide described herein may promote NTCP-mediated bile acid uptake in a subject treated with the polypeptide at or below a certain serum concentration of the administered polypeptide.
- the polypeptide may inhibit NTCP-mediated bile acid uptake in a subject treated with the polypeptide above that serum concentration of the administered polypeptide.
- the polypeptide when the serum concentration of the polypeptide described herein is at or below 93 nmol/L in a subject treated with the polypeptide, the polypeptide is capable of enhancing NTCP-mediated uptake of bile acids in the subject.
- the polypeptide when the serum concentration of the polypeptide described herein is above 93 nmol/L in a subject treated with the polypeptide, the polypeptide is capable of inhibiting NTCP-mediated uptake of bile acids in the subject.
- the Cmyr-47 polypeptide described herein may be capable of enhancing NTCP-mediated uptake of bile acids in the subject at or below a serum concentration of 500 ng/ml, and inhibiting NTCP-mediated uptake of bile acids in the subject above a serum concentration of 500 ng/ml.
- the biological activity of the polypeptide described herein may also include the ability to treat a metabolic disease or to ameliorate one or more symptoms associated with the metabolic disease.
- the biological activity may further include the ability of the polypeptide described herein to prevent the development of a metabolic disease.
- the biological activity of the polypeptide described herein may include the ability of the polypeptide to modulate the level or activity of one or more chemical or biological molecules associated with metabolism, and/or to modulate the level or value of one or more physiological parameters that measure metabolic changes.
- the “biological activity” of the polypeptide described herein includes the ability of the polypeptide to reduce or stabilize the level or activity of one or more such chemical or biological molecules or physiological parameters.
- metabolism refers to bile acid metabolism, glucose metabolism, lipid metabolism, and/or amino acid metabolism.
- the chemical or biological molecules associated with metabolism may include, e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, such as, e.g., insulin, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals.
- the physiological parameters that measure metabolic changes may include, e.g., glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index (AI) , heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index.
- the “biological activity” of the polypeptide described herein includes the ability of the polypeptide to increase the level of serum bile acid in a subject. In certain embodiments, the “biological activity” of the polypeptide described herein includes the ability of the polypeptide to enhance cholesterol elimination through bile acid synthesis in hepatocytes.
- the biological activity of the polypeptide described herein may include the ability to lower the serum level of one or more chemical or biological molecules associated with lipid metabolism in a subject administered with the polypeptide.
- the biological activity of the polypeptides described herein may include the ability to lower the serum level of serum lipids, such as, e.g., triglyceride, total cholesterol, or LDL-C in a subject administered with the polypeptide.
- the biological activity of the polypeptide described herein may include the ability to lower the serum level of one or more chemical or biological molecules associated with glucose metabolism in a subject administered with the polypeptide. In some embodiments, the biological activity of the polypeptides described herein may include the ability to lower the serum level of glucose or HbA1c in a subject administered with the polypeptide. In some embodiments, the polypeptides described herein may be capable of stabilizing the serum level of insulin in a subject.
- the “biological activity” of the polypeptide described herein includes the ability of the polypeptide to treat a metabolic disorder in a subject.
- the metabolic disorder involves dysregulation of lipid metabolism.
- the metabolic disease may include a cholesterol-related disorder, such as, e.g., hyperlipidemia (including hypertriglyceridemia, hypercholesterolemia, or both) .
- the metabolic disorder involves dysregulation of glucose metabolism.
- the metabolic disease may include, e.g., diabetes and obesity.
- the “biological activity” of the polypeptide described herein includes the ability of the polypeptide to ameliorate or prevent one or more symptoms or complications of such disorders. In certain embodiments, the “biological activity” of the polypeptide described herein includes the ability of the polypeptide to mitigate the negative impact of such disorders on the health of a patient or reduce the risk of developing such disorders. In certain embodiments, the “biological activity” of the polypeptide described herein also includes the ability of the polypeptide to reduce the severity of or the risk of developing other associated diseases, such as, e.g., atherosclerosis and/or cardiovascular diseases, heart diseases, kidney impairment, or obesity.
- these biological activities of the polypeptide described herein may result from bidirectional regulation of NTCP-mediated bile acid uptake in the subject by the polypeptide at the serum concentrations following administration of the polypeptide to the subject.
- concentration of the polypeptide described herein in the blood stream of a subject administered with such polypeptide is at or below a certain concentration, bile acid uptake in the subject is enhanced.
- concentration of the polypeptide described herein in the blood stream of the subject is above a certain concentration, bile acid uptake in the subject is inhibited.
- bile acid uptake in the subject when the concentration of the polypeptide described herein in the blood stream of a subject administered with such polypeptide is at or below 93 nmol/L, bile acid uptake in the subject is enhanced. In some embodiments, when the concentration of the polypeptide described herein in the blood stream of the subject is above 93 nmol/L, bile acid uptake in the subject is inhibited. For example, when the concentration of the Cmyr-47 polypeptide described herein in the blood stream of a subject administered with such polypeptide is at or below 500 ng/ml, bile acid uptake in the subject is enhanced. When the concentration of the Cmyr-47 polypeptide described herein in the blood stream of the subject is above 500 ng/ml, bile acid uptake in the subject is inhibited.
- the biological activity of the polypeptide described herein may be confirmed in vivo, by collecting a sample from a subject treated with the polypeptide described herein.
- the sample may be a biopsy sample collected from a specific tissue such as, e.g., liver, muscle, fat, and pancreas, or a snap-frozen tissue collected from an animal post-mortem.
- the sample may be a serum sample collected from blood drawn from a subject.
- the biological activity of the polypeptide described herein may be confirmed in vitro, by contacting the polypeptide described herein with a cell that is either a transformed cell line or a cell isolated from an animal.
- the cell may be a primary hepatocyte isolated from an animal.
- NTCP e.g., mammalian cells overexpressing NTCP or hepatocytes
- cells expressing NTCP may be treated in vitro with bile acids and increasing amounts of the polypeptide described herein.
- Bile acids added to the cells may be radiolabeled or chemically labeled for detection.
- the cells may be then harvested and the amount of bile acids taken up by the cells may be measured.
- the ability of the polypeptide described herein to bidirectionally regulate NTCP may be confirmed when the polypeptide enhances bile acid uptake at or below a certain concentration while inhibits bile acid uptake above that concentration.
- the exemplary assays useful to confirm the biological activity of the polypeptide may also include a functional analysis with a sample collected from a subject treated with the polypeptide described herein, including, e.g., glucose production assay, glucose uptake assay, fatty acid oxidation assay, cholesterol assay, bile acids assay, urea assay, and triglyceride assay.
- a functional analysis with a sample collected from a subject treated with the polypeptide described herein including, e.g., glucose production assay, glucose uptake assay, fatty acid oxidation assay, cholesterol assay, bile acids assay, urea assay, and triglyceride assay.
- the assays may also include, e.g., a binding analysis between the polypeptide and NTCP, an activity assay of NTCP for transporting bile acids, and an expression, localization, or activity analysis of molecular factors involved in metabolism, such as, e.g., bile acid metabolism, glucose metabolism, lipid metabolism, and amino acid metabolism.
- a binding analysis between the polypeptide and NTCP an activity assay of NTCP for transporting bile acids
- an expression, localization, or activity analysis of molecular factors involved in metabolism such as, e.g., bile acid metabolism, glucose metabolism, lipid metabolism, and amino acid metabolism.
- the polypeptide described herein may comprise an amino acid sequence of the pre-S1 region of any HBV subtype.
- the polypeptide described herein comprises the sequence of amino acids 13-59 of the pre-S1 region of HBV genotype C: GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVG (SEQ ID NO: 23) .
- the polypeptide described herein may comprise the corresponding pre-S1 sequence from another HBV genotype, such as, e.g., any one of genotypes A, B, D, E, F, G, and H.
- the polypeptide described herein may comprise:
- NTANPDWDFNPNKDTWPDANKVG SEQ ID NO: 36
- NTRNPDWDHNPNKDHWTEANKVG (SEQ ID NO: 37)
- NSSSPDWDFNTNKDSWPMANKVG (SEQ ID NO: 38)
- pre-S1 amino acids 12-58 of the HBV genotype G GKNLSASNPLGFLPDHQLDPAFR
- the polypeptide described herein may comprise a portion of the pre-S1 region of HBV, said portion comprising at least an amino acid sequence chosen from SEQ ID NOs: 23 and 34-40. In some embodiments, the polypeptide described herein may comprise the entire pre-S1 region of HBV.
- the polypeptide described herein may be 10-100 amino acids in length.
- the polypeptide may be 15-100, 15-80, 20-100, 20-80, 20-60, 25-60, 30-60, 35-60, or 40-60 amino acids in length, including all integers in between these ranges.
- the polypeptide described herein may be at least 20, such as, e.g., at least 25, 30, 35, 40, amino acids in length.
- the polypeptide described herein may be 20, 25, 30, 35, 40, 47, 55, 60 amino acids in length.
- the polypeptide described herein may be 47 amino acids in length.
- variants of the polypeptides described herein that differ in length retain one or more biological activities associated with the corresponding polypeptides, including at least the biological activity of binding to NTCP and bidirectionally regulating NTCP-mediated transport of bile acid into hepatocytes.
- the polypeptide described herein may comprise an N-terminal modification with a hydrophobic group.
- the hydrophobic group may be chosen from myristic acid, palmitic acid, stearic acid, oleic acid, linoleic acid, cholesterol, and arachidonic acid.
- the hydrophobic group may be chosen from myristic acid, palmitic acid, stearic acid, and cholesterol.
- the hydrophobic group may be myristic acid.
- the polypeptide described herein may comprise an amino acid sequence chosen from SEQ ID NOs: 23 and 34-40, wherein the N terminus may be modified with a hydrophobic group chosen from myristic acid, palmitic acid, stearic acid, and cholesterol.
- the polypeptide described herein may comprise an amino acid sequence chosen from SEQ ID NOs: 23 and 34-40, wherein the N terminus may be myristoylated.
- the polypeptide described herein may comprise the amino acid sequence of SEQ ID NO: 23, wherein the N terminus may be myristoylated.
- the polypeptide described herein may comprise a C-terminal modification to stabilize the polypeptide.
- the C-terminal modification may be chosen from amidation (amination) , isopentanediolization, and any other C-terminal modification capable of stabilizing the polypeptide described herein.
- the C-terminal modification may be amidation (amination) .
- the polypeptide described herein may comprise the amino acid sequence of NO: 23, wherein the N terminus may be myristoylated, and/or the C terminus may be amidated (aminated) .
- the polypeptide described herein may comprise the amino acid sequence of NO: 3 (Cmyr-47) .
- the polypeptide described herein may comprise an amino acid sequence chosen from SEQ ID NOs: 34-40, wherein the N terminus may be myristoylated, and/or the C terminus may be modified by amidated (aminated) .
- the polypeptide described herein may comprise an amino acid sequence chosen from SEQ ID NOs: 14-20.
- the variants of the polypeptide described herein that are modified at the N-terminus and/or the C-terminus retain one or more biological activities of the corresponding polypeptides that are not modified in the same manner, including at least the biological activity of binding to NTCP and bidirectionally regulating NTCP-mediated transport of bile acid into hepatocytes.
- Variants of the polypeptides described herein are also contemplated in the present disclosure, including variants with one or more amino acid deletions, substitutions, or insertions that retain one or more biological activities of the polypeptides, including at least the biological activity of binding to NTCP and bidirectionally regulating NTCP-mediated transport of bile acid into hepatocytes.
- the polypeptides described herein preferably retain the glycine corresponding to amino acid 13 of the pre-S1 region of HBV genotype C (i.e., the N-terminal glycine of SEQ ID NO: 23) .
- the polypeptides described herein retain the asparagine corresponding to amino acid 20 of the pre-S1 region of HBV genotype C.
- the polypeptide described herein may have one or more naturally-occurring mutations in the pre-S1 region of HBV. In some embodiments, the polypeptide described herein may have 1-30, such as, e.g., 1-20, 1-10, 1-8, 1-5, or 1-3, amino acid deletions, substitutions, or insertions relative to a sequence from the pre-S1 region of HBV, including all integers in between these ranges.
- the polypeptide described herein may have 1-30, such as, e.g., 1-20, 1-10, 1-8, 1-5, or 1-3, amino acid deletions, substitutions, or insertions relative to an amino acid sequence chosen from SEQ ID NOs: 23 and 34-40, including all integers in between these ranges. In some embodiments, the polypeptide described herein may have 1-30, such as, e.g., 1-20, 1-10, 1-8, 1-5, or 1-3, amino acid deletions, substitutions, or insertions relative to the amino acid sequence of SEQ ID NO: 23, including all integers in between these ranges.
- the polypeptide described herein may have 1-3 amino acid deletions, substitutions, or insertions from the amino acid sequence of SEQ ID NO: 23.
- the polypeptide described herein may have 1-30, such as, e.g., 1-20, 1-10, 1-8, 1-5, or 1-3, amino acid deletions or insertions at the C terminus of an amino acid sequence chosen from SEQ ID NOs: 23 and 34-40, including all integers in between these ranges.
- the polypeptide described herein may comprise an amino acid sequence chosen from SEQ ID NOs: 21, 22, and 24-28.
- the polypeptide described herein may comprise the amino acid sequence of any one of the polypeptides listed in Table 1.
- the polypeptide described herein may be chosen from any one of the post-translationally modified polypeptides listed in Table 1.
- the polypeptide described herein may have at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%identity to any of the polypeptides described herein.
- the polypeptide may comprise an amino acid sequence at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%identical to any one of SEQ ID NOs: 21-40.
- the polypeptide may comprise an amino acid sequence at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%identical to any one of SEQ ID NOs: 23 and 34-40. In some embodiments, the polypeptide may comprise an amino acid sequence at least about 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%identical to SEQ ID NO: 23.
- variants having certain sequence identity to the polypeptides described herein retain one or more biological activities of the corresponding polypeptides, including at least the biological activity of binding to NTCP and bidirectionally regulating NTCP-mediated transport of bile acid into hepatocytes.
- aspects of the present disclosure also include variants of the polypeptides described herein having a native flanking amino acid sequence from the HBV L protein, such as, e.g., from the pre-S1 region of the L protein, added to the N and/or C terminus.
- the native flanking amino acid sequence refers to the native sequence flanking the N or C terminus of the polypeptide described herein in the pre-S1 region of the corresponding HBV genotype or any other HBV genotypes.
- the polypeptide described herein may comprise an amino acid sequence chosen from SEQ ID NOs: 23 and 34-40, and a native flanking amino acid sequence at the N and/or C terminus derived from the pre-S1 region of any one of HBV genotypes A-H.
- the native flanking amino acid sequence may be derived from the consensus sequence of an HBV strain with the GenBank Accession No. KC875260 (genotype A; SEQ ID NO: 41) , AY220704 (genotype B; SEQ ID NO: 42) , AF461363 (genotype C; SEQ ID NO: 43) , AY796030 (genotype D; SEQ ID NO: 44) , AB205129 (genotype E; SEQ ID NO: 45) , DQ823095 (genotype F; SEQ ID NO: 46) , HE981176 (genotype G; SEQ ID NO: 47) , or AB179747 (genotype H; SEQ ID NO: 48) .
- polypeptide described herein may comprise the amino acid sequence of SEQ ID NO: 23, and a native flanking amino acid sequence at the N and/or C terminus derived from the pre-S1 region of HBV genotype C.
- polypeptide described herein may comprise the amino acid sequence of SEQ ID NO: 23, and a native flanking amino acid sequence at the N and/or C terminus derived from the pre-S1 region of any one of HBV genotypes A, B, D, E, F, G, and H.
- the N and/or C terminus of the polypeptide described herein may independently comprise a native flanking amino acid sequence having a length of 1-10, such as, e.g., 1-8, 1-5, or 1-3 amino acids, including all integers in between these ranges.
- the polypeptide described herein may comprise the amino acid sequence of SEQ ID NO: 23 and a native flanking amino acid sequence of 10 amino acids at the N terminus from the pre-S1 region of HBV genotype C.
- the polypeptide may comprise amino acids 2-59 of the pre-S1 region of HBV genotype C (SEQ ID NO: 29) .
- polypeptide described herein may comprise the amino acid sequence of SEQ ID NO: 23 and a native flanking amino acid sequence of 9 amino acids at the N terminus from the pre-S1 region of HBV genotype E or G.
- polypeptide may comprise amino acids 13-59 of the pre-S1 region of HBV genotype C and amino acids 2-11 of the pre-S1 region of HBV genotype E or G (SEQ ID NO: 30) .
- any polypeptides described herein can have native flanking amino acid sequences of any length extended from the N and/or C terminus, and the resulting polypeptides retain one or more biological activities of the original polypeptides, including at least the biological activity of binding to NTCP and bidirectionally regulating NTCP-mediated transport of bile acid into hepatocytes.
- the polypeptides described herein are capable of bidirectionally regulating NTCP-mediated transport of bile acids into hepatocytes.
- NTCP-mediated transport of bile acid into the hepatocytes may be enhanced as compared with hepatocytes that are not in contact with such polypeptide.
- NTCP-mediated transport of bile acid into the hepatocytes may be inhibited as compared with hepatocytes that are not in contact with such polypeptide.
- NTCP-mediated transport of bile acid into the hepatocytes may be enhanced as compared with hepatocytes that are not in contact with such polypeptide.
- NTCP-mediated transport of bile acid into the hepatocytes may be inhibited as compared with hepatocytes that are not in contact with such polypeptide.
- NTCP-mediated transport of bile acid into the hepatocytes may be enhanced as compared with hepatocytes that are not in contact with such polypeptide.
- NTCP-mediated transport of bile acid into the hepatocytes may be inhibited as compared with hepatocytes that are not in contact with such polypeptide.
- the polypeptides described herein may be capable of modulating, such as, e.g., reducing or stabilizing, the level or activity of one or more chemical or biological molecules associated with metabolism in a subject.
- metabolism may include, e.g., bile acid metabolism, glucose metabolism, lipid metabolism, or amino acid metabolism.
- the chemical or biological molecule is chosen from glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals.
- the polypeptides described herein may be capable of modulating, such as, e.g., reducing or stabilizing, the level or value of one or more physiological parameters that measure metabolic changes such as, e.g., glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index (AI) , heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index.
- the polypeptides described herein may be capable of increasing the serum level of bile acids in a subject.
- the polypeptides described herein may be capable of reducing the level of serum lipids in a subject.
- the polypeptides described herein may be capable of reducing the serum level of total cholesterol in a subject. In further embodiments, the polypeptides described herein may be capable of reducing the serum level of LDL-cholesterol in a subject. In some embodiments, the polypeptides described herein may be capable of reducing the serum level of triglyceride in a subject. In some embodiments, the polypeptides described herein may be capable of reducing the serum level of glucose in a subject. In some embodiments, the polypeptides described herein may be capable of reducing the serum level of HbA1c in a subject. In some embodiments, the polypeptides described herein may be capable of stabilizing the serum level of insulin in a subject. In some embodiments, the subject may be a mammal. In some embodiments, the subject may be a human. In some embodiments, the subject may suffer from a metabolic disease or may be at risk of developing such disease.
- module or “alter, ” all used interchangeably, includes “reducing, ” “decreasing, ” “lowering, ” “down-regulating, ” or “inhibiting” one or more quantifiable parameters optionally by a defined and/or statistically significant amount.
- modulate also includes “enhancing, ” “increasing, ” “elevating, ” “up-regulating, ” or “promoting” one or more quantifiable parameters optionally by a defined and/or statistically significant amount.
- metabolism e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, or hormones, including, e.g., insulin, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals
- “reduce” may mean that the level or value of one or more physiological parameters that measure metabolic changes, such as, e.g., glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index (AI) , heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index, are reduced below the level or activity observed in the absence of the polypeptides described herein or lower than a control polypeptide. In certain embodiments, reduction with a polypeptide described herein is below the level or activity observed in the presence of an inactive or attenuated molecule.
- metabolic changes such as, e.g., glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index (AI) , heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index
- the polypeptides described herein are capable of reducing the level of glucose, insulin, cholesterol, or triglyceride in the serum and/or in another tissue or organ, such as, e.g., liver, heart, muscle, visceral fat, subcutaneous fat, intestine, and brain.
- BMI body mass index
- the level of inflammation can be measured by following various clinical tests available in the art. For instance, the level of C-reactive protein (CRP) in blood can be measured to quantitatively measure the level of inflammation in a subject.
- CRP C-reactive protein
- An erythrocyte sedimentation rate (ESR) test is another example of tests that measure the level of inflammation in a subject. The ESR test measures the rate of erythrocytes sediment in a set period.
- AI atherosclerosis index
- homeostatic model assessment (HOMA) index may refer HOMA-IR (quantifying the level of insulin resistance) index and/or HOMA- ⁇ index (quantifying the level of ⁇ -cell function) .
- total fat index refers to the ratio between the weight of fat (e.g., abdominal and/or scapular fat) and the total body weight.
- the terms “enhance, ” “increase, ” “elevate, ” “up-regulate, ” and “promote” all used interchangeably, mean that the level or activity of one or more chemical or biological molecules associated with metabolism, such as, e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, including, e.g., insulin, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals, is increased above the level or activity observed in the absence of the polypeptides described herein or higher than a control polypeptide.
- metabolism such as, e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, including, e.g., insulin, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals.
- “enhance” may mean that the level of value of one or more physiological parameters that measure metabolic changes, such as, e.g., glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index (AI) , heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index, are increased above the level or activity observed in the absence of the polypeptides described herein or higher than a control polypeptide. In certain embodiments, increase with a polypeptide described herein is above the level or activity observed in the presence of an inactive or attenuated molecule.
- physiological parameters that measure metabolic changes such as, e.g., glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index (AI) , heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index
- the polypeptides described herein are capable of increasing the level of bile acid in the serum and/or in another tissue or organ, such as, e.g., liver, heart, muscle, visceral fat, subcutaneous fat, intestine, and brain.
- stabilize, ” “maintain, ” “sustain, ” and “preserve, ” are used interchangeably in connection with one or more chemical or biological molecules associated with metabolism, and mean that the level or activity of the one or more chemical or biological molecules associated with metabolism, such as, e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, including, e.g., insulin, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals, shows a minimal difference from the level or activity observed in a healthy subject or a subject who is not suffering from a metabolic disease, or from the level or activity observed in the presence of a positive control polypeptide.
- level or activity of the one or more chemical or biological molecules associated with metabolism such as, e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, including, e.g., insulin, LDL-C
- “stabilize” may mean that the level or value of one or more physiological parameters that measure metabolic changes, such as, e.g., glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index (AI) , heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index, shows a minimal difference from the level or value observed in a healthy subject or a subject who is not suffering from a metabolic disease, or from the level or value observed in the presence of a positive control polypeptide.
- the polypeptides described herein are capable of stabilizing the level of insulin in the serum and/or insulin production from pancreas.
- polypeptides described herein can be made by chemical synthesis or by employing recombinant technology.
- a synthetic gene When recombinant procedures are selected, a synthetic gene may be constructed de novo or a natural gene may be mutated by, for example, cassette mutagenesis.
- the polypeptides described herein may be produced using recombinant DNA techniques. These techniques contemplate, in simplified form, taking the gene, either natural or synthetic, encoding the peptide; inserting it into an appropriate vector; inserting the vector into an appropriate host cell; culturing the host cell to cause expression of the gene; and recovering or isolating the peptide produced thereby. In some embodiments, the recovered peptide is then purified to a suitable degree.
- DNA sequence encoding a polypeptide described herein is cloned and manipulated so that it may be expressed in a convenient host.
- DNA encoding parent polypeptides can be obtained from an HBV genomic library, from cDNA derived from mRNA from cells expressing the polypeptide, or by synthetically constructing the DNA sequence.
- the parent DNA is then inserted into an appropriate plasmid or vector which is used to transform a host cell.
- plasmid vectors containing replication and control sequences which are derived from species compatible with the host cell are used in connection with those hosts.
- the vector ordinarily carries a replication site, as well as sequences which encode proteins or peptides that are capable of providing phenotypic selection in transformed cells.
- the vector may be those commonly used in the art, or constructed using standard techniques by combining functional fragments of the vectors commonly used in the art.
- the host cell may be prokaryotic or eukaryotic.
- prokaryotic host cells may include E. coli, Bacillus subtilis, and other enterobacteriaceae such as, e.g., Salmonella typhimurium or Serratia marcesans, and various Pseudomonas species.
- eukaryotic organisms such as yeast cultures, or cells derived from multicellular organisms, such as insect or mammalian cell cultures, may be used. Examples of such eukaryotic host cell lines include VERO and HeLa cells, Chinese Hamster Ovary (CHO) cell lines, W138, 293, BHK, COS-7, and MDCK cell lines.
- the polypeptides described herein may be prepared using solid-phase synthesis, or other equivalent chemical syntheses known in the art.
- solid-phase synthesis is initiated from the C-terminus of the peptide by coupling a protected ⁇ -amino acid to a suitable resin.
- a suitable resin can be prepared by attaching an ⁇ -amino-protected amino acid by an ester linkage to a chloromethylated resin or a hydroxymethyl resin, or by an amide bond to a BHA resin or MBHA resin.
- the amino acids are coupled to the peptide chain using techniques well known in the art for the formation of peptide bonds.
- One method involves converting the amino acid to a derivative that will render the carboxyl group more susceptible to reaction with the free N-terminal amino group of the peptide fragment.
- the amino acid can be converted to a mixed anhydride by reaction of a protected amino acid with ethylchloroformate, phenyl chloroformate, sec-butyl chloroformate, isobutyl chloroformate, pivaloyl chloride or like acid chlorides.
- the amino acid can be converted to an active ester such as a 2, 4, 5-trichlorophenyl ester, a pentachlorophenyl ester, a pentafluorophenyl ester, a p-nitrophenyl ester, a N-hydroxysuccinimide ester, or an ester formed from 1-hydroxybenzotriazole.
- an active ester such as a 2, 4, 5-trichlorophenyl ester, a pentachlorophenyl ester, a pentafluorophenyl ester, a p-nitrophenyl ester, a N-hydroxysuccinimide ester, or an ester formed from 1-hydroxybenzotriazole.
- Another coupling method involves use of a suitable coupling agent such as N, N′-dicyclohexylcarbodiimide or N, N′-diisopropylcarbodiimide.
- the ⁇ -amino group of each amino acid employed in the peptide synthesis may be protected during the coupling reaction to prevent side reactions involving their active ⁇ -amino function.
- certain amino acids that contain reactive side-chain functional groups e.g., sulfhydryl, amino, carboxyl, and hydroxyl
- suitable protecting groups to prevent a chemical reaction from occurring at that site during both the initial and subsequent coupling steps.
- the selection of a suitable side-chain protecting group is within the skill of the art. The protecting group will be readily removable upon completion of the desired amino acid peptide under reaction conditions that will not alter the structure of the peptide chain.
- the remaining ⁇ -amino and side-chain protected amino acids are coupled stepwise within the desired order.
- some may be coupled to one another prior to addition to the solid-phase synthesizer. The selection of an appropriate coupling reagent is within the skill of the art.
- Each protected amino acid or amino acid sequence is introduced into the solid-phase reactor in excess, and the coupling is suitably carried out in a medium of dimethylformamide (DMF) or CH 2 Cl 2 or mixtures thereof. If incomplete coupling occurs, the coupling procedure is repeated before removal of the N-amino protecting group prior to the coupling of the next amino acid. The success of the coupling reaction at each stage of the synthesis may be monitored.
- the coupling reactions can be performed automatically using well known methods, for example, a BIOSEARCH 9500 TM peptide synthesizer.
- the protected peptide Upon completion of the desired peptide sequence, the protected peptide must be cleaved from the resin support, and all protecting groups must be removed. The cleavage reaction and removal of the protecting groups is suitably accomplished simultaneously or stepwise.
- the bond anchoring the peptide to the resin is an ester linkage formed between the free carboxyl group of the C-terminal residue and one of the many chloromethyl groups present on the resin matrix. It will be appreciated that the anchoring bond can be cleaved by reagents that are known to be capable of breaking an ester linkage and of penetrating the resin matrix.
- polypeptides may be modified (such as, e.g., modified at the N-terminus with a hydrophobic group, including, e.g., myristic acid, palmitic acid, stearic acid, oleic acid, linoleic acid, cholesterol, arachidonic acid; modified at the C-terminus by amidation (amination) , isopentanediolization, or other stabilizing C-terminal modification) either before or after the polypeptide is cleaved from the support.
- a hydrophobic group including, e.g., myristic acid, palmitic acid, stearic acid, oleic acid, linoleic acid, cholesterol, arachidonic acid
- modified at the C-terminus by amidation (amination) , isopentanediolization, or other stabilizing C-terminal modification either before or after the polypeptide is cleaved from the support.
- Purification of the polypeptides of the invention may be achieved using conventional procedures such as preparative HPLC (including reversed phase HPLC) or other known chromatographic techniques such as gel permeation, ion exchange, partition chromatography, affinity chromatography (including monoclonal antibody columns) or countercurrent distribution.
- preparative HPLC including reversed phase HPLC
- chromatographic techniques such as gel permeation, ion exchange, partition chromatography, affinity chromatography (including monoclonal antibody columns) or countercurrent distribution.
- compositions comprising a polypeptide described herein.
- the composition may comprise any one or more polypeptides described herein.
- the composition may further comprise a suitable pharmaceutically acceptable carrier.
- the pharmaceutical composition when administered to a subject in need thereof, provides serum concentrations of the polypeptide described herein that allow for bidirectional regulation of NTCP-mediated bile acid uptake in the subject.
- a “pharmaceutically acceptable carrier” refers to an inactive ingredient, such as, e.g., solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, excipient, or carrier, for use with a therapeutic agent that together comprise a “pharmaceutical composition” for administration to a subject.
- a pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed, and is compatible with other ingredients of the formulation.
- the pharmaceutically acceptable carrier is appropriate for the formulation employed.
- the carrier may be a gel capsule. If the therapeutic agent is to be administered subcutaneously, the carrier ideally is not irritable to the skin and does not cause injection site reaction.
- compositions of the polypeptides described herein may be prepared by mixing such polypeptide having the desired degree of purity with one or more optional pharmaceutically acceptable carriers.
- Pharmaceutically acceptable carriers may include, e.g. : buffers (such as, e.g., phosphate, citrate, and other organic acids) ; antioxidants (such as, e.g., ascorbic acid and methionine) ; preservatives (such as, e.g., octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethonium chloride, phenol, butyl or benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m-cresol) ; low molecular weight (such as, e.g., less than about 10 residues)
- Exemplary pharmaceutical carriers may also include binding agents (such as, e.g., pregelatinized maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose, etc. ) ; fillers (such as, e.g., lactose and other sugars, microcrystalline cellulose, pectin, gelatin, calcium sulfate, ethyl cellulose, polyacrylates or calcium hydrogen phosphate, etc. ) ; lubricants (such as, e.g., magnesium stearate, talc, silica, colloidal silicon dioxide, stearic acid, metallic stearates, hydrogenated vegetable oils, corn starch, polyethylene glycols, sodium benzoate, sodium acetate, etc. ) ; disintegrants (such as, e.g., starch, sodium starch glycolate, etc. ) ; and wetting agents (such as, e.g., sodium lauryl sulphate, etc. ) .
- Exemplary pharmaceutically acceptable carriers may further include interstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP) , for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 ( Baxter International, Inc. ) .
- sHASEGP soluble neutral-active hyaluronidase glycoproteins
- rHuPH20 Baxter International, Inc.
- a sHASEGP may be combined in the pharmaceutical composition with one or more additional glycosammoglycanases, such as, e.g., chondroitinases.
- compositions may also comprise more than one active ingredient suitable for the particular indication being treated, for example, those with complementary activities that do not adversely affect each other.
- active ingredients may be suitably present in combination in amounts that are effective for the purpose intended.
- the active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, such as, e.g., hydroxymethylcellulose or gelatin-microcapsules and poly- (methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (such as e.g., liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) , or in macroemulsions.
- colloidal drug delivery systems such as e.g., liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- the pharmaceutical composition may comprise sustained-release preparations.
- sustained-release preparations include, e.g., semipermeable matrices of solid hydrophobic polymers containing the polypeptides described herein, which matrices may be in the form of shaped articles, such as, e.g., films or microcapsules.
- the pharmaceutical compositions may be used for in vivo administration and may be sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
- the pharmaceutical compositions may be formulated into any of many possible dosage forms, such as, e.g., tablets, capsules, gel capsules, powders, or granules.
- the pharmaceutical compositions may also be formulated as solutions, suspensions, emulsions, or mixed media.
- the pharmaceutical compositions may be formulated as lyophilized formulations or aqueous solutions.
- the pharmaceutical compositions may be formulated as a solution.
- the polypeptides described herein may be administered in an unbuffered solution, such as, e.g., in saline or in water.
- the polypeptides may also be administered in a suitable buffer solution.
- the buffer solution may comprise acetate, citrate, prolamine, carbonate, or phosphate, or any combination thereof.
- the buffer solution may be phosphate buffered saline (PBS) .
- PBS phosphate buffered saline
- the pharmaceutical compositions may be formulated as suspensions in aqueous, non-aqueous, or mixed media.
- Aqueous suspensions may further contain substances which increase the viscosity of the suspension including, for example, sodium carboxymethylcellulose, sorbitol and/or dextran.
- the suspension may also contain stabilizers.
- the pharmaceutical compositions may be formulated as emulsions.
- Exemplary emulsions include heterogeneous systems of one liquid dispersed in another in the form of droplets usually exceeding 0.1 ⁇ m in diameter.
- Emulsions may contain additional components in addition to the dispersed phases, and the active drug which may be present in a solution in the aqueous phase, the oily phase, or itself as a separate phase.
- Microemulsions are also included as an embodiment of the present disclosure.
- the pharmaceutical compositions may also be formulated as liposomal formulations.
- Embodiments of the present disclosure include therapeutic uses of the polypeptides described herein.
- use of the polypeptides described herein as a medicament is provided.
- use of the polypeptides described herein in treating a metabolic disease is provided.
- the metabolic disease involves dysregulation of lipid metabolism.
- the metabolic disease may be a cholesterol-related disorder.
- the cholesterol-related disorder may be hyperlipidemia.
- the hyperlipidemia may be hypertriglyceridemia, hypercholesterolemia, or a combination thereof.
- use of the polypeptides described herein in treating conditions associated with elevated serum level of any one of total triglycerides, total cholesterol, and LDL-C is provided.
- the metabolic disease involves dysregulation of glucose metabolism.
- the metabolic disease is diabetes.
- the metabolic disease is type II diabetes.
- the metabolic disease is obesity.
- use of the polypeptides described herein in treating conditions associated with elevated serum level of glucose or HbA1c is also provided.
- a method of treating a metabolic disease in a subject comprising administering to the subject a therapeutically effective amount of the polypeptides described herein or of a pharmaceutical composition of such polypeptide.
- the subject may suffer from a metabolic disease or may be at risk of developing such disease.
- the subject may be a mammal.
- the subject may be a human.
- the methods and uses described herein may further comprise administering to the subject a therapeutically effective amount of at least one additional therapeutic agent.
- the metabolic disease involves dysregulation of lipid metabolism.
- the metabolic disease may be a cholesterol-related disorder.
- the cholesterol-related disorder may be hyperlipidemia.
- the hyperlipidemia may be hypertriglyceridemia, hypercholesterolemia, or a combination thereof.
- a method of lowering the level of serum lipids, such as, e.g., the total cholesterol, total triglyceride, or LDL cholesterol level, in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the polypeptide described herein or of a pharmaceutical composition of such polypeptide.
- the subject is suffering or at risk of developing a metabolic disease involving dysregulation of lipid metabolism.
- the subject is suffering or at risk of developing a cholesterol-related disorder.
- the subject is suffering or at risk of developing hyperlipidemia.
- the subject is suffering or at risk of developing hypertriglyceridemia, hypercholesterolemia, or a combination thereof.
- the metabolic disease involves dysregulation of glucose metabolism.
- the metabolic disease is diabetes.
- the metabolic disease is type II diabetes.
- the metabolic disease is obesity.
- a method of lowering the blood glucose or HbA1c level in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the polypeptide described herein or of a pharmaceutical composition of such polypeptide.
- a method of stabilizing the serum level of insulin in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the polypeptide described herein or of a pharmaceutical composition of such polypeptide.
- the subject is suffering from or at risk of developing a metabolic disease involving dysregulation of glucose metabolism.
- the subject is suffering or at risk of developing diabetes.
- the subject is suffering from or at a risk of developing type II diabetes.
- the subject is suffering from or at a risk of developing obesity.
- the polypeptide described herein may be capable of treating the metabolic diseases or modulating the serum level of metabolism-associated molecules in the subject by bidirectionally regulating NTCP-mediated bile acid uptake in the subject following administration of the polypeptide to the subject.
- the concentration of the polypeptide described herein in the blood stream of a subject administered with such polypeptide is at or below a certain concentration, bile acid uptake in the subject is enhanced.
- the concentration of the polypeptide described herein in the blood stream of the subject is above a certain concentration, bile acid uptake in the subject is inhibited.
- bile acid uptake in the subject when the concentration of the polypeptide described herein in the blood stream of a subject administered with such polypeptide is at or below 93 nmol/L, bile acid uptake in the subject is enhanced. In some embodiments, when the concentration of the polypeptide described herein in the blood stream of the subject is above 93 nmol/L, bile acid uptake in the subject is inhibited. For example, when the concentration of the Cmyr-47 polypeptide described herein in the blood stream of a subject administered with such polypeptide is at or below 500 ng/ml, bile acid uptake in the subject is enhanced.
- the serum concentration of the polypeptide described herein may be measured at least about 10, 20, 40, 60, 90, 120, 180, 240, or 360 minutes following the administration. In some embodiments, the serum concentration of the polypeptide described herein is above 93 nmol/L by certain time following the administration. In some embodiments, the serum concentration of the polypeptide described herein is at or below 93 nmol/L after that time following the administration. For example, the serum concentration of the Cmyr-47 polypeptide described herein is above 500 ng/ml by a certain time following the administration. In some embodiments, the serum concentration of the Cmyr-47 polypeptide described herein is at or below 500 ng/ml after that time following the administration. In some embodiments, such threshold serum concentration of the polypeptide occurs at about 20 minutes following the administration.
- a “metabolic disease” or “metabolic disorder” includes any disease that may be caused by dysregulation of metabolic pathways, such as, e.g., pathways involved in bile acid metabolism, glucose metabolism, lipid metabolism, and amino acid metabolism.
- the metabolic disease refers to a disease that involves dysregulation of lipid metabolism.
- the metabolic disease refers to a disease that comprises dysregulation in producing, clearing, and/or utilizing lipid metabolites including, e.g., bile acids, cholesterol, triglycerides, and fatty acids.
- the metabolic disease described herein therefore may refer to a cholesterol-related disorder.
- the metabolic disease described herein therefore may refer to hyperlipidemia, such as, e.g., hypertriglyceridemia, hypercholesterolemia, or a combination thereof.
- the metabolic disease refers to a disease that involves dysregulation of glucose metabolism.
- the metabolic disease refers to a disease that comprises dysregulation in producing, clearing, and/or utilizing glucose metabolites, e.g., glucose, pyruvate, and glucose-6-phosphate.
- the metabolic disease described herein therefore may refer to diabetes and obesity.
- the metabolic disease described herein may be chosen from hyperglycemia; hypoglycemia; hyperinsulinemia; obesity, hyperlipidemia; hypertriglyceridemia; hypercholesterolemia; heart disease; metabolic syndrome; atherosclerotic disease; coronary heart disease; coronary artery disease; peripheral arterial disease; angina pectoris; cerebrovascular disease; acute coronary syndrome; myocardial infarction; stroke; cardiovascular disease; Alzheimer’s disease; dyslipidemias; familial combined hyperlipidemia; familial hypertriglyceridemia; familial hypercholesterolemia; heterozygous hypercholesterolemia; homozygous hypercholesterolemia; familial defective apolipoprotein B-100; polygenic hypercholesterolemia; remnant removal disease; hepatic lipase deficiency; dyslipidemia caused by dietary indiscretion, hypothyroidism, drugs including estrogen and progestin therapy, beta-blockers, and thiazide diuretics; nephrotic syndrome; chronic renal failure; Cushing
- metabolic disease includes, e.g., type I diabetes, type II diabetes, hyperglycemia, hypoglycemia, hyperinsulinemia, obesity, hyperlipidemia, hypertriglyceridemia, hypercholesterolemia, heart disease, metabolic syndrome, coronary heart disease, stroke, cardiovascular diseases, Alzheimer’s disease, and generally dyslipidemias, which can be manifested, for example, by an elevated total serum cholesterol, LDL, triglycerides, VLDL, and/or HDL.
- primary and secondary dyslipidemias that can be treated using the polypeptides described herein, either alone or in combination with one or more other agents include metabolic syndrome, diabetes, hyperlipidemia, familial combined hyperlipidemia, familial hypertriglyceridemia, familial hypercholesterolemia, including heterozygous hypercholesterolemia, homozygous hypercholesterolemia, familial defective apolipoprotein B-100; polygenic hypercholesterolemia; remnant removal disease, hepatic lipase deficiency; dyslipidemia secondary to any of the following: dietary indiscretion, hypothyroidism, drugs including estrogen and progestin therapy, beta-blockers, and thiazide diuretics; nephrotic syndrome, chronic renal failure, Cushing’s syndrome, primary biliary cirrhosis, glycogen storage diseases, hepatoma, cholestasis, acromegaly, insulinoma, isolated growth hormone deficiency, and alcohol-induced hypertriglyce
- the polypeptide described herein is useful in preventing or treating one or more metabolic diseases.
- the polypeptides described herein can also be useful in preventing or treating one or more symptoms or complications associated with a metabolic disease.
- the polypeptide can be used to prevent or treat cardiovascular diseases, including atherosclerotic diseases, such as, e.g., coronary heart disease, coronary artery disease, peripheral arterial disease, stroke (ischaemic and hemorrhagic) , angina pectoris, or cerebrovascular disease and acute coronary syndrome, myocardial infarction.
- the polypeptides described herein can also be useful in preventing or treating heart diseases, kidney impairment, or obesity associated with a metabolic disorder.
- diabetes refers to a disease or condition generally characterized by metabolic defects in production and/or utilization of glucose that result in the failure to maintain appropriate blood sugar levels in the body. The results of these defects include elevated blood glucose, referred to as “hyperglycemia. ”
- Type I diabetes generally results from an absolute deficiency of insulin (e.g., the production from pancreatic ⁇ cells is extremely low or completely ablated) , therefore failing to regulate glucose utilization.
- Type II diabetes often occurs in the face of normal or even elevated levels of insulin, and can result from the inability of tissues to respond appropriately to insulin. Most Type II diabetic patients are insulin resistant and have a relative deficiency of insulin in that insulin secretion cannot compensate for the resistance of peripheral tissues to respond to insulin.
- hyperlipidemia refers to a condition characterized by an abnormal increase in serum lipids.
- the lipids fractions in the circulating blood include, e.g., total cholesterol, certain lipoproteins, and triglycerides.
- Serum lipoproteins serve as carriers for lipids in the circulation and are classified by their density, including: chylomicrons, very low density lipoproteins ( “LDL” ) , intermediate density lipoproteins ( “IDL” ) , low density lipoproteins ( “LDL” ) , and high density lipoproteins ( “HDL” ) .
- the term “hyperlipidemia” encompasses primary and secondary hyperlipidemia.
- Primary hyperlipidemia is generally caused by genetic defects, while secondary hyperlipidemia is generally caused by other factors, such as various disease states, drugs, and dietary factors.
- secondary hyperlipidemia may be caused by diabetes.
- hyperlipidemia can result from a combination of primary and secondary causes.
- Hyperlipidemia may encompass hypertriglyceridemia, hypercholesterolemia, or a combination thereof.
- hypertriglyceridemia, ” as used herein refers to a condition in which serum total triglyceride levels are elevated above a desired level.
- hypercholesterolemia, ” as used herein refers to a condition in which serum cholesterol levels are elevated above a desired level.
- the serum total cholesterol, HDL cholesterol ( “HDL-C” ) , or LDL cholesterol ( “LDL-C” ) levels are elevated above the desired level in hypercholesterolemia.
- Hyperlipidemia also imposes a risk in and may encompass development of cardiovascular and atherosclerosis diseases.
- cardiovascular disease encompasses a disease of the blood vessels of the circulation system caused by abnormally high concentrations of lipids in the vessels.
- atherosclerosis refers to a disease of the arteries in which fatty plaques develop on the inner walls, with eventual obstruction of blood flow.
- “Patient” and “subject” may be used interchangeably to refer to an animal, such as a mammal or a human, being treated or assessed for a disease, disorder, or condition, at risk of developing a disease, disorder, or condition, or having or suffering from a disease, disorder, or condition.
- such disease, disorder, or condition may include a metabolic disease.
- the metabolic disease may involve dysregulation of lipid metabolism.
- the metabolic disease may be a cholesterol-related disorder, such as hyperlipidemia (e.g., hypercholesterolemia, hypertriglyceridemia, or a combination thereof) .
- the metabolic disease may involve dysregulation of glucose metabolism.
- the metabolic disease may be diabetes, including type I and type II diabetes.
- a “therapeutically effective amount” or “effective amount” of a polypeptide described herein or a composition comprising such polypeptide refers to an amount effective in the prevention or treatment of a disorder for the treatment of which the polypeptide or composition is effective.
- the term may include an amount of the polypeptide described herein that is effective in increasing the serum level of bile acid in a subject suffering from or at a risk of developing a metabolic disease.
- the term may include an amount of the polypeptide described herein that is effective in lowering the blood glucose or HbA1c level or stabilizing the serum level of insulin in a subject suffering from or at a risk of developing a metabolic disease, such as, e.g., diabetes and obesity.
- the term may also include an amount of the polypeptide described herein that is effective in lowering the level of serum lipids, such as, e.g., the total cholesterol, total triglycerides, LDL cholesterol level, in a subject suffering from or at a risk of developing a metabolic disease, such as, e.g., hyperlipidemia, including hypercholesterolemia, hypertriglyceridemia, or both.
- serum lipids such as, e.g., the total cholesterol, total triglycerides, LDL cholesterol level
- a metabolic disease such as, e.g., hyperlipidemia, including hypercholesterolemia, hypertriglyceridemia, or both.
- the term also includes an amount of a polypeptide described herein that, when administered to a subject for treating a metabolic disease, such as, e.g., diabetes and hyperlipidemia (e.g., hypercholesterolemia, hypertriglyceridemia, or both) , is sufficient to effect treatment of the disease, e.g., by diminishing, ameliorating, or maintaining the existing disease or one or more symptoms of the disease, or by inhibiting the progression of the disease.
- a metabolic disease such as, e.g., diabetes and hyperlipidemia (e.g., hypercholesterolemia, hypertriglyceridemia, or both)
- hyperlipidemia e.g., hypercholesterolemia, hypertriglyceridemia, or both
- the “therapeutically effective amount” or “effective amount” may vary depending on the polypeptide, the route of administration, the disease and its severity, and the health, age, weight, family history, genetic makeup, stage of pathological processes, the types of preceding or concomitant treatments, if any, and other individual characteristics of the subject to be treated.
- the “therapeutically effective amount” of the polypeptide described herein may allow the administered polypeptide to reach a concentration in the blood stream of the subject at which the polypeptide is capable of inhibiting NTCP-mediated bile acid uptake in the subject.
- a therapeutically effective amount of the polypeptide described herein may allow the administered polypeptide to reach at least about 93 nmol/L in the blood stream of a subject administered with that amount.
- a therapeutically effective amount of the Cmyr-47 polypeptide described herein may allow the administered polypeptide to reach at least about 500 ng/ml in the blood stream of a subject administered with that amount.
- a therapeutically effective amount of the polypeptide described herein refers to an amount such that the serum concentrations of the administered polypeptide allow for bidirectional regulation of NTCP-mediated bile acid uptake in the subject.
- the initial serum concentration of the polypeptide in the subject may be above a certain concentration where the polypeptide inhibits NTCP-mediated bile acids uptake.
- the serum concentration of the polypeptide in the subject may gradually reduce and fall to or below a value where the polypeptide begins enhancing NTCP-mediated bile acids uptake.
- the serum concentration of the administered polypeptide may be assessed at least about 10, 20, 40, 60, 90, 120, 180, 240, or 360 minutes after the administration.
- the therapeutically effective amount of the polypeptide described herein allows the polypeptide to reach a serum concentration above 93 nmol/L by certain time following the administration.
- the therapeutically effective amount of the polypeptide described herein allows the polypeptide to reach a serum concentration at or below 93 nmol/L after that certain time following the administration.
- the therapeutically effective amount of the Cmyr-47 polypeptide described herein allows the polypeptide to reach a serum concentration above 500 ng/ml by certain time following the administration.
- the therapeutically effective amount of the Cmyr-47 polypeptide described herein allows the polypeptide to reach a serum concentration at or below 500 ng/ml after that certain time following the administration. In some embodiments, the therapeutically effective amount of the polypeptide described herein produces such threshold serum concentration of the polypeptide at about 20 minutes following the administration.
- treatment includes treatment of a subject (e.g. a mammal, such as a human) or a cell to alter the current course of the subject or cell.
- Treatment includes, e.g., administration of a polypeptide described herein or a pharmaceutical composition comprising such polypeptide, and may be performed either prophylactically or subsequent to the initiation of a pathologic event or contact with an etiologic agent.
- prophylactic treatments which can be directed to reducing the rate of progression of the disease or condition being treated, delaying the onset of that disease or condition, or reducing the severity of its onset.
- Treatment does not necessarily indicate complete eradication, cure, or prevention of the disease or condition or the associated symptoms.
- the term “treatment” may include relieving, slowing, or reversing the pathological processes or symptoms in a subject suffering from a metabolic disease, such as, e.g., diabetes and hyperlipidemia (e.g., hypercholesterolemia, hypertriglyceridemia, or both) .
- the term “treatment” may include improving at least one symptom or measurable parameter of a metabolic disease. It will be apparent to one of skill in the art which biological and/or physiological parameters can be used to access the pathological process of the metabolic disease.
- Such pathological processes or symptoms may include, e.g., excessive or increased levels compared with healthy subjects of one or more chemical or biological molecules associated with metabolism, such as, e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, including, e.g., insulin, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals; or of one or more physiological parameters that measure metabolic changes, such as, e.g., glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index (AI) , heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index.
- chemical or biological molecules associated with metabolism such as, e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, including, e.g., insulin, LDL-C, HDL-C, HbA
- administering include delivery of the polypeptide described herein to a subject either by local or systemic administration.
- Administration may be topical (including ophthalmic and to mucous membranes including vaginal and rectal delivery) , pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer, intratracheal, intranasal) , epidermal, transdermal, oral, or parenteral.
- Parenteral administration includes intravenous, subcutaneous, intraperitoneal, or intramuscular injection or infusion; or intracranial, e.g., intrathecal or intraventricular, administration.
- the present disclosure provides use of the polypeptides described herein in modulating, such as, e.g., reducing or stabilizing, the level or activity of one or more chemical or biological molecules associated with metabolism, such as, e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals in a subject.
- one or more chemical or biological molecules associated with metabolism such as, e.g., glucose, triglyceride, cholesterol, free fatty acids, bile acids, amino acids, hormones, LDL-C, HDL-C, HbA1c, blood urea nitrogen, and minerals in a subject.
- the present disclosure provides use of the polypeptides described herein in modulating, such as, e.g., reducing or stabilizing, the level or value of one or more physiological parameters that measure metabolic changes such as, e.g., glycemia, blood pressure, body weight, fat mass, body mass index (BMI) , inflammation, atherosclerosis index (AI) , heart index, kidney index, total fat index, and homeostatic model assessment (HOMA) index.
- glycemia blood pressure
- body weight fat mass
- body mass index BMI
- inflammation atherosclerosis index
- AI atherosclerosis index
- HOMA homeostatic model assessment
- the present disclosure provides use of the polypeptides described herein in reducing the level of serum lipids in a subject. In some embodiments, the present disclosure provides use of the polypeptides described herein in reducing the serum level of total cholesterol in a subject. In further embodiments, the present disclosure provides use of the polypeptides described herein in reducing the serum level of LDL-cholesterol in a subject. In some embodiments, the present disclosure provides use of the polypeptides described herein in reducing the serum level of triglyceride in a subject. In some embodiments, the present disclosure provides use of the polypeptides described herein in reducing the serum level of glucose in a subject. In some embodiments, the present disclosure provides use of the polypeptides described herein in stabilizing the serum level of insulin in a subject. In some embodiments, the subject may be a mammal. In some embodiments, the subject may be a human.
- the present disclosure provides use of the polypeptides described herein in reducing the risk of developing a metabolic disease. In certain embodiments, the present disclosure also provides use of the polypeptides described herein in reducing the risk of developing one or more symptoms or complications associated with a metabolic disease.
- the metabolic disease involves dysregulation of lipid metabolism. In some embodiments, the metabolic disease is a cholesterol-related disorder. In some embodiments, the metabolic disease is hyperlipidemia. The hyperlipidemia may include hypertriglyceridemia, hypercholesterolemia, or both. In some embodiments, the metabolic disease involves dysregulation of glucose metabolism. In some embodiments, the metabolic disease is diabetes. The diabetes may include type I and type II diabetes. In some embodiments, the metabolic disease is obesity.
- the symptoms or complications associated with the metabolic disease may include, e.g., cardiovascular diseases such as atherosclerosis diseases, heart diseases, kidney impairment, or obesity, in a subject having such metabolic disease (such as, e.g., diabetes, hyperlipidemia, including hypertriglyceridemia, hypercholesterolemia, or both) .
- cardiovascular diseases such as atherosclerosis diseases, heart diseases, kidney impairment, or obesity
- hyperlipidemia including hypertriglyceridemia, hypercholesterolemia, or both.
- the present disclosure also provides methods to carry out the above uses of the polypeptides described herein in a subject. Such methods may comprise administering to the subject a therapeutically effective amount of a polypeptide described herein or of a pharmaceutical composition comprising such polypeptide.
- the subject may be a mammal.
- the subject may be a human.
- the subject may suffer from a metabolic disease or may be at risk of developing such disease.
- the present disclosure provides for the use of the polypeptides described herein in the manufacture or preparation of a medicament.
- the medicament may be for treatment of a metabolic disease.
- the metabolic disease may involve dysregulation of lipid metabolism.
- the medicament may be for treatment of a cholesterol-related disorder.
- the cholesterol-related disorder may be hyperlipidemia.
- the hyperlipidemia may be hypertriglyceridemia, hypercholesterolemia, or a combination thereof.
- the medicament is for use in a method of lowering the level of serum lipids, such as, e.g., the total cholesterol, total triglyceride, or LDL cholesterol level, in a subject, comprising administering to the subject a therapeutically effective amount of the medicament.
- serum lipids such as, e.g., the total cholesterol, total triglyceride, or LDL cholesterol level
- the metabolic disease may involve dysregulation of glucose metabolism.
- the medicament may be for treatment of diabetes e.g., type I or type II diabetes. .
- the medicament may be for treatment of obesity.
- the medicament is for use in a method of lowering the blood glucose or HbA1c level in a subject, comprising administering to the subject a therapeutically effective amount of the medicament.
- the disorder treated may be any disease or condition which can be improved, ameliorated, inhibited, or prevented by bidirectionally regulating NTCP activity.
- disorders or disease that can benefit from the regulation of bile acid intake by hepatocytes can also be treated by the polypeptides described herein.
- subjects treatable by the polypeptides and methods and uses described herein may include subjects indicated for LDL apheresis, subjects with diabetes, subjects with primary hyperlipidemia (including hypercholesterolemia, hypertriglyceridemia, or a combination thereof) who are intolerant or uncontrolled by other therapeutic agent, and subjects at risk for developing hyperlipidemia who may be preventably treated.
- dyslipidemia associated with secondary causes such as Type 2 diabetes mellitus, cholestatic liver diseases (primary biliary cirrhosis) , nephrotic syndrome, hypothyroidism, obesity, and the prevention and treatment of cardiovascular diseases (e.g., atherosclerotic diseases) , heart diseases, and kidney impairment.
- the methods and uses described herein may further comprise administering to the subject an effective amount of at least one additional therapeutic agent.
- the additional therapeutic agent may be for preventing and/or treating one or more diseases associated with the metabolic diseases described herein, such as, e.g., one or more diseases associated with diabetes or hyperlipidemia.
- the additional therapeutic agent may be for preventing and/or treating cardiovascular diseases (e.g., atherosclerotic diseases) .
- the additional therapeutic agent may be for reducing the risk of recurrent cardiovascular events.
- the additional therapeutic agent may be for preventing and/or treating heart diseases, kidney impairment, or obesity.
- the polypeptides described herein can be used either alone or in combination with other agents in a therapy.
- any of the polypeptides described herein may be administered before, concurrently with, or after administration of at least one additional therapeutic agent.
- the additional therapeutic agent may be chosen from e.g., an antihyperlipidemic agent, an antihyperglycemic agent, an antidiabetic agent, an antiobesity agent, and a bile acid analogue.
- the antihyperglycemic agent may be chosen from, e.g., a biduanide (e.g., metformin, phenformin, and buformin) , insulin (e.g., regular human insulin, NPH insulin, insulin aspart, insulin lispro, insulin glargine, insulin detemir, and insulin levemir) , a glucagon-like peptide 1 receptor agonist (GLP-1RA; e.g., albiglutide, dulaglutide, exenatide, liraglutide, lixisenatide, and extended-release glucagon) , a sodium-glucose cotransporter 2 inhibitor (SGLR2I; e.g., canagliflozin, empagliflozin, dapagliflozin, empagliflozin, and ipragliflozin) , a dipeptidyl peptidase 4 inhibitor (DPP4I; e
- Micronase glibornuride, gliquidone, glisoxepide, glyclopyramide, glimepiride, amaryl, and glimiprime
- an amylin analogue e.g., pramlinitide
- PCSK9I proprotein convertase subtilisin/kexin type 9 inhibitor
- PCSK9I proprotein convertase subtilisin/kexin type 9 inhibitor
- PCSK9I proprotein convertase subtilisin/kexin type 9 inhibitor
- PCSK9I proprotein convertase subtilisin/kexin type 9 inhibitor
- PCSK9I proprotein convertase subtilisin/kexin type 9 inhibitor
- GKA glucokinase activator
- PPAR agonist/modulator e.g., MK-0941, RO-28–1675, and AZD1656
- a PPAR agonist/modulator e.g., MK-0941, RO-
- the additional therapeutic agent is an antihyperlipidemic agent and may be chosen from, e.g., a statin (e.g., HMG-CoA reductase inhibitor; e.g., smvastatin, atorvastatin, rosuvastatin, pravastatin, pitavastatin, lovastatin, atorvastatin, fluvastatin, cerivastatin, mevastatin, pantethine, elastase, and probucol) , a fibric acid (e.g., bezafibrate (e.g., Bezalip) , ciprofibrate (e.g., Modalim) , clofibrate, gemfibrozil (e.g., Lopid) , fenofibrate (e.g., TriCor) , clinofibrate (e.g., Lipoclin) , lifibrate, alufibrate
- the additional therapeutic agent is an antiobesity agent and may be chosen from, e.g., orlistat (e.g., Xenical) , lorcaserin (e.g., Belviq) , phentermine, topiramate, diethylpropion, phendimetrazine, benzphetamine, and a combination of phendimetrazine and benzphetamine.
- orlistat e.g., Xenical
- lorcaserin e.g., Belviq
- the additional therapeutic agent is a bile acid analogue and may be chosen from, e.g., obeticholic acid, ursodeoxycholic acid, and cholylsarcosine.
- the additional therapeutic agent may also be chosen from, e.g., a farnesoid X receptor (FXR) agonist, an FXR inhibitor, a transemembrane G protein-coupled receptor 5 (TGR5) agonist, and a TGR5 inhibitor.
- FXR farnesoid X receptor
- TGR5 transemembrane G protein-coupled receptor 5
- the additional therapeutic agent may be chosen from insulin, metformin, sitagliptin, colesevelam, glipizide, simvastatin, atorvastatin, ezetimibe, fenofibrate, nicotinic acid, orlistat, lorcaserin, phentermine, topiramate, obeticholic acid, and ursodeoxycholic acid.
- combination therapies described herein may encompass combined administration (where two or more therapeutic agents are included in the same or separate formulations) , and separate administration, in which case, administration of the polypeptides described herein can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent.
- polypeptides described herein can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment or intralesional administration.
- the polypeptides described herein may be parenterally administered.
- Parenteral administration may include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
- the polypeptides described herein may administered subcutaneously.
- the polypeptides described herein may administered intravenously.
- Dosing can be by any suitable route, such as, e.g., by injections or infusions, such as intravenous or subcutaneous injections or infusions, depending in part on whether the administration is brief or chronic.
- Various dosing schedules including e.g. single or multiple administrations over various time-points, bolus administration, and pulse infusion are also contemplated.
- polypeptides described herein would be formulated, dosed, and administered in a fashion consistent with common medical practice. Factors for consideration in this context may include, e.g., the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
- the polypeptides described herein need not be but can be optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of the polypeptide described herein present in the formulation, the type of disorder or treatment, and other factors discussed above.
- the appropriate dosage of a polypeptide described herein may depend on the type of disease to be treated, the severity and course of the disease, whether the polypeptide is administered for preventive or therapeutic purposes, previous therapy, the patient’s clinical history and response to the polypeptide, and the discretion of the attending physician.
- the polypeptides described herein may be suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, the polypeptide described herein may be administered to the patient, for example, by one or more separate administrations, or by continuous infusion.
- the treatment may be sustained until a desired suppression of disease symptoms occurs.
- the polypeptide described herein may be administered intermittently, e.g. every day, every two days, every three days, every week, or every two or three weeks (e.g. such that the patient receives from more than one, such as, e.g., about two to about twenty, or e.g. about six doses of the polypeptide) .
- An initial higher loading dose, followed by one or more lower doses, may be administered.
- a flat-fixed dosing regimen may be used to administer the polypeptide described herein to a subject.
- other dosage regimens may also be useful depending on the factors discussed above. The progress of this therapy can be easily monitored by conventional techniques and assays for the disease or condition treated.
- Polypeptides as shown in Table 1 were synthesized according to the standard Fmoc protocol for polypeptide synthesis. Generally, individual amino acid residues were extended from the carboxyl terminus to the amino terminus, starting from a MBHA resin. The N terminus was then modified by myristoylation. After completion of peptide synthesis, the polypeptides were cleaved from the resin by a cleavage solution and the C terminus of the polypeptides was further modified by amination. The resin was removed by filtering with G6 sand-core funnel and the filtrate containing the polypeptides was dried under vacuum. The polypeptide product was dissolved in deionized water, and purified in explorer 100 type medium pressure liquid chromatograph equipped with C18 column.
- Fig. 1A shows an exemplary graph depicting the purity of the synthesized polypeptide, Cmyr-47, as measured by HPLC.
- Fig. 1B shows an exemplary graph confirming the correct molecular weight of Cmyr-47 (5398.8 Da) as measured by mass spectrometry.
- a polypeptide derived from HBV can bind to NTCP
- various cell-lines expressing NTCP were treated with Cmyr-47.
- the polypeptide was labeled with FITC.
- FITC labeled Cmyr-47 binds to hepatocytes from two different species (Fig. 2A depicting binding of Cmyr-47 to tupaia primary hepatocytes; Fig. 2B depicting binding of Cmyr-47 to HepG2 cells) .
- NTCP-L02 NTCP expressing L02 cells
- BLANK-L02 L02 cells transfected with a vector that does not express NTCP
- FITC a vector that does not express NTCP
- HEK293 cells a cell-line that is not derived from the liver, were prepared for the study.
- NTCP expressing HEK293 cells were established by transfecting the cells with an NTCP expressing vector.
- HEK293 cells transfected with a control vector that does not express NTCP (BLANK-293) were used as a negative control.
- Cmyr-47 labeled with FITC binds to NTCP-293 cells, but not BLANK-293 cells.
- an avian HBV does not infect mammals
- NTCP-293 cells were incubated with bile acids labeled with 3 H ( 3 H-TA; taurocholate) .
- 3 H-TA the amount of bile acids absorbed by the cells can be quantified by measuring the level of radioactivity of the cells. Since HEK293 cells are not capable of absorbing bile acids without NTCP expression, any bile acids taken up by NTCP-293 cells can be contributed to NTCP.
- TA at 10 umol/L radioactively labeled as 3 H-TA at 0.5 uCi/ml
- Cmyr-47 were simultaneously added to cultured cells for 10 minutes.
- Cyclosporine A known to inhibit bile acids transport, was used as a positive control at a concentration of 50 ⁇ M.
- Fig. 5A compared with BLANK-293 cells, NTCP-293 cells were capable of absorbing a significant amount of bile acids.
- NTCP-293 cells were treated with Cmyr-47, the uptake of bile acids was bidirectionally regulated at different concentrations of Cmyr-47.
- Cmyr-47 enhanced NTCP transport of bile acids into hepatocytes at a concentration at and below 500 ng/ml, while Cmyr-47 significantly reduced TA absorption at a concentration more than 500 ng/ml.
- Cmyr-47 was determined to have an IC 50 value of 0.15 ⁇ M in blocking bile acids transport.
- CsA did not enhance NTCP-mediated transportation of TA at either a low concentration of 10 ng/ml or a high concentration of 100 ⁇ g/ml. Based on the escalating dose study shown in Fig. 5D, the calculated IC 50 value of CsA for inhibiting bile acids transport was 3.05 ⁇ M.
- HBV-derived polypeptides listed in Table 1 (Cmyr-60, Cmyr-55, Cmyr-47, Cmyr-40, Cmyr-35, Cmyr-30, Cmyr-25, Cmyr-20, Cmyr-47+ (-10) , Cmyr-47+ (-9) , Cplam-47, Cstea-47, Cchol-47, Amyr-47, Bmyr-47, Dmyr-47, Emyr-47, Fmyr-47, Gmyr-47 or Hmyr-47) enhanced TA absorption at a low concentration molarly equivalent to 62.5 ng/ml (11.58 nmol/L) of Cmyr-47, confirming that HBV-derived polypeptides are capable of enhancing NTCP-mediated uptake of bile acids at a low concentration
- HBV-derived polypeptides (Cmyr-60, Cmyr-55, Cmyr-47, Cmyr-40, Cmyr-35, Cmyr-30, Cmyr-25, Cmyr-20, Cmyr-47+ (-10) , Cmyr-47+ (-9) , Cplam-47, Cstea-47, Cchol-47, Amyr-47, Bmyr-47, Dmyr-47, Emyr-47, Fmyr-47, Gmyr-47 or Hmyr-47) were tested at a higher concentration molarly equivalent to 1 ⁇ g/ml (185.23 nmol/L) of Cmyr-47, all the polypeptides effectively inhibited TA absorption (Fig.
- HBV-derived polypeptides are capable of inhibiting NTCP-mediated uptake of bile acids at a high certain concentration.
- CsA at 50 ⁇ g/ml inhibited TA absorption, while quinidine at 20 ⁇ mol/L enhanced TA absorption.
- a blood sample from each rat was collected by tail-bleeding. Serums from the blood samples were further separated out by centrifugation at 3,000 rpm for 10 min. The serum samples were then analyzed a total bile acid assay kit (Nanjing Jiancheng Bioengineering Institute) in order to determine the level of total bile acids (TBA) .
- TAA total bile acid assay kit
- both female and male rats treated with Cmyr-47 displayed an increased level of total bile acids in the serum as compared with the control group, indicating that Cmyr-47 is capable of effectively blocking the bile acids uptake in vivo. The increase of total bile acids was dose-dependent.
- TC total cholesterol
- TG triglyceride
- GLU glycemia
- a blood sample from each dog was collected by vein puncture, and serum from the collected blood samples was separated as described above. The serum samples were then analyzed to determine the concentration of total bile acids levels as described above.
- Cmyr-47 increased the serum level of total bile acids in dogs in a dose-dependent manner as compared with the control group.
- the levels of total cholesterol (TC) , triglyceride (TG) , and glycemia (GLU) of each animal are summarized in Table 9.
- the low dose, middle dose, or high dose of Cmyr-47 had no significant effect on serum TC, TG or GLU, as compared with the control group (all values of P>0.05) . Therefore, Cmyr-47 does not affect normal levels of serum TC, TG or GLU at physiological conditions.
- the peak concentration (i.e. C max ) of Cmyr-47 in blood stream was reached at 20 minutes (i.e. T max ) following the administration.
- a C max refers to the peak serum concentration that a drug achieves after a dosing.
- a T max refers to the time at which the C max is observed.
- Table 13 for instance, the highest dose of Cmyr-47 was able to reach the C max of above 500 ng/ml at 20 minutes, indicating the T max of Cymr-47 is about 20 minutes in this test condition.
- Tables 11-13 only the highest dose, 3.6 mg/kg, was able to reach the peak concentration above 500 ng/ml.
- a hyperlipidemic golden hamster model was established by feeding hamsters with a high-fat diet for 2 weeks (after adaptive feeding for 10 days) .
- the composition of the high-fat diet included 1.25%cholesterol and 20.06%fat (soybean oil 2.79%, cocoa butter 17.27%) and the diet was purchased from Research Diets Inc. (New Brunswick, NJ) and stored at 4°C.
- As a normal non-hyperlipidemic control “anormal control group” ) , a group of golden hamsters was fed with a regular chow diet. A full nutritional rat pellet was used as a normal chow diet after sterilization with Co 60 irradiation. Animals were provided with filtered and sterilized tap water ad libitum. All food was available ad libitum and animals were housed 4 to 5 per cage.
- Weight and food consumption of each hamster fed with the high-fat diet was monitored on a weekly basis. All animals were treated humanely and care was taken to minimize pain and suffering in accordance with the principle of the 3Rs (replacement, reduction, and refinement) .
- TC serum total cholesterol
- 10 hamsters fed with the normal chow diet were used as a normal control group (10 mL/kg PBS, sc) .
- Cmyr-47 was synthesized as a white powder by HEP Pharmaceutical (Shanghai, China; Lot number: 14011801) .
- Cmyr-47 was freshly prepared in PBS and used immediately after preparation.
- PBS was prepared by formulating a 20 ⁇ PB solution (Na 2 HPO 4 ⁇ 12H 2 O (64.4652 g) and NaH 2 PO 4 ⁇ 2H 2 O (3.1202 g) in water to 500 mL) . Then, 1 volume of 20 ⁇ PB, 4 volumes of pure water, and 15 volumes of 0.9% normal saline were mixed together to obtain PBS for dissolving the test drug.
- Fenofibrate (FENO) of Fenolip tablet used as a positive control in this study was purchased from Laboratoires FOURNIER S.A. CsA was purchased from Novartis.
- PBS, Cmyr-47, FENO, and CsA were respectively administered for 4 consecutive weeks.
- all animals in the model control group, low and high dose group, and positive control group were fed with the high fat diet while the normal control group was fed with the normal chow diet.
- Cmyr-47 or PBS was subcutaneously injected to the hamsters twice a day (9: 00–10: 00 in the morning and 16: 00–17: 00 in the afternoon) .
- a positive treatment control group was provided with FENO via peroral intragastrical administration.
- a CsA treatment group was provided with CsA via peroral intragastrical administration.
- Each morning, food and water consumption, feces, and animal grooming were monitored. All animals were weighed weekly.
- An RO-MB-50 Ultrapure water system was from Yongjieda Purification Technology Co. Ltd. (Hangzhou, Zhejiang, China) .
- KQ-300DE ultrasound was purchased from Kunshan Ultrasonic Instrument Co., Ltd. (Kunshan, Jiangsu, China) and a Hitachi 7020 automatic biochemical analyzer from Hitachi Ltd. (Japan) .
- the multifunctional ELISA machine was from Thermo Fisher Scientific Inc. (USA) .
- SPSS19.0 software was used to analyze data, expressed as means ⁇ standard deviation or mean ⁇ SEM.
- ANOVA variance analysis was used to evaluate the data from the test results.
- LSD test was used for pairwise comparisons. Values of the statistical analyses were rounded to 2 decimal places.
- the serum TC levels in the model controls were significantly higher than those in the normal controls during the experiment, confirming that the animals fed with the high-fat diet were hyperlipidemic (all values of P ⁇ 0.01) .
- the administration of FENO significantly lowered the serum TC levels as compared with the model control group (all of P values less than 0.01) .
- Hyperlipidemic animals treated with Cmyr-47 also displayed lower serum TC levels than the model control group, and the effect of Cmyr-47 was dose-dependent.
- hyperlipidemic animals treated with CsA showed significantly elevated serum TC levels as compared with the model control group.
- Figs. 7A and 7B confirmed that animals fed with the high-fat diet were hyperlipidemic (compare the serum TC levels of normal controls and model controls) .
- FENO was capable of decreasing the serum TC levels in the animals.
- animals treated with other HBV-derived peptides (Cmyr-60, Cmyr-55, Cmyr-40, Cmyr-35, Cmyr-30, Cmyr-25, Cmyr-20, Cmyr-47+ (-10) , Cmyr-47+ (-9) , Cplam-47, Cstea-47, Cchol-47, Amyr-47, Bmyr-47, Dmyr-47, Emyr-47, Fmyr-47, Gmyr-47 or Hmyr-47) also showed lower serum TC levels than that of the model controls.
- the serum TG levels in the model controls were significantly higher than the normal controls throughout the experiment (all values of P ⁇ 0.01) .
- the high dose of Cmyr-47 also significantly lowered the serum TG levels in the animals as compared with the model controls. Similar to the effect on serum TC, the effect of Cmyr-47 on serum TG were also dose-dependent.
- CsA treatment increased the serum TG levels in the animals as compared with the model controls.
- the serum TG levels of animals treated with additional polypeptides derived from HBV were also measured by following the protocol described above.
- the serum TG levels of animals treated with these HBV-derived polypeptides were lower than that of the model controls, indicating all the tested polypeptides derived from HBV are capable of lowering serum TG in vivo.
- Table 16 and Fig. 10 summarize the measurements of serum LDL-C levels from the animals treated with PBS, FENO, or Cmyr-47.
- the serum LDL-C levels in the model controls significantly increased as compared with the normal controls, confirming the hyperlipidemic phenotype (P ⁇ 0.01) .
- the positive controls treated with FENO displayed significantly lower serum LDL-C levels than the model controls.
- animals treated with Cmyr-47 did not significantly decreased serum LDL-C levels as compared with the model controls.
- the serum LDL-C levels of animals treated with additional polypeptides derived from HBV were also measured by following the protocol described above. As shown in Figs. 11A and 11B, the serum LDL-C levels of those animals were lower than that of the model controls.
- Table 17 and Fig. 12 provide the measurements of serum HDL-C levels. Based on the values obtained in this study, an AI value of each animal was calculated by following the formula discussed above. The average AI value of each group is provided in Table 17 and Fig. 13. Although Cmyr-47 did not lower serum HDL-C in vivo, the average AI value of animals treated with Cmyr-47 was significantly lower than the average value of the model controls, indicating that Cmyr-47 may be protective against atherosclerosis and other vascular disease including cardiovascular diseases that are caused by accumulation of fat.
- Table 18 and Fig. 14 provide the measurements of serum TBA levels. As expected, the serum TBA levels in the model controls were higher than the normal controls. As compared with the model control group, the serum TBA levels of animals treated with Cmyr-47 were further elevated in a dose-dependent fashion, confirming that Cmyr-47 is capable of inhibiting bile acid uptake in vivo. Measurements at week 4 confirmed that the high dose of Cmyr-47 significantly increased the serum TBA levels (P values less than 0.05) . CsA and the low dose of Cmyr-47 also moderately elevated the serum TBA levels after 4 weeks of treatment, though the significance was not reached.
- hyperlipidemic animals did not show any significant hyperglycemic phenotype as compared with the normal controls (all values of P>0.05) .
- the high and low doses of Cmyr-47 did not reduce the serum GLU levels below the normal glycemia displayed in the normal controls and the model controls (all values of P>0.05) .
- Cmyr-47 was capable of reversing hyperlipidemic phenotype in golden hamsters fed with a high-fat diet.
- the high dose of Cmyr-47 was capable of lowering all biological indicators measured in this study.
- CsA a bile acid uptake inhibitor
- CsA treatment in vivo caused an increase of the serum TG and TC levels, confirming the hyperlipidemic effect of CsA.
- the hyperlipidemic golden hamster model was established as described in Example 3.1. After 2 weeks of the high-fat diet treatment, the hyperlipidemic phenotype of hamsters was confirmed when the animals had serum total cholesterol (TC) levels higher than 10 mmol/L.
- TC total cholesterol
- Eight hamsters fed with the normal chow diet were used as a normal control group (10 mL/kg PBS, sc) .
- Cmyr-47 was administered for 4 consecutive weeks.
- all animals in the model control group, low, middle and high dose groups were fed with the high fat diet, while the normal control group was fed with the normal chow diet.
- Cmyr-47 or PBS was subcutaneously injected to the hamsters twice a day (9: 00–10: 00 in the morning and 16: 00–17: 00 in the afternoon) .
- Each morning, food and water consumption, feces, and animal grooming were monitored.
- the serum TC and TG levels of all animals were measured on week 2 and week 4 of treatment as described in Example 3.1 and the results are summarized in Tables 20 and 21. The data was analyzed as described in Example 3.1.
- the serum TC levels in the model controls were significantly higher than those in the normal controls during the experiment (all values of P ⁇ 0.01) .
- the treatment with Cmyr-47 at a dose of 1 mg/kg or 3 mg/kg had no effect on serum TC.
- hyperlipidemic animals treated with 10 mg/kg Cmyr-47 for 4 weeks showed moderately reduced levels of serum TC as compared with the model control group (P ⁇ 0.05) .
- Example 4.1 Methods and Materials Used in Treatment of Zucker Diabetic Fatty Rats with Cmyr-47
- Cmyr-47 as an anti-diabetic, anti-hyperlipidemic, and/or anti-hypercholesterolemic agent was tested in Zucker Diabetic Fatty (ZDF) rats, a spontaneous type II diabetes animal model.
- ZDF Zucker Diabetic Fatty
- ZL rats were fed with a normal chow diet (basic feed) sterilized by Co 60 gamma irradiation. Two ZDF rats or ZL rats were housed in each cage and cage bedding was changed once every 2 days. The experimental rat breeding and all other operations were in accordance with the principle of 3R with humane care.
- HbA1c glycated hemoglobin
- mice with the fasting serum GLU levels close to the average level were selected and randomly divided into 5 groups: a model control group (10 ml ⁇ kg -1 PBS) , a low-dose treatment group (10 mg ⁇ kg -1 Cmyr-47) , a high-dose treatment group (30 mg ⁇ kg -1 Cmyr-47) , a positive control group (300 mg ⁇ kg -1 Metformin) , and a CsA treatment group (20 mg ⁇ kg -1 CSA) with 6 animals per group.
- Six ZL rats were used as a normal control group (10 ml ⁇ kg -1 PBS) .
- PBS or Cmyr-47 was injected to animals subcutaneously twice per day (at 09: 00 and 17: 00) .
- Meformin (MET) and CsA solutions were given via oral gavage twice per day in the morning and afternoon. The dosing was conducted for 4 weeks. During the experiment, ZDF rats were fed with Purina #5008 diet while ZL rats were fed the normal chow diet.
- Cmyr-47 was synthesized as described above, purified as a white powder by Shanghai HEP Pharmaceutical Co., Ltd (Shanghai, China; Lot number 14011801) , and stored at -20°C. Cmyr-47 was weighed and dissolved in PBS right before use. MET was manufactured by Bristol-Myers Squibb Co., Ltd. (Shanghai, China) with approval number H20023370 and lot number of AAD7878. CsA was purchased from Novartis.
- the animals were fasted for 10 h with free access to water, and 0.3 mL of blood from each animal was collected via tail vein bleeding for measuring serum GLU, total cholesterol (TC) , triglycerides (TG) and blood urea nitrogen (BUN) .
- the animals were fasted for 10 h and the blood was then collected for the measurement of serum GLU, TC, TG and BUN, HbA1c and insulin.
- the animals were fasted for 12 h and then anesthetized via intraperitoneal injection of 3%sodium pentobarbital and cervical dislocation.
- Heart, kidneys, scapular fat, and abdominal fat of each animal were dissected for visual observation and weighed to calculate heart, kidney, and total fat index.
- Pentobarbital sodium (content ⁇ 95.0%; Lot number 20130112) was purchased from Merck.
- TC, TG, GLU and BUN kits were purchased from DiaSys Diagnostic Systems (Shanghai, China) .
- HbA1c detection reagent was purchased from Trinity Biotech Inc., Ireland.
- Insulin ELISA detection kit (Lot number: 0469636-1) was purchased from Bertin Pharma (France) . All measurements using the purchased kits were conducted following the manufacturers’ protocols provided in the kits.
- SQP electronic balance was purchased from Sartorius Scientific Instruments (Beijing) Co., Ltd. (Beijing, china) .
- MLS-3750 autoclave was purchased from Sanyo, Japan.
- RO-MB-50 ultrapure water system was manufactured by Hangzhou Yongjieda Cleaning Science and Technology, Co., Ltd. (Zhejiang, China) .
- KQ-300DE ultrasound was purchased from Kunshan Ultrasonic Instruments Co., Ltd. (Jiangsu, China) .
- Hitachi 7020 automatic biochemical analyzer was purchased from Hitachi, Japan.
- Multifunctional microplate reader was purchased from Thermo Fisher Scientific, Co. (MA, USA) .
- SPSS 19.0 software SPSS, Chicago, IL was used for statistical analysis. All data were presented as mean ⁇ standard error mean ANOVA variance analysis was used to evaluate the data from the test results. LSD test was used for pairwise comparisons. Values of the statistical analyses were rounded to 2 decimal places.
- Hyperglycemia i.e., increased blood glucose
- MET is a well-known anti-diabetic agent that effectively lowers glycemia in diabetic patients.
- ZDF rats treated with MET showed significantly decreased fasting serum GLU as compared with the model controls.
- Cmyr-47 was also capable of lowering glycemia in ZDF rats. In particular, by 4 weeks of treatments, both low and high doses of Cmyr-47 effectively reduced the serum GLU levels in the animals. The effect of Cmyr-47 on glycemia was dose-dependent. In contrast, CsA treatment significantly elevated the serum GLU levels in the animals as compared with the model control.
- polypeptides derived from HBV listed in Table 1 were also tested in order to analyze their effects on glycemia in vivo by following the same protocol described above. All polypeptide was administrated at a dose molarly equivalent to 30 mg/kg/day of Cmyr-47.
- Figs. 18A and 18B hyperglycemic phenotype of ZDF rats was confirmed.
- the treatment with MET significantly decreased fasting serum GLU in vivo.
- HBV-derived peptides Cmyr-60, Cmyr-55, Cmyr-40, Cmyr-35, Cmyr-30, Cmyr-25, Cmyr-20, Cmyr-47+ (-10) , Cmyr-47+ (-9) , Cplam-47, Cstea- 47, Cchol-47, Amyr-47, Bmyr-47, Dmyr-47, Emyr-47, Fmyr-47, Gmyr-47 or Hmyr-47) , the fasting serum GLU levels of ZDF rats decreased as compared with the model controls, indicating the efficacy of the polypeptides as an anti-diabetic agent.
- HbA1c refers to glycated hemoglobin, and its level significantly increases when a subject is experiencing chronic hyperglycemia. As shown in Table 23 and Fig. 19, consistent with hyperglycemic phenotype of ZDF rats, the HbA1c levels in the model controls were significantly higher than the normal control throughout the study (all values of P ⁇ 0.01) . Also, consistent with the effect of MET on glycemia, the treatment with MET significantly decreased the HbA1c levels in ZDF rats (P ⁇ 0.01) .
- ZDF rats treated with Cmyr-47 also showed significantly reduced HbA1c levels as compared with the model controls in a dose-dependent fashion, confirming the efficacy of Cmyr-47 as an anti-diabetic agent that regulates glycemia in vivo. Consistent with the effect of CsA on the serum GLU levels, CsA treatment significantly increased the serum HbA1c after 4 weeks of treatment.
- polypeptides derived from HBV listed in Table 1 also showed a similar effect on HbA1c when tested in the same animal model as described above. As shown in Figs. 20A and 20B, the HbA1c levels of the model controls were higher than that of the ZDF rats treated with the polypeptides. These results demonstrate that the polypeptides derived from HBV are capable of effectively lowering glycemia and HbA1c, and confirm the hyperglycemic effect of CsA.
- Type II diabetic patients experience insulin resistance, overproduction of insulin, and ultimately insulin depravation due to pancreatic damage.
- Cmyr-47 is capable of modulating insulin by preventing pancreatic damage.
- the insulin levels of animals treated with Cmyr-47 were compared with animals treated with PBS or MET.
- the initial serum insulin levels of ZDF rats were significantly higher than the normal controls. While the insulin levels of ZDF rats remained higher than the normal controls at week 4, the absolute levels significantly dropped as compared with the initial levels. This change indicates that insulin resistance in ZDF rats progressed during the study, resulting in pancreatic failure.
- diabetic phenotypes include lipid dysregulation including elevated cholesterol and triglycerides in the blood stream.
- the serum TC levels in the model controls were consistently elevated as compared with the normal controls (all values of P ⁇ 0.05) .
- MET appeared to be completely ineffective in lowering the serum TC levels in ZDF rats.
- CsA was also ineffective in lowering the serum TC levels in ZDF rats and by 4 weeks of treatment, CsA significantly increased the serum TC levels as compared with the model control.
- the high dose of Cmyr-47 significantly reduced the serum TC levels in ZDF rats as compared with the model controls, confirming that Cmyr-47 can regulate a wide array of biomarkers that are severely elevated in diabetic patients.
- serum TG is also a biomarker for hyperlipidemia that may be caused by diabetes.
- Table 26 and Fig. 24 show that the serum TG levels in the model controls were significantly higher than that of the normal controls throughout the study (all values of P ⁇ 0.01) .
- MET significantly elevated the serum TG levels in ZDF rats at week 2 (P ⁇ 0.01) .
- the serum TC levels in ZDF rats treated with MET remained higher than the model controls at week 4.
- CsA further increased the serum TG levels in ZDF rats.
- both doses of Cmyr-47 were capable of lowering the serum TG levels of ZDF rats and the effect of Cmyr-47 was dose-dependent.
- Additional polypeptides derived from HBV were also capable of reducing serum TG in vivo when tested in the same animal model described above. As shown in Figs. 25A and 25B, the serum TG levels of the model controls remained higher than ZDF rats treated with HBV-derived peptides (Cmyr-60, Cmyr-55, Cmyr-40, Cmyr-35, Cmyr-30, Cmyr-25, Cmyr-20, Cmyr-47+ (-10) , Cmyr-47+ (-9) , Cplam-47, Cstea-47, Cchol-47, Amyr-47, Bmyr-47, Dmyr-47, Emyr-47, Fmyr-47, Gmyr-47 or Hmyr-47) , further confirming that polypeptides derived from HBV are capable of regulating glucose metabolism and lipid metabolism simultaneously.
- Elevated serum BUN reflects impaired renal function, which often occurs in human diabetic patients.
- diabetic phenotypes lead to renal dysfunction and the correlative elevation of serum BUN.
- Table 27 and Fig. 26 show that the serum BUN levels in the model controls were significantly higher than that of the normal controls throughout the study.
- the treatment of MET was not capable of reversing renal dysfunction as no significant BUN difference was found between the model controls and the positive controls.
- the high dose of Cmyr-47 significantly lowered the serum BUN levels in ZDF rats at week 4 (P ⁇ 0.01) , indicating that Cmyr-47 may protect a diabetic subject against kidney damage and renal dysfunction.
- Diabetic patients have an increased risk of developing cardiovascular diseases, renal dysfunction, and obesity.
- various indexes such as heart index (HI) , kidney index (KI) , and total fat index (TFI) can be used as a quantitative indicator of the risk.
- HI heart index
- KI kidney index
- TFI total fat index
- Table 28 and Fig. 27A the HI values of the model controls were higher than the normal controls.
- the treatment with MET had no effect on the HI values.
- both doses of Cmyr-47 significantly decreased the HI values of ZDF rats, indicating that Cmyr-47 can be beneficial to prevent adverse cardiovascular events.
- Table 28 and Fig. 27C show that the TFI values of the model controls were significantly higher than normal controls (P ⁇ 0.01) , indicating that ZDF rats reached morbid obesity. Although not significant, ZDF rats treated with Cmyr-47 showed a trend of TFI values lower than the model controls. Of note, MET did not show the similar trend and rather, it appeared to increase the TFI values in ZDF rats.
- the serum TBA level of each animal was measured. As shown in Table 29 and Fig. 28, the serum TBA levels in the model controls were higher than the normal controls. As compared with the model control group, the serum TBA levels of ZDF rats treated with Cmyr-47 were further elevated in a dose-dependent fashion. Measurements at week 4 confirmed that the high dose of Cmyr-47 significantly increased the serum TBA levels (P values less than 0.05) . Also, CsA significantly elevated the serum TBA levels after 4 weeks of treatment (P values less than 0.01) .
- MET is a widely used antidiabetic drug that can efficiently modulate glycemia in vivo.
- efficacy of MET in glycemia regulation was also confirmed in this study.
- MET failed to provide benefits against lipid dysregulation and associated diseases, as evident by the results that MET was not capable of lowering serum TC, TG, and BUN levels, and HI values in ZDF rats.
- CsA treatment not only increased the serum TG and TC levels, but further increased the serum GLU levels, suggesting that effective inhibition of bile acid uptake in vitro does not always translate to a therapeutic effect on lipid and glucose metabolism in vivo.
- Cmyr-47 performed well all across the tests.
- Cmyr-47 was capable of modulating glycemia and lipid metabolism while providing protection against pancreas damage, renal dysfunction, and cardiovascular diseases.
- Cmyr-47 performed superior as an anti-hyperglycemia, anti-hypercholesterolemia, anti-hyperlipidemia, and anti-adiposity agent over MET and showed a comprehensive effect on multiple diabetic phenotypes simultaneously.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Diabetes (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Immunology (AREA)
- Emergency Medicine (AREA)
- Endocrinology (AREA)
- Dermatology (AREA)
- Molecular Biology (AREA)
- Child & Adolescent Psychology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK17805843.4T DK3463422T3 (da) | 2016-05-30 | 2017-05-31 | Sammensætninger og fremgangsmåder til behandling af stofskiftelidelser |
| JP2018562995A JP7684788B2 (ja) | 2016-05-30 | 2017-05-31 | 代謝疾患を治療する組成物と方法 |
| EP17805843.4A EP3463422B1 (en) | 2016-05-30 | 2017-05-31 | Compositions and methods for treating metabolic diseases |
| US16/305,790 US11633454B2 (en) | 2016-05-30 | 2017-05-31 | Compositions and methods for treating metabolic diseases |
| AU2017274094A AU2017274094B2 (en) | 2016-05-30 | 2017-05-31 | Compositions and methods for treating metabolic diseases |
| ES17805843T ES2979305T3 (es) | 2016-05-30 | 2017-05-31 | Composiciones y métodos para tratar enfermedades metabólicas |
| CN201780033504.5A CN109310737B (zh) | 2016-05-30 | 2017-05-31 | 治疗代谢疾病的组合物和方法 |
| KR1020187037955A KR102627084B1 (ko) | 2016-05-30 | 2017-05-31 | 대사성 질환을 치료하기 위한 조성물 및 방법 |
| CA3026140A CA3026140A1 (en) | 2016-05-30 | 2017-05-31 | Compositions and methods for treating metabolic diseases |
| US18/296,454 US20230414706A1 (en) | 2016-05-30 | 2023-04-06 | Compositions and methods for treating metabolic diseases |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201610370442.4 | 2016-05-30 | ||
| CN201610370442 | 2016-05-30 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/305,790 A-371-Of-International US11633454B2 (en) | 2016-05-30 | 2017-05-31 | Compositions and methods for treating metabolic diseases |
| US18/296,454 Division US20230414706A1 (en) | 2016-05-30 | 2023-04-06 | Compositions and methods for treating metabolic diseases |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017206898A1 true WO2017206898A1 (en) | 2017-12-07 |
Family
ID=60479717
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CN2017/086558 Ceased WO2017206898A1 (en) | 2016-05-30 | 2017-05-31 | Compositions and methods for treating metabolic diseases |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US11633454B2 (enExample) |
| EP (1) | EP3463422B1 (enExample) |
| JP (1) | JP7684788B2 (enExample) |
| KR (1) | KR102627084B1 (enExample) |
| CN (1) | CN109310737B (enExample) |
| AU (1) | AU2017274094B2 (enExample) |
| CA (1) | CA3026140A1 (enExample) |
| DK (1) | DK3463422T3 (enExample) |
| ES (1) | ES2979305T3 (enExample) |
| WO (1) | WO2017206898A1 (enExample) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20240058393A1 (en) * | 2020-12-28 | 2024-02-22 | Md Healthcare Inc. | Composition comprising micrococcus luteus-derived extracellular vesicle for prevention or treatment of metabolic disease |
| KR102605753B1 (ko) * | 2021-08-06 | 2023-11-29 | 주식회사 동운아나텍 | 인공지능 기반의 혈당 예측 시스템 및 방법 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014072524A1 (en) * | 2012-11-12 | 2014-05-15 | Ruprecht-Karls-Universität Heidelberg | Lipopetides for use in treating liver diseases and cardiovascular diseases |
| WO2014105939A1 (en) * | 2012-12-27 | 2014-07-03 | Ngm Biopharmaceuticals, Inc. | Methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
| CN104130316A (zh) * | 2005-08-12 | 2014-11-05 | 上海贺普药业股份有限公司 | 乙型肝炎病毒表面l蛋白相关肽 |
| EP3181146A1 (en) | 2015-12-16 | 2017-06-21 | Ruprecht-Karls-Universität Heidelberg | Cyclic ntcp-targeting peptides and their uses as entry inhibitors |
| EP3189850A1 (en) | 2015-12-16 | 2017-07-12 | Ruprecht-Karls-Universität Heidelberg | Liver targeting of cyclic pres-derived peptides of hbv |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102675430B (zh) * | 2005-08-12 | 2014-08-27 | 上海贺普药业股份有限公司 | 乙型肝炎病毒表面l蛋白相关肽 |
| CN102241744B (zh) * | 2010-05-14 | 2015-03-04 | 上海贺普药业股份有限公司 | 一种病毒感染阻断剂、其药物组合物及其应用 |
| EP3204030B1 (en) | 2014-10-07 | 2022-04-27 | Myr GmbH | Combination therapy of hbv and hdv infection |
-
2017
- 2017-05-31 EP EP17805843.4A patent/EP3463422B1/en active Active
- 2017-05-31 AU AU2017274094A patent/AU2017274094B2/en active Active
- 2017-05-31 US US16/305,790 patent/US11633454B2/en active Active
- 2017-05-31 CA CA3026140A patent/CA3026140A1/en active Pending
- 2017-05-31 ES ES17805843T patent/ES2979305T3/es active Active
- 2017-05-31 JP JP2018562995A patent/JP7684788B2/ja active Active
- 2017-05-31 WO PCT/CN2017/086558 patent/WO2017206898A1/en not_active Ceased
- 2017-05-31 CN CN201780033504.5A patent/CN109310737B/zh active Active
- 2017-05-31 KR KR1020187037955A patent/KR102627084B1/ko active Active
- 2017-05-31 DK DK17805843.4T patent/DK3463422T3/da active
-
2023
- 2023-04-06 US US18/296,454 patent/US20230414706A1/en active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN104130316A (zh) * | 2005-08-12 | 2014-11-05 | 上海贺普药业股份有限公司 | 乙型肝炎病毒表面l蛋白相关肽 |
| WO2014072524A1 (en) * | 2012-11-12 | 2014-05-15 | Ruprecht-Karls-Universität Heidelberg | Lipopetides for use in treating liver diseases and cardiovascular diseases |
| WO2014105939A1 (en) * | 2012-12-27 | 2014-07-03 | Ngm Biopharmaceuticals, Inc. | Methods for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
| EP3181146A1 (en) | 2015-12-16 | 2017-06-21 | Ruprecht-Karls-Universität Heidelberg | Cyclic ntcp-targeting peptides and their uses as entry inhibitors |
| EP3189850A1 (en) | 2015-12-16 | 2017-07-12 | Ruprecht-Karls-Universität Heidelberg | Liver targeting of cyclic pres-derived peptides of hbv |
Non-Patent Citations (20)
| Title |
|---|
| BALLANTYNE ET AL., JAMA, vol. 262, no. 1, 1989, pages 53 - 56 |
| BAUER ET AL., DIABETIC MEDICINE, vol. 31, 2014, pages 1078 - 85 |
| BEAUDOIN ET AL., APPL. PHYSIOL. NUTR. METAB., vol. 38, no. 2, 2013, pages 140 - 47 |
| BLANK ANTJE; MARKERT CHRISTOPH; HOHMANN NICOLAS; CARLS ALEXANDRA; MIKUS GERD; LEHR THORSTEN; ALEXANDROV ALEXANDER; HAAG MATHIAS; S: "First-in-human application of the novel hepatitis B and hepatitis D virus entry inhibitor myrcludex B", JOURNAL OF HEPATOLOGY, ELSEVIER, AMSTERDAM, NL, vol. 65, no. 3, 27 April 2016 (2016-04-27), AMSTERDAM, NL , pages 483 - 489, XP029703163, ISSN: 0168-8278, DOI: 10.1016/j.jhep.2016.04.013 |
| BODEN ET AL., CIRCULATION, vol. 85, no. 6, 1992, pages 2039 - 44 |
| DATABASE Nucleotide 8 April 2008 (2008-04-08), LIU, Y. ET AL.: "Hepatitis B virus isolate S 472-20 , complete genome", XP055598821, Database accession no. EU554535.1 * |
| DRESNER ET AL., SURGERY, vol. 106, no. 2, 1989, pages 163 - 69 |
| GARCIA-PEREZ ET AL., DIABETES THERAPY, vol. 4, 2013, pages 175 - 94 |
| GRIPON ET AL., J. VIROL., vol. 79, no. 3, 2005, pages 1613 - 22 |
| KIM ET AL., J. PHARMACOL. EXP. THER., vol. 291, no. 3, 1999, pages 1204 - 09 |
| OEHLER, N. ET AL.: "Binding of Hepatitis B Virus to Its Cellular Receptor Alters the Expression Profile of Genes of Bile Acid Metabolism", HEPATOLOGY, vol. 60, no. 5, 30 November 2014 (2014-11-30), pages 1483 - 1493, XP055175277, DOI: doi:10.1002/hep.27159 * |
| PHILLIPS ET AL., BR. MED. J., vol. 292, 1986, pages 1319 - 21 |
| See also references of EP3463422A4 |
| SLIJEPCEVIC, D. ET AL.: "Impaired Uptake of Conjugated Bile Acids and Hepatitis B Virus Pres1-Binding in Na+-Taurocholate Cotransporting Polypeptide Knockout Mice", HEPATOLOGY, vol. 62, no. 1, 31 July 2015 (2015-07-31), pages 207 - 219, XP055598827 * |
| THELLE ET AL., N. ENGL. J. MED., vol. 308, no. 24, 1983, pages 1454 - 57 |
| TIAN, J.H. ET AL.: "Recent advances in the study of a receptor for HBV: The sodium-taurocholate cotransporting polypeptide (NTCP)", JOURNAL OF PATHOGEN BIOLOGY, vol. 10, no. 7, 31 July 2015 (2015-07-31), pages 655 - 658, XP009514277, ISSN: 1673-5234 * |
| VAZ ET AL., HEPATOLOGY, vol. 61, no. 1, 2015, pages 260 - 267 |
| WATASHI ET AL., HPATOLOGY, vol. 59, 2014, pages 1726 - 37 |
| WEI ET AL., CLINICA. CHIMICA. ACTA., vol. 317, 2002, pages 159 - 69 |
| YAN, H. ET AL.: "Viral Entry of Hepatitis B and D Viruses and Bile Salts Transportation Share Common Molecular Determinants on Sodium Taurocholate Cotransporting Polypeptide", JOURNAL OF VIROLOGY., vol. 88, no. 6, 3 January 2014 (2014-01-03), pages 3273 - 3284, XP055598830 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN109310737A (zh) | 2019-02-05 |
| EP3463422A1 (en) | 2019-04-10 |
| JP7684788B2 (ja) | 2025-05-28 |
| AU2017274094A1 (en) | 2019-02-14 |
| US11633454B2 (en) | 2023-04-25 |
| ES2979305T3 (es) | 2024-09-25 |
| JP2019520341A (ja) | 2019-07-18 |
| CA3026140A1 (en) | 2017-12-07 |
| EP3463422A4 (en) | 2020-02-26 |
| DK3463422T3 (da) | 2024-07-22 |
| KR20190015392A (ko) | 2019-02-13 |
| US20230414706A1 (en) | 2023-12-28 |
| CN109310737B (zh) | 2023-05-05 |
| US20200323951A1 (en) | 2020-10-15 |
| EP3463422B1 (en) | 2024-05-22 |
| AU2017274094B2 (en) | 2020-09-10 |
| KR102627084B1 (ko) | 2024-01-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20200338158A1 (en) | Therapeutic Drug for Non-Alcoholic Fatty Liver Disease | |
| US20210196786A1 (en) | Therapy of atherosclerosis, primary biliary cirrhosis and nrlp3 inflammasome-associated disease by htcp inhibitors | |
| CN106715466A (zh) | 作为选择性胰高血糖素受体激动剂的毒蜥外泌肽‑4衍生物 | |
| CA2895755A1 (en) | Functionalized exendin-4 derivatives | |
| US20230414706A1 (en) | Compositions and methods for treating metabolic diseases | |
| US20210324043A1 (en) | ApoC-II Mimetic Peptides | |
| US20240360194A1 (en) | New Peptides as Potent and Selective GIP Receptor Agonists | |
| EP1634605A2 (en) | Treatment of dyslipidemia in a patient having type 2 diabetes | |
| JP7672677B2 (ja) | 全用量条件下でb型肝炎ウイルス関連肝疾患を治療する医薬品および方法 | |
| KR20140071272A (ko) | 항 당뇨병 펩타이드로서의 아포리포프로테인 aiv | |
| US20070218504A1 (en) | Human leptin-derived polypeptides and uses thereof | |
| AU2012385960B2 (en) | Method of treating hyperglycemic disorders using apolipoprotein AIV | |
| US20250376498A1 (en) | Fusion proteins comprising an improved glp-1 receptor agonist and uses thereof | |
| WO2018204918A1 (en) | Treatment of hepatic disorders | |
| US20140147421A1 (en) | C1q/tnf-related protein 12 and compositions and methods of using same | |
| TW202440649A (zh) | 一種包含glp-1 融合蛋白的藥物製劑及其用途 | |
| TW202506170A (zh) | 糖尿病之治療 | |
| CN117186206A (zh) | 新型不同glp1类似肽共价聚合体及其制备方法和应用 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17805843 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2018562995 Country of ref document: JP Kind code of ref document: A Ref document number: 3026140 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20187037955 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017805843 Country of ref document: EP Effective date: 20190102 |
|
| ENP | Entry into the national phase |
Ref document number: 2017274094 Country of ref document: AU Date of ref document: 20170531 Kind code of ref document: A |