WO2017205846A1 - Peptides and nanoparticles for intracellular delivery of genome-editing molecules - Google Patents
Peptides and nanoparticles for intracellular delivery of genome-editing molecules Download PDFInfo
- Publication number
- WO2017205846A1 WO2017205846A1 PCT/US2017/034862 US2017034862W WO2017205846A1 WO 2017205846 A1 WO2017205846 A1 WO 2017205846A1 US 2017034862 W US2017034862 W US 2017034862W WO 2017205846 A1 WO2017205846 A1 WO 2017205846A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- genome
- cell
- peptide
- vepep
- complex
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/111—General methods applicable to biologically active non-coding nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
- C12N9/222—Clustered regularly interspaced short palindromic repeats [CRISPR]-associated [CAS] enzymes
- C12N9/226—Class 2 CAS enzyme complex, e.g. single CAS protein
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B82—NANOTECHNOLOGY
- B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
- B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
- C12N2320/32—Special delivery means, e.g. tissue-specific
Definitions
- the present invention pertains to peptide-containing complexes/nanoparticles that are useful for stabilizing and/or delivering into a cell one or more molecules of a genome-editing system, such as CRISPR-associated proteins and nucleic acids.
- the CRISPR interference technique has enormous potential application, including altering the germline of humans, animals, and other organisms, and modifying the genes of food crops.
- a CRISPR-associated nuclease such as Cas9 or Cpf1
- appropriate guide RNAs into a cell
- CRISPRs have been used in concert with specific endonuclease enzymes for genome editing and gene regulation in many different species (Mali et al., (2013). Nature Methods.10(10):957–63).
- CRISPR tools have been used for various genome modifications, including double-strand break formation with non-homologous end joining (NHEJ)-mediated mutagenesis (Wang et al., (2013). Cell.153:910–918), nick formation with NHEJ-mediated mutagenesis (Cheng et al. (2014). FEBS Lett.588:3954–3958), knock-in with homology-dependent repair (HDR) (Inui et al. (2014). Sci. Rep.4:5396), and genome-rearrangement (Maddalo et al. (2014) Nature.
- NHEJ non-homologous end joining
- Nuclease-deficient Cas nucleases can be used to block the binding of transcriptional activators in order to block expression of specific genes, to deliver transcriptional activators to stimulate expression of specific genes, or to deliver epigenetic modifiers to target sequences to alter histone methylation or acetylation (Ledford, H. (2016). Nature.531:156-159).
- the present application provides complexes and nanoparticles comprising cell- penetrating peptide that are useful for stabilizing and/or delivering into a cell one or more molecules of a genome-editing system, such as CRISPR-associated proteins and nucleic acids.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide associated with an RGEN/gRNA complex comprising an RNA-guided endonuclease (RGEN) and a guide RNA (gRNA), wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide.
- RGEN RNA-guided endonuclease
- gRNA guide RNA
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide and one or more molecules of a genome-editing system targeting the target polynucleotide, wherein the cell-penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the one or more genome-editing system molecules are selected from the group consisting of: a) an RNA-guided endonuclease (RGEN) and a guide RNA (gRNA), wherein the gRNA comprises a guide sequence
- gDNA guide DNA
- a zinc finger protein ZFP
- ZFP zinc finger protein
- TALEN transcription activator-like effector nuclease
- TALEN transcription activator-like effector nuclease
- a homing endonuclease wherein the homing endonuclease recognizes a target sequence in the target polynucleotide
- an integrase wherein the integrase recognizes a recombination site in the target polynucleotide.
- the cell-penetrating peptide is a VEPEP-3 peptide.
- the cell- penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14.
- the cell-penetrating peptide comprises the amino acid sequence of SEQ ID NO: 75 or 76.
- the cell-penetrating peptide is a VEPEP-6 peptide.
- the cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40.
- the cell-penetrating peptide comprises the amino acid sequence of SEQ ID NO: 77.
- the cell-penetrating peptide is a VEPEP-9 peptide.
- the cell- penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52.
- the cell-penetrating peptide comprises the amino acid sequence of SEQ ID NO: 78.
- the cell-penetrating peptide is an ADGN-100 peptide.
- the cell- penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70.
- the cell-penetrating peptide comprises the amino acid sequence of SEQ ID NO: 79 or 80.
- the cell-penetrating peptide further comprises one or more moieties covalently linked to the N-terminus of the cell-penetrating peptide, and wherein the one or more moieties are selected from the group consisting of an acetyl, a fatty acid, a cholesterol, a poly-ethylene glycol, a nuclear localization signal, nuclear export signal, an antibody, a polysaccharide and a targeting molecule.
- the cell-penetrating peptide comprises an acetyl group covalently linked to its N-terminus.
- the cell-penetrating peptide further comprises one or more moieties covalently linked to the C-terminus of the cell-penetrating peptide, and wherein the one or more moieties are selected from the group consisting of a cysteamide, a cysteine, a thiol, an amide, a nitrilotriacetic acid optionally substituted, a carboxyl, a linear or ramified C 1 -C 6 alkyl optionally substituted, a primary or secondary amine, an osidic derivative, a lipid, a phospholipid, a fatty acid, a cholesterol, a poly-ethylene glycol, a nuclear localization signal, nuclear export signal, an antibody, a polysaccharide and a targeting molecule.
- the cell-penetrating peptide comprises a cysteamide group covalently linked to its C-terminus.
- At least some of the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety by a linkage.
- the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA).
- the sgRNA comprises a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9.
- the molar ratio of RGEN to gRNA is between about 1:10 and about 10:1.
- the molar ratio of the cell-penetrating peptide to the RGEN is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of the cell-penetrating peptide to the RGEN is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the genome-editing complex further comprises one or more additional gRNAs comprising different guide sequences.
- the target sequence is present in a target gene, and the one or more additional gRNAs individually comprise a guide sequence complementary to a sequence in the target gene.
- the target sequence is present in a first target gene, and the one or more additional gRNAs individually comprise a guide sequence complementary to a sequence present in one or more additional target genes.
- the one or more genome-editing system molecules comprise a ZFP.
- the one or more genome-editing system molecules comprise a TALEN. In some embodiments, according to any of the genome-editing complexes described above, the one or more genome-editing system molecules comprise a homing endonuclease.
- the genome-editing complex further comprises a donor nucleic acid for introducing a modification to the target polynucleotide comprising a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification.
- the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide.
- the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the modification is insertion of a heterologous nucleic acid in the target polynucleotide.
- the donor nucleic acid is a double- stranded DNA comprising the heterologous nucleic acid flanked by a 5’ homology arm and a 3’ homology arm, and wherein the 5’ homology arm and the 3’ homology arm are homologous to sequences flanking the region of the target polynucleotide to be modified.
- the genome-editing complex further comprises one or more additional donor nucleic acids for introducing modifications to one or more additional target polynucleotides.
- each of the one or more additional donor nucleic acids comprises a sequence corresponding to a portion of one of the one or more additional target polynucleotides modified to comprise the modification.
- the one or more genome-editing system molecules comprise an integrase.
- the genome-editing complex further comprises a donor nucleic acid for insertion into the target polynucleotide, wherein the integrase recognizes a recombination site in the donor nucleic acid and is capable of mediating recombination between the recombination site in the target polynucleotide and the recombination site in the donor nucleic acid to insert the donor nucleic acid into the target polynucleotide.
- the average diameter of the genome-editing complex is between about 10 nm and about 300 nm.
- a nanoparticle comprising a core comprising a genome-editing complex according to any of the embodiments described above.
- the core further comprises one or more additional genome-editing complexes according to any of the embodiments described above.
- the core further comprises a donor nucleic acid for introducing a modification to the target polynucleotide comprising a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, wherein the donor nucleic acid is complexed with a second cell- penetrating peptide.
- the second cell-penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN- 100 peptides.
- the second cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-70 and 75-80.
- the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide.
- the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the modification is insertion of a heterologous nucleic acid in the target polynucleotide.
- the donor nucleic acid is a double-stranded DNA comprising the heterologous nucleic acid flanked by a 5’ homology arm and a 3’ homology arm, and wherein the 5’ homology arm and the 3’ homology arm are homologous to sequences flanking the region of the target polynucleotide to be modified.
- the core further comprises one or more additional donor nucleic acids for introducing modifications to one or more additional target polynucleotides, wherein each of the one or more additional donor nucleic acids comprises a sequence corresponding to a portion of one of the one or more additional target polynucleotides modified to comprise the modification, and wherein each of the one or more additional donor nucleic acids is complexed with a cell- penetrating peptide.
- at least some of the cell-penetrating peptides in the nanoparticle are linked to a targeting moiety by a linkage.
- the core is coated by a shell comprising peripheral cell-penetrating peptides.
- the peripheral cell-penetrating peptides in the shell are linked to a targeting moiety by a linkage. In some embodiments, the linkage is covalent.
- the peripheral cell-penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the peripheral cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-70 and 75-80.
- the average diameter of the nanoparticle is between about 10 nm and about 400 nm. In some embodiments, the average diameter of the nanoparticle is between about 50 nm and about 300 nm. In some embodiments, the average diameter of the nanoparticle is between about 80 nm and about 200 nm.
- a pharmaceutical composition comprising a genome-editing complex according to any of the embodiments described above or a nanoparticle according to any of the embodiments described above, and a pharmaceutically acceptable carrier.
- the pharmaceutical composition is formulated for intravenous, intratumoral, intraarterial, topical, intraocular, ophthalmic, intraportal, intracranial, intracerebral, intracerebroventricular, intrathecal, intravesicular, intradermal, subcutaneous, intramuscular, intranasal, intratracheal, pulmonary, intracavity, or oral administration.
- the pharmaceutical composition is lyophilized.
- the pharmaceutical composition further comprises an expression complex comprising a third cell-penetrating peptide and a nucleic acid molecule encoding an exogenous protein.
- the exogenous protein is a recombinant receptor capable of being expressed on the surface of a cell.
- the recombinant receptor is a chimeric antigen receptor (CAR).
- the third cell-penetrating peptide is selected from the group consisting of VEPEP- 3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the third cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-70 and 75-80.
- a method of preparing a genome-editing complex comprising combining the cell- penetrating peptide with the RGEN/gRNA complex, thereby forming the genome-editing complex.
- the cell-penetrating peptide is combined with the RGEN/gRNA complex at a ratio from about 1:1 to about 80:1.
- the cell-penetrating peptide is combined with the RGEN/gRNA complex at a ratio from about 5:1 to about 20:1.
- the genome-editing system molecules comprise an RGEN and a gRNA, and the cell-penetrating peptide and the RGEN are combined at a ratio from about 1:1 to about 80:1, respectively, and the RGEN and the gRNA are combined at a ratio from about 10:1 to about 1:10, respectively.
- the cell-penetrating peptide and the RGEN are combined at a ratio from about 5:1 to about 20:1, respectively.
- the RGEN and the gRNA are combined at a ratio of about 1:1.
- a method of delivering one or more molecules of a genome-editing system into a cell comprising contacting the cell with a genome- editing complex according to any of the embodiments described above or a nanoparticle according to any of the embodiments described above, wherein the genome-editing complex or the nanoparticle comprises the one or more genome-editing system molecules.
- the contacting of the cell with the genome-editing complex nanoparticle is carried out in vivo.
- the contacting of the cell with the genome-editing complex nanoparticle is carried out ex vivo.
- the contacting of the cell with the genome-editing complex nanoparticle is carried out in vitro.
- the cell is a granulocyte, a mast cell, a monocyte, a dendritic cell, a B cell, a T cell, a natural killer cell, a fibroblast, or a hepatocyte.
- the cell is a T cell.
- the cell is a fibroblast.
- the cell is a hepatocyte.
- the cell is a lung progenitor cell.
- the cell is a neuronal cell. In some
- the genome-editing system targets a sequence in a gene selected from the group consisting of PD-1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CTLA-4, TIGIT, 4-1BB, OX40, CD27, TIM-1, CD28, HVEM, GITR, and ICOS.
- the method further comprises contacting the cell with an expression complex comprising a fourth cell- penetrating peptide and a nucleic acid molecule encoding an exogenous protein.
- the exogenous protein is a recombinant receptor capable of being expressed on the surface of a cell.
- the recombinant receptor is a chimeric antigen receptor (CAR).
- the fourth cell-penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the fourth cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-70 and 75-80.
- polynucleotide in a cell comprising contacting the cell with a genome-editing complex according to any of the embodiments described above or a nanoparticle according to any of the embodiments described above, wherein the genome-editing complex or the nanoparticle comprises one or more molecules of a genome-editing system that targets a sequence in the target polynucleotide.
- a method of treating a disease in an individual comprising administering to the individual an effective amount of a pharmaceutical composition according to any of the embodiments described above.
- the disease is selected from the group consisting of cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, liver diseases, lung disease, kidney diseases, and aging and degenerative diseases.
- the disease is cancer.
- the cancer is a solid tumor
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system that modulates the expression of one or more proteins selected from the group consisting of growth factors and cytokines, cell surface receptors, signaling molecules and kinases, transcription factors and other modulators of transcription, regulators of protein expression and modification, and regulators of apoptosis and metastasis.
- the cancer is cancer of the liver, lung, or kidney.
- the cancer is a hematological malignancy
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system that modulates the expression of one or more proteins selected from the group consisting of growth factors and cytokines, cell surface receptors, signaling molecules and kinases, transcription factors and other modulators of transcription, regulators of protein expression and modification, and regulators of apoptosis and metastasis.
- the disease is a viral infection disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system that modulates the expression of one or more proteins involved in the viral infectious disease development and/or progression.
- the disease is a genetic disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome- editing system that modulates the expression of one or more proteins involved in the hereditary disease development and/or progression.
- the disease is an aging or degenerative disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system that modulates the expression of one or more proteins involved in the aging or degenerative disease development and/or progression.
- the disease is a fibrotic or inflammatory disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system that modulates the expression of two or more proteins involved in the fibrotic or inflammatory disease development and/or progression.
- kits comprising a composition comprising a genome-editing complex according to any of the embodiments described above and/or a nanoparticle according to any of the embodiments described above.
- FIG.1A shows binding titration curve of CAS9 to CPPs as monitored by CY-5 fluorescence.
- a fixed concentration of 5 nM of fluorescently labeled CAS9 was titrated by increasing concentration of VEPEP-3b (SEQ ID NO: 76), VEPEP-6 (SEQ ID NO: 77), VEPEP- 9 (SEQ ID NO: 78), CADY (SEQ ID NO: 81) and ADGN-100b (SEQ ID NO: 80) peptides.
- Dissociation constants were calculated from data fitting using a quadatric equation.
- FIG.1B shows binding titration curve of CAS9:gRNA to CPPs as monitored by CY- 5 fluorescence.
- a fixed concentration of 5 nM of fluorescently labeled CAS9:gRNA was titrated by increasing concentration of VEPEP-3b (SEQ ID NO: 76), VEPEP-6 (SEQ ID NO: 77), VEPEP-9 (SEQ ID NO: 78), CADY (SEQ ID NO: 81) and ADGN-100b (SEQ ID NO: 80) peptides.
- Dissociation constants were calculated from data fitting using a quadatric equation.
- FIG.2A shows gene disruption frequency of an EGFP reporter gene in U2OS cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with different peptides at molar ratio 1:5, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.2B shows gene disruption frequency of an EGFP reporter gene in U2OS cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with different peptides at molar ratio 1:10, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.2C shows gene disruption frequency of an EGFP reporter gene in U2OS cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with different peptides at molar ratio 1:20, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.2D shows a dose response of gene disruption frequency of an EGFP reporter gene in U2OS using different peptides.
- Lipofectamine 2000 and RNAiMAX were used as controls. Values in parentheses indicated molar ratio of peptide to CAS9:gRNA complex.
- FIG.3A shows gene disruption frequency of an EGFP reporter gene in HEK cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with different peptides at molar ratio 1:5, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.3B shows gene disruption frequency of an EGFP reporter gene in HEK cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with different peptides at molar ratio 1:10, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.3C shows gene disruption frequency of an EGFP reporter gene in HEK cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with different peptides at molar ratio 1:20, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.3D shows a dose response of gene disruption frequency of an EGFP reporter gene in HEK cells using different peptides.
- Lipofectamine 2000 and RNAiMAX were used as controls. Values in parentheses indicated molar ratio of peptide to CAS9:gRNA complex.
- FIG.4A shows gene disruption frequency of an EGFP reporter gene in JURKAT T cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with different peptides at molar ratio 1:50, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.4B shows gene disruption frequency of an EGFP reporter gene in JURKAT T cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with different peptides at molar ratio 1:10, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.4C shows gene disruption frequency of an EGFP reporter gene in JURKAT T cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with different peptides at molar ratio 1:20, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.4D shows a dose response of gene disruption frequency of an EGFP reporter gene in JURKAT T cells using different peptides. Lipofectamine 2000 and RNAiMAX were used as controls. Values in parentheses indicated molar ratio of peptide to CAS9:gRNA complex.
- FIG.5A shows gene disruption frequency of an EGFP reporter gene in U2OS cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with variant sequences of VEPEP-3 and ADGN-100 at molar ratio 1:20, respectively. RNAiMAX was used as control delivery system.
- FIG.5B shows gene disruption frequency of an EGFP reporter gene in JURKAT T cells from delivery of CAS9:sgRNA as quantified by flow cytometry.10 nM, 25 nM and 50 nM of CAS9:gRNA complexes were associated with variant sequences of VEPEP-3 and ADGN-100 at molar ratio 1:20, respectively. RNAiMAX was used as control delivery system.
- FIG.6A shows toxicity evaluation of ADGN-100a/CAS9/gRNA and VEPEP- 3b/CAS9/gRNA complexes on U2OS cells as measured by MTT assay. Peptides were compared to CAS9/gRNA complexed to Lipofectamine 2000 and RNAiMAX. Values in parentheses indicated molar ratio of peptide to CAS9:gRNA complex.
- FIG.6B shows toxicity evaluation of ADGN-100a/CAS9/gRNA and VEPEP- 3b/CAS9/gRNA complexes on HEK cells as measured by MTT assay. Peptides were compared to Lipofectamine 2000 and RNAiMAX. Values in parentheses indicated molar ratio of peptide to CAS9:gRNA complex.
- FIG.6C shows toxicity evaluation of ADGN-100a/CAS9/gRNA and VEPEP- 3b/CAS9/gRNA complexes on JURKAT cells as measured by MTT assay. Peptides were compared to Lipofectamine 2000 and RNAiMAX. Values in parentheses indicated molar ratio of peptide to CAS9:gRNA complex.
- FIG.7A shows EMX1 gene editing in U2OS cells.
- Cell were transfected with 25 nM CAS9/gRNA associated with either VEPEP-3b, ADGN-100a, VEPEP-9, or RNAiMAX.
- Cell samples were analysed by T7EI methods and indel results were determined by quantifying the amount of uncut vs cut DNA using Fragment Analyzer System and reported in Table 3.
- FIG.7B shows EMX1 gene editing in K562 cells.
- Cell were transfected with 25 nM CAS9/gRNA associated with either VEPEP-b3, ADGN-100a, VEPEP-9, or RNAiMAX.
- Cell samples were analysed by T7EI methods and indel results were determined by quantifying the amount of uncut vs cut DNA using Fragment Analyzer System and reported in Table 3.
- FIG.7C shows EMX1 gene editing in JURKAT cells.
- Cell were transfected with 25 nM CAS9/gRNA associated with either VEPEP-3b, ADGN-100a, VEPEP-9, or RNAiMAX.
- Cell samples were analysed by T7EI methods and indel results were determined by quantifying the amount of uncut vs cut DNA using Fragment Analyzer System and reported in Table 3.
- FIG.8A shows EMX1 gene editing in EGFP-U2OS cells.
- Cell were transfected with 25 nM CAS9/gRNA associated with either VEPEP-3b, ADGN-100a, VEPEP-9, or RNAiMAX.
- Cell samples were analysed by T7EI methods and indel results were determined by quantifying the amount of uncut vs cut DNA using Fragment Analyzer System and reported in Table 4.
- FIG.8B shows EMX1 gene editing in EGFP-JURKAT cells.
- Cell were transfected with 25 nM CAS9/gRNA associated with either VEPEP-3b, ADGN-100a, VEPEP-9, or RNAiMAX.
- Cell samples were analyzed by T7EI methods and indel results were determined by quantifying the amount of uncut vs cut DNA using Fragment Analyzer System and reported in Table 4.
- FIG.8C shows gene disruption frequency of an EGFP reporter gene in both U2OS and JURKAT T cells from delivery of CAS9:sgRNA as quantified by flow cytometry.25 nM of CAS9:gRNA complexes were associated with VEPEP-3b, VEPEP-9 and ADGN-100a at molar ratio 1:20, respectively, and to lipofectamine 2000 and RNAiMAX.
- FIG.9A shows analysis of the efficiency of HDR insertion of a HindIII and NheI restriction enzyme site in the EMX1 gene in U2OS cells.
- the percent HDR editing were calculated using an RFLP assay with NheI digestion of EMXI PCR amplicons.
- FIG.9B shows analysis of the efficiency of HDR insertion of a HindIII and NheI restriction enzyme site in the EMX1 gene in JURKAT cells.
- the percent HDR editing were calculated using an RFLP assay with NheI digestion of EMXI PCR amplicons.
- FIG.10 shows gene disruption frequency of an EGFP reporter gene in U2OS cells from co delivery of CAS9-expresson plasmid and sgRNA using ADGN-100a peptide.
- CAS9 expression plasmid and sgRNA were associated with ADGN-100a at molar ratio 10:1 or 20:1 (indicated by values in parentheses) of ADGN-100a to each of the CAS9 expression plasmid and the sgRNA, and to lipofectamine 2000.
- FIG.11 shows the transfection efficiency of ADGN-100a/plasmid complexes.
- FIG.12 shows the viability of primary T cells following transfection with ADGN- 100a/plasmid complexes.
- Primary T cells were transfected with ADGN-100a particles containing an anti-CD19 CAR-encoding plasmid at 2 concentrations (2 ⁇ g and 5 ⁇ g).
- cell viability was quantified by flow cytometry using 7-AAD. Data were normalized to untransfected cells and compared to T cells incubated with free plasmid.
- FIG.13 shows the transfection efficiency of ADGN-100a/plasmid complexes used in combination with peptide/RGEN/gRNA complexes.
- Primary T cells were transfected with ADGN-100a particles containing an anti-CD19 CAR-encoding plasmid (5 ⁇ g) and peptide particles containing gRNA/CAS9 complexes.
- expression of the anti-CD19-CAR was evaluated by flow cytometry using a Protein L assay. Data were normalized to untransfected cells and compared to cells incubated with free plasmid.
- FIG.14 shows toxicity evaluation of ADGN-100a/CAS9/gRNA and VEPEP- 3a/CAS9/gRNA complexes on JURKAT and K562 cells as measured by MTT assay. Delivery of CAS9/gRNA complexes by RNAiMAX was included for comparison.
- FIG.15 shows the viability of primary T cells following transfection with ADGN- 100a or VEPEP-3a particles containing CAS9/gRNA complexes.
- T cells were transfected with ADGN-100a or VEPEP-3a particles containing CAS9/gRNA particles at 2 concentrations (5 ⁇ g/10 ⁇ g CAS9/gRNA and 2.5 ⁇ g/5 ⁇ g CAS9/gRNA). After 48h, cell viability was quantified by flow cytometry using 7-AAD. Data were normalized to untransfected cells and compared to T cells incubated with free CAS9/gRNA.
- FIGS.16A and 16B show the gene disruption frequency of EMX1 and HPRT endogenous genes in primary human fibroblasts (FIG.16A) or primary human hepatocytes (FIG. 16B) mediated by CAS9/gRNA, as quantified by T7E1 assay.
- CAS9/gRNA complexes (10 nM, 20 nM, or 50 nM) were delivered either by ADGN-100a (molar ratio of 20:1 for peptide to complex) or by RNAiMAX.
- FIGS.17A and 17B show the toxicity evaluation of ADGN-100a/CAS9/gRNA complexes on human primary fibroblasts (FIG.17A) or human primary hepatocytes (FIG.17B) as measured by MTT assay. Peptide-mediated delivery was compared to delivery by
- FIG.18 shows western blot analysis and quantification for CAS9 protein expression in U2OS cells transfected with CSA9 mRNA (0.2 ⁇ g or 0.5 ⁇ g) using either ADGN-100a or Lipofectamine 2000.
- FIG.19 shows the gene disruption frequency of an EGFP reporter gene in U2OS cells by ADGN-100a-mediated delivery of CAS9/gRNA or CAS9 mRNA/gRNA, as quantified by flow cytometry.
- CAS9/gRNA 2.5 ⁇ M/5 ⁇ M
- CAS9 mRNA/gRNA 0.5 ⁇ g complexes were associated with ADGN-100a at a molar ratio of 20:1 (peptide to complex) for peptide-mediated delivery, and compared to delivery by lipofectamine 2000 or RNAiMAX.
- FIGS.20A and 20B show quantification of CAS9 protein expression by western blot (FIG.20A) or ELISA (FIG.20B) in different tissues after in vivo administration of CAS9 mRNA (10 ⁇ g) associated with ADGN-100a peptide at a 20:1 molar ratio of peptide to mRNA.
- Tissues were homogenized and CAS9 expression was analyzed by western blot or ELISA on protein extract using antibody against CRISPR/Cas9.
- FIG.21 shows whole animal fluorescence imaging for luciferase expression 72 hours after injection of free ADGN-100a peptide (2 animals/group), free CAS9 mRNA (2
- FIG.22 shows the in vivo gene disruption frequency of a Luciferase reporter gene in the liver resulting from ADGN-100a-mediated delivery of mRNA CAS9/sgRNA, as quantified by fluorescence imaging.
- Mice received a single intravenous injection of free ADGN-100a peptide, free CAS9 mRNA, or CAS9 mRNA/gRNA/ADGN-100a.3 animals per group (labeled M1, M2, and M3).
- FIG.23 shows ELISA analysis for CAS9 protein expression in different tissues after in vivo administration of CAS9 mRNA/gRNA (10 ⁇ g) associated with ADGN-100a peptide at a 20:1 molar ratio of peptide to mRNA/gRNA. Tissues were homogenized and CAS9 expression was analyzed by ELISA on protein extract using antibody against CRISPR/Cas9.
- FIG.24 shows FACS analysis of E2 microglobulin gene editing in T cells.
- T cells were transfected with CAS9/gRNA (5 ⁇ g/10 ⁇ g CAS9/gRNA) by association with either ADGN-100a or VEPEP-3a, or by electroporation. Free CAS9/gRNA and no treatment conditions were included as controls. E2 microglobulin expression was evaluated by FACS after 72 hours.
- FIGS.25A and 25B show toxicity analysis of CPP/CAS9/gRNA complexes on T cells.
- PBMC-isolated T cells were treated with CAS9/gRNA complexes associated with ADGN- 100a or VEPEP-3b, or electroporated with CAS9/gRNA complexes, and toxicity was assessed after 48 hours by MTT assay (FIG.25A) and by monitoring activation damage-induced cell death (DICD) after 72 hours (FIG.25B).
- DICD activation damage-induced cell death
- FIG.26 shows gene disruption of the E-Catenin gene in undifferentiated and differentiated mouse muscle myoblast cells (C2C12) by VEPEP-3b- and ADGN-100a-mediated delivery of CAS9/gRNA as quantified by gel analysis of PCR.
- Cells were transfected with CAS9/gRNA (2.5 ⁇ M/5 ⁇ M) complexes associated with CPP (+) or not (-) at a molar ratio of 20:1 (peptide to complex) and compared to delivery by RNAiMAX for E-Catenin expression.
- ⁇ - actin expression was included as a loading control.
- FIG.27 shows the gene disruption efficiency of the HPRT gene in undifferentiated and differentiated mouse muscle myoblast cells (C2C12) by VEPEP-3b- and ADGN-100a- mediated delivery of CAS9/gRNA.
- Cell samples were analyzed by T7EI methods and indel results were determined by quantifying the amount of uncut vs cut DNA using a Fragment Analyzer System. Delivery by RNAiMAX was included as a control.
- FIGS.28A-28D show quantification of CAS9 protein expression by ELISA in different cell types transfected with CAS9 mRNA (0.5 ⁇ g) using ADGN-100a, VEPEP-6, VEPEP-9, or VEPEP-3a peptides or RNAiMAX.
- FIG.28A shows results for U2OS cells.
- FIG. 28B shows results for HEPG2 cells.
- FIG.28C shows results for primary human fibroblasts.
- FIG. 28D shows results for K562 cells.
- FIGS.29A-29D show the gene disruption frequency of the endogenous EMX1 gene in U2OS cells (FIG.29A), HEPG2 cells (FIG.29B), primary human fibroblasts (FIG.29C), or K562 cells (FIG.29D) mediated by CAS9 mRNA/gRNA, as quantified by T7E1 assay.
- CAS9 mRNA/gRNA 0.5 ⁇ g/2.5 ⁇ g
- FIG.30 shows the toxicity evaluation of CPP/CAS9 mRNA/gRNA complexes on U2OS, HEPG2, and K562 cell lines and human primary fibroblasts as measured by MTT assay. Peptide-mediated delivery was compared to delivery by RNAiMAX.
- FIGS.31A-31D show the gene disruption frequency of the endogenous EMX1 gene in U2OS cells (FIG.31A), HEPG2 cells (FIG.31B), primary human fibroblasts (FIG.31C), or K562 cells (FIG.31D) mediated by CAS9 protein/gRNA, as quantified by T7E1 assay.
- the preloaded CAS9/gRNA complexes (2.5 ⁇ g/5 ⁇ g CAS9/gRNA) were mixed with CPP peptides at a 20:1 molar ratio of CPP to CAS9/gRNA complexes for peptide-mediated delivery, and compared to delivery by lipofectamine 2000 or RNAiMAX.
- FIGS.32A-32C show quantification of CAS9 protein expression by ELISA in different cell types transfected with a CAS9-expressing plasmid (0.5 ⁇ g) using ADGN-100a, VEPEP-6, VEPEP-9, or VEPEP-3a peptides, or using lipofectamine 2000.
- FIG.32A shows results for U2OS cells.
- FIG.32B shows results for HEPG2 cells.
- FIG.32C shows results for primary human fibroblasts.
- FIGS.33A-33C show the gene disruption frequency of the endogenous EMX1 gene in U2OS cells (FIG.33A), HEPG2 cells (FIG.33B), or primary human fibroblasts (FIG.33C) mediated by a CAS9-expressing plasmid and gRNA, as quantified by T7E1 assay.
- the CAS9- expressing plasmid (0.5 ⁇ g) and gRNA (5 ⁇ g) were mixed with CPP peptides at a 20:1 molar ratio of CPP to nucleic acid (plasmid + gRNA).
- Peptide-mediated delivery of the CAS9-expressing plasmid/gRNA was compared to delivery by lipofectamine 2000 or RNAiMAX.
- FIG.34 shows evaluation of non-specific cytokine induction associated with in vivo administration of CPP/mRNA complexes.
- Mice were injected with a single intravenous injection of CAS9 mRNA/ADGN-100a, CAS9 mRNA/VEPEP-6, or CAS9 mRNA/VEPEP-9.
- Serum cytokine levels were evaluated at different time points using The Cytokine Mouse Magnetic 20- Plex Panel. Control included administration of LPS or free mRNA.
- bars from left to right correspond to TNF-a, GM-CSF, IFN- ⁇ , IL1 ⁇ , IL2, IL5, IL6, IL10, IL12 (p40/p70), IL13, IL17, IL1 ⁇ , VEGF, FGF, MIP-1a, and FGF, respectively.
- FIGS.35A-35C show quantification of CAS9 protein expression by ELISA in various tissues at 3 days (FIG.35A), 6 days (FIG.35B), and 10 days (FIG.35C) after in vivo administration of CAS9 mRNA (5 ⁇ g) associated with ADGN-100a, VEPEP-6, or VEPEP-9 peptides at a 20:1 molar ratio of CPP to mRNA.
- Tissues were homogenized and CAS9 expression was analyzed by ELISA on protein extract using an antibody against CRISPR/Cas9.
- FIG.36 shows quantification of serum PCSK9 protein levels at different time points after in vivo administration of CAS9 mRNA (5 ⁇ g)/gRNA targeting PCSK9 exon 1 associated with ADGN-100a, VEPEP-6, or VEPEP-9 peptides at a 20:1 molar ratio of CPP to nucleic acid (mRNA + gRNA).
- Serum levels of PCSK9 were determined by ELISA using the Mouse Proprotein Convertase 9/PCSK9 Quantikine ELISA Kit (MPC-900, R&DSystems).
- FIG.37 shows quantification of total serum cholesterol levels at different time points after in vivo administration of CAS9 mRNA (5 ⁇ g)/gRNA targeting PCSK9 exon 1 associated with ADGN-100a, VEPEP-6, or VEPEP-9 peptides at a 20:1 molar ratio of CPP to nucleic acid (mRNA + gRNA).
- Total serum cholesterol levels were measured using the Infinity Cholesterol Reagent (Thermo Fisher).
- FIG.38 shows evaluation of non-specific cytokine induction associated with in vivo administration of VEPEP-3a/CAS9 protein complexes. Mice were injected with a single intravenous injection of CAS9 /VEPEP-3a. Serum cytokine levels were evaluated at different time points using The Cytokine Mouse Magnetic 20-Plex Panel. Controls included
- FIGS.39A and 39B show quantification of CAS9 protein expression as determined by ELISA in primary human T cells.
- FIG.39A corresponds to T cells transfected with CAS9 mRNA (0.5 ⁇ g) using ADGN-100a, VEPEP-6, VEPEP-9, or VEPEP-3a peptides, or
- FIG.39B corresponds to T cells transfected with CAS9 expressing plasmid (0.5 ⁇ g) using ADGN-100a, VEPEP-6, VEPEP-9, or VEPEP-3a peptides, or lipofectamine 2000.
- FIGS.40A-40D show the gene disruption frequency of the endogenous EMX1 gene in human primary T cells mediated by RGEN/gRNA, as quantified by T7E1 assay.
- FIG.40A corresponds to T cells transfected with CAS9 mRNA/gRNA (0.5 ⁇ g/2.5 ⁇ g) using ADGN-100a, VEPEP-6, or VEPEP-9 (molar ratio of 20:1 for CPP to cargo), or by RNAiMAX.
- FIG.40B corresponds to T cells transfected with preloaded CAS9/gRNA complexes (2.5 ⁇ g/5 ⁇ g
- FIG.40C corresponds to T cells transfected with CAS9-expressing plasmid (0.5 ⁇ g) and gRNA (5 ⁇ g) using ADGN-100a, VEPEP-6, or VEPEP-9 (molar ratio of 20:1 for CPP to cargo), or by lipofectamine 2000/RNAiMAX.
- FIG 40D corresponds to the toxicity evaluation of CPP in complexes with CAS9 mRNA, CAS9 protein, or CAS9-expressing plasmid (CAS9 pls) either associated or not with a gRNA in human primary T cells as measured by MTT assay.
- Peptide-mediated delivery was compared to delivery by RNAiMAX or Lipofectamine 2000.
- genome-editing techniques such as designer nuclease-based genome- modification, e.g., CRISPR
- CRISPR system molecules such as CRISPR system molecules
- Adeno-associated viral particles have commonly been used as gene delivery agents, however due to safety issues and loading capacity limits, viral carriers are non-ideal delivery vehicles (Swiech et al., Nat. Biotechnol.33:102–106, 2015).
- Non-viral means of delivering genome-editing system molecules include lipid-based vectors, lipid nanoparticles, polymeric vectors, polyethylenimine, and poly(L-lysine) to name a few, though application of genome editing (such as by using CRISPR tools) in vivo remains a challenge due to the limitations of the delivery approaches currently being used (Li et al. (2015). Human gene therapy, 26(7):452-462; Wang et al. (2016). Proceedings of the National Academy of Sciences, 113(11):2868-2873). Thus, there is a need for improved methods for simple and efficient delivery of genome-editing system molecules (such as CRISPR system molecules).
- the present application provides complexes and nanoparticles comprising a cell- penetrating peptide (CPP) and one or more molecules of a genome-editing system, wherein the CPP is suitable for stabilizing and/or delivering into a cell the one or more genome-editing system molecules.
- CPP cell- penetrating peptide
- the complexes and nanoparticles may comprise a plurality of genome-editing system molecules, and some of the plurality of genome-editing system molecules may be in pre- formed complexes prior to association with the CPP.
- the complexes and nanoparticles may comprise the entire genome-editing system (e.g., the complexes and nanoparticles may comprise molecules that when delivered to a cell are sufficient for effecting the modification to the genome for which the genome-editing system is designed).
- Cell-penetrating peptide technology is less complex, less toxic and easier to use than viral vectors or chemical transfection.
- Genome- editing system molecules are meant to include nucleic acids encoding a molecule of a genome- editing system.
- the molecules of a genome-editing system may include, for example, a) an enzyme and an RNA, b) the RNA and a nucleic acid encoding the enzyme, c) the enzyme and a nucleic acid encoding the RNA, or d) nucleic acid encoding both the enzyme and the RNA.
- the genome-editing system comprises a designer nuclease (or a nucleic acid encoding the designer nuclease, such as an mRNA or a DNA plasmid), such as a zinc-finger nuclease (ZFN), a transcription activator-like effector nuclease (TALEN), a homing endonuclease (such as an ARC nucleaseTM) or a nucleic acid-guided endonuclease (NGEN), such as an RNA-guided endonuclease (RGEN, e.g., Cas9) or a DNA-guided endonuclease (DGEN).
- a designer nuclease or a nucleic acid encoding the designer nuclease, such as an mRNA or a DNA plasmid
- ZFN zinc-finger nuclease
- TALEN transcription activator-like effector nuclease
- NGEN nucle
- the genome-editing system further comprises a guide nucleic acid (gNA) (or a nucleic acid encoding the guide nucleic acid, such as an mRNA or a DNA plasmid), such as a guide RNA (gRNA) or a guide DNA (gDNA).
- gNA guide nucleic acid
- gRNA guide RNA
- gDNA guide DNA
- the genome-editing system is a clustered regularly interspaced short palindromic repeat (CRISPR) system (including, for example, CRISPR-associated proteins and/or nucleic acids, or nucleic acids encoding one or more of CRISPR-associated proteins and/or nucleic acids).
- CRISPR regularly interspaced short palindromic repeat
- the genome-editing system comprises a ZFN.
- the genome- editing system comprises a TALEN.
- the genome-editing system comprises a homing endonuclease. In some embodiments, the genome-editing system comprises an integrase (or a nucleic acid encoding the integrase, such as an mRNA or a DNA plasmid). In some embodiments, the genome-editing system further comprises a donor nucleic acid comprising a recombination site recognized by the integrase.
- the present application in one aspect provides novel genome-editing complexes and nanoparticles which are described further below in more detail.
- compositions comprising a cell-penetrating peptide and one or more molecules of a genome-editing system (for example in the forms of complexes and nanoparticles) and uses thereof for treating diseases.
- the term“single guide RNA” or“sgRNA” refers to a polynucleotide sequence comprising a guide sequence, a tracr sequence and a tracr mate sequence.
- the term“guide sequence” refers to the about 20 bp sequence within the guide RNA that specifies the target site.
- the term“tracr mate sequence” may also be used interchangeably with the term“direct repeat(s)”.
- wild type is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
- variable should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature.
- nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature.
- “Complementarity” refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non- traditional types.
- a percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%, 60%, 70%, 80%/, 90%, and 100% complementary).
- Perfectly complementary means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
- “Substantially complementary” as used herein refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
- stringent conditions for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes with the target sequence, and substantially does not hybridize to non-target sequences.
- Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence.
- Non-limiting examples of stringent conditions are described in detail in Tijssen (1993). Laboratory Techniques In Biochemistry And Molecular Biology- Hybridization With Nucleic Acid Probes Part I, Second Chapter“Overview of principles of hybridization and the strategy of nucleic acid probe assay”. Elsevier, N.Y.
- Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
- the hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner.
- the complex may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self hybridizing strand, or any combination of these.
- a hybridization reaction may constitute a step in a more extensive process, such as the initiation of PCR, or the cleavage of a polynucleotide by an enzyme.
- a sequence capable of hybridizing with a given sequence is referred to as the “complement” of the given sequence.
- “expression” refers to the process by which a polynucleotide is transcribed from a DNA template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins. Transcripts and encoded polypeptides may be collectively referred to as“gene product.” If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.
- the terms“subject,”“individual,” and“patient” are used interchangeably herein to refer to a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro are also.
- therapeutic agent “therapeutic capable agent” or“treatment agent” are used interchangeably and refer to a molecule or compound that confers some beneficial effect upon administration to a subject.
- the beneficial effect includes enablement of diagnostic determinations; amelioration of a disease, symptom, disorder, or pathological condition;
- treatment or“treating” refers to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit.
- therapeutic benefit is meant any therapeutically relevant improvement in or effect on one or more diseases, conditions, or symptoms under treatment.
- the term“effective amount” or“therapeutically effective amount” refers to the amount of an agent that is sufficient to effect beneficial or desired results.
- the therapeutically effective amount may vary depending upon one or more of: the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, which can readily be determined by one of ordinary skill in the art.
- the term also applies to a dose that will provide an image for detection by any one of the imaging methods described herein.
- the specific dose may vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to be imaged, and the physical delivery system in which it is carried.
- Reference to“about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se. For example, description referring to“about X” includes description of“X.”
- compositions and methods of the present invention may comprise, consist of, or consist essentially of the essential elements and limitations of the invention described herein, as well as any additional or optional ingredients, components, or limitations described herein or otherwise useful.
- the invention provides complexes and nanoparticles comprising cell- penetrating peptides for delivering one or more molecules of a genome-editing system into a cell.
- cell-penetrating peptides are complexed with a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease, such as an mRNA or DNA plasmid).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN (e.g., Cas9), or DGEN.
- the genome-editing nuclease is a ZFN.
- the genome-editing nuclease is a TALEN.
- the genome-editing nuclease is a nucleic acid-guided nuclease (e.g., an RGEN or DGEN), and the cell-penetrating peptides are complexed with the nucleic acid-guided nuclease (or a nucleic acid encoding the nucleic acid-guided nuclease) in combination with (such as complexed with) a guide sequence (or a nucleic acid encoding a guide sequence) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- a nucleic acid-guided nuclease e.g., an RGEN or DGEN
- the cell-penetrating peptides are complexed with the nucleic acid-guided nuclease (or a nucleic acid encoding the nucleic acid-guided nuclease) in combination with (such
- the genome-editing complex or nanoparticle comprises a cell-penetrating peptide and a ZFN or TALEN, or a nucleic acid encoding the ZFN or TALEN. In some embodiments, the genome-editing complex or nanoparticle comprises a cell-penetrating peptide, an RGEN or a nucleic acid encoding the RGEN, and a guide RNA (gRNA) or a nucleic acid encoding the gRNA.
- gRNA guide RNA
- the genome-editing complex or nanoparticle comprises a cell- penetrating peptide, a DGEN or a nucleic acid encoding the DGEN, and a guide DNA (gDNA) or a nucleic acid encoding the gDNA.
- the cell-penetrating peptide and the genome-editing nuclease are covalently attached.
- the RGEN and gRNA or DGEN and gDNA are in a pre-formed complex prior to association with the cell-penetrating peptide to form the genome-editing complex.
- cell-penetrating peptides are complexed with a genome-editing integrase (or a nucleic acid encoding the genome-editing integrase).
- the genome-editing integrase is a bacteriophage integrase.
- the cell-penetrating peptides are complexed with the genome-editing integrase (or a nucleic acid encoding the genome-editing integrase) in combination with (such as complexed with) a donor nucleic acid comprising a recombination site recognized by the integrase to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the cell-penetrating peptides are capable of forming stable complexes and nanoparticles with genome-editing system molecules (e.g., a Cas nuclease and/or guide RNA, or nucleic acids encoding a Cas nuclease and/or guide RNA).
- the genome-editing complex or nanoparticle comprises the entire genome-editing system (e.g., delivery of the molecules in the genome-editing complex or nanoparticle into a cell is sufficient to effect genome editing in the cell).
- the invention provides complexes and nanoparticles comprising cell- penetrating peptides for delivering a ZFP or ZFN to a host cell.
- cell- penetrating peptides are complexed with a ZFP or ZFN (or a nucleic acid encoding the ZFP or ZFN) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the cell-penetrating peptides are capable of forming stable complexes and nanoparticles with the ZFP or ZFN or nucleic acids encoding the ZFP or ZFN.
- the genome- editing complex or nanoparticle comprises a cell-penetrating peptide and a ZFP or ZFN or a nucleic acid encoding the ZFP or ZFN.
- the cell-penetrating peptide and the ZFP or ZFN are covalently attached.
- the invention provides complexes and nanoparticles comprising cell- penetrating peptides for delivering a TALE or TALEN to a host cell.
- cell- penetrating peptides are complexed with a TALE or TALEN (or a nucleic acid encoding the TALE or TALEN) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the cell-penetrating peptides are capable of forming stable complexes and
- the genome-editing complex or nanoparticle comprises a cell-penetrating peptide and a TALE or TALEN or a nucleic acid encoding the TALE or TALEN.
- the cell-penetrating peptide and the TALE or TALEN are covalently attached.
- the invention provides complexes and nanoparticles comprising cell- penetrating peptides for delivering one or more CRISPR system molecules to a host cell.
- cell-penetrating peptides are complexed with a CRISPR nuclease (e.g., Cas9), or a nucleic acid encoding the CRISPR nuclease, optionally in combination with (such as complexed with) a guide sequence (or a nucleic acid encoding the guide sequence) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- a CRISPR nuclease e.g., Cas9
- a guide sequence or a nucleic acid encoding the guide sequence
- the cell- penetrating peptides are capable of forming stable complexes and nanoparticles with CRISPR system molecules (e.g., Cas nuclease and/or guide RNA) and/or nucleic acids encoding one or more of the CRISPR system molecules.
- the genome-editing complex or nanoparticle comprises a cell-penetrating peptide and a) an RGEN (e.g., Cas9) or a nucleic acid encoding the RGEN and/or b) a gRNA or a nucleic acid encoding the gRNA.
- the cell-penetrating peptide and the RGEN are covalently attached.
- the RGEN and gRNA are in a pre-formed complex prior to association with the cell-penetrating peptide to form the genome-editing complex or nanoparticle.
- the genome-editing complex or nanoparticle comprises the entire CRISPR system.
- the genome-editing complex or nanoparticle comprises a cell-penetrating peptide, an RGEN (e.g., Cas9) or a nucleic acid encoding the RGEN, and a gRNA or a nucleic acid encoding the gRNA.
- the invention provides complexes and nanoparticles comprising cell- penetrating peptides for delivering one or more molecules of a DGEN system to a host cell, such as the system described in Gao et al. (2016). Nature biotechnology, which uses a DNA-guided genome editing system comprising the Natronobacterium gregoryi Argonaute (NgAgo) and a guide DNA (gDNA).
- NgAgo Natronobacterium gregoryi Argonaute
- gDNA guide DNA
- cell-penetrating peptides are complexed with a DGEN (or a nucleic acid encoding the DGEN) in combination with (such as complexed with) a guide sequence (or a nucleic acid encoding the guide sequence) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the cell-penetrating peptides are capable of forming stable complexes and nanoparticles with DGEN system molecules (e.g., NgAgo nuclease and/or guide DNA) and/or nucleic acids encoding one or more of the DGEN system molecules.
- the genome-editing complex or nanoparticle comprises a cell-penetrating peptide, a DGEN or a nucleic acid encoding the DGEN, and a gDNA or a nucleic acid encoding the gDNA.
- the cell-penetrating peptide and the DGEN are covalently attached.
- the DGEN and gDNA are in a pre-formed complex prior to association with the cell-penetrating peptide to form the genome- editing complex.
- the genome-editing complex or nanoparticle comprises the entire DGEN system.
- the genome-editing complex or nanoparticle comprises a cell-penetrating peptide, a DGEN or a nucleic acid encoding the DGEN, and a gDNA or a nucleic acid encoding the gDNA.
- the invention provides complexes and nanoparticles comprising cell- penetrating peptides for delivering an integrase to a host cell.
- cell- penetrating peptides are complexed with an integrase (or a nucleic acid encoding the integrase) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the cell-penetrating peptides are complexed with the integrase (or a nucleic acid encoding the integrase) in combination with (such as complexed with) a donor nucleic acid comprising a recombination site recognized by the integrase to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the cell-penetrating peptides are capable of forming stable complexes and nanoparticles with the integrase or nucleic acid encoding the integrase.
- the genome-editing complex or nanoparticle comprises a cell- penetrating peptide and an integrase or a nucleic acid encoding the integrase.
- the cell-penetrating peptide and the integrase are covalently attached.
- the integrase and donor nucleic acid are in a pre-formed complex prior to association with the cell-penetrating peptide to form the genome-editing complex or
- the cell-penetrating peptides in the genome-editing complexes or nanoparticles of the present invention are capable of forming stable complexes and nanoparticles with various molecules of a genome-editing system, such as nucleases (e.g., ZFNs, TALENs, and CRISPR- associated nucleases (such as Cas9 and Cpf1)), integrases (such as bacteriophage integrases, e.g., ⁇ C31), and nucleic acids (e.g., guide RNAs, guide DNAs, and donor nucleic acids).
- nucleases e.g., ZFNs, TALENs, and CRISPR- associated nucleases (such as Cas9 and Cpf1)
- integrases such as bacteriophage integrases, e.g., ⁇ C31
- nucleic acids e.g., guide RNAs, guide DNAs, and donor nucleic acids.
- a genome-editing complex or nanoparticle described herein comprises a cell-penetrating peptide selected from the group consisting of CADY, PEP-1, MPG, VEPEP-3 peptides, VEPEP-4 peptides, VEPEP-5 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the cell-penetrating peptide is present in a genome-editing complex.
- the cell-penetrating peptide is present in a genome-editing complex present in the core of a nanoparticle.
- the cell- penetrating peptide is present in the core of a nanoparticle. In some embodiments, the cell- penetrating peptide is present in the core of a nanoparticle and is associated with a ZFN, TALEN, homing endonuclease, RGEN (e.g., Cas9), DGEN, or integrase. In some embodiments, the cell-penetrating peptide is present in the core of a nanoparticle and is associated with a gRNA or gDNA. In some embodiments, the cell-penetrating peptide is present in the core of a nanoparticle and is associated with an RGEN/gRNA complex or a DGEN/gDNA complex.
- the cell-penetrating peptide is present in the core of a nanoparticle and is associated with a donor nucleic acid. In some embodiments, the cell-penetrating peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the cell-penetrating peptide is present in the surface layer of a nanoparticle. In some embodiments, the cell- penetrating peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent.
- WO2014/053879 discloses VEPEP-3 peptides
- WO2014/053881 discloses VEPEP-4 peptides
- WO2014/053882 discloses VEPEP-5 peptides
- WO2012/137150 discloses VEPEP-6 peptides
- WO2014/053880 discloses VEPEP-9 peptides
- WO 2016/102687 discloses ADGN-100 peptides
- US2010/0099626 discloses CADY peptides
- U.S. Pat. No.7,514,530 discloses MPG peptides; the disclosures of which are hereby incorporated herein by reference in their entirety.
- a genome-editing complex or nanoparticle described herein comprises a VEPEP-3 cell-penetrating peptide comprising the amino acid sequence
- VEPEP-3 peptide comprises the amino acid sequence
- VEPEP-3 peptide comprises the amino acid sequence
- X 1 KWFERWFREWPRKRR (SEQ ID NO: 3), X 1 KWWERWWREWPRKRR (SEQ ID NO: 4), X 1 KWWERWWREWPRKRK (SEQ ID NO: 5), X 1 RWWEKWWTRWPRKRK (SEQ ID NO: 6), or X 1 RWYEKWYTEFPRRRR (SEQ ID NO: 7), wherein X 1 is beta-A or S.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-7, wherein the cell-penetrating peptide is modified by replacement of the amino acid in position 10 by a non-natural amino acid, addition of a non-natural amino acid between the amino acids in positions 2 and 3, and addition of a hydrocarbon linkage between the two non-natural amino acids.
- the VEPEP-3 peptide comprises the amino acid sequence X 1 KX 14 WERWWRX 14 WPRKRK (SEQ ID NO: 8), wherein X 1 is beta-A or S and X 14 is a non-natural amino acid, and wherein there is a hydrocarbon linkage between the two non-natural amino acids.
- the VEPEP-3 peptide comprises the amino acid sequence X 1 X 2 X 3 WX 5 X 10 X 3 WX 6 X 7 WX 8 X 9 X 10 WX 12 R (SEQ ID NO: 9), wherein X 1 is beta-A or S, X 2 is K, R or L, X 3 is F or W, X 5 is R or S, X 6 is R or S, X 7 is R or S, X 8 is F or W, X 9 is R or P, X 10 is L or R, and X 12 is R or F.
- the VEPEP-3 peptide comprises the amino acid sequence X 1 RWWRLWWRSWFRLWRR (SEQ ID NO: 10), X 1 LWWRRWWSRWWPRWRR (SEQ ID NO: 11), X 1 LWWSRWWRSWFRLWFR (SEQ ID NO: 12), or
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1 and 9-13, wherein the cell-penetrating peptide is modified by replacement of the amino acids in position 5 and 12 by non-natural amino acids, and addition of a hydrocarbon linkage between the two non-natural amino acids.
- the VEPEP-3 peptide comprises the amino acid sequence X 1 RWWX 14 LWWRSWX 14 RLWRR (SEQ ID NO: 14), wherein X 1 is a beta-alanine or a serine and X 14 is a non-natural amino acid, and wherein there is a hydrocarbon linkage between the two non-natural amino acids.
- the VEPEP-3 peptide is present in a genome-editing complex.
- the VEPEP-3 peptide is present in a genome-editing complex in the core of a nanoparticle.
- the VEPEP-3 peptide is present in the core of a nanoparticle.
- the VEPEP-3 peptide is present in the core of a nanoparticle and is associated with a ZFN, TALEN, homing endonuclease, RGEN (e.g., Cas9), DGEN, or integrase.
- the VEPEP-3 peptide is present in the core of a nanoparticle and is associated with a gRNA or gDNA.
- the VEPEP-3 peptide is present in the core of a nanoparticle and is associated with an RGEN/gRNA complex or a DGEN/gDNA complex.
- the VEPEP-3 peptide is present in the core of a nanoparticle and is associated with a donor nucleic acid.
- the VEPEP-3 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the VEPEP-3 peptide is present in the surface layer of a nanoparticle. In some embodiments, the VEPEP-3 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent.
- a genome-editing complex or nanoparticle described herein comprises a VEPEP-6 cell-penetrating peptide.
- the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of
- X 1 LX 2 ARLWX 9 LX 3 X 9 X 4 LWX 9 LX 5 X 6 X 7 X 8 (SEQ ID NO: 17), wherein X 1 is beta-A or S, X 2 is F or W, X 3 is L, W, C or I, X 4 is S, A, N or T, X 5 is L or W, X 6 is W or R, X 7 is K or R, X 8 is A or none, and X 9 is R or S.
- the VEPEP-6 peptide comprises the amino acid sequence X 1 LX 2 RALWRLX 3 RX 4 LWRLX 5 X 6 X 7 X 8 (SEQ ID NO: 18), wherein X 1 is beta-A or S, X 2 is F or W, X 3 is L, W, C or I, X 4 is S, A, N or T, X 5 is L or W, X 6 is W or R, X 7 is K or R, and X 8 is A or none.
- the VEPEP-6 peptide comprises the amino acid sequence X 1 LX 2 RALWRLX 3 RX 4 LWRLX 5 X 6 KX 7 (SEQ ID NO: 19), wherein X 1 is beta-A or S, X 2 is F or W, X 3 is L or W, X 4 is S, A or N, X 5 is L or W, X 6 is W or R, X 7 is A or none.
- the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of X 1 LFRALWRLLRX 2 LWRLLWX 3 (SEQ ID NO: 20),
- X 1 LWRALWRLX 4 RNLWRLLWX 3 A (SEQ ID NO: 25), wherein X 1 is beta-A or S, X 2 is S or T, X 3 is K or R, X 4 is L, C or I and X 5 is L or I.
- the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of Ac- X 1 LFRALWRLLRSLWRLLWK-cysteamide (SEQ ID NO: 26), Ac- X 1 LWRALWRLWRSLWRLLWKA-cysteamide (SEQ ID NO: 27), Ac- X 1 LWRALWRLLRSLWRLWRKA-cysteamide (SEQ ID NO: 28), Ac- X1LWRALWRLWRSLWRLWRKA-cysteamide (SEQ ID NO: 29), Ac- X 1 LWRALWRLLRALWRLLWKA-cysteamide (SEQ ID NO: 30), and Ac- X 1 LWRALWRLLRNLWRLLWKA-cysteamide (SEQ ID NO: 31), wherein X 1 is beta-A or S.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-31, further comprising a hydrocarbon linkage between two residues at positions 8 and 12.
- the VEPEP-6 peptide comprises an amino acid sequence selected from the group consisting of Ac-X 1 LFRALWR S LLRS S LWRLLWK-cysteamide (SEQ ID NO: 32), Ac-X 1 LFLARWR S LLRS S LWRLLWK-cysteamide (SEQ ID NO: 33), Ac- X 1 LFRALWS S LLRS S LWRLLWK-cysteamide (SEQ ID NO: 34), Ac- X 1 LFLARWS S LLRS S LWRLLWK-cysteamide (SEQ ID NO: 35), Ac- X 1 LFRALWRLLR S SLWS S LLWK-cysteamide (SEQ ID NO: 36), Ac- X 1 LFLARWRLLR S SLWS S LLWK-cysteamide (SEQ
- the VEPEP-6 peptide is present in a genome-editing complex. In some embodiments, the VEPEP-6 peptide is present in a genome-editing complex in the core of a nanoparticle. In some embodiments, the VEPEP-6 peptide is present in the core of a nanoparticle. In some embodiments, the VEPEP-6 peptide is present in the core of a nanoparticle and is associated with a ZFN, TALEN, homing endonuclease, RGEN (e.g., Cas9), DGEN, or integrase. In some embodiments, the VEPEP-6 peptide is present in the core of a nanoparticle and is associated with a gRNA or gDNA.
- the VEPEP-6 peptide is present in the core of a nanoparticle and is associated with an RGEN/gRNA complex or a DGEN/gDNA complex. In some embodiments, the VEPEP-6 peptide is present in the core of a nanoparticle and is associated with a donor nucleic acid. In some embodiments, the VEPEP-6 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the VEPEP-6 peptide is present in the surface layer of a nanoparticle. In some embodiments, the VEPEP-6 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent.
- a genome-editing complex or nanoparticle described herein comprises a VEPEP-9 cell-penetrating peptide comprising the amino acid sequence
- VEPEP-9 peptide comprises the amino acid sequence
- VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of X 1 LRWWLRWASRWFSRWAWWR (SEQ ID NO: 43),
- the VEPEP-9 peptide comprises the amino acid sequence of X 1 WWX 4 X 5 WAX 6 X 7 X 8 RX 10 WWR (SEQ ID NO: 49), wherein X 1 is beta-A or S, X 4 is R or G, X 5 is W or S, X 6 is S, T or P, X 7 is W or P, X 8 is A or R, and X 10 is S or R.
- the VEPEP-9 peptide comprises an amino acid sequence selected from the group consisting of X 1 WWRWWASWARSWWR (SEQ ID NO: 50), X 1 WWGSWATPRRRWWR (SEQ ID NO: 51), and X 1 WWRWWAPWARSWWR (SEQ ID NO: 52), wherein X 1 is beta-A or S.
- the VEPEP-9 peptide is present in a genome-editing complex.
- the VEPEP-9 peptide is present in a genome- editing complex in the core of a nanoparticle.
- the VEPEP-9 peptide is present in the core of a nanoparticle.
- the VEPEP-9 peptide is present in the core of a nanoparticle and is associated with a ZFN, TALEN, homing endonuclease, RGEN (e.g., Cas9), DGEN, or integrase.
- the VEPEP-9 peptide is present in the core of a nanoparticle and is associated with a gRNA or gDNA.
- the VEPEP-9 peptide is present in the core of a nanoparticle and is associated with an RGEN/gRNA complex or a DGEN/gDNA complex.
- the VEPEP-9 peptide is present in the core of a nanoparticle and is associated with a donor nucleic acid.
- the VEPEP-9 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the VEPEP-9 peptide is present in the surface layer of a nanoparticle. In some embodiments, the VEPEP-9 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent.
- a genome-editing complex or nanoparticle described herein comprises an ADGN-100 cell-penetrating peptide comprising the amino acid sequence
- the ADGN-100 peptide comprises the amino acid sequence X 1 KWRSX 2 X 3 X 4 RWRLWRX 5 X 6 X 7 X 8 SR (SEQ ID NO: 54), wherein X 1 is ⁇ A, S, or none, X 2 is A or V, X 3 is or L, X 4 is W or Y, X 5 is V or S, X 6 is R, V, or A, X 7 is S or L, and X 8 is W or Y.
- the ADGN-100 peptide comprises the amino acid sequence KWRSAGWRWRLWRVRSWSR (SEQ ID NO: 55), KWRSALYRWRLWRVRSWSR (SEQ ID NO: 56), KWRSALYRWRLWRSRSWSR (SEQ ID NO: 57), or
- the ADGN-100 peptide comprises two residues separated by three or six residues that are linked by a hydrocarbon linkage. In some embodiments, the ADGN-100 peptide comprises the amino acid sequence KWRS S AGWR S WRLWRVRSWSR (SEQ ID NO: 59),
- KWRSALYRWRLWRS S RSWS S R (SEQ ID NO: 66), KWR S SALYRWR S LWRSALYSR (SEQ ID NO: 67), KWRS S ALYR S WRLWRSALYSR (SEQ ID NO: 68),
- the ADGN-100 peptide is present in a genome-editing complex. In some embodiments, the ADGN-100 peptide is present in a genome-editing complex in the core of a nanoparticle. In some embodiments, the ADGN-100 peptide is present in the core of a nanoparticle.
- the ADGN-100 peptide is present in the core of a nanoparticle and is associated with a ZFN, TALEN, homing endonuclease, RGEN (e.g., Cas9), DGEN, or integrase.
- the ADGN-100 peptide is present in the core of a nanoparticle and is associated with a gRNA or gDNA.
- the ADGN-100 peptide is present in the core of a nanoparticle and is associated with an RGEN/gRNA complex or a DGEN/gDNA complex.
- the ADGN-100 peptide is present in the core of a nanoparticle and is associated with a donor nucleic acid.
- the ADGN- 100 peptide is present in an intermediate layer of a nanoparticle. In some embodiments, the ADGN-100 peptide is present in the surface layer of a nanoparticle. In some embodiments, the ADGN-100 peptide is linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the CPP described herein e.g., VEPEP-3 peptide, VEPEP-6 peptide, VEPEP-9 peptide, or ADGN-100 peptide
- the CPP described herein further comprises one or more moieties linked to the N-terminus of the CPP.
- the one or more moieties is covalently linked to the N-terminus of the CPP.
- the one or more moieties are selected from the group consisting of an acetyl group, a stearyl group, a fatty acid, a cholesterol, a poly-ethylene glycol, a nuclear localization signal, a nuclear export signal, an antibody or antibody fragment thereof, a peptide, a polysaccharide, and a targeting molecule.
- the one or more moieties is an acetyl group and/or a stearyl group.
- the CPP comprises an acetyl group and/or a stearyl group linked to its N-terminus.
- the CPP comprises an acetyl group linked to its N-terminus.
- the CPP comprises a stearyl group linked to its N-terminus.
- the CPP comprises an acetyl group and/or a stearyl group covalently linked to its N-terminus. In some embodiments, the CPP comprises an acetyl group covalently linked to its N-terminus. In some embodiments, the CPP comprises a stearyl group covalently linked to its N- terminus.
- the CPP described herein e.g., VEPEP-3 peptide, VEPEP-6 peptide, VEPEP-9 peptide, or ADGN-100 peptide
- the CPP described herein further comprises one or more moieties linked to the C-terminus of the CPP.
- the one or more moieties is covalently linked to the C-terminus of the CPP.
- the one or more moieties are selected from the group consisting of a cysteamide group, a cysteine, a thiol, an amide, a nitrilotriacetic acid, a carboxyl group, a linear or ramified C 1 -C 6 alkyl group, a primary or secondary amine, an osidic derivative, a lipid, a phospholipid, a fatty acid, a cholesterol, a poly- ethylene glycol, a nuclear localization signal, a nuclear export signal, an antibody or antibody fragment thereof, a peptide, a polysaccharide, and a targeting molecule.
- the one or more moieties is a cysteamide group.
- the CPP comprises a cysteamide group linked to its C-terminus.
- the CPP comprises a cysteamide group covalently linked to its C-terminus.
- the CPP described herein (e.g., VEPEP-3 peptide, VEPEP-6 peptide, VEPEP-9 peptide, or ADGN-100 peptide) is stapled.“Stapled” as used herein refers to a chemical linkage between two residues in a peptide.
- the CPP is stapled, comprising a chemical linkage between two amino acids of the peptide.
- the two amino acids linked by the chemical linkage are separated by 3 or 6 amino acids.
- two amino acids linked by the chemical linkage are separated by 3 amino acids.
- the two amino acids linked by the chemical linkage are separated by 6 amino acids.
- each of the two amino acids linked by the chemical linkage is R or S. In some embodiments, each of the two amino acids linked by the chemical linkage is R. In some embodiments, each of the two amino acids linked by the chemical linkage is S. In some embodiments, one of the two amino acids linked by the chemical linkage is R and the other is S. In some embodiments, the chemical linkage is a hydrocarbon linkage.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide and one or more molecules of a genome-editing system (including nucleic acids encoding any of the one or more genome- editing system molecules).
- the genome-editing complex comprises a cell- penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide) and a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN (e.g., Cas9), or DGEN.
- the genome-editing complex further comprises a gRNA or gDNA (or nucleic acid encoding the gRNA or gDNA), wherein the gRNA or gDNA comprises a guide sequence complementary to a target sequence in the target polynucleotide.
- the genome-editing complex comprises the cell-penetrating peptide associated with a pre-formed complex comprising an RGEN and a gRNA or a pre-formed complex comprising a DGEN and a gDNA.
- the genome-editing complex comprises a cell-penetrating peptide and an integrase (or a nucleic acid encoding the integrase).
- the integrase is a bacteriophage integrase (e.g., ⁇ C31).
- the genome-editing complex further comprises a donor nucleic acid comprising a recombination site recognized by the integrase.
- at least some of the cell- penetrating peptides in the genome-editing complex are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the molar ratio of cell-penetrating peptide to at least one of the one or more genome-editing system molecules (such as all of the one or more genome-editing system molecules) in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of cell- penetrating peptide to at least one of the one or more genome-editing system molecules (such as all of the one or more genome-editing system molecules) in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD-based peptide, an
- the genome-editing complex further comprises one or more additional gRNAs or dDNAs comprising different guide sequences.
- the genome-editing complex further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the target polynucleotide is modified in a coding sequence.
- the target nucleic acid for introducing a specific modification to the target polynucleotide.
- the polynucleotide is modified in a non-coding sequence.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the genome-editing complex comprises the entire genome-editing system.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide) and a ZFN or TALEN (or one or more nucleic acids encoding the ZFN or TALEN).
- a cell-penetrating peptide e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- ZFN or TALEN or one or more nucleic acids encoding the ZFN or TALEN
- the molar ratio of cell-penetrating peptide to ZFN or TALEN in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of cell-penetrating peptide to ZFN or TALEN in the genome- editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the target polynucleotide is modified in a coding sequence.
- the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide) and an integrase (or one or more nucleic acids encoding the integrase).
- the integrase is a bacteriophage integrase (e.g., ⁇ C31).
- the genome-editing complex further comprises a donor nucleic acid comprising a recombination site recognized by the integrase for introducing a specific modification to the target polynucleotide.
- at least some of the cell- penetrating peptides in the genome-editing complex are linked to a targeting moiety.
- the linkage is covalent.
- the molar ratio of cell-penetrating peptide to integrase in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of cell-penetrating peptide to integrase in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide) and one or both of an RGEN (or nucleic acid encoding the RGEN) and a gRNA (or nucleic acid encoding the gRNA), wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide.
- a cell-penetrating peptide e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- an RGEN or nucleic acid encoding the RGEN
- a gRNA or nucleic acid encoding the gRNA
- the genome-editing complex comprises the cell-penetrating peptide associated with a pre-formed complex comprising the RGEN and the gRNA.
- at least some of the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety.
- the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the genome-editing complex is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the genome-editing complex is about 1:1.
- the molar ratio of cell-penetrating peptide to RGEN in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios). In some embodiments, the molar ratio of cell- penetrating peptide to RGEN in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine- based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises one or more additional gRNAs comprising different guide sequences.
- the genome-editing complex further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide) and one or both of a DGEN (or nucleic acid encoding the DGEN) and a gDNA (or nucleic acid encoding the gDNA), wherein the gDNA comprises a guide sequence complementary to a target sequence in the target polynucleotide.
- the genome-editing complex comprises the cell-penetrating peptide associated with a pre-formed complex comprising the DGEN and the gDNA.
- the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety.
- the linkage is covalent.
- the DGEN is NgAgo.
- the molar ratio of DGEN to gDNA in the genome- editing complex is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios).
- the molar ratio of DGEN to gDNA in the genome- editing complex is about 1:1.
- the molar ratio of cell-penetrating peptide to DGEN in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios). In some embodiments, the molar ratio of cell-penetrating peptide to DGEN in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD- based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises one or more additional gDNAs comprising different guide sequences.
- the genome-editing complex further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the target polynucleotide is modified in a coding sequence.
- the target polynucleotide is modified in a coding sequence.
- the target peptide is modified in a coding sequence.
- polynucleotide is modified in a non-coding sequence.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide) associated with a pre-formed RGEN/gRNA complex comprising an RGEN and a gRNA, wherein the gRNA comprises a guide sequence
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the genome-editing complex is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the genome-editing complex is about 1:1.
- the molar ratio of cell-penetrating peptide to RGEN in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios). In some embodiments, the molar ratio of cell- penetrating peptide to RGEN in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine- based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises one or more additional gRNAs comprising different guide sequences.
- the genome-editing complex further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), a ZFN or TALEN, and a donor nucleic acid, wherein the ZFN or TALEN cleaves a target sequence in the target polynucleotide, and wherein the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification.
- a cell-penetrating peptide e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- a ZFN or TALEN cleaves a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification.
- the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide, and the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the modification is insertion of a heterologous nucleic acid in the target polynucleotide, and the donor nucleic acid is a double-stranded DNA molecule, such as a plasmid.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- at least some of the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the molar ratio of cell- penetrating peptide to ZFN or TALEN in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of cell-penetrating peptide to ZFN or TALEN in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the genome- editing complex comprises a TALEN.
- the CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises one or more additional donor nucleic acids comprising different modifications.
- the target polynucleotide is modified in a coding sequence.
- the target polynucleotide is modified in a non- coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for introducing an exogenous nucleic acid into a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), an integrase, and a donor nucleic acid comprising the exogenous nucleic acid, wherein the integrase is capable of mediating recombination between a first recombination site in the target polynucleotide and a second recombination site in the donor nucleic acid.
- a cell-penetrating peptide e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- integrase e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- a donor nucleic acid comprising the exogenous nu
- the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety.
- the linkage is covalent.
- the molar ratio of cell- penetrating peptide to integrase in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of cell-penetrating peptide to integrase in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises one or more additional donor nucleic acids comprising different exogenous nucleic acids.
- the exogenous nucleic acid is inserted into a coding sequence of the target polynucleotide.
- the exogenous nucleic acid is inserted into a non-coding sequence of the target polynucleotide.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the target polynucleotide is modified to express a product of the exogenous nucleic acid (such as a protein, e.g., an exogenous protein).
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide) and one or more of an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification.
- a cell-penetrating peptide e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- RGEN or a nucleic acid encoding the RGEN
- gRNA or a
- the genome-editing complex comprises the cell-penetrating peptide associated with a) a pre-formed complex comprising the RGEN and the gRNA; and b) the donor nucleic acid.
- the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide, and the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the modification is insertion of a heterologous nucleic acid in the target polynucleotide, and the donor nucleic acid is a double-stranded DNA molecule, such as a plasmid.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- at least some of the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety.
- the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the genome-editing complex is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios).
- the molar ratio of RGEN to gRNA in the genome-editing complex is about 1:1.
- the molar ratio of cell-penetrating peptide to RGEN in the genome- editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios). In some embodiments, the molar ratio of cell-penetrating peptide to RGEN in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises one or more additional gRNAs comprising different guide sequences.
- the genome-editing complex further comprises one or more additional donor nucleic acids comprising different modifications.
- the target comprising different guide sequences.
- the genome-editing complex further comprises one or more additional donor nucleic acids comprising different modifications.
- the target nucleic acids comprising different modifications.
- polynucleotide is modified in a coding sequence.
- the target is a sequence that is a sequence that is modified in a coding sequence.
- polynucleotide is modified in a non-coding sequence.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, and the modification is addition, deletion, or substitution of one or more nucleotides in the target nucleic acid.
- a cell-penetrating peptide e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- an RGEN or
- the genome-editing complex comprises the cell-penetrating peptide associated with a) a pre-formed complex comprising the RGEN and the gRNA; and b) the donor nucleic acid.
- the modification is addition, deletion, or substitution of between about 1 and about 50 (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, and 50, including any ranges between these values) nucleotides in the target polynucleotide.
- the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually between about 20 and about 150 (such as about any of 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, and 150, including any ranges between these values) nucleotides in length.
- at least some of the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans- activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans- activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the genome-editing complex is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the genome-editing complex is about 1:1.
- the molar ratio of cell-penetrating peptide to RGEN in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios). In some embodiments, the molar ratio of cell-penetrating peptide to RGEN in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises one or more additional gRNAs comprising different guide sequences.
- the genome-editing complex further comprises one or more additional donor nucleic acids comprising different modifications.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, and the modification is insertion of a heterologous nucleic acid in the target nucleic acid.
- a cell-penetrating peptide e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- an RGEN or a nu
- the genome-editing complex comprises the cell-penetrating peptide associated with a) a pre-formed complex comprising the RGEN and the gRNA; and b) the donor nucleic acid.
- the modification is insertion of a heterologous nucleic acid greater than about 50 (such as greater than about any of 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, or more, including any ranges between these values) nucleotides in length.
- the donor nucleic acid is a double-stranded DNA molecule.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually greater than about 300 (such as greater than about any of 300, 400, 500, 600, 700, 800, 900, 1000, or more, including any ranges between these values) nucleotides in length.
- at least some of the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the genome-editing complex is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the genome-editing complex is about 1:1.
- the molar ratio of cell-penetrating peptide to RGEN in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios). In some embodiments, the molar ratio of cell-penetrating peptide to RGEN in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD- based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises one or more additional gRNAs comprising different guide sequences.
- the genome-editing complex further comprises one or more additional donor nucleic acids comprising different modifications.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target
- polynucleotide is modified in a non-coding sequence.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for modifying one or more target polynucleotides comprising a cell-penetrating peptide (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), an RGEN (or a nucleic acid encoding the RGEN), and a plurality of gRNAs (or one or more nucleic acids encoding the plurality of gRNAs), wherein each of the plurality of gRNAs individually comprises a different guide sequence complementary to a target sequence in one of the one or more target polynucleotides.
- a cell-penetrating peptide e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- an RGEN or a nucleic acid encoding the RGEN
- a plurality of gRNAs or one or more nucleic acids encoding the plurality of gRNAs
- the genome-editing complex comprises the cell-penetrating peptide associated with pre-formed complexes comprising the RGEN and the plurality of gRNAs. In some embodiments, at least some of the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety. In some embodiments, the linkage is covalent. In some
- each of the plurality of gRNAs is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- each of the plurality of gRNAs is an sgRNA comprising the guide sequence of the gRNA, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the genome-editing complex is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the genome-editing complex is about 1:1.
- the molar ratio of cell-penetrating peptide to RGEN in the genome-editing complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios). In some embodiments, the molar ratio of cell- penetrating peptide to RGEN in the genome-editing complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine- based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the genome-editing complex further comprises one or more donor nucleic acids, wherein each of the one or more donor nucleic acids individually comprises a sequence for introducing a modification to one of the one or more target polynucleotides.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide associated with a genome-editing enzyme (or a nucleic acid encoding the genome-editing enzyme), such as a nuclease or integrase, wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide associated with a genome-editing enzyme (or a nucleic acid encoding the genome-editing enzyme), such as a nuclease or integrase, wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEP
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing enzyme is a nuclease selected from a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing enzyme is Cas9. In some embodiments, the genome-editing complex further comprises a gRNA or a gDNA (or a nucleic acid encoding the gRNA or gDNA). In some embodiments, the genome-editing enzyme is a TALEN. In some embodiments, the genome- editing enzyme is an integrase. In some embodiments, the genome-editing complex further comprises a donor nucleic acid for introducing a specific modification to the target
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide associated with a pre-formed RGEN/gRNA complex comprising an RGEN and a gRNA, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the RGEN is Cas9.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), and a gRNA (or a nucleic acid encoding the gRNA), wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the RGEN is Cas9.
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification
- the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing complex comprises the cell-penetrating peptide associated with a) a pre-formed complex comprising the RGEN and the gRNA; and b) the donor nucleic acid.
- the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide, and the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the modification is insertion of a heterologous nucleic acid in the target polynucleotide, and the donor nucleic acid is a double-stranded DNA molecule, such as a plasmid.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the RGEN is Cas9.
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification
- the modification is addition, deletion, or substitution of one or more nucleotides in the target nucleic acid
- the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing complex comprises the cell-penetrating peptide associated with a) a pre-formed complex comprising the RGEN and the gRNA; and b) the donor nucleic acid.
- the modification is addition, deletion, or substitution of between about 1 and about 50 (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, and 50, including any ranges between these values) nucleotides in the target polynucleotide.
- the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually between about 20 and about 150 (such as about any of 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, and 150, including any ranges between these values) nucleotides in length.
- the RGEN is Cas9.
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification
- the modification is insertion of a heterologous nucleic acid in the target nucleic acid
- the cell- penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing complex comprises the cell-penetrating peptide associated with a) a pre-formed complex comprising the RGEN and the gRNA; and b) the donor nucleic acid.
- the modification is insertion of a heterologous nucleic acid greater than about 50 (such as greater than about any of 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, or more, including any ranges between these values) nucleotides in length.
- the donor nucleic acid is a double-stranded DNA molecule.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually greater than about 300 (such as greater than about any of 300, 400, 500, 600, 700, 800, 900, 1000, or more, including any ranges between these values) nucleotides in length.
- the RGEN is Cas9.
- a genome-editing complex for modifying one or more target polynucleotides comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), and a plurality of gRNAs (or one or more nucleic acids encoding the plurality of gRNAs), wherein each of the plurality of gRNAs individually comprises a different guide sequence complementary to a target sequence in one of the one or more target polynucleotides, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing complex comprises the cell- penetrating peptide associated with pre-formed complexes comprising the RGEN and the plurality of gRNAs.
- the RGEN is Cas9.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide associated with a pre-formed Cas9/gRNA complex comprising Cas9 and a gRNA, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the cell- penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), and a gRNA (or a nucleic acid encoding the gRNA), wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification
- the cell- penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing complex comprises the cell-penetrating peptide associated with a) a pre-formed complex comprising Cas9 and the gRNA; and b) the donor nucleic acid.
- the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide, and the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the modification is insertion of a heterologous nucleic acid in the target polynucleotide, and the donor nucleic acid is a double-stranded DNA molecule, such as a plasmid.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification
- the modification is addition, deletion, or substitution of one or more nucleotides in the target nucleic acid
- the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing complex comprises the cell-penetrating peptide associated with a) a pre-formed complex comprising Cas9 and the gRNA; and b) the donor nucleic acid.
- the modification is addition, deletion, or substitution of between about 1 and about 50 (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, and 50, including any ranges between these values) nucleotides in the target
- the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually between about 20 and about 150 (such as about any of 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, and 150, including any ranges between these values) nucleotides in length.
- a genome-editing complex for introducing a modification to a target polynucleotide comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification
- the modification is insertion of a heterologous nucleic acid in the target nucleic acid
- the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing complex comprises the cell-penetrating peptide associated with a) a pre-formed complex comprising Cas9 and the gRNA; and b) the donor nucleic acid.
- the modification is insertion of a heterologous nucleic acid greater than about 50 (such as greater than about any of 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, or more, including any ranges between these values) nucleotides in length.
- the donor nucleic acid is a double-stranded DNA molecule.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually greater than about 300 (such as greater than about any of 300, 400, 500, 600, 700, 800, 900, 1000, or more, including any ranges between these values) nucleotides in length.
- a genome-editing complex for modifying one or more target polynucleotides comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), and a plurality of gRNAs (or one or more nucleic acids encoding the plurality of gRNAs), wherein each of the plurality of gRNAs individually comprises a different guide sequence complementary to a target sequence in one of the one or more target polynucleotides, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing complex comprises the cell- penetrating peptide associated with pre-formed complexes comprising Cas9 and the plurality of gRNAs.
- the guide sequence of a gRNA contained in a genome-editing complex according to any of the embodiments described herein is complementary to a target sequence in a gene encoding a protein involved in regulating an immune response, including immune checkpoint regulators and proteins involved in antigen presentation.
- the guide sequence of a gRNA contained in a genome-editing complex according to any of the embodiments described herein is complementary to a target sequence in a gene encoding a protein involved in regulating cholesterol transport and/or metabolism.
- the guide sequence is complementary to a target sequence in a gene encoding a protein including, without limitation, PD-1, PD-L1, PD-L2, TIM-1, TIM-3, TIM-4, BTLA, VISTA, LAG-3, CTLA-4, TIGIT, 4-1BB, OX40, CD27, CD28, HVEM, GITR, ICOS, CD40, CD80, CD86, B7-H2, B7-H3, B7-H4, B7-H6, 2B4, CD160, gp49B, PIR-B, KIR family receptors, SIRPalpha (CD47), CD48, 2B4 (CD244), B7.1, B7.2, ILT-2, ILT-4, A2aR, toll-like receptors TLR-2, 3, 4, 6, 7, 8, and 9, granulocyte macrophage colony stimulating factor (GM- CSF), TNF, CD40L, FLT-3 ligand, cytokines such as IL-1, IL-2,
- the genome-editing complex further comprises a protein other than a genome-editing system molecule, or a nucleic acid molecule encoding the protein (such as a DNA plasmid or mRNA).
- the mean size (diameter) of a genome-editing complex described herein is between any of about 10 nm and about 10 microns, including for example between about 30 nm and about 1 micron, between about 50 nm and about 250 nm, between about 50 nm and about 180 nm, and between about 150 nm and about 200 nm.
- the genome-editing complex is between about 10 nm and about 400 nm. In some embodiments, the genome-editing complex is between about 20 nm and about 400 nm. In some embodiments, the genome-editing complex is between about 30 nm and about 200 nm.
- the genome-editing complex is between about 40 nm and about 200 nm. In some embodiments, the genome-editing complex is between about 40 nm and about 150 nm. In some embodiments, the genome-editing complex is between about 40 nm and about 100 nm. In some embodiments, the genome-editing complex is substantially non-toxic.
- the targeting moiety of a genome-editing complex described herein targets the genome-editing complex to a tissue or a specific cell type.
- the tissue is a tissue in need of treatment.
- the targeting moiety targets the genome-editing complex to a tissue or cell that can be treated by the genome- editing system.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising one or more genome-editing complexes described herein.
- the nanoparticle core comprises a plurality of genome-editing complexes.
- the nanoparticle core comprises a plurality of genome-editing complexes present in a predetermined ratio. In some embodiments, the predetermined ratio is selected to allow the most effective use of the nanoparticle in any of the methods described below in more detail.
- the nanoparticle core further comprises one or more additional cell-penetrating peptides, one or more additional genome-editing nucleases, one or more additional gNAs, and/or one or more additional donor nucleic acids.
- the one or more additional cell-penetrating peptides do not comprise a cell- penetrating peptide found in any of the one or more genome-editing complexes.
- the one or more additional genome-editing nucleases do not comprise a genome- editing nuclease found in any of the one or more genome-editing complexes.
- the one or more additional gNAs do not comprise a gNA found in any of the one or more genome-editing complexes.
- the one or more additional donor nucleic acids do not comprise a donor nucleic acid found in any of the one or more genome- editing complexes.
- the one or more additional cell-penetrating peptides include, but are not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine- based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- at least some of the one or more additional cell-penetrating peptides are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising one or more cell-penetrating peptides (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide) and a genome-editing enzyme (or a nucleic acid encoding the genome-editing enzyme), such as a nuclease or integrase.
- a targeting moiety In some embodiments, the linkage is covalent.
- the molar ratio of cell-penetrating peptide to genome-editing enzyme associated with the cell-penetrating peptide in a complex present in the nanoparticle is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of cell- penetrating peptide to genome-editing enzyme associated with the cell-penetrating peptide in a complex present in the nanoparticle is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the genome-editing enzyme is a nuclease selected from a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing enzyme is Cas9.
- the nanoparticle core further comprises one or more gRNAs or gDNAs (or one or more nucleic acids encoding the one or more gRNAs or gDNAs).
- the genome-editing enzyme is a TALEN.
- the genome-editing enzyme is an integrase.
- the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the target polynucleotide is modified in a coding sequence.
- the target polynucleotide is modified in a non-coding sequence.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the one or more cell-penetrating peptides include, but are not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising one or more cell-penetrating peptides (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), an RGEN (or a nucleic acid encoding the RGEN), and a gRNA (or a nucleic acid encoding the gRNA), wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide.
- cell-penetrating peptides e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- an RGEN or a nucleic acid encoding the RGEN
- a gRNA or a nucleic acid encoding the gRNA
- the nanoparticle core comprises one of the one or more cell-penetrating peptides associated with a pre-formed complex comprising the RGEN and the gRNA (RGEN/gRNA complex).
- the nanoparticle core comprises a first complex comprising one of the one or more cell-penetrating peptides associated with the RGEN and a second complex comprising one of the one or more cell-penetrating peptides associated with the gRNA.
- at least some of the one or more cell-penetrating peptides in the nanoparticle are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity- determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity- determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the nanoparticle is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the nanoparticle is about 1:1.
- the molar ratio of a) cell-penetrating peptide to RGEN associated with the cell- penetrating peptide in a complex present in the nanoparticle; and/or b) cell-penetrating peptide to gRNA associated with the cell-penetrating peptide in a complex present in the nanoparticle is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of a) cell-penetrating peptide to RGEN associated with the cell-penetrating peptide in a complex present in the nanoparticle; and/or b) cell-penetrating peptide to gRNA associated with the cell-penetrating peptide in a complex present in the nanoparticle is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the nanoparticle core further comprises one or more additional gRNAs comprising different guide sequences. In some embodiments, at least one of the one or more additional gRNAs is present in the pre-formed RGEN/gRNA complex. In some embodiments, at least one of the one or more additional gRNAs is present in the second complex. In some embodiments, at least one of the one or more additional gRNAs is present in an additional complex comprising one of the one or more cell-penetrating peptides. In some embodiments, the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target
- the donor nucleic acid is present in the pre-formed RGEN/gRNA complex. In some embodiments, the donor nucleic acid is present in the first or second complex. In some embodiments, the donor nucleic acid is present in an additional complex comprising one of the one or more cell-penetrating peptides.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the one or more cell-penetrating peptides include, but are not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine- based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising one or more cell-penetrating peptides (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), a DGEN (or a nucleic acid encoding the DGEN), and a gDNA (or a nucleic acid encoding the gDNA), wherein the gDNA comprises a guide sequence complementary to a target sequence in the target polynucleotide.
- cell-penetrating peptides e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- a DGEN or a nucleic acid encoding the DGEN
- a gDNA or a nucleic acid encoding the gDNA
- the nanoparticle core comprises one of the one or more cell-penetrating peptides associated with a pre-formed complex comprising the DGEN and the gDNA (DGEN/gDNA complex).
- the nanoparticle core comprises a first complex comprising one of the one or more cell-penetrating peptides associated with the DGEN and a second complex comprising one of the one or more cell-penetrating peptides associated with the gDNA.
- at least some of the one or more cell-penetrating peptides in the nanoparticle are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the DGEN is NgAgo.
- the molar ratio of DGEN to gDNA in the nanoparticle is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of DGEN to gDNA in the nanoparticle is about 1:1.
- the molar ratio of a) cell-penetrating peptide to DGEN associated with the cell-penetrating peptide in a complex present in the nanoparticle; and/or b) cell-penetrating peptide to gDNA associated with the cell-penetrating peptide in a complex present in the nanoparticle is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of a) cell-penetrating peptide to DGEN associated with the cell-penetrating peptide in a complex present in the nanoparticle; and/or b) cell- penetrating peptide to gDNA associated with the cell-penetrating peptide in a complex present in the nanoparticle is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the nanoparticle core further comprises one or more additional gDNAs comprising different guide sequences. In some embodiments, at least one of the one or more additional gDNAs is present in the pre-formed DGEN/gDNA complex. In some embodiments, at least one of the one or more additional gDNAs is present in the second complex. In some embodiments, at least one of the one or more additional gDNAs is present in an additional complex comprising one of the one or more cell-penetrating peptides. In some embodiments, the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide. In some embodiments, the donor nucleic acid is present in the pre-formed DGEN/gDNA complex.
- the donor nucleic acid is present in the first or second complex. In some embodiments, the donor nucleic acid is present in an additional complex comprising one of the one or more cell-penetrating peptides.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the one or more cell- penetrating peptides include, but are not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising one or more cell-penetrating peptides (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide) and a pre-formed complex comprising an RGEN and a gRNA (RGEN/gRNA complex), wherein at least one of the one or more cell- penetrating peptides is associated with the pre-formed RGEN/gRNA complex, and wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide.
- cell-penetrating peptides e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- RGEN/gRNA complex e.gRNA complex
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the nanoparticle is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the nanoparticle is about 1:1.
- the molar ratio of cell-penetrating peptide to RGEN in the pre- formed RGEN/gRNA complex associated with the cell-penetrating peptide is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of cell- penetrating peptide to RGEN in the pre-formed RGEN/gRNA complex associated with the cell- penetrating peptide is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the nanoparticle core further comprises one or more additional gRNAs comprising different guide sequences. In some embodiments, at least one of the one or more additional gRNAs is present in the pre-formed RGEN/gRNA complex.
- the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the donor nucleic acid is present in the pre-formed RGEN/gRNA complex.
- the donor nucleic acid is present in the first or second complex.
- the donor nucleic acid is present in an additional complex comprising one of the one or more cell-penetrating peptides.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the one or more cell- penetrating peptides include, but are not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising one or more cell-penetrating peptides (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), a first complex comprising one of the one or more cell-penetrating peptides associated with an RGEN (or a nucleic acid encoding the RGEN), and a second complex comprising one of the one or more cell-penetrating peptides associated with a gRNA (or a nucleic acid encoding the gRNA), wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide.
- at least some of the one or more cell-penetrating peptides in the nanoparticle are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the nanoparticle is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the nanoparticle is about 1:1.
- the molar ratio of a) cell-penetrating peptide to RGEN associated with the cell-penetrating peptide in the first complex; and/or b) cell-penetrating peptide to gRNA associated with the cell- penetrating peptide in the second complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of a) cell-penetrating peptide to RGEN associated with the cell-penetrating peptide in the first complex; and/or b) cell-penetrating peptide to gRNA associated with the cell-penetrating peptide in the second complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the nanoparticle core further comprises one or more additional gRNAs comprising different guide sequences.
- At least one of the one or more additional gRNAs is present in the pre-formed RGEN/gRNA complex. In some embodiments, at least one of the one or more additional gRNAs is present in the second complex. In some embodiments, at least one of the one or more additional gRNAs is present in an additional complex comprising one of the one or more cell-penetrating peptides. In some embodiments, the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target
- the donor nucleic acid is present in the pre-formed RGEN/gRNA complex. In some embodiments, the donor nucleic acid is present in the first or second complex. In some embodiments, the donor nucleic acid is present in an additional complex comprising one of the one or more cell-penetrating peptides.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the one or more cell-penetrating peptides include, but are not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine- based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising one or more cell-penetrating peptides (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid for introducing a specific modification to the target polynucleotide, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification.
- a cell-penetrating peptides e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- an RGEN or a nucleic
- the nanoparticle core comprises one of the one or more cell-penetrating peptides associated with a pre-formed complex comprising the RGEN and the gRNA (RGEN/gRNA complex).
- the donor nucleic acid is present in a ternary complex comprising one of the one or more cell-penetrating peptides, a pre-formed RGEN/gRNA complex, and the donor nucleic acid.
- the nanoparticle core comprises a first complex comprising one of the one or more cell-penetrating peptides associated with the RGEN and a second complex comprising one of the one or more cell-penetrating peptides associated with the gRNA.
- the donor nucleic acid is present in the first complex.
- the donor nucleic acid is present in the second complex.
- the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide, and the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the modification is insertion of a heterologous nucleic acid in the target polynucleotide
- the donor nucleic acid is a double-stranded DNA molecule, such as a plasmid.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- at least some of the one or more cell-penetrating peptides in the nanoparticle are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the nanoparticle is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the nanoparticle is about 1:1.
- the nanoparticle core further comprises one or more additional gRNAs comprising different guide sequences.
- at least one of the one or more additional gRNAs is present in the pre-formed RGEN/gRNA complex. In some embodiments, at least one of the one or more additional gRNAs is present in the second complex.
- the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the donor nucleic acid is present in the pre-formed RGEN/gRNA complex.
- the donor nucleic acid is present in the first or second complex.
- the donor nucleic acid is present in an additional complex comprising one of the one or more cell-penetrating peptides.
- the target polynucleotide is modified in a coding sequence.
- the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the one or more cell- penetrating peptides include, but are not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising one or more cell-penetrating peptides (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid for introducing a specific modification to the target polynucleotide, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, and the modification is addition, deletion, or substitution of one or more nucleotides in the target nucleic acid.
- a cell-penetrating peptides e.g., a VEPEP-3, VEP
- the nanoparticle core comprises one of the one or more cell-penetrating peptides associated with a pre-formed complex comprising the RGEN and the gRNA (RGEN/gRNA complex).
- the donor nucleic acid is present in a ternary complex comprising one of the one or more cell- penetrating peptides, a pre-formed RGEN/gRNA complex, and the donor nucleic acid.
- the nanoparticle core comprises a first complex comprising one of the one or more cell-penetrating peptides associated with the RGEN and a second complex comprising one of the one or more cell-penetrating peptides associated with the gRNA.
- the donor nucleic acid is present in the first complex. In some embodiments, the donor nucleic acid is present in the second complex. In some embodiments, the modification is addition, deletion, or substitution of between about 1 and about 50 (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, and 50, including any ranges between these values) nucleotides in the target polynucleotide. In some embodiments, the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually between about 20 and about 150 (such as about any of 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, and 150, including any ranges between these values) nucleotides in length.
- at least some of the one or more cell-penetrating peptides in the nanoparticle are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the nanoparticle is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the nanoparticle is about 1:1.
- the nanoparticle core further comprises one or more additional gRNAs comprising different guide sequences. In some embodiments, at least one of the one or more additional gRNAs is present in the pre-formed RGEN/gRNA complex. In some embodiments, at least one of the one or more additional gRNAs is present in the second complex. In some embodiments, at least one of the one or more additional gRNAs is present in an additional complex comprising one of the one or more cell-penetrating peptides. In some embodiments, the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide. In some embodiments, the donor nucleic acid is present in the pre- formed RGEN/gRNA complex.
- the donor nucleic acid is present in the first or second complex. In some embodiments, the donor nucleic acid is present in an additional complex comprising one of the one or more cell-penetrating peptides.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the one or more cell-penetrating peptides include, but are not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine- based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising one or more cell-penetrating peptides (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid for introducing a specific modification to the target polynucleotide, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, and the modification is insertion of a heterologous nucleic acid in the target nucleic acid.
- a cell-penetrating peptides e.g., a VEPEP-3, VEPEP-6,
- the nanoparticle core comprises one of the one or more cell-penetrating peptides associated with a pre-formed complex comprising the RGEN and the gRNA (RGEN/gRNA complex).
- the donor nucleic acid is present in a ternary complex comprising one of the one or more cell-penetrating peptides, a pre-formed RGEN/gRNA complex, and the donor nucleic acid.
- the nanoparticle core comprises a first complex comprising one of the one or more cell-penetrating peptides associated with the RGEN and a second complex comprising one of the one or more cell-penetrating peptides associated with the gRNA.
- the donor nucleic acid is present in the first complex.
- the donor nucleic acid is present in the second complex.
- the modification is insertion of a heterologous nucleic acid greater than about 50 (such as greater than about any of 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, or more, including any ranges between these values) nucleotides in length.
- the donor nucleic acid is a double-stranded DNA molecule.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually greater than about 300 (such as greater than about any of 300, 400, 500, 600, 700, 800, 900, 1000, or more, including any ranges between these values) nucleotides in length.
- at least some of the one or more cell-penetrating peptides in the nanoparticle are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the gRNA is a single-guide RNA (sgRNA) comprising a specificity- determining CRISPR RNA (crRNA) fused to an auxiliary trans-activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity- determining CRISPR RNA
- tracrRNA auxiliary trans-activating crRNA
- the gRNA is an sgRNA comprising the guide sequence, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the nanoparticle is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the nanoparticle is about 1:1.
- the nanoparticle core further comprises one or more additional gRNAs comprising different guide sequences. In some embodiments, at least one of the one or more additional gRNAs is present in the pre-formed RGEN/gRNA complex. In some embodiments, at least one of the one or more additional gRNAs is present in the second complex. In some embodiments, at least one of the one or more additional gRNAs is present in an additional complex comprising one of the one or more cell-penetrating peptides. In some embodiments, the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide. In some embodiments, the donor nucleic acid is present in the pre-formed RGEN/gRNA complex.
- the donor nucleic acid is present in the first or second complex. In some embodiments, the donor nucleic acid is present in an additional complex comprising one of the one or more cell-penetrating peptides.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence. In some embodiments, the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the one or more cell-penetrating peptides include, but are not limited to, a PTD- based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- a nanoparticle for modifying one or more target polynucleotides comprising a core comprising one or more cell-penetrating peptides (e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide), an RGEN (or a nucleic acid encoding the RGEN), and a plurality of gRNAs (or one or more nucleic acids encoding the plurality of gRNAs), wherein each of the plurality of gRNAs individually comprises a different guide sequence complementary to a target sequence in one of the one or more target polynucleotides.
- a cell-penetrating peptides e.g., a VEPEP-3, VEPEP-6, VEPEP-9, or ADGN-100 peptide
- an RGEN or a nucleic acid encoding the RGEN
- a plurality of gRNAs or one or more nucleic acids encoding the plurality of gRNAs
- the nanoparticle core comprises one of the one or more cell-penetrating peptides associated with a pre-formed complex comprising the RGEN and at least one of the plurality of gRNAs (RGEN/gRNA complex).
- the pre-formed complex comprising the RGEN and at least one of the plurality of gRNAs (RGEN/gRNA complex).
- RGEN/gRNA complex comprises each of the plurality of gRNAs.
- the nanoparticle core comprises a first complex comprising one of the one or more cell-penetrating peptides associated with the RGEN and one or more complexes, each comprising one of the one or more cell-penetrating peptides associated with at least one of the plurality of gRNAs.
- the one or more complexes is a second complex comprising each of the plurality of gRNAs.
- at least some of the one or more cell-penetrating peptides in the nanoparticle are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- each of the plurality of gRNAs is a single-guide RNA (sgRNA) comprising a specificity-determining CRISPR RNA (crRNA) fused to an auxiliary trans- activating crRNA (tracrRNA).
- sgRNA single-guide RNA
- crRNA specificity-determining CRISPR RNA
- tracrRNA auxiliary trans- activating crRNA
- each of the plurality of gRNAs is an sgRNA comprising the guide sequence of the gRNA, a tracr mate sequence, a tracr sequence, and a tail sequence.
- the RGEN is Cas9 or Cpf1.
- the molar ratio of RGEN to gRNA in the nanoparticle is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of RGEN to gRNA in the nanoparticle is about 1:1.
- the molar ratio of a) cell-penetrating peptide to RGEN associated with the cell-penetrating peptide in a complex present in the nanoparticle; and/or b) cell-penetrating peptide to gRNA associated with the cell- penetrating peptide in a complex present in the nanoparticle is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of a) cell-penetrating peptide to RGEN associated with the cell-penetrating peptide in a complex present in the nanoparticle; and/or b) cell-penetrating peptide to gRNA associated with the cell-penetrating peptide in a complex present in the nanoparticle is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target
- the donor nucleic acid is present in the pre-formed RGEN/gRNA complex. In some embodiments, the donor nucleic acid is present in the first complex or the one or more complexes. In some embodiments, the donor nucleic acid is present in an additional complex comprising one of the one or more cell-penetrating peptides.
- the target polynucleotide is modified in a coding sequence. In some embodiments, the target polynucleotide is modified in a non-coding sequence.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product. In some embodiments, the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the one or more cell-penetrating peptides include, but are not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine- based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide and a genome-editing enzyme (or a nucleic acid encoding the genome-editing enzyme), wherein the cell-penetrating peptide is associated with the genome-editing enzyme, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing enzyme is a nuclease selected from a ZFN, TALEN, homing endonuclease, RGEN, or DGEN. In some embodiments, the genome-editing enzyme is Cas9.
- the nanoparticle core further comprises a gRNA or gDNA (or a nucleic acid encoding the gRNA or gDNA).
- the genome-editing enzyme is a TALEN.
- the genome-editing enzyme is an integrase.
- the nanoparticle core further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), and a gRNA (or a nucleic acid encoding the gRNA), wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the cell-penetrating peptide comprises the amino acid sequence of of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell- penetrating peptide associated with a pre-formed complex comprising the RGEN and the gRNA (RGEN/gRNA complex).
- the nanoparticle core comprises a first complex comprising the cell-penetrating peptide associated with the RGEN and a second complex comprising the cell-penetrating peptide associated with the gRNA.
- the RGEN is Cas9.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide and a pre-formed complex comprising an RGEN and a gRNA (RGEN/gRNA complex), wherein the cell- penetrating peptide is associated with the pre-formed RGEN/gRNA complex, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the RGEN is Cas9.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, a first complex comprising the cell-penetrating peptide associated with an RGEN (or a nucleic acid encoding the RGEN), and a second complex comprising the cell-penetrating peptide associated with a gRNA (or a nucleic acid encoding the gRNA), wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the cell- penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the RGEN is Cas9.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid for introducing a specific modification to the target polynucleotide
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification
- the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell-penetrating peptide associated with a pre-formed complex comprising the RGEN and the gRNA (RGEN/gRNA complex) and a separate complex comprising the cell-penetrating peptide associated with the donor nucleic acid.
- the donor nucleic acid is present in a ternary complex comprising the cell- penetrating peptide, a pre-formed RGEN/gRNA complex, and the donor nucleic acid.
- the nanoparticle core comprises a first complex comprising the cell-penetrating peptide associated with the RGEN and a second complex comprising the cell-penetrating peptide associated with the gRNA.
- the donor nucleic acid is present in the first complex. In some embodiments, the donor nucleic acid is present in the second complex. In some embodiments, the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide, and the donor nucleic acid is a single-stranded DNA oligonucleotide. In some embodiments, the modification is insertion of a heterologous nucleic acid in the target polynucleotide, and the donor nucleic acid is a double-stranded DNA molecule, such as a plasmid.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the RGEN is Cas9.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid for introducing a specific modification to the target polynucleotide
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, and the modification is addition, deletion, or substitution of one or more nucleotides in the target nucleic acid
- the cell- penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an AD
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell-penetrating peptide associated with a pre-formed complex comprising the RGEN and the gRNA (RGEN/gRNA complex) and a separate complex comprising the cell-penetrating peptide associated with the donor nucleic acid.
- the donor nucleic acid is present in a ternary complex comprising the cell-penetrating peptide, a pre-formed RGEN/gRNA complex, and the donor nucleic acid.
- the nanoparticle core comprises a first complex comprising the cell- penetrating peptide associated with the RGEN and a second complex comprising the cell- penetrating peptide associated with the gRNA.
- the donor nucleic acid is present in the first complex. In some embodiments, the donor nucleic acid is present in the second complex. In some embodiments, the modification is addition, deletion, or substitution of between about 1 and about 50 (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, and 50, including any ranges between these values) nucleotides in the target
- the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually between about 20 and about 150 (such as about any of 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, and 150, including any ranges between these values) nucleotides in length.
- the RGEN is Cas9.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid for introducing a specific modification to the target polynucleotide
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, and the modification is insertion of a heterologous nucleic acid in the target nucleic acid
- the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell-penetrating peptide associated with a pre-formed complex comprising the RGEN and the gRNA (RGEN/gRNA complex) and a separate complex comprising the cell-penetrating peptide associated with the donor nucleic acid.
- the donor nucleic acid is present in a ternary complex comprising the cell- penetrating peptide, a pre-formed RGEN/gRNA complex, and the donor nucleic acid.
- the nanoparticle core comprises a first complex comprising the cell-penetrating peptide associated with the RGEN and a second complex comprising the cell-penetrating peptide associated with the gRNA.
- the donor nucleic acid is present in the first complex. In some embodiments, the donor nucleic acid is present in the second complex. In some embodiments, the modification is insertion of a heterologous nucleic acid greater than about 50 (such as greater than about any of 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, or more, including any ranges between these values) nucleotides in length. In some embodiments, the donor nucleic acid is a double-stranded DNA molecule.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually greater than about 300 (such as greater than about any of 300, 400, 500, 600, 700, 800, 900, 1000, or more, including any ranges between these values) nucleotides in length.
- the RGEN is Cas9.
- a nanoparticle for modifying one or more target polynucleotides comprising a core comprising a cell-penetrating peptide, an RGEN (or a nucleic acid encoding the RGEN), and a plurality of gRNAs (or one or more nucleic acids encoding the plurality of gRNAs), wherein each of the plurality of gRNAs individually comprises a different guide sequence complementary to a target sequence in one of the one or more target polynucleotides, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell- penetrating peptide associated with a pre-formed complex comprising the RGEN and at least one of the plurality of gRNAs (RGEN/gRNA complex).
- the pre-formed RGEN/gRNA complex comprises each of the plurality of gRNAs.
- the nanoparticle core comprises a first complex comprising the cell-penetrating peptide associated with the RGEN and one or more complexes, each comprising the cell-penetrating peptide associated with at least one of the plurality of gRNAs.
- the one or more complexes is a second complex comprising each of the plurality of gRNAs.
- the RGEN is Cas9.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), and a gRNA (or a nucleic acid encoding the gRNA), wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the cell-penetrating peptide comprises the amino acid sequence of of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell- penetrating peptide associated with a pre-formed complex comprising Cas9 and the gRNA (Cas9/gRNA complex). In some embodiments, the nanoparticle core comprises a first complex comprising the cell-penetrating peptide associated with the RGEN and a second complex comprising the cell-penetrating peptide associated with the gRNA.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide and a pre-formed complex comprising Cas9 and a gRNA (Cas9/gRNA complex), wherein the cell-penetrating peptide is associated with the pre-formed Cas9/gRNA complex, wherein the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, a first complex comprising the cell-penetrating peptide associated with Cas9 (or a nucleic acid encoding Cas9), and a second complex comprising the cell-penetrating peptide associated with a gRNA (or a nucleic acid encoding the gRNA), wherein the gRNA comprises a guide sequence
- the cell- penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid for introducing a specific modification to the target polynucleotide
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification
- the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell-penetrating peptide associated with a pre-formed complex comprising Cas9 and the gRNA (Cas9/gRNA complex) and a separate complex comprising the cell- penetrating peptide associated with the donor nucleic acid.
- the donor nucleic acid is present in a ternary complex comprising the cell-penetrating peptide, a pre- formed Cas9/gRNA complex, and the donor nucleic acid.
- the nanoparticle core comprises a first complex comprising the cell-penetrating peptide associated with Cas9 and a second complex comprising the cell-penetrating peptide associated with the gRNA.
- the donor nucleic acid is present in the first complex. In some embodiments, the donor nucleic acid is present in the second complex. In some embodiments, the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide, and the donor nucleic acid is a single-stranded DNA oligonucleotide. In some embodiments, the modification is insertion of a heterologous nucleic acid in the target polynucleotide, and the donor nucleic acid is a double-stranded DNA molecule, such as a plasmid.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid for introducing a specific modification to the target polynucleotide
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, and the modification is addition, deletion, or substitution of one or more nucleotides in the target nucleic acid
- the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an AD
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell-penetrating peptide associated with a pre-formed complex comprising Cas9 and the gRNA (Cas9/gRNA complex) and a separate complex comprising the cell-penetrating peptide associated with the donor nucleic acid.
- the donor nucleic acid is present in a ternary complex comprising the cell-penetrating peptide, a pre- formed Cas9/gRNA complex, and the donor nucleic acid.
- the nanoparticle core comprises a first complex comprising the cell-penetrating peptide associated with Cas9 and a second complex comprising the cell-penetrating peptide associated with the gRNA.
- the donor nucleic acid is present in the first complex. In some embodiments, the donor nucleic acid is present in the second complex. In some embodiments, the modification is addition, deletion, or substitution of between about 1 and about 50 (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, and 50, including any ranges between these values) nucleotides in the target polynucleotide. In some embodiments, the donor nucleic acid is a single-stranded DNA oligonucleotide.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually between about 20 and about 150 (such as about any of 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, and 150, including any ranges between these values) nucleotides in length.
- a nanoparticle for modifying a target polynucleotide comprising a core comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), a gRNA (or a nucleic acid encoding the gRNA), and a donor nucleic acid for introducing a specific modification to the target polynucleotide
- the gRNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, and the modification is insertion of a heterologous nucleic acid in the target nucleic acid
- the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell-penetrating peptide associated with a pre-formed complex comprising Cas9 and the gRNA (Cas9/gRNA complex) and a separate complex comprising the cell- penetrating peptide associated with the donor nucleic acid.
- the donor nucleic acid is present in a ternary complex comprising the cell-penetrating peptide, a pre- formed Cas9/gRNA complex, and the donor nucleic acid.
- the nanoparticle core comprises a first complex comprising the cell-penetrating peptide associated with Cas9 and a second complex comprising the cell-penetrating peptide associated with the gRNA.
- the donor nucleic acid is present in the first complex. In some embodiments, the donor nucleic acid is present in the second complex. In some embodiments, the modification is insertion of a heterologous nucleic acid greater than about 50 (such as greater than about any of 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, or more, including any ranges between these values) nucleotides in length. In some embodiments, the donor nucleic acid is a double-stranded DNA molecule.
- the donor nucleic acid comprises a 5’ homology arm that is homologous to a 5’ target homology region comprising a portion of the target polynucleotide adjacent and 5’ to the modification and a 3’ homology arm that is homologous to a 3’ target homology region comprising a portion of the target polynucleotide adjacent and 3’ to the modification.
- the 5’ target homology region and/or the 3’ target homology region overlap with at least about 1 (such as at least about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, or more) nucleotide in the target sequence.
- the 5’ target homology region and/or the 3’ target homology region are within about 1000 (such as within about any of 1000, 500, 400, 300, 200, 100, 75, 50, 25, 20, 15, 10, 5, or 1) nucleotides from the target sequence.
- the 5’ homology arm and the 3’ homology arm are each individually greater than about 300 (such as greater than about any of 300, 400, 500, 600, 700, 800, 900, 1000, or more, including any ranges between these values) nucleotides in length.
- a nanoparticle for modifying one or more target polynucleotides comprising a core comprising a cell-penetrating peptide, Cas9 (or a nucleic acid encoding Cas9), and a plurality of gRNAs (or one or more nucleic acids encoding the plurality of gRNAs), wherein each of the plurality of gRNAs individually comprises a different guide sequence complementary to a target sequence in one of the one or more target polynucleotides, and wherein the cell-penetrating peptide comprises the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the nanoparticle core comprises the cell- penetrating peptide associated with a pre-formed complex comprising Cas9 and at least one of the plurality of gRNAs (Cas9/gRNA complex).
- the pre-formed complex comprising Cas9 and at least one of the plurality of gRNAs (Cas9/gRNA complex).
- Cas9/gRNA complex comprises each of the plurality of gRNAs.
- the nanoparticle core comprises a first complex comprising the cell-penetrating peptide associated with Cas9 and one or more complexes, each comprising the cell-penetrating peptide associated with at least one of the plurality of gRNAs.
- the one or more complexes is a second complex comprising each of the plurality of gRNAs.
- the nanoparticle further comprises a surface layer comprising a peripheral CPP surrounding the core.
- the peripheral CPP is the same as a CPP in the core. In some embodiments, the peripheral CPP is different than any of the CPPs in the core.
- the peripheral CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the peripheral CPP is a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- at least some of the peripheral cell-penetrating peptides in the surface layer are linked to a targeting moiety. In some embodiments, the linkage is covalent.
- the nanoparticle further comprises an intermediate layer between the core of the nanoparticle and the surface layer.
- the intermediate layer comprises an intermediate CPP.
- the intermediate CPP is the same as a CPP in the core. In some embodiments, the intermediate CPP is different than any of the CPPs in the core.
- the intermediate CPP includes, but is not limited to, a PTD-based peptide, an amphipathic peptide, a poly-arginine-based peptide, an MPG peptide, a CADY peptide, a VEPEP peptide (such as a VEPEP-3, VEPEP-6, or VEPEP-9 peptide), an ADGN-100 peptide, a Pep-1 peptide, and a Pep-2 peptide.
- the intermediate CPP is a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the guide sequence of a gRNA or gDNA contained in a nanoparticle according to any of the embodiments described herein is complementary to a target sequence in a gene encoding a protein involved in regulating an immune response, including immune checkpoint regulators and proteins involved in antigen presentation.
- the guide sequence of a gRNA or gDNA contained in a nanoparticle according to any of the embodiments described herein is complementary to a target sequence in a gene encoding a protein involved in regulating cholesterol transport and/or metabolism.
- the guide sequence is complementary to a target sequence in a gene encoding a protein including, without limitation, PD-1, PD-L1, PD-L2, TIM-1, TIM-3, TIM-4, BTLA, VISTA, LAG-3, CTLA-4, TIGIT, 4-1BB, OX40, CD27, CD28, HVEM, GITR, ICOS, CD40, CD80, CD86, B7-H2, B7-H3, B7-H4, B7-H6, 2B4, CD160, gp49B, PIR-B, KIR family receptors, SIRPalpha (CD47), CD48, 2B4 (CD244), B7.1, B7.2, ILT-2, ILT-4, A2aR, toll-like receptors TLR-2, 3, 4, 6, 7, 8, and 9, granulocyte macrophage colony stimulating factor (GM- CSF), TNF, CD40L, FLT-3 ligand, cytokines such as IL-1, IL-2,
- the nanoparticle further comprises a protein other than a genome-editing system molecule, or a nucleic acid molecule encoding the protein (such as a DNA plasmid or mRNA).
- the mean size (diameter) of the nanoparticle is from about 10 nm to about 400 nm, including for example from about 50 nm to about 200 nm, from about 60 nm to about 180 nm, from about 80 nm to about 140 nm, and from about 90 nm to about 120 nm. In some embodiments, the mean size (diameter) of the nanoparticle is no greater than about 1000 nanometers (nm), such as no greater than about any of 900, 800, 700, 600, 500, 400, 300, 200, or 100 nm.
- the average or mean diameter of the nanoparticle is no greater than about 200 nm. In some embodiments, the average or mean diameters of the nanoparticles is no greater than about 150 nm. In some embodiments, the average or mean diameter of the nanoparticle is no greater than about 100 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 10 nm to about 400 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 20 nm to about 400 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 30 nm to about 200 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 40 nm to about 200 nm.
- the average or mean diameter of the nanoparticle is about 40 nm to about 150 nm. In some embodiments, the average or mean diameter of the nanoparticle is about 40 nm to about 100 nm. In some embodiments, the nanoparticles are sterile-filterable.
- the zeta potential of the nanoparticle is from about -30 mV to about 60 mV (such as about any of -30, -25, -20, -15, -10, -5, 0, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, and 60 mV, including any ranges between these values).
- the zeta potential of the nanoparticle is from about -30 mV to about 30 mV, including for example from about -25 mV to about 25 mV, from about -20 mV to about 20 mV, from about -15 mV to about 15 mV, from about -10 mV to about 10 mV, and from about -5 mV to about 10 mV.
- the polydispersity index (PI) of the nanoparticle is from about 0.05 to about 0.6 (such as about any of 0.05, 0.1, 0.15, 0.2, 0.25, 0.3, 0.35, 0.4, 0.45, 0.5, 0.55, and 0.6, including any ranges between these values).
- the nanoparticle is substantially non- toxic.
- a genome-editing system molecule of a genome- editing complex or nanoparticle described herein is a protein or polypeptide.
- a genome-editing complex or nanoparticle described herein comprises an RGEN (e.g., Cas9).
- the protein or polypeptide is between about 10 kDa and about 200 kDa (such as about any of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, and 200 kDa, including any ranges between these values).
- the genome-editing complex or nanoparticle comprises a plurality of proteins or polypeptides, wherein each of the plurality of protein or polypeptides is between about 10 kDa and about 200 kDa (such as about any of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, and 200 kDa, including any ranges between these values).
- a genome-editing system molecule (e.g. gRNA) of a genome- editing complex or nanoparticle described herein is a nucleic acid.
- the nucleic acid is between about 20 nt and about 20 kb (such as about any of 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 kb, including any ranges between these values).
- a genome-editing complex or nanoparticle described herein comprises a gRNA (e.g., a Cas9 gRNA).
- the gRNA is between about 20 nt and about 200 nt (such as about any of 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, and 200 nt, including any ranges between these values).
- the nucleic acid is DNA, such as a DNA plasmid encoding a genome-editing system molecule.
- the DNA plasmid comprises an expression cassette for expressing the genome-editing system molecule.
- the DNA plasmid is between about 1 kb and about 20 kb (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 kb, including any ranges between these values).
- the nucleic acid is RNA, such as mRNA encoding a genome-editing system molecule.
- the mRNA is between about 100 nt and about 10 kb (such as about any of 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, and 10 kb, including any ranges between these values).
- the genome-editing complex or nanoparticle comprises a plurality of nucleic acids, such as any of the nucleic acids described herein.
- the genome-editing complex or nanoparticle comprises a gRNA and a nucleic acid encoding a genome-editing system molecule (e.g., a DNA plasmid or mRNA encoding the genome-editing system molecule).
- the genome-editing complex or nanoparticle comprises nucleic acid encoding a plurality of genome-editing system molecules (e.g., one or more DNA plasmid encoding the plurality of genome-editing system molecules, or a plurality of mRNAs encoding the plurality of genome-editing system
- a genome-editing system molecule e.g. RGEN or gRNA
- a genome-editing complex or nanoparticle described herein comprises a nucleic acid encoding an RGEN and/or a nucleic acid encoding a gRNA.
- the nucleic acid is DNA, such as a DNA plasmid encoding a genome-editing system molecule.
- the DNA plasmid comprises an expression cassette for expressing the genome-editing system molecule.
- the DNA plasmid is between about 1 kb and about 20 kb (such as about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 kb, including any ranges between these values).
- the nucleic acid is RNA, such as mRNA encoding a genome-editing system molecule.
- the mRNA is between about 100 nt and about 10 kb (such as about any of 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, and 10 kb, including any ranges between these values).
- Polynucleotide refers to polymers of nucleotides of any length, and includes DNA and RNA.
- the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs.
- nucleic acid refers to a polymer containing at least two deoxyribonucleotides or ribonucleotides in either single- or double-stranded form and includes DNA and RNA.
- DNA may be in the form of, e.g., antisense molecules, plasmid DNA, pre- condensed DNA, a PCR product, vectors (PAC, BAC, YAC, artificial chromosomes), expression cassettes, chimeric sequences, chromosomal DNA, or derivatives and combinations of these groups.
- RNA may be in the form of siRNA, asymmetrical interfering RNA (aiRNA), microRNA (miRNA), mRNA, tRNA, rRNA, RNA, viral RNA (vRNA), and combinations thereof.
- Nucleic acids include nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, including for example locked nucleic acid (LNA), unlocked nucleic acid (UNA), and zip nucleic acid (ZNA), which can be synthetic, naturally occurring, and non-naturally occurring, and which have similar binding properties as the reference nucleic acid.
- LNA locked nucleic acid
- UNA unlocked nucleic acid
- ZNA zip nucleic acid
- analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2’-O-methyl ribonucleotides, and peptide-nucleic acids (PNAs).
- PNAs peptide-nucleic acids
- the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid.
- a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated.
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer e al., Nucleic Acid Res., 19:5081 ( 1991); Ohtsuka et a ., j . Biol. Chern., 260:2605-2608 (1985); Rossolini et al., Mol. Cell. Probes, 8:91-98 (1994)).
- Nucleotides contain a sugar deoxyribose (DNA) or ribose (RNA), a base, and a phosphate group. Nucleotides are linked together through the phosphate groups.
- Bases include purines and pyrimidines, which further include natural compounds adenine, thymine, guanine, cytosine, uracil, inosine, and natural analogs, and synthetic derivatives of purines and pyrimidines, which include, but are not limited to, modifications which place new reactive groups such as, but not limited to, amines, alcohols, thiols, carboxylases, and alkylhalides.
- Oligonucleotide generally refers to short, generally synthetic polynucleotides that are generally, but not necessarily, less than about 200 nucleotides in length.
- oligonucleotide and
- polynucleotide are not mutually exclusive. The description above for polynucleotides is equally and fully applicable to oligonucleotides.
- the nucleic acids are single stranded oligonucleotides. In some embodiments, the nucleic acids are double stranded oligonucleotides.
- the nucleic acids described herein may be any of a range of length of up to, but not necessarily 200 nucleotides in the case of antisense oligonucleotides, RNAi, siRNA, shRNA, iRNA, antagomirs or up to 1000 kilo bases in the case of plasmid DNA.
- the nucleic acids are plasmid DNA or DNA fragments (for example DNA fragments of lengths of up to about 1000 bp).
- the plasmid DNA or DNA fragments may be hypermethylated or hypomethylated.
- the plasmid DNA or DNA fragments encode one or more genes, and may contain regulatory elements necessary for the expression of said one or more genes.
- the plasmid DNA or DNA fragments may comprise one or more genes that encode a selectable marker, allowing for maintenance of the plasmid DNA or DNA fragment in an appropriate host cell.
- a genome-editing complex or nanoparticle as described herein comprises a targeting moiety, wherein the targeting moiety is a ligand capable of cell-specific and/or nuclear targeting.
- a cell membrane surface receptor and/or cell surface marker is a molecule or structure which can bind said ligand with high affinity and preferably with high specificity. Said cell membrane surface receptor and/or cell surface marker is preferably specific for a particular cell, i.e. it is found predominantly in one type of cell rather than in another type of cell (e.g. galactosyl residues to target the asialoglycoprotein receptor on the surface of hepatocytes).
- the cell membrane surface receptor facilitates cell targeting and internalization into the target cell of the ligand (e.g. the targeting moiety) and attached molecules (e.g. the complex or nanoparticle of the invention).
- ligand moieties/ligand binding partners that may be used in the context of the present invention are widely described in the literature.
- Such a ligand moiety is capable of conferring to the complex or nanoparticle of the invention the ability to bind to a given binding-partner molecule or a class of binding-partner molecules localized at the surface of at least one target cell.
- Suitable binding-partner molecules include without limitation polypeptides selected from the group consisting of cell-specific markers, tissue-specific markers, cellular receptors, viral antigens, antigenic epitopes and tumor- associated markers.
- Binding-partner molecules may moreover consist of or comprise, for example, one or more sugar, lipid, glycolipid, antibody molecules or fragments thereof, or aptamer.
- a ligand moiety may be for example a lipid, a glycolipid, a hormone, a sugar, a polymer (e.g. PEG, polylysine, PET), an oligonucleotide, a vitamin, an antigen, all or part of a lectin, all or part of a polypeptide, such as for example JTS1 (WO 94/40958), an antibody or a fragment thereof, or a combination thereof.
- the ligand moiety used in the present invention is a peptide or polypeptide having a minimal length of 7 amino acids. It is either a native polypeptide or a polypeptide derived from a native polypeptide.“Derived” means containing (a) one or more modifications with respect to the native sequence (e.g. addition, deletion and/or substitution of one or more residues), (b) amino acid analogs, including non-naturally occurring amino acids, (c) substituted linkages, or (d) other modifications known in the art.
- polypeptides serving as ligand moiety encompass variant and chimeric polypeptides obtained by fusing sequences of various origins, such as for example a humanized antibody which combines the variable region of a mouse antibody and the constant region of a human immunoglobulin.
- polypeptides may have a linear or cyclized structure (e.g. by flanking at both extremities a polypeptide ligand by cysteine residues).
- the polypeptide in use as a ligand moiety may include modifications of its original structure by way of substitution or addition of chemical moieties (e.g. glycosylation, alkylation, acetylation, amidation, phosphorylation, addition of sulfhydryl groups and the like).
- the invention further contemplates modifications that render the ligand moiety detectable.
- modifications with a detectable moiety can be envisaged (i.e. a scintigraphic, radioactive, or fluorescent moiety, or a dye label and the like).
- detectable labels may be attached to the ligand moiety by any conventional techniques and may be used for diagnostic purposes (e.g. imaging of tumoral cells).
- the binding-partner molecule is an antigen (e.g. a target cell-specific antigen, a disease-specific antigen, an antigen specifically expressed on the surface of engineered target cells) and the ligand moiety is an antibody, a fragment or a minimal recognition unit thereof (e.g. a fragment still presenting an antigenic specificity) such as those described in detail in immunology manuals (see for example
- the ligand moiety may be a monoclonal antibody. Many monoclonal antibodies that bind many of these antigens are already known, and using techniques known in the art in relation to monoclonal antibody technology, antibodies to most antigens may be prepared.
- the ligand moiety may be a part of an antibody (for example a Fab fragment) or a synthetic antibody fragment (for example, ScFv). In some embodiments, the ligand moiety is selected among antibody fragments, rather than whole antibodies. Effective functions of whole antibodies, such as complement binding, are removed. ScFv and dAb antibody fragments may be expressed as a fusion with one or more other polypeptides.
- Minimal recognition units may be derived from the sequence of one or more of the complementary-determining regions (CDR) of the Fv fragment.
- Whole antibodies, and F(ab')2 fragments are“bivalent”. By“bivalent” it is meant that said antibodies and F(ab')2 fragments have two antigen binding sites.
- Fab, Fv, ScFv, dAb fragments and minimal recognition units are monovalent, having only one antigen binding sites.
- the ligand moiety allows targeting to a tumor cell and is capable of recognizing and binding to a molecule related to the tumor status, such as a tumor-specific antigen, a cellular protein differentially or over-expressed in tumor cells or a gene product of a cancer-associated vims.
- tumor-specific antigens include but are not limited to MUC-1 related to breast cancer (Hareuven i et al., 990, Eur. J. Biochem 189, 475-486), the products encoded by the mutated BRCAl and BRCA2 genes related to breast and ovarian cancers (Miki et al, 1994, Science 226, 66-71; Fuireal et al, 1994, Science 226, 120- 122; Wooster et al., 1995, Nature 378, 789-792), APC related to colon cancer (Poiakis, 1995, Curr. Opin. Genet.
- PSA prostate specific antigen
- CEA carcinoma embryonic antigen
- the ligand moiety is a fragment of an antibody capable of recognizing and binding to the MUC-1 antigen and thus targeting MUC-1 positive tumor cells.
- the ligand moiety is the scFv fragment of the SM3 monoclonal antibody which recognizes the tandem repeat region of the MUC-1 antigen
- Examples of cellular proteins differentially or overexpressed in tumor cells include but are not limited to the receptor for interleukin 2 (IL-2) overexpressed in some lymphoid tumors, GRP (Gastrin Release Peptide) overexpressed in lung carcinoma cells, pancreas, prostate and stomach tumors (Michael et al., 1995, Gene Therapy 2, 660-668), TNF (Tumor Necrosis Factor) receptor, epidermal growth factor receptors, Fas receptor, CD40 receptor, CD30 receptor, CD27 receptor, OX-40, ⁇ -v integrins (Brooks et al, 994, Science 264, 569) and receptors for certain angiogenic growth factors (Hanahan, 1997, Science 277, 48).
- IL-2 interleukin 2
- GRP Gastrin Release Peptide
- TNF Tumor Necrosis Factor
- epidermal growth factor receptors Fas receptor
- CD40 receptor CD30 receptor
- CD27 receptor CD27 receptor
- OX-40
- IL-2 is a suitable ligand moiety to bind to TL-2 receptor.
- receptors that are specific to fibrosis and inflammation, these include the TGFbeta receptors or the Adenosine receptors that are identified above and are suitable targets for invention compositions.
- Cell surface markers for multiple myeloma include, but are not limited to, CD56, CD40, FGFR3, CS1, CD138, IGF1R, VEGFR, and CD38, and are suitable targets for invention compositions.
- Suitable ligand moieties that bind to these cell surface markers include, but are not limited to, anti-CD56, anti-CD40, PRO-001, Chir-258, HuLuc63, anti-CD138-DM1, anti-IGF1R and bevacizumab.
- a genome-editing complex or nanoparticle described herein comprises one or more molecules of a genome-editing system (such as the entire genome-editing system) targeting one or more genes including, but are not limited to, Adenosine receptor A2A, Adenosine receptor A2B, Adenylyl cyclase, Akt, ALK, ALK/Met, angiopoietin receptor, Angiotensin II, APC, AR, ARK5, arrestin, ATF1, ATF-2, B7-1, B7-h1 (pdl-1), ⁇ -catenin, Bcl-2, BCL2L12, Bcl6, Bcr-Abl, BRAF, BRCA1, BRCA2, BTK, caspase-2, caspase-9, CCL2, CCN1, Ccnd2, CDK-activating kinases, CEBPA, Chop, c-Jun, c-Myc, CREB, CREB1, CS1, CTGF
- the genome-editing complex or nanoparticle comprises one or more molecules of an RGEN-based genome-editing system (e.g., a CRISPR/Cas9 genome-editing system), wherein the RGEN- based genome-editing system comprises a gRNA targeting one of the genes described herein.
- the genome-editing complex or nanoparticle comprises one or more molecules of a DGEN-based genome-editing system, wherein the DGEN-based genome-editing system comprises a gDNA targeting one of the genes described herein.
- the genome-editing complex or nanoparticle comprises one or more molecules of a ZFN-based genome-editing system, wherein the ZFN targets one of the genes described herein.
- the genome-editing complex or nanoparticle comprises one or more molecules of a TALEN-based genome-editing system, wherein the TALEN targets one of the genes described herein.
- the genome-editing complex or nanoparticle comprises one or more molecules of a homing endonuclease-based genome-editing system, wherein the homing endonuclease targets one of the genes described herein.
- the genome- editing complex or nanoparticle comprises one or more molecules of an integrase-based genome-editing system, wherein the integrase targets one of the genes described herein.
- the nucleic acid-guided endonuclease is a CRISPR-associated nuclease.
- CRISPRs Clustered Regularly Interspaced Short Palindromic Repeats
- SPIDRs Sacer Interspersed Direct Repeats
- the CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al., J. Bacteriol., 169:5429-5433 [1987]; and Nakata et al., J.
- the CRISPR loci typically differ from other SSRs by the structure of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. Integ. Biol., 6:23-33 [2002]; and Mojica et al., Mol. Microbiol., 36:244-246 [2000]).
- SRSRs short regularly spaced repeats
- the repeats are short elements that occur in clusters that are regularly spaced by unique intervening sequences with a substantially constant length (Mojica et al., [2000], supra).
- the repeat sequences are highly conserved between strains, the number of interspersed repeats and the sequences of the spacer regions typically differ from strain to strain (van Embden et al., J.
- CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al., Mol. Microbiol., 43:1565-1575 [2002]; and Mojica et al., [2005]) including, but not limited to Aeropyrum, Pyrobaculum, Sulfolobus, Archaeoglobus, Halocarcula, Methanobacterium, Methanococcus, Methanosarcina, Methanopyrus, Pyrococcus, Picrophilus, Thermoplasma, Corynebacterium, Mycobacterium, Streptomyces, Aquifex, Porphyromonas, Chlorobium, Thermus, Bacillus, Listeria, Staphylococcus, Clostridium, Thermoanaerobacter, Mycoplasma, Fusobacterium, Azarcus, Chromobacterium, Neisseria, Nitrosomon
- Acinetobacter Erwinia, Escherichia, Legionella, Methylococcus, Pasteurella, Photobacterium, Salmonella, Xanthomonas, Yersinia, Treponema, and Thermotoga.
- CRISPR system refers collectively to proteins, transcripts and other molecules involved in the activity of CRISPR-associated (“Cas”) nucleases (such as RNA- guided endonucleases, or“RGENs”), including Cas gene products, Cas gene sequences, tracr (trans-activating CRISPR) sequences (e.g.
- tracrRNA or an active partial tracrRNA include a“direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a“spacer” in the context of an endogenous CRISPR system), or other sequences, transcripts, and products derived from a CRISPR locus.
- one or more molecules of a CRISPR system are derived from a type I, type II, or type III CRISPR system.
- one or more molecules of a CRISPR system are derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes.
- a CRISPR system is characterized by molecules that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system).
- target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex. Full complementarity is not necessarily required, provided there is sufficient complementarity to cause hybridization and promote formation of a CRISPR complex.
- a target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides.
- a target sequence is present in the nucleus or cytoplasm of a cell.
- the target sequence may be within an organelle of a eukaryotic cell, for example, mitochondrion or chloroplast.
- a sequence or template that may be used for recombination into the targeted locus comprising the target sequences is referred to as an“editing template,”“editing polynucleotide,” “editing sequence,”“donor sequence,” or“donor nucleic acid”.
- an exogenous template polynucleotide may be referred to as an editing template.
- the recombination is homologous recombination.
- a CRISPR complex comprising a guide sequence hybridized to a target sequence and complexed with one or more Cas proteins
- formation of a CRISPR complex results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence.
- the tracr sequence which may comprise or consist of all or a portion of a wild-type tracr sequence (e.g.
- a wild-type tracr sequence may also form part of a CRISPR complex, such as by hybridization along at least a portion of the tracr sequence to all or a portion of a tracr mate sequence that is operably linked to the guide sequence.
- the tracr sequence has sufficient complementarity to a tracr mate sequence to hybridize and participate in formation of a CRISPR complex. As with the target sequence, it is believed that complete complementarity is not needed, provided there is sufficient to be functional.
- the tracr sequence has at least 50%, 60%, 70%, 80%, 90%, 95% or 99% of sequence complementarity along the length of the tracr mate sequence when optimally aligned.
- one or more molecules of a CRISPR system are introduced into a host cell such that formation of a CRISPR complex at one or more target sites can occur.
- a Cas nuclease, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be introduced into a host cell to allow formation of a CRISPR complex at a target sequence in the host cell complementary to the guide sequence.
- Non-limiting examples of Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 and Csx12), Cas10, Cpf1, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, homologs thereof, or modified versions thereof, such as inducible, inactivated, or split Cas proteins (see for example Dominguez et al.
- pyogenes Cas9 protein may be found in the SwissProt database under accession number Q99ZW2, and the amino acid sequence of Acidaminococcus sp.
- Cpf1 protein may be found in the SwissProt database under accession number U2UMQ6.
- the unmodified CRISPR enzyme has DNA cleavage activity, such as Cas9.
- the CRISPR enzyme is Cas9, and may be Cas9 from S. pyogenes or S. pneumoniae.
- the CRISPR enzyme is Cpf1, and may be Cpf1 from Acidaminococcus or
- the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence. In some embodiments, the CRISPR enzyme is mutated with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target
- a Cas9 nickase may be used in combination with guide sequences, e.g., two guide sequences, which target respectively sense and antisense strands of the DNA target. This combination allows both strands to be nicked and used to induce NHEJ.
- two or more catalytic domains of Cas9 may be mutated to produce a mutated Cas9 substantially lacking all DNA cleavage activity.
- a D10A mutation is combined with one or more of H840A, N854A, or N863A mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity.
- a CRISPR enzyme is considered to substantially lack all DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is less than about 25%, 10%, 5%, 1%, 0.1%, 0.01%, or lower with respect to its non-mutated form.
- Other mutations may be useful; where the Cas9 or other CRISPR enzyme is from a species other than S. pyogenes, mutations in corresponding amino acids may be made to achieve similar effects.
- the Cas protein (such as Cas9) is a split Cas protein comprising an N-terminal Cas protein fragment, Cas(N), and a C-terminal Cas protein fragment, Cas(C), wherein Cas(N) is fused to a first dimerization domain and Cas(C) is fused to a second dimerization domain, and wherein the first and second dimerization domains facilitate dimerization of Cas(N) and Cas(C) to form a complex with a functional Cas nuclease activity.
- dimerization of the first and second dimerization domains is sensitive to a dimerization agent.
- the first and second dimerization domains comprise the FK506 binding protein 12 (FKBP) and FKBP rapamycin binding (FRB) domains of the mammalian target of rapamycin (mTOR), and the dimerization agent is rapamycin.
- FKBP FK506 binding protein 12
- mTOR mammalian target of rapamycin
- an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular cells, such as eukaryotic cells.
- the eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human primate.
- codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
- codon bias differs in codon usage between organisms
- mRNA messenger RNA
- tRNA transfer RNA
- Codon usage tables are readily available, for example, at the“Codon Usage Database”, and these tables can be adapted in a number of ways. See Nakamura, Y., et al.“Codon usage tabulated from the international DNA sequence databases: status for the year 2000” Nucl. Acids Res.28:292 (2000).
- Computer algorithms for codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also available.
- one or more codons in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.
- a CRISPR enzyme comprises one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs.
- NLSs nuclear localization sequences
- the CRISPR enzyme comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g. one or more NLS at the amino-terminus and one or more NLS at the carboxy terminus).
- the CRISPR enzyme comprises at most 6 NLSs.
- an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus.
- an NLS consists of one or more short sequences of positively charged lysines or arginines exposed on the protein surface, but other types of NLS are known.
- Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 83); the NLS from nucleoplasmin (e.g. the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 84)); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 85) or RQRRNELKRSP (SEQ ID NO: 86); the hRNPA1 M9 NLS having the sequence
- NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY SEQ ID NO: 87
- sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV SEQ ID NO: 88
- sequences VSRKRPRP SEQ ID NO: 89
- PPKKARED (SEQ ID NO: 90) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 91) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 92) of mouse c-ab1 IV; the sequences DRLRR (SEQ ID NO: 93) and PKQKKRK (SEQ ID NO: 94) of the influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 95) of the Hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO: 96) of the mouse Mx1 protein; the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 97) of the human poly(ADP-ribose) polymerase; and the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 98) of the steroid hormone receptors (human) glucocorticoid.
- a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence.
- the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more.
- Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies, ELAND (Illumina, San Diego, Calif.), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).
- any suitable algorithm for aligning sequences include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies, ELAND (Illumina, San Diego, Calif.), SOAP (available at soap.genomics.org.cn), and
- a guide sequence is about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence-specific binding of a CRISPR complex to a target sequence may be assessed by any suitable assay.
- the components of a CRISPR system sufficient to form a CRISPR complex may be provided to a host cell having the corresponding target sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein.
- cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions.
- Other assays are possible, and will occur to those skilled in the art.
- a guide sequence may be selected to target any target sequence.
- the target sequence is a sequence within a genome of a cell.
- Exemplary target sequences include those that are unique in the target genome.
- a guide sequence is selected to reduce the degree of secondary structure within the guide sequence. Secondary structure may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegler (Nucleic Acids Res.9 (1981), 133-148). Another example folding algorithm is the online webserver RNAfold, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g. A. R. Gruber et al., 2008, Cell 106(1): 23-24; and P A Carr and G M Church, 2009, Nature Biotechnology 27(12): 1151-62). Further algorithms may be found in U.S.
- a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence.
- degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tracr sequence, along the length of the shorter of the two sequences.
- Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence.
- the degree of complementarity between the tracr sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher.
- the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length.
- the guide sequence, tracr sequence and tracr mate sequence are contained within a single RNA (referred to herein as a“single-guide RNA,” or“sgRNA”), such that hybridization between the tracr sequence and the tracr mate sequence produces a secondary structure, such as a hairpin.
- a“single-guide RNA,” or“sgRNA” single RNA
- Preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences.
- the sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG.
- the sgRNA has at least two or more hairpins. In preferred embodiments, the sgRNA has two, three, four or five hairpins. In a further embodiment of the invention, the sgRNA has at most five hairpins.
- the sgRNA further includes a transcription termination sequence; preferably this is a polyT sequence, for example six T nucleotides.
- a donor nucleic acid is also provided.
- the donor nucleic acid is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a CRISPR enzyme as a part of a CRISPR complex.
- a donor nucleic acid may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length.
- the donor nucleic acid comprises a sequence that is complementary to a portion of a polynucleotide comprising the target sequence.
- the donor nucleic acid overlaps with one or more nucleotides of the target sequence (e.g. about or more than about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more nucleotides).
- the nearest nucleotide of the donor nucleic acid in the region of complementarity is within about 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.
- the CRISPR enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domains in addition to the CRISPR enzyme).
- a CRISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains.
- protein domains that may be fused to a CRISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase activity, demethylase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity and nucleic acid binding activity.
- epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags.
- reporter genes include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP),
- a CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4 DNA binding domain fusions, and herpes simplex virus (HSV) BP16 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US20110059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.
- ZFPs and ZFNs ZFPs and ZFNs; TALs, TALEs, and TALENs
- the genome-editing system includes a DNA-binding protein such as one or more zinc finger protein (ZFP) or transcription activator-like protein (TAL), fused to an effector protein such as an endonuclease (or nucleic acid encoding the DNA-binding protein/effector protein fusion).
- ZFP zinc finger protein
- TAL transcription activator-like protein
- an effector protein such as an endonuclease (or nucleic acid encoding the DNA-binding protein/effector protein fusion).
- ZFNs zinc finger protein
- TALENs transcription activator-like protein
- the genome-editing system comprises one or more zinc-finger proteins (ZFPs) or domains thereof that bind to DNA in a sequence-specific manner.
- ZFPs zinc-finger proteins
- a ZFP or domain thereof is a protein or domain within a larger protein that binds DNA in a sequence- specific manner through one or more zinc fingers, regions of amino acid sequence within the binding domain whose structure is stabilized through coordination of a zinc ion.
- the term zinc finger DNA binding protein is often abbreviated as zinc finger protein or ZFP.
- ZFPs are artificial ZFP domains targeting specific DNA sequences, typically 9-18 nucleotides long, generated by assembly of individual fingers.
- ZFPs include those in which a single finger domain is approximately 30 amino acids in length and contains an alpha helix containing two invariant histidine residues coordinated through zinc with two cysteines of a single beta turn, and having two, three, four, five, or six fingers.
- sequence-specificity of a ZFP may be altered by making amino acid substitutions at the four helix positions ( ⁇ 1, 2, 3 and 6) on a zinc finger recognition helix.
- the ZFP or ZFP-containing molecule is non-naturally occurring, e.g., is engineered to bind to a target site of choice. See, for example, Beerli et al.
- the genome-editing system includes a zinc-finger DNA binding domain fused to a DNA cleavage domain to form a zinc-finger nuclease (ZFN).
- fusion proteins comprise the cleavage domain (or cleavage half-domain) from at least one Type IIS restriction enzyme and one or more zinc finger binding domains, which may or may not be engineered.
- the cleavage domain is from the Type IIS restriction endonuclease Fok I. Fok I generally catalyzes double-stranded cleavage of DNA, at 9 nucleotides from its recognition site on one strand and 13 nucleotides from its recognition site on the other.
- ZFNs target a gene present in a target cell.
- the ZFNs efficiently generate a double strand break (DSB), for example at a predetermined site in the coding region of the gene.
- Typical regions targeted include exons, regions encoding N- terminal regions, first exon, second exon, and promoter or enhancer regions.
- transient expression of the ZFNs promotes highly efficient and permanent disruption of the target gene in target cells.
- delivery of the ZFNs results in the permanent disruption of the gene with efficiencies surpassing 50%.
- the genome-editing system includes a naturally occurring or engineered (non-naturally occurring) transcription activator-like protein (TAL) DNA binding domain, such as in a transcription activator-like protein effector (TALE) protein, See, e.g., U.S. Patent Publication No.20110301073, incorporated by reference in its entirety herein.
- TAL transcription activator-like protein
- TALE transcription activator-like protein effector
- a TALE DNA binding domain or TALE is a polypeptide comprising one or more TALE repeat domains/units.
- the repeat domains are involved in binding of the TALE to its cognate target DNA sequence.
- a single“repeat unit” (also referred to as a“repeat”) is typically 33-35 amino acids in length and exhibits at least some sequence homology with other TALE repeat sequences within a naturally occurring TALE protein.
- Each TALE repeat unit includes 1 or 2 DNA-binding residues making up the Repeat Variable Diresidue (RVD), typically at positions 12 and/or 13 of the repeat.
- RVD Repeat Variable Diresidue
- TALEs The natural (canonical) code for DNA recognition of these TALEs has been determined such that an HD sequence at positions 12 and 13 leads to a binding to cytosine (C), NG binds to T, NI to A, NN binds to G or A, and NG binds to T and non- canonical (atypical) RVDs are also known. See, U.S. Patent Publication No.20110301073.
- TALEs may be targeted to any gene by design of TAL arrays with specificity to the target DNA sequence.
- the target sequence generally begins with a thymidine.
- the genome-editing system includes a DNA binding endonuclease, such as a TALE-nuclease (TALEN).
- TALEN is a fusion protein comprising a DNA-binding domain derived from a TALE and a nuclease catalytic domain to cleave a nucleic acid target sequence.
- the TALE DNA-binding domain has been engineered to bind a target sequence within a target gene.
- the TALEN recognizes and cleaves the target sequence in the gene.
- cleavage of the DNA results in double-stranded breaks.
- the breaks stimulate the rate of homologous recombination or non-homologous end joining (NHEJ).
- NHEJ non-homologous end joining
- repair mechanisms involve rejoining of what remains of the two DNA ends through direct re-ligation (Critchlow and Jackson, Trends Biochem Sci.1998 Oct;23(10):394-8) or via the so-called microhomology-mediated end joining.
- repair via NHEJ results in small insertions or deletions and can be used to disrupt and thereby repress the gene.
- the modification may be a substitution, deletion, or addition of at least one nucleotide.
- cells in which a cleavage-induced mutagenesis event, i.e. a mutagenesis event consecutive to an NHEJ event, has occurred can be identified and/or selected by well-known methods in the art.
- TALE repeats are assembled to specifically target a gene.
- a library of TALENs targeting 18,740 human protein-coding genes has been constructed (Kim et al., Nature Biotechnology.31, 251– 258 (2013)).
- Custom-designed TALE arrays are commercially available through Cellectis Bioresearch (Paris, France), Transposagen Biopharmaceuticals (Lexington, KY, USA), and Life Technologies (Grand Island, NY, USA).
- the TALENs are introduced as transgenes encoded by one or more plasmid vectors.
- the plasmid vector can contain a selection marker which provides for identification and/or selection of cells which received said vector.
- the genome-editing system includes a homing nuclease (or nucleic acid encoding the homing nuclease, such as an mRNA or a DNA plasmid).
- Homing endonucleases are a collection of endonucleases encoded either as
- Homing endonucleases act as monomers or homodimers, yet often require associated proteins to regulate their activity, or form ribonucleoprotein complexes, wherein RNA is an integral component of the catalytic apparatus.
- RNA is an integral component of the catalytic apparatus.
- structural families Their conserved structural motifs are: LAGLIDADG, GIY-YIG, His-Cys box, H-N-H, PD- (D/E)xK, and Vsr-like.
- the homing endonuclease is a synthetic enzyme (such as a fully synthetic enzyme) modified to target a specific DNA sequence.
- the homing endonuclease is an ARC nucleaseTM (Precision BioSciences).
- the genome-editing system includes an integrase (or nucleic acid encoding the integrase). In some embodiments, the genome-editing system further includes a donor nucleic acid comprising a first recombination site recognized by the integrase. In some embodiments, a polynucleotide targeted for modification by the genome-editing system comprises a second recombination site recognized by the integrase, such that the integrase is capable of mediating recombination between the first recombination site and the second recombination site.
- bacteriophage and integrative plasmids encode site-specific recombination systems that enable the stable incorporation of their genome into those of their hosts.
- the minimal requirements for the recombination reaction are a recombinase enzyme, or integrase, which catalyzes the recombination event, and two recombination sites (Sadowski (1986) J. Bacteriol.165: 341-347; Sadowski (1993) FASEB J.7: 760-767).
- attachment (att) sites with an attP element from phage DNA and the attB element encoded by the bacterial genome.
- the two attachment sites can share as little sequence identity as a few base pairs.
- the recombinase protein binds to both att sites and catalyzes a conservative and reciprocal exchange of DNA strands that result in integration of the circular phage or plasmid DNA into host DNA. Additional phage or host factors, such as the DNA binding protein IHF (integration host factor), may be required for an efficient reaction (Friedman (1988) Cell 55:545-554; Finkel & Johnson (1992) Mol. Microbiol. 6: 3257-3265).
- the reverse excision reaction sometimes requires an additional phage factor, such as the xis gene product of phage ⁇ (Weisberg & Landy (1983) "Site-specific recombination in phage lambda.” In Lambda II, eds. Hendrix et al (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY) pp.211-250; Landy (1989) Ann. Rev. Biochem.58: 913-949).
- phage factor such as the xis gene product of phage ⁇ (Weisberg & Landy (1983) "Site-specific recombination in phage lambda.” In Lambda II, eds. Hendrix et al (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY) pp.211-250; Landy (1989) Ann. Rev. Biochem.58: 913-949).
- the recombinases have been categorized into two groups, the ⁇ integrase (Argos et al. (1986) EMBOJ.5: 433-44; Voziyanov et al. (1999) Nucl. Acids Res.27: 930- 941) and the resolvase/invertase (Hatfull & Grindley (1988) "Resolvases and DNA- invertases: a family of enzymes active in site-specific recombination" In Genetic Recombination, eds. Kucherhpati, R., & Smith, G. R. (Am. Soc. Microbiol., Washington DC), pp.357-396) families.
- the temperate Streptomyces phage ⁇ C31 encodes a 68 kD recombinase of the latter class.
- the ⁇ C31 integration reaction is simple in that it does not require a host factor and appears irreversible, most likely because an additional phage protein is required for excision.
- the phage and bacterial att sites share only three base pairs of homology at the point of cross-over. This homology is flanked by inverted repeats, presumably binding sites for the integrase protein.
- the minimal known functional size for both attB and attP is ⁇ 50 bp.
- the Cre-lox system of bacteriophage PI, and the FLP-FRT system of Saccharomyces cerevisiae have been widely used for transgene and chromosome engineering in animals and plants (reviewed by Sauer (1994) Curr. Opin. Biotechnol.5: 521- 527; Ow (1996) Curr. Opin. Biotechnol.7: 181-186).
- Other systems that operate in animal or plant cells include the following: 1) the R-RS system from Zygosaccharomyces rouxii (Onouchi et al (1995) Mol Gen.
- the integrase is a prokaryotic recombinase, such as a bacteriophage integrase.
- the integrase is unidirectional, in that it can catalyze recombination between two complementary recombination sites, but cannot catalyze recombination between the hybrid sites that are formed by this recombination.
- the integrase is the ⁇ C31 integrase.
- the ⁇ C31 integrase by itself, catalyzes only the attB x attP reaction, and cannot mediate recombination between the attL and attR sites that are formed upon recombination between attB and attP. Because recombinases such as the ⁇ C31 integrase cannot alone catalyze the reverse reaction, the attB x attP recombination formed by such recombinases is stable.
- the methods involve contacting a pair of recombination sites (e.g., attB and attP) that are present in a eukaryotic cell with a corresponding recombinase.
- the recombinase then mediates recombination between the recombination sites.
- any one of a number of events can occur as a result of the recombination. For example, if the two recombination sites are present on different nucleic acid molecules, the recombination can result in integration of one nucleic acid molecule into a second molecule.
- the two recombination sites can also be present on the same nucleic acid molecule. In such cases, the resulting product typically depends upon the relative orientation of the sites.
- recombination between sites that are in the direct orientation will generally result in excision of any DNA that lies between the two recombination sites.
- recombination between sites that are in the reverse orientation can result in inversion of the intervening DNA.
- the resulting rearranged nucleic acid is stable in that the recombination is irreversible in the absence of an additional factor, generally encoded by the particular bacteriophage from which the recombinase is derived, that is not normally found in eukaryotic cells.
- One example of an application for which this method is useful involves the placement of a promoter between the two
- the promoter is initially in the opposite orientation relative to a coding sequence that is to be expressed by the promoter and the recombination sites that flank the promoter are in the inverted orientation, contacting the recombination sites will result in inversion of the promoter, thus placing the promoter in the correct orientation to drive expression of the coding sequence.
- contacting the recombination sites with the promoter can result in excision of the promoter fragment, thus stopping expression of the coding sequence.
- the genome-editing system includes a nucleic acid.
- the nucleic acid encodes a genome-editing enzyme, such as a nuclease or integrase.
- the nucleic acid is a guide RNA or guide DNA (or a nucleic acid encoding a guide RNA or guide DNA, such as an mRNA or a DNA plasmid).
- the nucleic acid is a donor nucleic acid, such as for introduction of a modification to a target polynucleotide by homologous recombination or insertion of an exogenous nucleic acid into a target polynucleotide by site-directed recombination.
- the nucleic acid is RNA, such as an mRNA.
- the nucleic acid is DNA, such as a DNA plasmid.
- the nucleic acid of a genome-editing system comprises at least one modification, such as modifications that affect stability, subcellular targeting, protein binding affinity, complementary target sequence binding affinity, resistance to cellular degradation, and/or cellular permeability.
- the at least one modification includes a label.
- modifications and methods for their introduction to nucleic acids are well known in the art and are contemplated for use with any of the nucleic acids described herein. See for example WO2011015347, WO2015026885, WO2015026887, WO2015026883, and WO2015026886.
- the genome-editing system comprises a nucleic acid comprising at least one modification selected from the group consisting of a 5' cap, a 3' polyadenylated tail, a riboswitch sequence, a stability control sequence, a sequence that forms a dsRNA duplex, a modification or sequence that targets the guide poly nucleotide to a subcellular location, a modification or sequence that provides for tracking, a modification or sequence that provides a binding site for proteins, a Locked Nucleic Acid (LNA), a 5-methyl dC nucleotide, a 2,6-Diaminopurine nucleotide, a 2'-Fluoro A nucleotide, a 2'-Fluoro U nucleotide; a 2'-O- Methyl RNA nucleotide, a phosphorothioate bond, linkage to a cholesterol molecule, linkage to a polyethylene glycol molecule
- compositions comprising a genome-editing complex or nanoparticle as described herein.
- the composition is a pharmaceutical composition comprising a genome-editing complex or nanoparticle as described herein and a pharmaceutically acceptable diluent, excipient and/or carrier.
- the concentration of the complex or nanoparticle in the composition is from about 1 nM to about 100 mM, including for example from about 10 nM to about 50 mM, from about 25 nM to about 25 mM, from about 50 nM to about 10 mM, from about 100 nM to about 1 mM, from about 500 nM to about 750 ⁇ M, from about 750 nM to about 500 ⁇ M, from about 1 ⁇ M to about 250 ⁇ M, from about 10 ⁇ M to about 200 ⁇ M, and from about 50 ⁇ M to about 150 ⁇ M.
- a pharmaceutically acceptable diluent, excipient, and/or carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with administration to humans or other vertebrate hosts.
- a pharmaceutically acceptable diluent, excipient, and/or carrier is a diluent, excipient, and/or carrier approved by a regulatory agency of a Federal, a state government, or other regulatory agency, or listed in the U.S.
- diluent, excipient, and/or“carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the pharmaceutical composition is administered.
- Such pharmaceutical diluent, excipient, and/or carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin. Water, saline solutions and aqueous dextrose and glycerol solutions can be employed as liquid diluents, excipients, and/or carriers, particularly for injectable solutions.
- Suitable pharmaceutical diluents and/or excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like, including lyophilization aids.
- the composition if desired, can also contain minor amounts of wetting, bulking, emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, sustained release formulations and the like.
- Suitable pharmaceutical diluent, excipient, and/or carriers are described in“Remington's Pharmaceutical Sciences” by E. W. Martin.
- the formulation should suit the mode of administration.
- the appropriate diluent, excipient, and/or carrier will be evident to those skilled in the art and will depend in large part upon the route of administration.
- a pharmaceutical composition as described herein is formulated for intravenous, intratumoral, intraarterial, topical, intraocular, ophthalmic, intraportal, intracranial, intracerebral, intracerebroventricular, intrathecal, intravesicular, intradermal, subcutaneous, intramuscular, intranasal, intratracheal, pulmonary, intracavity, or oral administration.
- dosages of the pharmaceutical compositions of the present invention found to be suitable for treatment of human or mammalian subjects are in the range of about 0.001 mg/kg to about 100 mg/kg (such as about any of 0.001, 0.01, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, and 100 mg/kg, including any ranges between these values) of the genome-editing complexes or nanoparticles.
- dosage ranges are about 0.1 mg/kg to about 20 mg/kg (such as about any of 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20 mg/kg, including any ranges between these values). In some embodiments, dosage ranges are about 0.5 mg/kg to about 10 mg/kg.
- Exemplary dosing frequencies include, but are not limited to, weekly without break; weekly, three out of four weeks; once every three weeks; once every two weeks; weekly, two out of three weeks.
- the pharmaceutical composition is administered about once every 2 weeks, once every 3 weeks, once every 4 weeks, once every 6 weeks, or once every 8 weeks.
- the pharmaceutical composition is administered at least about any of 1 ⁇ , 2 ⁇ , 3 ⁇ , 4 ⁇ , 5 ⁇ , 6 ⁇ , or 7 ⁇ (i.e., daily) a week.
- the intervals between each administration are less than about any of 6 months, 3 months, 1 month, 20 days, 15, days, 12 days, 10 days, 9 days, 8 days, 7 days, 6 days, 5 days, 4 days, 3 days, 2 days, or 1 day. In some embodiments, the intervals between each administration are more than about any of 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 8 months, or 12 months. In some embodiments, there is no break in the dosing schedule. In some embodiments, the interval between each administration is no more than about a week. In some embodiments, the schedule of administration of the pharmaceutical composition to an individual ranges from a single administration that constitutes the entire treatment to daily administration.
- the administration of the pharmaceutical composition can be extended over an extended period of time, such as from about a month up to about seven years.
- the pharmaceutical composition is administered over a period of at least about any of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 18, 24, 30, 36, 48, 60, 72, or 84 months.
- a pharmaceutical composition comprising a genome-editing complex or nanoparticle as described herein and a pharmaceutically acceptable carrier, wherein the pharmaceutically acceptable carrier is a sugar or a protein.
- the sugar is selected from the group consisting of sucrose, glucose, mannitol, and a combination thereof, and is present in the pharmaceutical composition at a concentration from about 5% to about 20%.
- the sugar is sucrose.
- the sugar is glucose.
- the sugar is mannitol.
- the protein is albumin.
- the albumin is human serum albumin.
- the pharmaceutical composition is lyophilized.
- a pharmaceutical composition as described herein further comprises an expression complex comprising a cell-penetrating peptide (such as any of the cell- penetrating peptides described herein) and a nucleic acid molecule encoding an exogenous construct.
- the exogenous construct is an exogenous protein or nucleic acid.
- the molar ratio of cell-penetrating peptide to nucleic acid molecule in the expression complex is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of cell-penetrating peptide to nucleic acid molecule in the expression complex is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the cell-penetrating peptide includes, without limitation, CADY, PEP-1, MPG, VEPEP-3, VEPEP-4, VEPEP,-5, VEPEP-6, VEPEP-9, and ADGN-100.
- the cell-penetrating peptide in the expression complex comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-70 and 75-80. In some embodiments, the cell-penetrating peptide is the same as a cell-penetrating peptide in a genome-editing complex in the pharmaceutical composition. In some embodiments, the cell-penetrating peptide is not the same as a cell-penetrating peptide in a genome-editing complex in the pharmaceutical composition.
- the exogenous protein is a therapeutic protein. In some embodiments, the exogenous protein is or comprises an antibody or antigen-binding fragment thereof.
- the exogenous protein is a recombinant receptor, such as a recombinant receptor capable of being expressed on the surface of a cell.
- the recombinant receptor comprises a ligand-binding domain, wherein upon ligand binding, the receptor is capable of transducing a signal through a signaling domain.
- the recombinant receptor comprises the signaling domain.
- the recombinant receptor is capable of associating with an endogenous protein comprising the signaling domain.
- the ligand-binding domain is or comprises an antibody or antigen-binding fragment thereof.
- the recombinant receptor is an antigen receptor, such as a chimeric antigen receptor (CAR).
- composition such as a
- composition comprising a genome-editing complex or nanoparticle as described herein and an expression complex as described herein.
- a genome-editing complex or nanoparticle as described herein
- an expression complex as described herein.
- compositions for example pharmaceutical compositions, can be used to simultaneously effect gene editing and gene expression in a cell.
- antigen receptors including CARs, and methods for engineering such receptors, include those described, for example, in international patent application publication numbers WO200014257, WO2013126726, WO2012/129514, WO2014031687,
- the antigen receptors include a CAR as described in U.S. Patent No.: 7,446,190, and those described in International Patent Application Publication No.: WO/2014055668 A1.
- Examples of the CARs include CARs as disclosed in any of the aforementioned publications, such as WO2014031687, US 8,339,645, US 7,446,179, US 2013/0149337, U.S.
- Patent No.: 7,446,190 US Patent No.: 8,389,282, Kochenderfer et al., 2013, Nature Reviews Clinical Oncology, 10, 267-276 (2013); Wang et al. (2012) J. Immunother.35(9): 689-701; and Brentjens et al., Sci Transl Med.2013 5(177). See also WO2014031687, US 8,339,645, US 7,446,179, US 2013/0149337, U.S. Patent No.: 7,446,190, and US Patent No.: 8,389,282.
- the ligand-binding domain specifically binds to a ligand associated with a disease or condition. In some embodiments, the ligand-binding domain specifically binds to a cancer associated antigen or a pathogen-specific antigen. In some embodiments, the ligand- binding domain is specific for viral antigens (such as HIV, HCV, HBV, etc.), bacterial antigens, and/or parasitic antigens.
- viral antigens such as HIV, HCV, HBV, etc.
- the ligand-binding domain specifically binds to a ligand including, without limitation, a orphan tyrosine kinase receptor RORl, tEGFR, Her2, Ll- CAM, CD19, CD20, CD22, mesothelin, CEA, and hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, 0EPHa2, ErbB2, 3, or 4, FBP, fetal acethycholine e receptor, GD2, GD3, HMW-MAA, IL-22R-alpha, IL-13R- alpha2, kdr, kappa light chain, Lewis Y, L1-cell adhesion molecule, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D Ligands, NY-ESO-1, MART-1, gp100,
- a method of preparing a genome-editing complex or nanoparticle as described herein comprising combining a CPP with one or more molecules of a genome-editing system, thereby forming the genome-editing complex or nanoparticle.
- the genome-editing system comprises a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing system further comprises a gRNA or gDNA (or a nucleic acid encoding the gRNA or gDNA). In some embodiments, the genome-editing system further comprises a donor nucleic acid for introducing a specific modification to the target
- the genome-editing nuclease is a TALEN.
- the genome-editing system is a CRISPR system (e.g., CRISPR/Cas9).
- some of the one or more genome-editing system molecules are in a pre-formed complex prior to combination with the CPP.
- the genome-editing system comprises an integrase (or a nucleic acid encoding the integrase).
- the genome-editing system further comprises a donor nucleic acid comprising a recombination site recognized by the integrase.
- a method of preparing a genome- editing complex or nanoparticle as described herein comprising a) combining a CPP with an RGEN (or a nucleic acid encoding the RGEN) and a gRNA (or a nucleic acid encoding the gRNA); or b) combining a CPP with a pre-formed RGEN/gRNA complex, thereby forming the genome-editing complex or nanoparticle.
- a method of preparing a genome-editing complex or nanoparticle as described herein comprising a) combining a first composition comprising one or more molecules of a genome-editing system (such as a genome- editing enzyme, or a nucleic acid encoding the genome-editing enzyme) with a second composition comprising a cell-penetrating peptide in an aqueous medium to form a mixture; and b) incubating the mixture to form a complex comprising the cell-penetrating peptide associated with the one or more genome-editing system molecules, thereby generating the genome-editing complex or nanoparticle.
- a genome-editing system such as a genome- editing enzyme, or a nucleic acid encoding the genome-editing enzyme
- the genome-editing system comprises a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing system further comprises a gRNA or gDNA (or a nucleic acid encoding the gRNA or gDNA).
- the genome-editing system further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the genome-editing nuclease is a TALEN.
- the genome-editing system is a CRISPR system (e.g., CRISPR/Cas9). In some embodiments, some of the one or more genome-editing system molecules are in a pre-formed complex prior to combination with the CPP. In some embodiments, the genome-editing system comprises an integrase (or a nucleic acid encoding the integrase). In some embodiments, the genome-editing system further comprises a donor nucleic acid comprising a recombination site recognized by the integrase. In some embodiments, the aqueous medium is a buffer, including for example PBS, Tris, or any buffer known in the art for stabilizing nucleoprotein complexes.
- a buffer including for example PBS, Tris, or any buffer known in the art for stabilizing nucleoprotein complexes.
- the first composition comprising the one or more genome-editing system molecules is a solution comprising at least one of the one or more genome-editing system molecules (such as a genome-editing nuclease, a gRNA or gDNA, and/or a donor nucleic acid) at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the one or more genome-editing system molecules such as a genome-editing nuclease, a gRNA or gDNA,
- the first composition comprising the one or more genome-editing system molecules is a solid comprising the one or more genome-editing system molecules in lyophilized form and a suitable carrier.
- the second composition comprising the cell-penetrating peptide is a solution comprising the cell-penetrating peptide at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the second composition comprising the cell-penetrating peptide is a solid comprising the cell-penetrating peptide in lyophilized form and a suitable carrier.
- the solutions are formulated in water.
- the water is distilled water.
- the solutions are formulated in a buffer.
- the buffer is any buffer known in the art used for storing a nucleic acid or polypeptide.
- the molar ratio of a genome-editing nuclease to a gRNA or gDNA in the first composition is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of a genome-editing nuclease to a gRNA or gDNA in the first composition is about 1:1.
- the molar ratio of the cell-penetrating peptide to a genome-editing nuclease or complex comprising the genome-editing nuclease in the mixture is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of the cell-penetrating peptide a genome-editing nuclease or complex comprising the genome-editing nuclease in the mixture is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the mixture is incubated to form a complex or nanoparticle comprising the cell-penetrating peptide associated with the one or more genome-editing system molecules for from about 10 min to 60 min, including for example for about any of 20 min, 30 min, 40min, and 50 min, at a temperature from about 2°C to about 50°C, including for example from about 2°C to about 5°C, from about 5°C to about 10°C, from about 10°C to about 15°C, from about 15°C to about 20°C, from about 20°C to about 25°C, from about 25°C to about 30°C, from about 30°C to about 35°C, from about 35°C to about 40°C, from about 40°C to about 45°C, and from about 45°C to about 50°C, thereby resulting in a solution comprising the genome-editing complex or nanoparticle.
- the solution comprising the genome-editing complex or nanoparticle remains stable for at least about three weeks, including for example for at least about any of 6 weeks, 2 months, 3 months, 4 months, 5 months, and 6 months at 4°C.
- the solution comprising the genome-editing complex or nanoparticle is lyophilized in the presence of a carrier.
- the carrier is a sugar, including for example, sucrose, glucose, mannitol and combinations thereof, and is present in the solution comprising the genome-editing complex or nanoparticle at from about 5% to about 20%, including for example from about 7.5% to about 17.5%, from about 10% to about 15%, and about 12.5%, weight per volume.
- the carrier is a protein, including for example albumin, such as human serum albumin.
- the cell- penetrating peptide is a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide as described herein.
- the cell-penetrating peptide comprises the amino acid sequence of any one of SEQ ID NOs: 75-80.
- a method of preparing a genome-editing complex or nanoparticle as described herein comprising a) combining a composition comprising an RGEN with a composition comprising a gRNA in an aqueous medium to form a first mixture; b) incubating the first mixture to form an RGEN/gRNA complex comprising the RGEN and the gRNA; c) combining a composition comprising the RGEN/gRNA complex, such as the mixture of b), with a composition comprising a cell-penetrating peptide in an aqueous medium to form a second mixture; d) incubating the second mixture to form a complex comprising the cell- penetrating peptide associated with the RGEN/gRNA complex, thereby generating the genome- editing complex or nanoparticle.
- step c) of the method comprises combining the composition comprising the RGEN/gRNA complex with the composition comprising the cell-penetrating peptide and a composition comprising a donor nucleic acid in an aqueous medium to form the second mixture.
- the composition comprising the RGEN/gRNA complex and the composition comprising the donor nucleic acid are a single composition.
- the aqueous medium is a buffer, including for example PBS, Tris, or any buffer known in the art for stabilizing nucleoprotein complexes.
- the composition comprising the RGEN is a solution comprising the RGEN at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the RGEN is a solid comprising the RGEN in lyophilized form and a suitable carrier.
- the composition comprising the gRNA is a solution comprising the gRNA at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the gRNA is a solid comprising the gRNA in lyophilized form and a suitable carrier.
- the composition comprising the cell-penetrating peptide is a solution comprising the cell-penetrating peptide at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the cell-penetrating peptide is a solid comprising the cell-penetrating peptide in lyophilized form and a suitable carrier.
- the composition comprising the donor nucleic acid is a solution comprising the donor nucleic acid at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the donor nucleic acid is a solid comprising the donor nucleic acid in lyophilized form and a suitable carrier.
- the solutions are formulated in water.
- the water is distilled water.
- the solutions are formulated in a buffer.
- the buffer is any buffer known in the art used for storing a nucleic acid or polypeptide.
- the molar ratio of the RGEN to the gRNA in the first mixture is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of the RGEN to the gRNA in the first mixture is about 1:1.
- the molar ratio of the cell-penetrating peptide to the RGEN/gRNA complex in the second mixture is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of the cell-penetrating peptide to the RGEN/gRNA complex in the second mixture is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the first mixture is incubated to form the RGEN/gRNA complex for from about 10 min to 60 min, including for example for about any of 20 min, 30 min, 40min, and 50 min, at a temperature from about 2°C to about 50°C, including for example from about 2°C to about 5°C, from about 5°C to about 10°C, from about 10°C to about 15°C, from about 15°C to about 20°C, from about 20°C to about 25°C, from about 25°C to about 30°C, from about 30°C to about 35°C, from about 35°C to about 40°C, from about 40°C to about 45°C, and from about 45°C to about 50°C, thereby resulting in a solution comprising the RGEN/gRNA complex.
- the second mixture is incubated to form the complex comprising the cell-penetrating peptide associated with the RGEN/gRNA complex for from about 10 min to 60 min, including for example for about any of 20 min, 30 min, 40min, and 50 min, at a temperature from about 2°C to about 50°C, including for example from about 2°C to about 5°C, from about 5°C to about 10°C, from about 10°C to about 15°C, from about 15°C to about 20°C, from about 20°C to about 25°C, from about 25°C to about 30°C, from about 30°C to about 35°C, from about 35°C to about 40°C, from about 40°C to about 45°C, and from about 45°C to about 50°C, thereby resulting in a solution comprising the genome-editing complex or nanoparticle.
- the solution comprising the genome-editing complex or nanoparticle remains stable for at least about three weeks, including for example for at least about any of 6 weeks, 2 months, 3 months, 4 months, 5 months, and 6 months at 4°C.
- the solution comprising the genome-editing complex or nanoparticle is lyophilized in the presence of a carrier.
- the carrier is a sugar, including for example, sucrose, glucose, mannitol and combinations thereof, and is present in the solution comprising the genome-editing complex or nanoparticle at from about 5% to about 20%, including for example from about 7.5% to about 17.5%, from about 10% to about 15%, and about 12.5%, weight per volume.
- the carrier is a protein, including for example albumin, such as human serum albumin.
- the cell-penetrating peptide is a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide as described herein.
- the cell-penetrating peptide comprises the amino acid sequence of any one of SEQ ID NOs: 75-80.
- a method of preparing a genome-editing complex or nanoparticle as described herein comprising a) combining a composition comprising a cell-penetrating peptide, a composition comprising an RGEN (or a nucleic acid encoding the RGEN), and a composition comprising a gRNA (or a nucleic acid encoding the gRNA) in an aqueous medium to form a mixture; b) incubating the mixture to form a complex comprising the cell-penetrating peptide associated with the RGEN and the gRNA, thereby generating the genome-editing complex or nanoparticle.
- step a) of the method comprises combining the composition comprising the cell-penetrating peptide, the composition comprising the RGEN, the composition comprising the gRNA, and a composition comprising a donor nucleic acid in an aqueous medium to form the mixture.
- at least two of the composition comprising the RGEN, the composition comprising the gRNA, and the composition comprising the donor nucleic acid are a single composition (e.g., a single composition comprises the gRNA and the donor nucleic acid).
- the aqueous medium is a buffer, including for example PBS, Tris, or any buffer known in the art for stabilizing nucleoprotein complexes.
- the composition comprising the RGEN is a solution comprising the RGEN at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the RGEN is a solid comprising the RGEN in lyophilized form and a suitable carrier.
- the composition comprising the gRNA is a solution comprising the gRNA at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the gRNA is a solid comprising the gRNA in lyophilized form and a suitable carrier.
- the composition comprising the cell-penetrating peptide is a solution comprising the cell-penetrating peptide at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the cell-penetrating peptide is a solid comprising the cell- penetrating peptide in lyophilized form and a suitable carrier.
- the composition comprising the donor nucleic acid is a solution comprising the donor nucleic acid at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the donor nucleic acid is a solid comprising the donor nucleic acid in lyophilized form and a suitable carrier.
- the solutions are formulated in water.
- the water is distilled water.
- the solutions are formulated in a buffer.
- the buffer is any buffer known in the art used for storing a nucleic acid or polypeptide.
- the molar ratio of the RGEN to the gRNA in the mixture is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios). In some embodiments, the molar ratio of the RGEN to the gRNA in the mixture is about 1:1.
- the molar ratio of the cell-penetrating peptide to the RGEN in the mixture is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios). In some embodiments, the molar ratio of the cell-penetrating peptide to the RGEN in the mixture is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the mixture is incubated to form the complex comprising the cell-penetrating peptide associated with the RGEN and the gRNA for from about 10 min to 60 min, including for example for about any of 20 min, 30 min, 40min, and 50 min, at a temperature from about 2°C to about 50°C, including for example from about 2°C to about 5°C, from about 5°C to about 10°C, from about 10°C to about 15°C, from about 15°C to about 20°C, from about 20°C to about 25°C, from about 25°C to about 30°C, from about 30°C to about 35°C, from about 35°C to about 40°C, from about 40°C to about 45°C, and from about 45°C to about 50°C, thereby resulting in a solution comprising the genome-editing complex or nanoparticle.
- the solution comprising the genome-editing complex or nanoparticle remains stable for at least about three weeks, including for example for at least about any of 6 weeks, 2 months, 3 months, 4 months, 5 months, and 6 months at 4°C.
- the solution comprising the genome-editing complex or nanoparticle is lyophilized in the presence of a carrier.
- the carrier is a sugar, including for example, sucrose, glucose, mannitol and combinations thereof, and is present in the solution comprising the genome-editing complex or nanoparticle at from about 5% to about 20%, including for example from about 7.5% to about 17.5%, from about 10% to about 15%, and about 12.5%, weight per volume.
- the carrier is a protein, including for example albumin, such as human serum albumin.
- the cell-penetrating peptide is a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide as described herein.
- the cell-penetrating peptide comprises the amino acid sequence of any one of SEQ ID NOs: 75-80.
- a method of preparing a nanoparticle comprising a core and at least one additional layer as described herein comprising a) combining a composition comprising an RGEN with a composition comprising a gRNA in an aqueous medium to form a first mixture; b) incubating the first mixture to form an RGEN/gRNA complex comprising the RGEN and the gRNA; c) combining a composition comprising the RGEN/gRNA complex, such as the mixture of b), with a composition comprising a first cell-penetrating peptide in an aqueous medium to form a second mixture; d) incubating the second mixture to form a core of the nanoparticle comprising the first cell-penetrating peptide associated with the RGEN/gRNA complex; e) combining a composition comprising the core of the nanoparticle, such as the mixture of d), with a composition comprising a second cell-penetrating peptide in an
- the method further comprises g) combining a composition comprising the nanoparticle comprising a core and at least one additional layer and a composition comprising a third cell-penetrating peptide in an aqueous medium to form a fourth mixture, and h) incubating the fourth mixture to form a nanoparticle comprising a core and at least two additional layers.
- the method can be adapted to form a nanoparticle comprising increasing numbers of layers.
- at least one of the steps of combining e.g. step a), c), e), or g) further comprises combination with a composition comprising a donor nucleic acid.
- the aqueous medium is a buffer, including for example PBS, Tris, or any buffer known in the art for stabilizing nucleoprotein complexes.
- the aqueous medium is a buffer, including for example PBS, Tris, or any buffer known in the art for stabilizing nucleoprotein complexes.
- the aqueous medium is a buffer, including for
- composition comprising the RGEN is a solution comprising the RGEN at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the RGEN is a solid comprising the RGEN in lyophilized form and a suitable carrier.
- the composition comprising the gRNA is a solution comprising the gRNA at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the gRNA is a solid comprising the gRNA in lyophilized form and a suitable carrier.
- the compositions comprising the first, second, and/or third cell-penetrating peptides are each a solution comprising the cell-penetrating peptide at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the compositions comprising the first, second, and/or third cell-penetrating peptides are each a solid comprising the cell-penetrating peptide in lyophilized form and a suitable carrier.
- the composition comprising the donor nucleic acid is a solution comprising the donor nucleic acid at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the donor nucleic acid is a solid comprising the donor nucleic acid in lyophilized form and a suitable carrier.
- the solutions are formulated in water.
- the water is distilled water.
- the solutions are formulated in a buffer.
- the buffer is any buffer known in the art used for storing a nucleic acid or polypeptide.
- the molar ratio of the RGEN to the gRNA in the first mixture is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios).
- the molar ratio of the RGEN to the gRNA in the first mixture is about 1:1.
- the molar ratio of the first cell-penetrating peptide to the RGEN/gRNA complex in the second mixture is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios).
- the molar ratio of the first cell-penetrating peptide to the RGEN/gRNA complex in the second mixture is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the first, second, third, and/or fourth mixtures are each incubated for from about 10 min to 60 min, including for example for about any of 20 min, 30 min, 40min, and 50 min, at a temperature from about 2°C to about 50°C, including for example from about 2°C to about 5°C, from about 5°C to about 10°C, from about 10°C to about 15°C, from about 15°C to about 20°C, from about 20°C to about 25°C, from about 25°C to about 30°C, from about 30°C to about 35°C, from about 35°C to about 40°C, from about 40°C to about 45°C, and from about 45°C to about 50°C.
- the solution comprising the nanoparticle remains stable for at least about three weeks, including for example for at least about any of 6 weeks, 2 months, 3 months, 4 months, 5 months, and 6 months at 4°C.
- the solution comprising the nanoparticle is lyophilized in the presence of a carrier.
- the carrier is a sugar, including for example, sucrose, glucose, mannitol and combinations thereof, and is present in the solution comprising the genome-editing complex or nanoparticle at from about 5% to about 20%, including for example from about 7.5% to about 17.5%, from about 10% to about 15%, and about 12.5%, weight per volume.
- the carrier is a protein, including for example albumin, such as human serum albumin.
- the first, second, and/or third cell-penetrating peptides are each a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide as described herein.
- the first, second, and/or third cell-penetrating peptides each comprises the amino acid sequence of SEQ ID NO: 75, 76, 77, 78, 79, or 80.
- a method of preparing a nanoparticle comprising a core and at least one additional layer as described herein comprising a) combining a composition comprising a first cell-penetrating peptide, a composition comprising an RGEN (or a nucleic acid encoding the RGEN), and a composition comprising a gRNA in an aqueous medium to form a first mixture; b) incubating the first mixture to form a core of the nanoparticle comprising the first cell-penetrating peptide associated with the RGEN and the gRNA; c) combining a composition comprising the core of the nanoparticle, such as the mixture of b), with a composition comprising a second cell-penetrating peptide in an aqueous medium to form a second mixture, and d) incubating the second mixture to form a nanoparticle comprising a core and at least one additional layer.
- the method further comprises e) combining a composition comprising the nanoparticle comprising a core and at least one additional layer and a composition comprising a third cell-penetrating peptide in an aqueous medium to form a third mixture, and f) incubating the third mixture to form a nanoparticle comprising a core and at least two additional layers. It is to be appreciated that the method can be adapted to form a nanoparticle comprising increasing numbers of layers. In some
- At least one of the steps of combining further comprises combination with a composition comprising a donor nucleic acid.
- the aqueous medium is a buffer, including for example PBS, Tris, or any buffer known in the art for stabilizing nucleoprotein complexes.
- the composition comprising the RGEN is a solution comprising the RGEN at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the RGEN is a solid comprising the RGEN in lyophilized form and a suitable carrier.
- the composition comprising the gRNA is a solution comprising the gRNA at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the gRNA is a solid comprising the gRNA in lyophilized form and a suitable carrier.
- the compositions comprising the first, second, and/or third cell- penetrating peptides are each a solution comprising the cell-penetrating peptide at a
- concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the compositions comprising the first, second, and/or third cell-penetrating peptides are each a solid comprising the cell-penetrating peptide in lyophilized form and a suitable carrier.
- the composition comprising the donor nucleic acid is a solution comprising the donor nucleic acid at a concentration from about 1 nM to about 200 ⁇ M (such as about any of 2 nM, 5 nM, 10 nM, 25 nM, 50 nM, 100 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 ⁇ M, 25 ⁇ M, 50 ⁇ M, 100 ⁇ M, 150 ⁇ M, or 200 ⁇ M, including any ranges between these values).
- the composition comprising the donor nucleic acid is a solid comprising the donor nucleic acid in lyophilized form and a suitable carrier.
- the solutions are formulated in water.
- the water is distilled water.
- the solutions are formulated in a buffer.
- the buffer is any buffer known in the art used for storing a nucleic acid or polypeptide.
- the molar ratio of the RGEN to the gRNA in the first mixture is between about 10:1 and about 1:10 (such as about any of 10:1, 9:1, 8:1, 7:1, 6:1, 5:1, 4:1, 3:1, 2:1, 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, and 1:10, including any ranges between these ratios).
- the molar ratio of the RGEN to the gRNA in the first mixture is about 1:1.
- the molar ratio of the first cell-penetrating peptide to the RGEN in the first mixture is between about 1:1 and about 80:1 (such as about any of 1:1, 5:1, 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, including any ranges between these ratios). In some embodiments, the molar ratio of the first cell-penetrating peptide to the RGEN in the first mixture is between about 5:1 and about 20:1 (such as about any of 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, and 20:1, including any ranges between these ratios).
- the first, second, and/or third mixtures are each incubated for from about 10 min to 60 min, including for example for about any of 20 min, 30 min, 40min, and 50 min, at a temperature from about 2°C to about 50°C, including for example from about 2°C to about 5°C, from about 5°C to about 10°C, from about 10°C to about 15°C, from about 15°C to about 20°C, from about 20°C to about 25°C, from about 25°C to about 30°C, from about 30°C to about 35°C, from about 35°C to about 40°C, from about 40°C to about 45°C, and from about 45°C to about 50°C.
- the solution comprising the nanoparticle remains stable for at least about three weeks, including for example for at least about any of 6 weeks, 2 months, 3 months, 4 months, 5 months, and 6 months at 4°C.
- the solution comprising the nanoparticle is lyophilized in the presence of a carrier.
- the carrier is a sugar, including for example, sucrose, glucose, mannitol and combinations thereof, and is present in the solution comprising the genome-editing complex or nanoparticle at from about 5% to about 20%, including for example from about 7.5% to about 17.5%, from about 10% to about 15%, and about 12.5%, weight per volume.
- the carrier is a protein, including for example albumin, such as human serum albumin.
- the first, second, and/or third cell-penetrating peptides are each a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide as described herein.
- the first, second, and/or third cell-penetrating peptides each comprises the amino acid sequence of SEQ ID NO: 75, 76, 77, 78, 79, or 80.
- the average diameter of the complex or nanoparticle does not change by more than about 10%, and the polydispersity index does not change by more than about 10%.
- a method of treating a disease or condition in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a genome-editing complex or nanoparticle as described herein for modifying a target polynucleotide and a pharmaceutically acceptable carrier, wherein the genome-editing complex or nanoparticle comprises one or more molecules of a genome-editing system useful for the treatment of the disease or condition.
- the genome- editing complex or nanoparticle comprises a CPP comprising the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the genome-editing system comprises a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing system further comprises a gRNA or gDNA (or a nucleic acid encoding the gRNA or gDNA).
- the genome-editing system further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the genome-editing nuclease is a TALEN.
- the genome- editing system is a CRISPR system (e.g., CRISPR/Cas9).
- the genome- editing system comprises an integrase (or a nucleic acid encoding the integrase).
- the genome-editing system further comprises a donor nucleic acid comprising a recombination site recognized by the integrase.
- the disease or condition to be treated includes, but is not limited to, cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, aging and degenerative diseases, and diseases characterized by cholesterol level abnormality.
- the genome- editing system is capable of modifying the sequence of one or more genes.
- the genome-editing system is capable of modulating the expression of one or more genes.
- the one or more genes encode proteins including, but not limited to, growth factors and cytokines, cell surface receptors, signaling molecules and kinases, transcription factors and other modulators of transcription, regulators of protein expression and modification, tumor suppressors, and regulators of apoptosis and metastasis.
- the genome-editing complex or nanoparticle comprises the entire genome-editing system, such that administration of the pharmaceutical composition to the individual is sufficient to modify the target polynucleotide in a cell of the individual.
- the pharmaceutical composition further comprises one or more additional genome-editing complexes or nanoparticles as described herein, wherein the plurality of genome-editing complexes or nanoparticles in the pharmaceutical composition comprise the entire genome- editing system, such that administration of the pharmaceutical composition to the individual is sufficient to modify the target polynucleotide in a cell of the individual.
- the method further comprises administering to the individual an effective amount of one or more additional pharmaceutical compositions comprising one or more additional genome-editing complexes or nanoparticles as described herein, wherein the plurality of genome-editing complexes or nanoparticles in the plurality of pharmaceutical compositions comprise the entire genome-editing system, such that administration of the plurality of pharmaceutical composition to the individual is sufficient to modify the target polynucleotide in a cell of the individual.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the pharmaceutical composition further comprises an expression complex according to any of the embodiments described herein.
- the pharmaceutical composition further comprises an expression complex comprising a cell-penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a recombinant receptor, such as chimeric antigen receptor.
- the recombinant receptor is a chimeric antigen receptor that specifically binds to an antigen associated with the disease or condition.
- Modulation of activity or expression used herein means regulating or altering the status or copy numbers of a gene or mRNA or changing the amount of gene product such as a protein that is produced.
- the genome-editing system inhibits the expression of a target gene. In some embodiments, the genome-editing system inhibits the expression of the gene or gene product by at least about any of 0%, 20%, 30%, 40%, 60%, 70%, 80%, 90%, or 100%.
- a method of treating a disease or condition in an individual comprising administering to the individual an effective amount of a pharmaceutical composition comprising a genome-editing complex or nanoparticle as described herein for modifying a target polynucleotide and a pharmaceutically acceptable carrier, wherein the genome-editing complex or nanoparticle comprises one or more molecules of a genome-editing system useful for the treatment of the disease or condition and a cell-penetrating peptide comprising the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the genome-editing system comprises a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing system further comprises a gRNA or gDNA (or a nucleic acid encoding the gRNA or gDNA).
- the genome-editing system further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the genome-editing nuclease is a TALEN.
- the genome-editing system is a CRISPR system (e.g., CRISPR/Cas9).
- the genome-editing system comprises an integrase (or a nucleic acid encoding the integrase). In some embodiments, the genome-editing system further comprises a donor nucleic acid comprising a recombination site recognized by the integrase.
- the disease or condition to be treated includes, but is not limited to, cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, aging and degenerative diseases, and cholesterol level abnormality.
- the genome-editing complex or nanoparticle in the pharmaceutical composition comprises one or more molecules of a genome-editing system for modifying the sequence of one or more genes in the individual.
- the genome-editing complex or nanoparticle in the pharmaceutical composition comprises one or more molecules of a genome-editing system for modulating the expression of one or more genes in the individual.
- the one or more genes encode proteins including, but not limited to, growth factors and cytokines, cell surface receptors, signaling molecules and kinases, transcription factors and other modulators of transcription, regulators of protein expression and modification, tumor suppressors, and regulators of apoptosis and metastasis.
- the genome-editing complex or nanoparticle comprises the entire genome- editing system, such that administration of the pharmaceutical composition to the individual is sufficient to modify the target polynucleotide in a cell of the individual.
- the pharmaceutical composition further comprises one or more additional genome-editing complexes or nanoparticles as described herein, wherein the plurality of genome-editing complexes or nanoparticles in the pharmaceutical composition comprise the entire genome- editing system, such that administration of the pharmaceutical composition to the individual is sufficient to modify the target polynucleotide in a cell of the individual.
- the method further comprises administering to the individual an effective amount of one or more additional pharmaceutical compositions comprising one or more additional genome-editing complexes or nanoparticles as described herein, wherein the plurality of genome-editing complexes or nanoparticles in the plurality of pharmaceutical compositions comprise the entire genome-editing system, such that administration of the plurality of pharmaceutical composition to the individual is sufficient to modify the target polynucleotide in a cell of the individual.
- the target polynucleotide is modified to inactivate a target gene, such as by decreasing expression of the target gene or resulting in a modified target gene that expresses an inactive product.
- the target polynucleotide is modified to activate a target gene, such as by increasing expression of the target gene or resulting in a modified target gene that expresses an active target gene product.
- the pharmaceutical composition further comprises an expression complex comprising a cell-penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a chimeric antigen receptor.
- the chimeric antigen receptor specifically binds to an antigen associated with the disease or condition.
- the genome-editing complex or nanoparticle comprises one or more molecules of a genome-editing system (such as the entire genome-editing system) targeting one or more genes including, but are not limited to, Adenosine receptor A2A, Adenosine receptor A2B, Adenylyl cyclase, Akt, ALK, ALK/Met, angiopoietin receptor, Angiotensin II, APC, AR, ARK5, arrestin, ATF1, ATF-2, B7-1, B7-h1 (pdl-1), ⁇ - catenin, Bcl-2, BCL2L12, Bcl6, Bcr-Abl, BRAF, BRCA1, BRCA2, BTK, caspase-2, caspase-9, CCL2, CCN1, Ccnd2, CDK-activating kinases, CEBPA, Chop, c-Jun, c-Myc, CREB, CREB1, CS1,
- a genome-editing system such as the entire genome
- the disease to be treated is cancer.
- the cancer is a solid tumor
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system that modulates the expression of one or more genes that encode proteins including, but not limited to, growth factors and cytokines, cell surface receptors, signaling molecules and kinases, transcription factors and other modulators of transcription, regulators of protein expression and modification, tumor suppressors, and regulators of apoptosis and metastasis.
- the growth factors or cytokines include, but are not limited to, EGF, VEGF, FGF, HGF, HDGF, IGF, PDGF, TGF- ⁇ , TGF- ⁇ , TNF- ⁇ , and wnt, including mutants thereof.
- the cell surface receptors include, but are not limited to, ER, PR, Her2, Her3, angiopoietin receptor, EGFR, FGFR, HGFR, HDGFR, IGFR, KGFR, MSFR, PDGFR, TGFR, VEGFR1, VEGFR2, VEGFR3, Frizzled family receptors (FZD-1 to 10), smoothened, patched, and CXCR4, including mutants thereof.
- the signaling molecules or kinases include, but are not limited to, KRAS, NRAS, RAF, MEK, MEKK, MAPK, MKK, ERK, JNK, JAK, PKA, PKC, PI3K, Akt, mTOR, Raptor, Rictor, MLST8, PRAS40, DEPTOR, MSIN1, S6 kinase, PDK1, BRAF, FAK, Src, Fyn, Shc, GSK, IKK, PLK-1, cyclin-dependent kinases (Cdk1 to 13), CDK-activating kinases, ALK/Met, Syk, BTK, Bcr-Abl, RET, ⁇ -catenin, Mcl-1, and PKN3, including mutants thereof.
- the transcription factors or other modulators of transcription include, but are not limited to, AR, ATF1, CEBPA, CREB1, ESR1, EWSR1, FOXO1, GATA1, GATA3, HNF1A, HNF1B, IKZF1, IRF1, IRF4, KLF6, LMO1, LYL1, MYC, NR4A3, PAX3, PAX5, PAX7, PBX1, PHOX2B, PML, RUNX1, SMAD4, SMAD7, STAT5B, TAL1, TP53, WT1, ZBTB16, ATF-2, Chop, c-Jun, c- Myc, DPC4, Elk-1, Ets1, Max, MEF2C, NFAT4, Sap1a, STATs, Tal, p53, CREB, NF- ⁇ B, HDACs, HIF-1 ⁇ , and RRM2, including mutants thereof.
- the regulators of protein expression or modification include, but are not limited to, ubiquitin ligase, LMP2, LMP7, and MECL-1, including mutants thereof.
- the tumor suppressors include, but are not limited to, APC, BRCA1, BRCA2, DPC4, INK4, MADR2, MLH1, MSH2, MSH6, NF1, NF2, p53, PTC, PTEN, Rb, VHL, WT1, and WT2, including mutants thereof.
- the regulators of apoptosis or metastasis include, but are not limited to, XIAP, Bcl-2, osteopontin, SPARC, MMP-2, MMP-9, uPAR, including mutants thereof.
- the disease to be treated is cancer, wherein the cancer is a solid tumor, and the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) targeting one or more genes encoding proteins involved in tumor development and/or progression.
- a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) targeting one or more genes encoding proteins involved in tumor development and/or progression.
- the one or more genes encoding proteins involved in tumor development and/or progression include, but are not limited to, IL-2, IL-12, interferon-gamma, GM-CSF, B7-1, caspase-9, p53, MUC-1, MDR-1, HLA-B7/Beta 2-Microglobulin, Her2, Hsp27, thymidine kinase, and MDA-7, including mutants thereof.
- the genome-editing system comprises a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing system further comprises a gRNA or gDNA (or a nucleic acid encoding the gRNA or gDNA).
- the genome-editing system further comprises a donor nucleic acid for introducing a specific modification to the target
- the genome-editing nuclease is a TALEN.
- the genome-editing system is a CRISPR system (e.g., CRISPR/Cas9).
- the genome-editing system comprises an integrase (or a nucleic acid encoding the integrase).
- the genome-editing system further comprises a donor nucleic acid comprising a recombination site recognized by the integrase.
- the disease to be treated is cancer
- the cancer is liver cancer
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) targeting one or more genes encoding proteins involved in liver cancer development and/or progression.
- the liver cancer is hepatocellular carcinoma, cholangiocarcinoma, angiosarcoma of the liver, or hemangiosarcoma of the liver.
- the one or more genes encoding proteins involved in liver cancer development and/or progression include, but are not limited to, CCND2, RAD23B, GRP78, CEP164, MDM2, and ALDH2, including mutants thereof.
- the cancer is hepatocellular carcinoma (HCC).
- HCC hepatocellular carcinoma
- the HCC is early stage HCC, non- metastatic HCC, primary HCC, advanced HCC, locally advanced HCC, metastatic HCC, HCC in remission, or recurrent HCC.
- the HCC is localized resectable (i.e., tumors that are confined to a portion of the liver that allows for complete surgical removal), localized unresectable (i.e., the localized tumors may be unresectable because crucial blood vessel structures are involved or because the liver is impaired), or unresectable (i.e., the tumors involve all lobes of the liver and/or has spread to involve other organs (e.g., lung, lymph nodes, bone).
- organs e.g., lung, lymph nodes, bone
- the HCC is, according to TNM classifications, a stage I tumor (single tumor without vascular invasion), a stage II tumor (single tumor with vascular invasion, or multiple tumors, none greater than 5 cm), a stage III tumor (multiple tumors, any greater than 5 cm, or tumors involving major branch of portal or hepatic veins), a stage IV tumor (tumors with direct invasion of adjacent organs other than the gallbladder, or perforation of visceral peritoneum), N1 tumor (regional lymph node metastasis), or M1 tumor (distant metastasis).
- the HCC is, according to AJCC (American Joint Commission on Cancer) staging criteria, stage T1, T2, T3, or T4 HCC.
- the HCC is any one of liver cell carcinomas, fibrolamellar variants of HCC, and mixed hepatocellular cholangiocarcinomas.
- the individual may be a human who has a gene, genetic mutation, or polymorphism associated with hepatocellular carcinoma (e.g., mutation or polymorphism in CCND2, RAD23B, GRP78, CEP164, MDM2, and/or ALDH2) or has one or more extra copies of a gene associated with hepatocellular carcinoma.
- the disease to be treated is cancer
- the cancer is lung cancer
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) targeting one or more genes encoding proteins involved in lung cancer development and/or progression.
- the one or more genes encoding proteins involved in lung cancer development and/or progression include, but are not limited to, SASH1, LATS1, IGF2R, PARK2, KRAS, PTEN, Kras2, Krag, Pas1, ERCC1, XPD, IL8RA, EGFR, Ot 1 -AD, EPHX, MMP1, MMP2, MMP3, MMP12, IL1 ⁇ , RAS, and AKT, including mutants thereof.
- the cancer is lung cancer.
- the lung cancer is a non-small cell lung cancer (NSCLC).
- NSCLC non-small cell lung cancer
- Examples of NSCLC include, but are not limited to, large-cell carcinoma (e.g., large-cell neuroendocrine carcinoma, combined large-cell neuroendocrine carcinoma, basaloid carcinoma, lymphoepithelioma-like carcinoma, clear cell carcinoma, and large-cell carcinoma with rhabdoid phenotype), adenocarcinoma (e.g., acinar, papillary (e.g., bronchioloalveolar carcinoma, nonmucinous, mucinous, mixed mucinous and nonmucinous and indeterminate cell type), solid adenocarcinoma with mucin, adenocarcinoma with mixed subtypes, well-differentiated fetal adenocarcinoma, mucinous (colloid) adenocarcinoma, mucinous
- the NSCLC is, according to TNM classifications, a stage T tumor (primary tumor), a stage N tumor (regional lymph nodes), or a stage M tumor (distant metastasis).
- the lung cancer is a carcinoid (typical or atypical), adenosquamous carcinoma, cylindroma, or carcinoma of the salivary gland (e.g., adenoid cystic carcinoma or mucoepidermoid carcinoma).
- the lung cancer is a carcinoma with pleomorphic, sarcomatoid, or sarcomatous elements (e.g., carcinomas with spindle and/or giant cells, spindle cell carcinoma, giant cell carcinoma, carcinosarcoma, or pulmonary blastoma).
- the cancer is small cell lung cancer (SCLC; also called oat cell carcinoma).
- SCLC small cell lung cancer
- the small cell lung cancer may be limited-stage, extensive stage or recurrent small cell lung cancer.
- the individual may be a human who has a gene, genetic mutation, or polymorphism suspected or shown to be associated with lung cancer (e.g., mutation or polymorphism in SASH1, LATS1, IGF2R, PARK2, KRAS, PTEN, Kras2, Krag, Pas1, ERCC1, XPD, IL8RA, EGFR, Ot 1 -AD, EPHX, MMP1, MMP2, MMP3, MMP12, IL1 ⁇ , RAS, and/or AKT) or has one or more extra copies of a gene associated with lung cancer.
- a gene, genetic mutation, or polymorphism suspected or shown to be associated with lung cancer e.g., mutation or polymorphism in SASH1, LATS1, IGF2R, PARK2, KRAS, PTEN, Kras2, Krag, Pas1, ERCC1, XPD, IL8RA, EGFR, Ot 1 -AD, EPHX, MMP1, MMP2, MMP3, MMP12, IL1
- the disease to be treated is cancer, wherein the cancer is renal cell carcinoma (RCC), and the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) targeting one or more genes encoding proteins involved in RCC development and/or progression.
- the one or more genes encoding proteins involved in RCC development and/or progression include, but are not limited to, VHL, TSCl, TSC2, CUL2, MSH2, MLHl, INK4a/ARF, MET, TGF- ⁇ , TGF- ⁇ l, IGF-I, IGF-IR, AKT, and PTEN, including mutants thereof.
- the cancer is renal cell carcinoma.
- the renal cell carcinoma is an adenocarcinoma.
- the renal cell carcinoma is a clear cell renal cell carcinoma, papillary renal cell carcinoma (also called chromophilic renal cell carcinoma), chromophobe renal cell carcinoma, collecting duct renal cell carcinoma, granular renal cell carcinoma, mixed granular renal cell carcinoma, renal angiomyolipomas, or spindle renal cell carcinoma.
- the individual may be a human who has a gene, genetic mutation, or
- the renal cell carcinoma is associated with (1) von Hippel-Lindau (VHL) syndrome, (2) hereditary papillary renal carcinoma (HPRC), (3) familial renal oncocytoma (FRO) associated with Birt-Hogg-Dube syndrome (BHDS), or (4) hereditary renal carcinoma (HRC).
- VHL von Hippel-Lindau
- HPRC hereditary papillary renal carcinoma
- FRO familial renal oncocytoma
- BHDS Birt-Hogg-Dube syndrome
- HRC hereditary renal carcinoma
- the renal cell carcinoma is at any of stage I, II, III, or IV, according to the American Joint Committee on Cancer (AJCC) staging groups.
- the renal cell carcinoma is stage IV renal cell carcinoma.
- the disease to be treated is cancer, wherein the cancer is a central nervous system (CNS) tumor, and the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) targeting one or more genes encoding proteins involved in the CNS tumor development and/or progression.
- the pharmaceutical composition is administered during or after (such as immediately following) a surgical procedure on the CNS tumor.
- the surgical procedure is resection of the CNS tumor.
- the pharmaceutical composition is administered into a surgical cavity resulting from the surgical procedure.
- the one or more genes encoding proteins involved in the CNS tumor development and/or progression include, but are not limited to, NF1, NF2, SMARCB1, pVHL, TSC1, TSC2, p53, CHK2, MLH1, PMS2, PTCH, SUFU, and XRCC7, including mutants thereof.
- the cancer is a CNS tumor.
- the CNS tumor is a glioma (e.g., brainstem glioma and mixed gliomas), glioblastoma (also known as glioblastoma multiforme), astrocytoma (such as high-grade astrocytoma), pediatric glioma or glioblastoma (such as pediatric high-grade glioma (HGG) and diffuse intrinsic pontine glioma (DIPG)), CNS lymphoma, germinoma,
- glioma e.g., brainstem glioma and mixed gliomas
- glioblastoma also known as glioblastoma multiforme
- astrocytoma such as high-grade astrocytoma
- pediatric glioma or glioblastoma such as pediatric high-grade glioma (HGG) and diffuse intrinsic pontine glioma (D
- the individual may be a human who has a gene, genetic mutation, or polymorphism suspected or shown to be associated with the CNS tumor (e.g., mutation or polymorphism in NF1, NF2, SMARCB1, pVHL, TSC1, TSC2, p53, CHK2, MLH1, PMS2, PTCH, SUFU, and XRCC7) or has one or more extra copies of a gene associated with the CNS tumor.
- a gene, genetic mutation, or polymorphism suspected or shown to be associated with the CNS tumor e.g., mutation or polymorphism in NF1, NF2, SMARCB1, pVHL, TSC1, TSC2, p53, CHK2, MLH1, PMS2, PTCH, SUFU, and XRCC7
- a gene, genetic mutation, or polymorphism suspected or shown to be associated with the CNS tumor e.g., mutation or polymorphism in NF1, NF2, SMARCB1, pVHL
- the disease to be treated is a hematologic disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in hematologic disease development and/or progression.
- the hematologic disease is a hemoglobinopathy, such as sickle-cell disease, thalassemia, or methemoglobinemia, an anemia, such as megaloblastic anemia, hemolytic anemia (e.g., hereditary spherocytosis, hereditary elliptocytosis, congenital dyserythropoietic anemia, glucose-6-phosphate dehydrogenase deficiency, pyruvate kinase deficiency, immune mediated hemolytic anemia, autoimmune hemolytic anemia, warm antibody autoimmune hemolytic anemia, systemic lupus erythematosus, Evans’ syndrome, cold autoimmune hemolytic anemia, cold agglutinin disease, paroxysmal cold hemoglobinuria, infectious mononucleosis, alloimmune hemolytic anemia, hemolytic disease of the newborn, or paroxysmal nocturnal hemoglobinuria), aplastic anemia (e.g., Fancon
- the one or more genes encoding proteins involved in hematologic disease development and/or progression include, but are not limited to, HBA1, HBA2, HBB, PROC, ALAS2, ABCB7, SLC25A38, MTTP, FANCA, FANCB, FANCC, FANCD1 (BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (BRIP1), FANCL, FANCM, FANCN (PALB2), FANCP (SLX4), FANCS (BRCA1), RAD51C, XPF, ANK1, SPTB, SPTA, SLC4A1, EPB42, and TPI1, including mutants thereof.
- the disease to be treated is an organ-based disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in the organ-based disease development and/or progression.
- the organ-based disease is a disease of the eye, liver, lung, kidney, heart, nervous system, muscle, or skin.
- the disease is a cardiovascular disease, such as coronary heart disease, hypertension, atrial fibrillation, peripheral arterial disease, Marfan syndrome, long QT syndrome, or a congenital heart defect.
- the disease is a digestive disease, such as irritable bowel syndrome, ulcerative colitis, Crohn’s disease, celiac disease, peptic ulcer disease, gastroesophageal reflux disease, or chronic pancreatitis.
- the disease is a urologic disease, such as chronic prostatitis, benign prostatic hyperplasia, or interstitial cystitis.
- the disease is a musculoskeletal disease, such as osteoarthritis, osteoporosis, osteogenesis imperfecta, or Paget’s disease of bone.
- the disease is a skin disease, such as eczema, psoriasis, acne, rosacea, or dermatitis.
- the disease is a dental or craniofacial disorder, such as periodontal disease or temporomandibular joint and muscle disorder (TMJD).
- the disease to be treated is an ocular disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in ocular disease development and/or progression.
- the ocular disease is age-related macular degeneration or the like, retinopathy of prematurity, polypoidal choroidal vasculopathy, diabetic retinopathy, diabetic macular edema, ischemic proliferative retinopathy, retinitis pigmentosa, cone dystrophy, proliferative vitreoretinopathy, retinal artery occlusion, retinal vein occlusion, keratitis, conjunctivitis, uveitis, Leber's disease, retinal detachment, retinal pigment epithelial detachment, neovascular glaucoma, corneal neovascularization, retinochoroidal neovascularization.
- retinopathy of prematurity polypoidal choroidal vasculopathy
- diabetic retinopathy diabetic macular edema
- ischemic proliferative retinopathy retinitis pigmentosa
- cone dystrophy proliferative
- the one or more genes encoding proteins involved in hematologic disease development and/or progression include, but are not limited to, ⁇ Rho, PDE6 ⁇ , ABCA4, RPE65, LRAT, RDS/Peripherin, MERTK, CNGA1, RPGR, IMPDH1, ChR2, GUCY2D,
- the disease to be treated is a liver disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in liver disease development and/or progression.
- the liver disease is hepatitis, fatty liver disease (alcoholic and nonalcoholic), hemochromatosis, Wilson’s disease, progressive familial intrahepatic cholestasis type 3, hereditary fructose intolerance, glycogen storage disease type IV, tyrosinemia type I, argininosuccinate lyase deficiency, citrin deficiency (CTLN2, NICCD), cholesteryl ester storage disease, cystic fibrosis, Alström syndrome, congenital hepatic fibrosis, alpha 1-antitrypsin deficiency, glycogen storage disease type II, transthyretin-related hereditary amyloidosis, Gilbert’s syndrome, cirrhosis, primary biliary cirrhosis, or primary sclerosing cholangitis.
- the one or more genes encoding proteins involved in liver disease development and/or progression include, but are not limited to, ATP7B, ABCB4, ALDOB, GBE1, FAH, ASL, SLC25A13, LIPA, CFTR, ALMS1, HFE, HFE2, HFDE2B, HFE3,
- the disease to be treated is a lung disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in lung disease development and/or progression.
- the lung disease is chronic obstructive pulmonary disease (COPD), asthma, cystic fibrosis, primary ciliary dyskinesia, pulmonary fibrosis, Birt Hogg Dube syndrome, tuberous sclerosis, Kartagener syndrome, ⁇ 1 ⁇ antitrypsin deficiency, pulmonary capillary hemangiomatosis (PCH), or hereditary heamorrhagic telangiectasia.
- COPD chronic obstructive pulmonary disease
- asthma cystic fibrosis
- primary ciliary dyskinesia pulmonary fibrosis
- Birt Hogg Dube syndrome tuberous sclerosis
- Kartagener syndrome ⁇ 1 ⁇ antitrypsin deficiency
- PCH pulmonary capillary hemangiomatosis
- hereditary heamorrhagic telangiectasia hereditary heamorrhagic telangiectasia.
- the one or more genes encoding proteins involved in lung disease development and/or progression include, but are not limited to, EIF2AK4, IREB2, HHIP, FAM13A, IL1RL1, TSLP, IL33, IL25, CFTR, DNAI1, DNAH5, TXNDC3, DNAH11, DNAI2, KTU, RSPH4A, RSPH9, LRRC50, TERC, TERT, SFTPC, SFTPA2, FLCN, TSC1, TSC2, A1AT, ENG, ACVRL1, and MADH4, including mutants thereof.
- the disease to be treated is a kidney disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in kidney disease development and/or progression.
- the kidney disease is cystic kidney disease (e.g., autosomal dominant polycystic kidney disease, autosomal recessive polycystic kidney disease, nephronophthisis, or medullary sponge kidney), Alport’s syndrome, Bartter’s syndrome, congenital nephrotic syndrome, nail- patella syndrome, primary immune glomerulonephritis, reflux nephropathy, or haemolytic uraemic syndrome.
- cystic kidney disease e.g., autosomal dominant polycystic kidney disease, autosomal recessive polycystic kidney disease, nephronophthisis, or medullary sponge kidney
- Alport’s syndrome e.g., autosomal dominant polycystic kidney disease, autosomal recessive polycystic kidney disease, nephronophthisis, or medullary sponge kidney
- Alport’s syndrome e.g., autosomal dominant polycystic kidney disease, auto
- the one or more genes encoding proteins involved in kidney disease development and/or progression include, but are not limited to, PKD1, PKD2, PKD3, fibrocystin, NPHP1, NPHP2, NPHP3, NPHP4, NPHP5, NPHP6, NPHP7, NPHP8, NPHP9, NPHP11, NPHP11, NPHPL1, GDNF, COL4A5, COL4A3, COL4A4,
- SLC12A2 (NKCC2), ROMK/KCNJ1, CLCNKB, BSND, CASR, SLC12A3 (NCCT), and ADAMTS13, including mutants thereof.
- the disease to be treated is a muscle disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in muscle disease development and/or progression.
- the muscle disease is myopathy (e.g., mitochondrial myopathy), muscular dystrophy (e.g., Duchenne, Becker, Emery-Dreifuss, facioscapulohumeral, myotonic, congenital, distal, limb-girdle, and oculopharyngeal), cerebral palsy, fibrodysplasia ossificans progressiva, dermatomyositis, compartment syndrome, myasthenia gravis, amyotrophic lateral sclerosis, rhabdomyolysis, polymyositis, fibromyalgia, myotonia, myofascial pain syndrome, .
- myopathy e.g., mitochondrial myopathy
- muscular dystrophy e.g., Duchenne, Becker, Emery-Dreifuss, facioscapulohumeral, myotonic, congenital, distal, limb-girdle, and oculopharyngeal
- the one or more genes encoding proteins involved in muscle disease development and/or progression include, but are not limited to, DMD, LAMA2, collagen VI (COL6A1, COL6A2, or COL6A3), POMT1, POMT2, FKTN, FKRP, LARGE1, POMGNT1, ISPD, SEPN1, LMNA, DYSF, EMD, DUX4, DMPK, ZNF9, PABPN1, CAV3, CAPN3, SGCA, SGCB, SGCG, SGCD, TTN, ANO5, DNAJB6, HNRNPDL, MYOT, TCAP, TNPO3, TRAPPC11, and TRIM32, including mutants thereof.
- the disease to be treated is a nervous system disease (such as a central nervous system disease)
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in nervous system disease development and/or progression.
- the nervous system disease is adrenoleukodystrophy, Angelman syndrome, ataxia telangiectasia, Charcot-Marie- Tooth syndrome, Cockayne syndrome, essential tremor, fragile X syndrome, Friedreich's ataxia, Gaucher disease, Lesch-Nyhan syndrome, maple syrup urine disease, Menkes syndrome, narcolepsy, neurofibromatosis, Niemann-Pick disease, phenylketonuria, Prader-Willi syndrome, Refsum disease, Rett syndrome, spinal muscular atrophy, spinocerebellar ataxia, Tangier disease, Tay-Sachs disease, tuberous sclerosis, Von Hippel-Lindau syndrome, Williams syndrome, Wilson's disease, Zellweger syndrome, attention deficit/hyperactivity disorder (ADHD), autism, bipolar disorder, depression, epilepsy, migraine, multiple sclerosis, myelopathy, Alzheimer’s, Huntington’s, Parkinson’s, or Tourette’s.
- ADHD attention deficit/hyperactivity disorder
- the one or more genes encoding proteins involved in nervous system disease development and/or progression include, but are not limited to, ALD, PS1 (AD3), PS2 (AD4), SOD1, UBE3A, ATM, PMP22, MPZ, LITAF, EGR2, MFN2, KIF1B, RAB7A, LMNA, TRPV4, BSCL2, GARS, NEFL, HSPB1, GDAP1, HSPB8, MTMR2, SBF2, SH3TC2, NDRG1, PRX, FGD4, FIG4, DNM2, YARS, GJB1, PRPS1, CSA, CSB, Cx26, EPM2A, ETM1 (FET1), ETM2, FMR1, frataxin, GBA, HTT, HPRT1, BCKDH, ATP7A, ATP7B, HLA-DQB1, HLA-DQA1, HLA-DRB1, NF1, NF2, SMPD1, NPC1, NPC2, LRRK2, PARK7, PINK
- CLIP2 ELN
- GTF2I GTF2I
- GTF2IRD1 LIMK1
- PXR1 PXR1
- the disease to be treated is cancer, wherein the cancer is a hematological malignancy, and the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in hematological malignancy development and/or progression.
- the one or more genes encoding proteins involved in hematological malignancy development and/or progression include, but are not limited to, GLI1, CTNNB1, eIF5A, mutant DDX3X, Hexokinase II, histone
- methyltransferase ⁇ 2 ARK5, ALK, MUC1, HMGA2, IRF1, RPN13, HDAC11, Rad51, Spry2, mir-146a, mir-146b, survivin, MDM2, MCL1, CMYC, XBP1 (spliced and unspliced), SLAMF7, CS1, Erbb4, Cxcr4 (waldenstroms macroglobulinemia), Myc, Bcl2, Prdx1 and Prdx2 (burkitts lymphoma), Bcl6, Idh1, Idh2, Smad, Ccnd2, Cyclin d1-2, B7-h1 (pdl-1), and Pyk2, including mutants thereof.
- the disease to be treated is a viral infectious disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in the viral infectious disease development and/or progression.
- the viral infectious disease is characterized by infection with hepatitis virus, human immunodeficiency virus (HIV), picornavirus, poliovirus, enterovirus, human Coxsackie virus, influenza virus, rhinovirus, echovirus, rubella virus, encephalitis virus, rabies virus, herpes virus, papillomavirus, polyoma virus, RSV, adenovirus, yellow fever virus, dengue virus, parainfluenza virus, hemorrhagic virus, pox virus, varicella zoster virus, parainfluenza virus, reovirus, orbivirus, rotavirus, parvovirus, African swine fever virus, measles, mumps or Norwalk virus.
- HCV human immunodeficiency virus
- picornavirus poliovirus
- enterovirus enterovirus
- human Coxsackie virus influenza virus
- rhinovirus rhinovirus
- echovirus rubella virus
- encephalitis virus rabies virus
- the viral infectious disease is characterized by infection with an oncogenic virus including, but not limited to, CMV, EBV, HBV, KSHV, HPV, MCV, HTLV-1, HIV-1, and HCV
- the one or more genes encoding proteins involved in the viral infectious disease development and/or progression include, but are not limited to, genes encoding RSV nucleocapsid, Pre-gen/Pre-C, Pre-S1, Pre-S2/S,X, HBV conserved sequences, HIV Gag polyprotein (p55), HIV Pol polyprotein, HIV Gag-Pol precursor (p160), HIV matrix protein (MA, p17), HIV capsid protein (CA, p24), HIV spacer peptide 1 (SP1, p2), HIV nucleocapsid protein (NC, p9), HIV spacer peptide 2 (SP2, p1), HIV P6 protein, HIV reverse transcriptase (RT, p50), HIV RNase H (p15), HIV integrase (
- the disease or condition to be treated is an autoimmune or inflammatory disease or condition
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in the autoimmune or inflammatory disease or condition development and/or progression.
- the autoimmune or inflammatory disease or condition is acne, allergies, anaphylaxis, asthma, celiac disease, diverticulitis, glomerulonephritis, inflammatory bowel disease, interstitial cystitis, lupus, otitis, pelvic inflammatory disease, rheumatoid arthritis, sarcoidosis, or vasculitis.
- the one or more genes encoding proteins involved in the autoimmune or inflammatory disease or condition development and/or progression include, but are not limited to, genes encoding molecules of the complement system (CD46, CD59, CFB, CFD, CFH, CFHR1, CFHR2, CFHR3, CFHR4, CFHR5, CFI, CFP, CR1, CR1L, CR2, C1QA, C1QB, C1QC, C1R, C1S, C2, C3, C3AR1, C4A, C4B, C5, C5AR1, C6, C7, C8A, C8B, C8G, C9, ITGAM, ITGAX, and ITGB2) , including mutants thereof.
- the complement system CD46, CD59, CFB, CFD, CFH, CFHR1, CFHR2, CFHR3, CFHR4, CFHR5, CFI, CFP, CR1, CR1L, CR2, C1QA, C1QB, C1QC, C1R, C
- the disease or condition to be treated is a lysosomal storage disease
- the pharmaceutical composition comprises a genome- editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in the lysosomal storage disease development and/or progression.
- the lysosomal storage disease is Sphingolipidoses (e.g., Farber disease, Krabbe disease (infantile onset, late onset), galactosialidosis, gangliosidoses (e.g., Fabry disease, Schindler disease, GM1 gangliosidosis (Infantile, Juvenile, Adult/Chronic), GM2 gangliosidosis (e.g., Sandhoff disease (Infantile, Juvenile, Adult onset), Tay–Sachs)), Gaucher Disease (Type I, Type II, Type III), Lysosomal acid lipase deficiency (Early onset, Late onset), Niemann–Pick disease (Type A, Type B), Sulfatidosis (e.g., Metachromatic), gangliosidoses (e.g., Fabry disease, Schindler disease, GM1 gangliosidosis (Infantile, Juvenile, Adult/Chronic),
- MLD Leukodystrophy
- Mucopolysaccharidoses e.g., MPS I Hurler Syndrome, MPS I S Scheie Syndrome, MPS I H-S Hurler–Scheie Syndrome, Type II (Hunter syndrome), Type III (Sanfilippo syndrome), Type IV (Morquio), Type VI (Maroteaux– Lamy syndrome), Type VII (Sly Syndrome), Type IX (Hyaluronidase deficiency)
- Mucolipidosis e.g.,. Type I (Sialidosis), Type II (I-cell disease), Type III (Pseudo-Hurler Polydystrophy / Phosphotransferase deficiency), Type IV (Mucolipidin 1 deficiency)
- Lipidoses e.g., Niemann–Pick disease (Type C, Type D), Neuronal Ceroid Lipofuscinoses, Wolman disease), Alpha-mannosidosis, Beta-mannosidosis, Aspartylglucosaminuria, Fucosidosis, Lysosomal Transport Diseases (e.g., Cystinosis, Pycnodysostosis, Salla disease/Sialic Acid Storage Disease, Infantile Free Sialic Acid Storage Disease (ISSD)), Cholesteryl ester storage disease.
- the one or more genes encoding proteins involved in the lysosomal storage disease development and/or progression include, but are not limited to, genes encoding ceramidase, Alpha-galactosidase (A, B), Beta-galactosidase, Hexosaminidase A, Sphingomyelinase, Lysosomal acid lipase, Saposin B, sulfatase, Hyaluronidase,
- Phosphotransferase Mucolipidin 1, aspartylglucosaminidase, alpha-D-mannosidase, beta- mannosidase, alpha-L-fucosidase, cystinosin, cathepsin K, sialin, SLC17A5, acid alpha- glucosidase, LAMP2, including mutants thereof.
- the disease or condition to be treated is a glycogen storage disease
- the pharmaceutical composition comprises a genome- editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in the glycogen storage disease development and/or progression.
- the glycogen storage disease is von Gierke's disease, Pompe's disease, Cori's disease or Forbes' disease, Andersen disease, McArdle disease, Hers' disease, Tarui's disease, Fanconi-Bickel syndrome, or Red cell aldolase deficiency.
- the one or more genes encoding proteins involved in the glycogen storage disease development and/or progression include, but are not limited to, genes encoding glycogen synthase, glucose-6-phosphatase, acid alpha-glucosidase, glycogen debranching enzyme, glycogen branching enzyme, muscle glycogen phosphorylase, liver glycogen phosphorylase, muscle phosphofructokinase, Phosphorylase kinase, glucose transporter, GLUT2, Aldolase A, and ⁇ -enolase, including mutants thereof.
- the disease or condition to be treated is an immunodeficiency disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in the glycogen storage disease development and/or progression.
- the glycogen storage disease is von Gierke's disease, Pompe's disease, Cori's disease or Forbes' disease, Andersen disease, McArdle disease, Hers' disease, Tarui's disease, Fanconi-Bickel syndrome, or Red cell aldolase deficiency.
- the one or more genes encoding proteins involved in the glycogen storage disease development and/or progression include, but are not limited to, genes encoding glycogen synthase, glucose-6-phosphatase, acid alpha-glucosidase, glycogen debranching enzyme, glycogen branching enzyme, muscle glycogen phosphorylase, liver glycogen phosphorylase, muscle phosphofructokinase, Phosphorylase kinase, glucose transporter, GLUT2, Aldolase A, and ⁇ -enolase, including mutants thereof.
- the condition to be treated is characterized by abnormal cholesterol levels (such as abnormally high LDL levels, e.g., LDL above about 100 mg/dL, and/or abnormally low HDL levels, e.g., HDL below about 40-50 mg/dL), including, e.g., familial hypercholesterolemia, and the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in cholesterol transport and/or metabolism.
- abnormal cholesterol levels such as abnormally high LDL levels, e.g., LDL above about 100 mg/dL, and/or abnormally low HDL levels, e.g., HDL below about 40-50 mg/dL
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/
- the one or more genes encoding proteins involved in cholesterol transport and/or metabolism include, but are not limited to, low-density lipoprotein (LDL) receptor (LDLR), apolipoprotein B (ApoB), low-density lipoprotein receptor adapter protein 1 (LDLRAP1), and PCSK9, including mutants thereof.
- LDL low-density lipoprotein
- LDLR low-density lipoprotein receptor
- ApoB apolipoprotein B
- LDLRAP1 low-density lipoprotein receptor adapter protein 1
- PCSK9 including mutants thereof.
- a genome-editing complex or nanoparticle as described herein is used to activate LDLR expression.
- Methods of using such systems to activate cell expression of LDLR are well within the level of a skilled artisan.
- Exemplary LDLR-specific target sequences for guide RNA/DNA sequences can include any set forth in SEQ ID NOS: 110-112.
- Commercially available reagents, such as nuclease dead Cas9 (dCas9) and gRNA vectors are readily available, e.g. from Santa Cruz Biotechnology (see, e.g., catalog number sc-400645-ACT and sc-400645-ACT-2).
- a genome-editing complex or nanoparticle as described herein is used to correct a mutation in a gene encoding LDLR.
- Methods of using such systems with template DNA corresponding to wild-type LDLR sequences are well within the level of a skilled artisan.
- Methods using CRISPR systems, e.g., for introducing double-strand DNA breaks in an LDLR gene are known in the art, and can be combined, e.g., with donor nucleic acids for homology-directed DNA repair (HDR) to replace mutant sequences in the LDLR gene with wild-type sequences.
- HDR homology-directed DNA repair
- exemplary target sequences for guide RNA sequences can include any set forth in SEQ ID NOS: 104-109.
- kits, gRNA vectors, and donor vectors for introducing double-strand DNA breaks in an LDLR gene and correcting mutations by HDR are readily available, e.g., from Santa Cruz Biotechnology (see, e.g., catalog number sc-400645 and sc-400645-HDR) or GeneCopoeia (see, e.g., catalog number
- HTN210577 HTN261606, HTN261605, HTN261608, and HTN261607).
- a genome-editing complex or nanoparticle as described herein is used to introduce a gene encoding LDLR.
- Methods of using such systems with template DNA comprising a gene encoding LDLR are well within the level of a skilled artisan.
- Methods using CRISPR systems, e.g., for introducing double-strand DNA breaks in a genome are known in the art, and can be combined, e.g., with donor nucleic acids for HDR-mediated insertion of a gene encoding LDLR into the genome.
- a genome-editing complex or nanoparticle as described herein is used to activate ApoB expression. Methods of using such systems to activate cell expression of ApoB are well within the level of a skilled artisan.
- Exemplary ApoB-specific target sequences for guide RNA/DNA sequences can include any set forth in SEQ ID NOS: 119-121.
- nuclease dead Cas9 dCas9
- gRNA vectors are readily available, e.g. from Santa Cruz Biotechnology (see, e.g., catalog number sc-400705-ACT and sc-400705-ACT-2).
- a genome-editing complex or nanoparticle as described herein is used to correct a mutation in a gene encoding ApoB.
- Methods of using such systems with template DNA corresponding to wild-type ApoB sequences are well within the level of a skilled artisan.
- Methods using CRISPR systems, e.g., for introducing double-strand DNA breaks in an ApoB gene are known in the art, and can be combined, e.g., with donor nucleic acids for homology-directed DNA repair (HDR) to replace mutant sequences in the ApoB gene with wild- type sequences.
- HDR homology-directed DNA repair
- exemplary target sequences for guide RNA sequences can include any set forth in SEQ ID NOS: 113-118.
- kits, gRNA vectors, and donor vectors for introducing double-strand DNA breaks in an ApoB gene and correcting mutations by HDR are readily available, e.g., from Santa Cruz Biotechnology (see, e.g., catalog number sc- 400705-KO-2 and sc-400705-HDR-2) or GeneCopoeia (see, e.g., catalog number HTN209218).
- a genome-editing complex or nanoparticle as described herein is used to introduce a gene encoding ApoB.
- Methods of using such systems with template DNA comprising a gene encoding ApoB are well within the level of a skilled artisan.
- Methods using CRISPR systems, e.g., for introducing double-strand DNA breaks in a genome are known in the art, and can be combined, e.g., with donor nucleic acids for HDR-mediated insertion of a gene encoding ApoB into the genome.
- a genome-editing complex or nanoparticle as described herein is used to activate LDLRAP1 expression.
- Methods of using such systems to activate cell expression of LDLRAP1 are well within the level of a skilled artisan.
- Exemplary LDLRAP1- specific target sequences for guide RNA/DNA sequences can include any set forth in SEQ ID NOS: 128-130.
- Commercially available reagents, such as nuclease dead Cas9 (dCas9) and gRNA vectors are readily available, e.g. from Santa Cruz Biotechnology (see, e.g., catalog number sc-406114-ACT and sc-406114-ACT-2).
- a genome-editing complex or nanoparticle as described herein is used to correct a mutation in a gene encoding LDLRAP1.
- Methods of using such systems with template DNA corresponding to wild-type LDLRAP1 sequences are well within the level of a skilled artisan.
- Methods using CRISPR systems, e.g., for introducing double-strand DNA breaks in an LDLRAP1 gene are known in the art, and can be combined, e.g., with donor nucleic acids for homology-directed DNA repair (HDR) to replace mutant sequences in the LDLRAP1 gene with wild-type sequences.
- HDR homology-directed DNA repair
- exemplary target sequences for guide RNA sequences can include any set forth in SEQ ID NOS: 122-127.
- kits, gRNA vectors, and donor vectors for introducing double-strand DNA breaks in an LDLRAP1 gene and correcting mutations by HDR are readily available, e.g., from Santa Cruz Biotechnology (see, e.g., catalog number sc-406114, sc-406114-KO-2, and sc-406114-HDR-2) or GeneCopoeia (see, e.g., catalog number HTN207062).
- a genome-editing complex or nanoparticle as described herein is used to introduce a gene encoding LDLRAP1.
- Methods of using such systems with template DNA comprising a gene encoding LDLRAP1 are well within the level of a skilled artisan.
- CRISPR systems e.g., for introducing double-strand DNA breaks in a genome are known in the art, and can be combined, e.g., with donor nucleic acids for HDR-mediated insertion of a gene encoding LDLRAP1 into the genome.
- a genome-editing complex or nanoparticle as described herein is used to repress PCSK9 expression, such as by gene knockout.
- Methods of using such systems to repress cell expression of PCSK9 are well within the level of a skilled artisan.
- Exemplary PCSK9-specific target sequences for guide RNA/DNA sequences can include any set forth in SEQ ID NOS: 131-136.
- kits, gRNA vectors, and donor vectors for introducing double-strand DNA breaks in a PCSK9 gene are readily available, e.g., from Santa Cruz Biotechnology (see, e.g., catalog number sc-402445) or GeneCopoeia (see, e.g., catalog number HTN206606).
- the disease to be treated is a genetic disease, such as a hereditary disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in the genetic disease development and/or progression.
- the genome-editing system corrects a mutation in one or more genes encoding proteins involved in the genetic disease development and/or progression.
- the genetic disease includes, but is not limited to, 22q11.2 deletion syndrome, achondroplasia, Alpha-1 Antitrypsin Deficiency, Angelman syndrome, Autosomal dominant polycystic kidney disease, breast cancer, Canavan disease, Charcot–Marie–Tooth disease, colon cancer, Color blindness, Cystic fibrosis, Duchenne muscular dystrophy, Factor V Leiden thrombophilia, Familial Mediterranean Fever, Fragile X syndrome, Gaucher disease, Haemochromatosis, Haemophilia, Huntington's disease, Marfan syndrome, Myotonic dystrophy, Osteogenesis imperfecta, Parkinson’s disease, Phenylketonuria, Polycystic kidney disease, porphyria, Prader–Willi syndrome, progeria, SCID, Sickle-cell disease, Spinal muscular atrophy, Tay–Sachs disease, thalassemia, Trimethylamine, and Wilson’s disease.
- the genes involved in the genetic disease development and/or progression include, but are not limited to, AAT, ADA, ALAD, ALAS2, APC, ASPM, ATP7B, BDNF, BRCA1, BRCA2, CFTR, COL1A1, COL1A2, COMT, CNBP, CPOX, CREBBP, CRH, CRTAP, CXCR4, DHFR, DMD, DMPK, F5, FBN1, FECHFGFR3, FGR3, FIX, FVIII, FMO3, FMR1, GARS, GBA, HBB, HEXA, HFE, HMBS, HTT, IL2RG, KRT14, KRT5, LMNA, LRRK2, MEFV, MLH1, MSH2, MSH6, PAH, PARK2, PARK3, PARK7, PGL2, PHF8, PINK1, PKD1, PKD2, PMS1, PMS2, PPOX, RHO, SDHB, SDHC, SDHD, SMNI,
- the disease to be treated is an aging or degenerative disease
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in the aging or degenerative disease development and/or progression.
- the one or more genes encoding proteins involved in the aging or degenerative disease development and/or progression include, but are not limited to, keratin K6A, keratin K6B, keratin 16, keratin 17, p53, ß-2 adrenergic receptors (ADRB2), TRPV1, VEGF, VEGFR, HIF-1, and caspase-2, including mutants thereof.
- the disease to be treated is a fibrotic or inflammatory disease
- the pharmaceutical composition comprises a genome- editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modifies the sequence and/or expression of one or more genes encoding proteins involved in the fibrotic or inflammatory disease development and/or progression.
- the one or more genes encoding proteins involved in the fibrotic or inflammatory disease development and/or progression are selected from the group consisting of SPARC, CTGF, TGF ⁇ 1, TGF ⁇ receptors 1, TGF ⁇ receptors 2, TGF ⁇ receptors 3, VEGF, Angiotensin II, TIMP, HSP47, thrombospondin, CCN1, LOXL2, MMP2, MMP9, CCL2, Adenosine receptor A2A, Adenosine receptor A2B, Adenylyl cyclase, Smad 3, Smad 4, Smad 7, SOX9, arrestin, PDCD4, PAI-1, NF- ⁇ B, and PARP-1, including mutants thereof.
- the pharmaceutical composition comprises a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modulates the expression of one or more miRNAs involved in a disease or condition.
- a genome-editing complex or nanoparticle comprising one or more molecules of a genome-editing system (such as the entire genome-editing system) that modulates the expression of one or more miRNAs involved in a disease or condition.
- the disease or conditoin includes, but is not limited to, hepatitis B, hepatitis C, polycystic liver and kidney disease, cancer, cardiovascular disease, cardiac failure, cardiac hypertrophy, neurodevelopmental disease, fragile X syndrome, Rett syndrome, Down syndrome, Alzheimer’s disease, Huntington’s disease, schizophrenia, inflammatory disease, rheumatoid arthritis, systemic lupus erythematosus, psoriasis, and skeletal muscle disease.
- the one or more miRNAs include, but are not limited to, has-mir-126 ⁇ , Has-miR- 191, has-mir-205, has-mir-21, hsa-let-7a-2, let-7 family, let-7c, let-7f-1, miR-1, miR-100, miR- 103, miR-103-1, miR-106b-25, miR-107, miR-10b, miR-112, miR-122, miR-125b, miR-125b-2, miR125bl, miR-126, miR-128a, mIR-132, miR-133, miR-133b, miR135, miR-140, miR-141, miR-142-3p, miR143, miR-143, miR145, miR-145, miR-146, miR-146b, miR150, miR-155, miR-15a, miR-15b, miR16, miR-16, miR-17-19 family, miR-173p, miR17
- the pharmaceutical composition is administered to the individual by any of intravenous, intratumoral, intraarterial, topical, intraocular, ophthalmic, intraportal, intracranial, intracerebral, intracerebroventricular, intrathecal, intravesicular, intradermal, subcutaneous, intramuscular, intranasal, intratracheal, pulmonary, intracavity, or oral administration.
- the individual is a mammal. In some embodiments, the individual is human.
- a method of delivering one or more molecules of a genome-editing system into a cell comprising contacting the cell with a genome- editing complex or nanoparticle as described herein, wherein the complex or nanoparticle comprises the one or more genome-editing system molecules.
- the complex or nanoparticle comprises a CPP comprising the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the contacting of the cell with the complex or nanoparticle is carried out in vivo. In some embodiments, the contacting of the cell with the complex or nanoparticle is carried out ex vivo.
- the contacting of the cell with the complex or nanoparticle is carried out in vitro.
- the cell is an immortalized cell, such as a cell from a cell line.
- the cell is a primary cell, such as a cell from an individual.
- the cell is an immune cell, such as a granulocyte, a mast cell, a monocyte, a dendritic cell, a B cell, a T cell, or a natural killer cell.
- the cell is a peripheral blood–derived T cell, a central memory T cell, a cord blood–derived T cell, or a hematopoietic stem cell or other precursor cell.
- the T cell is an immortalized T cell, such as a T cell from a T cell line.
- the T cell is a primary T cell, such as a T cell of an individual.
- the cell is a T cell, and the contacting is carried out after activating the T cell.
- the cell is a T cell, and the contacting is carried out at least 12 hours (such as at least about any of 12 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, or more) after activating the T cell.
- the T cell is activated using an anti-CD3/CD28 reagent (such as microbeads).
- the cell is a fibroblast.
- the fibroblast is a primary fibroblast, such as a fibroblast of an individual.
- the cell is a hepatocyte.
- the hepatocyte is a primary hepatocyte, such as a hepatocyte of an individual.
- the cell is a human lung progenitor cell (LPC).
- the cell is a neuronal cell.
- the genome-editing system comprises a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN. In some embodiments, the genome-editing nuclease is a TALEN. In some embodiments, the genome-editing system is a CRISPR system. In some embodiments, the one or more CRISPR system molecules are selected from the group consisting of CRISPR-associated proteins (e.g., an RGEN, such as Cas9, or a nucleic acid encoding the RGEN) and nucleic acids (e.g., gRNAs and donor nucleic acid).
- CRISPR-associated proteins e.g., an RGEN, such as Cas9, or a nucleic acid encoding the RGEN
- nucleic acids e.g., gRNAs and donor nucleic acid
- the genome-editing system comprises an integrase (or a nucleic acid encoding the integrase). In some embodiments, the genome-editing system further comprises a donor nucleic acid comprising a recombination site recognized by the integrase. In some embodiments, the genome-editing system is useful for the treatment of a disease, such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases). In some embodiments, the complex or nanoparticle further comprises one or more molecules of an additional genome-editing system. In some embodiments, the additional genome-editing system is useful for the treatment of the disease. In some embodiments, the method further comprises contacting the cell with an expression complex according to any of the embodiments described herein. In some
- the method further comprises contacting the cell with an expression complex comprising a cell-penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a recombinant receptor, such as chimeric antigen receptor.
- the recombinant receptor is a chimeric antigen receptor that specifically binds to an antigen associated with the disease.
- a method of delivering one or more molecules of a genome-editing system into a cell comprising contacting the cell with a genome- editing complex or nanoparticle as described herein, wherein the genome-editing complex or nanoparticle comprises the one or more genome-editing system molecules and a CPP comprising the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the contacting of the cell with the complex or nanoparticle is carried out in vivo. In some embodiments, the contacting of the cell with the complex or nanoparticle is carried out ex vivo. In some embodiments, the contacting of the cell with the complex or nanoparticle is carried out in vitro.
- the cell is an immortalized cell, such as a cell from a cell line.
- the cell is a primary cell, such as a cell from an individual.
- the cell is an immune cell, such as a granulocyte, a mast cell, a monocyte, a dendritic cell, a B cell, a T cell, or a natural killer cell.
- the T cell is an immortalized T cell, such as a T cell from a T cell line.
- the T cell is a primary T cell, such as a T cell of an individual.
- the cell is a fibroblast.
- the fibroblast is a primary fibroblast, such as a fibroblast of an individual.
- the cell is a hepatocyte.
- the hepatocyte is a primary hepatocyte, such as a hepatocyte of an individual.
- the cell is a human lung progenitor cell (LPC).
- the cell is a neuronal cell.
- the genome- editing system comprises a genome-editing nuclease (or a nucleic acid encoding the genome- editing nuclease).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing system further comprises a gRNA or gDNA (or a nucleic acid encoding the gRNA or gDNA).
- the genome-editing system further comprises a donor nucleic acid for introducing a specific modification to the target polynucleotide.
- the genome-editing nuclease is a TALEN.
- the genome-editing system is a CRISPR system (e.g., CRISPR/Cas9).
- the genome-editing system comprises an integrase (or a nucleic acid encoding the integrase). In some embodiments, the genome-editing system further comprises a donor nucleic acid comprising a recombination site recognized by the integrase. In some embodiments, the genome-editing system is useful for the treatment of a disease, such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- a disease such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- the genome-editing system is useful for modulating a protein involved in a disease, such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- a disease such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- diseases to be treated described herein e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases.
- the method further comprises contacting the cell with an expression complex comprising a cell-penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a recombinant receptor, such as chimeric antigen receptor.
- the recombinant receptor is a chimeric antigen receptor that specifically binds to an antigen associated with the disease.
- the cell- penetrating peptide is an ADGN-100 peptide or a VEPEP-3 peptide.
- a method of delivering one or more CRISPR system (e.g., CRISPR/Cas9) molecules into a cell comprising contacting the cell with a genome- editing complex or nanoparticle as described herein, wherein the genome-editing complex or nanoparticle comprises the one or more CRISPR system molecules and a CPP selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the contacting of the cell with the complex or nanoparticle is carried out in vivo. In some embodiments, the contacting of the cell with the complex or nanoparticle is carried out ex vivo.
- the contacting of the cell with the complex or nanoparticle is carried out in vitro.
- the cell is an immortalized cell, such as a cell from a cell line.
- the cell is a primary cell, such as a cell from an individual.
- the cell is an immune cell, such as a granulocyte, a mast cell, a monocyte, a dendritic cell, a B cell, a T cell, or a natural killer cell.
- the T cell is an immortalized T cell, such as a T cell from a T cell line.
- the T cell is a primary T cell, such as a T cell of an individual.
- the cell is a fibroblast. In some embodiments, the fibroblast is a primary fibroblast, such as a fibroblast of an individual. In some embodiments, the cell is a hepatocyte. In some embodiments, the hepatocyte is a primary hepatocyte, such as a hepatocyte of an individual. In some embodiments, the cell is a human lung progenitor cell (LPC). In some embodiments, the cell is a neuronal cell.
- LPC human lung progenitor cell
- the CRISPR system is useful for the treatment of a disease, such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- a disease such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- the CRISPR system is useful for modulating a protein involved in a disease, such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- the method further comprises contacting the cell with an expression complex comprising a cell-penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a recombinant receptor, such as chimeric antigen receptor.
- the recombinant receptor is a chimeric antigen receptor that specifically binds to an antigen associated with the disease.
- the cell- penetrating peptide is an ADGN-100 peptide or a VEPEP-3 peptide.
- the CRISPR system molecules include Cas9 (or a nucleic acid encoding Cas9) and a gRNA (or a nucleic acid encoding the gRNA), and optionally a donor nucleic acid for introducing a modification.
- a method of delivering one or more CRISPR system molecules into a cell comprising contacting the cell with a genome-editing complex or nanoparticle as described herein, wherein the genome-editing complex or nanoparticle comprises the one or more CRISPR system molecules and a CPP comprising the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the contacting of the cell with the complex or nanoparticle is carried out in vivo. In some embodiments, the contacting of the cell with the complex or nanoparticle is carried out ex vivo. In some embodiments, the contacting of the cell with the complex or nanoparticle is carried out in vitro.
- the cell is an immortalized cell, such as a cell from a cell line.
- the cell is a primary cell, such as a cell from an individual.
- the cell is an immune cell, such as a granulocyte, a mast cell, a monocyte, a dendritic cell, a B cell, a T cell, or a natural killer cell.
- the T cell is an immortalized T cell, such as a T cell from a T cell line.
- the T cell is a primary T cell, such as a T cell of an individual.
- the cell is a fibroblast.
- the fibroblast is a primary fibroblast, such as a fibroblast of an individual.
- the cell is a hepatocyte.
- the hepatocyte is a primary hepatocyte, such as a hepatocyte of an individual.
- the cell is a human lung progenitor cell (LPC).
- the cell is a neuronal cell.
- the CRISPR system is useful for the treatment of a disease, such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- the CRISPR system is useful for modulating a protein involved in a disease, such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- a disease such as any of the diseases to be treated described herein (e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases).
- diseases to be treated described herein e.g., cancer, diabetes, inflammatory diseases, fibrosis, viral infectious diseases, hereditary diseases, ocular diseases, and aging and degenerative diseases.
- the method further comprises contacting the cell with an expression complex comprising a cell-penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a recombinant receptor, such as chimeric antigen receptor.
- the recombinant receptor is a chimeric antigen receptor that specifically binds to an antigen associated with the disease.
- the cell- penetrating peptide is an ADGN-100 peptide or a VEPEP-3 peptide.
- the CRISPR system molecules include Cas9 (or a nucleic acid encoding Cas9) and a gRNA (or a nucleic acid encoding the gRNA), and optionally a donor nucleic acid for introducing a modification.
- a method of delivering one or more molecules of a genome-editing system into a T cell comprising contacting the cell with a genome-editing complex or nanoparticle as described herein, wherein the complex or nanoparticle comprises the one or more genome-editing system molecules and a CPP selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the contacting of the T cell with the complex or nanoparticle is carried out in vivo. In some embodiments, the contacting of the T cell with the complex or nanoparticle is carried out ex vivo.
- the contacting of the T cell with the complex or nanoparticle is carried out in vitro.
- the T cell is an immortalized T cell, such as a T cell from a T cell line.
- the T cell is a primary T cell, such as a T cell of an individual.
- the one or more genome- editing system molecules comprise a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease, such as an mRNA or DNA plasmid).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing nuclease is a nucleic acid-guided nuclease (e.g., an RGEN or DGEN), and the cell-penetrating peptides are complexed with the nucleic acid-guided nuclease (or a nucleic acid encoding the nucleic acid-guided nuclease) in combination with (such as complexed with) a guide sequence (or a nucleic acid encoding a guide sequence) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the one or more genome-editing system molecules further comprises a donor nucleic acid as a template for homology-directed repair.
- the one or more genome-editing system molecules comprise a genome-editing integrase (or a nucleic acid encoding the genome-editing integrase), optionally in combination with (such as complexed with) a donor nucleic acid comprising a recombination site recognized by the integrase to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the genome-editing system is useful for the treatment of a disease, such as any of the diseases to be treated described herein.
- the complex or nanoparticle further comprises one or more molecules of an additional genome-editing system.
- the additional genome-editing system is useful for the treatment of the disease.
- the method further comprises contacting the cell with an expression complex comprising a cell-penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a recombinant receptor, such as chimeric antigen receptor.
- the recombinant receptor is a chimeric antigen receptor that specifically binds to an antigen associated with the disease.
- a method of delivering one or more CRISPR system molecules into a T cell comprising contacting the cell with a genome-editing complex or nanoparticle as described herein, wherein the complex or nanoparticle comprises the one or more CRISPR system molecules and a CPP comprising the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the contacting of the T cell with the complex or nanoparticle is carried out in vivo. In some embodiments, the contacting of the T cell with the complex or nanoparticle is carried out ex vivo. In some embodiments, the contacting of the T cell with the complex or nanoparticle is carried out in vitro.
- the T cell is an immortalized T cell, such as a T cell from a T cell line.
- the T cell is a primary T cell, such as a T cell of an individual.
- the one or more CRISPR system molecules are selected from the group consisting of CRISPR-associated proteins (e.g., RGENs, such as Cas9, including nucleic acids encoding the RGEN) and nucleic acids (e.g., gRNAs and donor nucleic acid).
- the CRISPR system is useful for the treatment of a disease, such as any of the diseases to be treated described herein.
- the complex or nanoparticle further comprises one or more molecules of an additional CRISPR system.
- the additional CRISPR system is useful for the treatment of the disease.
- the method further comprises contacting the cell with an expression complex comprising a cell-penetrating peptide (such as any of the cell- penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP- 9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a recombinant receptor, such as chimeric antigen receptor.
- the recombinant receptor is a chimeric antigen receptor that specifically binds to an antigen associated with the disease.
- the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-3 peptide.
- a method of delivering one or more molecules of a genome-editing system into a fibroblast comprising contacting the fibroblast with a genome-editing complex or nanoparticle as described herein, wherein the complex or nanoparticle comprises the one or more genome-editing system molecules and a CPP selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the contacting of the fibroblast with the complex or nanoparticle is carried out in vivo. In some embodiments, the contacting of the fibroblast with the complex or nanoparticle is carried out ex vivo.
- the contacting of the fibroblast with the complex or nanoparticle is carried out in vitro.
- the fibroblast is an immortalized fibroblast, such as a fibroblast from a fibroblast line.
- the fibroblast is a primary fibroblast, such as a fibroblast of an individual.
- the one or more genome-editing system molecules comprise a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease, such as an mRNA or DNA plasmid).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing nuclease is a nucleic acid-guided nuclease (e.g., an RGEN or DGEN), and the cell-penetrating peptides are complexed with the nucleic acid-guided nuclease (or a nucleic acid encoding the nucleic acid- guided nuclease) in combination with (such as complexed with) a guide sequence (or a nucleic acid encoding a guide sequence) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the one or more genome-editing system molecules further comprises a donor nucleic acid as a template for homology-directed repair.
- the one or more genome-editing system molecules comprise a genome- editing integrase (or a nucleic acid encoding the genome-editing integrase), optionally in combination with (such as complexed with) a donor nucleic acid comprising a recombination site recognized by the integrase to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the genome-editing system is useful for the treatment of a disease, such as any of the diseases to be treated described herein.
- the complex or nanoparticle further comprises one or more molecules of an additional genome-editing system.
- the additional genome-editing system is useful for the treatment of the disease.
- the method further comprises contacting the cell with an expression complex comprising a cell-penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a recombinant receptor, such as chimeric antigen receptor.
- the recombinant receptor is a chimeric antigen receptor that specifically binds to an antigen associated with the disease.
- a method of delivering one or more molecules of a genome-editing system into a hepatocyte comprising contacting the hepatocyte with a genome-editing complex or nanoparticle as described herein, wherein the complex or nanoparticle comprises the one or more genome-editing system molecules and a CPP selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the contacting of the hepatocyte with the complex or nanoparticle is carried out in vivo. In some embodiments, the contacting of the hepatocyte with the complex or nanoparticle is carried out ex vivo.
- the contacting of the hepatocyte with the complex or nanoparticle is carried out in vitro.
- the hepatocyte is an immortalized hepatocyte, such as a hepatocyte from a hepatocyte line.
- the hepatocyte is a primary hepatocyte, such as a hepatocyte of an individual.
- the one or more genome-editing system molecules comprise a genome-editing nuclease (or a nucleic acid encoding the genome-editing nuclease, such as an mRNA or DNA plasmid).
- the genome-editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing nuclease is a nucleic acid-guided nuclease (e.g., an RGEN or DGEN), and the cell-penetrating peptides are complexed with the nucleic acid-guided nuclease (or a nucleic acid encoding the nucleic acid-guided nuclease) in combination with (such as complexed with) a guide sequence (or a nucleic acid encoding a guide sequence) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the one or more genome-editing system molecules further comprises a donor nucleic acid as a template for homology-directed repair.
- the one or more genome-editing system molecules comprise a genome-editing integrase (or a nucleic acid encoding the genome-editing integrase), optionally in combination with (such as complexed with) a donor nucleic acid comprising a recombination site recognized by the integrase to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the genome-editing system is useful for the treatment of a disease, such as any of the diseases to be treated described herein.
- the complex or nanoparticle further comprises one or more molecules of an additional genome-editing system.
- the additional genome-editing system is useful for the treatment of the disease.
- the method further comprises contacting the cell with an expression complex comprising a cell-penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a recombinant receptor, such as chimeric antigen receptor.
- the recombinant receptor is a chimeric antigen receptor that specifically binds to an antigen associated with the disease.
- a method of delivering one or more molecules of a genome-editing system into a cell in an individual comprising administering to the individual a composition comprising a genome-editing complex or nanoparticle as described herein, wherein the complex or nanoparticle comprises the one or more genome-editing system molecules and a CPP selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- the composition is administered to the individual via an intravenous, intraarterial, intraperitoneal, intravesicular, subcutaneous, intrathecal, intracranial, intracerebral, intracerebroventricular, intrapulmonary, intramuscular, intratracheal, intraocular, ophthalmic, intraportal, transdermal, intradermal, oral, sublingual, topical, or inhalation route.
- the composition is administered to the individual via an intravenous route.
- the composition is administered to the individual via a subcutaneous route.
- the cell is present in an organ or tissue including lung, liver, brain, kidney, heart, spleen, blood, pancreas, muscle, bone marrow, and intestine.
- the cell is present in the lung, liver, kidney, or spleen of the individual.
- the one or more genome-editing system molecules comprise a genome-editing nuclease (or a nucleic acid encoding the genome- editing nuclease, such as an mRNA or DNA plasmid).
- the genome- editing nuclease is a ZFN, TALEN, homing endonuclease, RGEN, or DGEN.
- the genome-editing nuclease is a nucleic acid-guided nuclease (e.g., an RGEN or DGEN), and the cell-penetrating peptides are complexed with the nucleic acid-guided nuclease (or a nucleic acid encoding the nucleic acid-guided nuclease) in combination with (such as complexed with) a guide sequence (or a nucleic acid encoding a guide sequence) to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the one or more genome-editing system molecules further comprises a donor nucleic acid as a template for homology-directed repair.
- the one or more genome-editing system molecules comprise a genome-editing integrase (or a nucleic acid encoding the genome-editing integrase), optionally in combination with (such as complexed with) a donor nucleic acid comprising a recombination site recognized by the integrase to form a genome-editing complex or nanoparticle capable of being delivered to a cell.
- the cell is an immune cell, such as a granulocyte, a mast cell, a monocyte, a dendritic cell, a B cell, a T cell, or a natural killer cell.
- the cell is a fibroblast.
- the cell is a hepatocyte. In some embodiments, the cell is a human lung progenitor cell (LPC). In some embodiments, the cell is a neuronal cell. In some embodiments, the individual has, or is at risk of developing, a disease, and the CRISPR system is useful for the treatment of the disease.
- the composition further comprises an expression complex comprising a cell-penetrating peptide (such as any of the cell- penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP- 9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a chimeric antigen receptor.
- a cell-penetrating peptide such as any of the cell- penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP- 9 peptides, and ADGN-100 peptides
- the chimeric antigen receptor specifically binds to an antigen associated with the disease.
- the composition is a pharmaceutical composition, and further comprises a pharmaceutically acceptable carrier.
- the individual is a mammal. In some embodiments, the individual is human.
- a method of delivering one or more CRISPR system molecules into a cell in an individual comprising administering to the individual a composition comprising a genome-editing complex or nanoparticle as described herein, wherein the complex or nanoparticle comprises the one or more CRISPR system molecules and a CPP comprising the amino acid sequence of a VEPEP-3 peptide, a VEPEP-6 peptide, a VEPEP-9 peptide, or an ADGN-100 peptide.
- the VEPEP-3 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 1-14, 75, and 76.
- the VEPEP-6 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 15-40, and 77.
- the VEPEP-9 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 41-52, and 78.
- the ADGN-100 peptide comprises the amino acid sequence of any one of SEQ ID NOs: 53-70, 79, and 80.
- the composition is administered to the individual via an intravenous, intraarterial, intraperitoneal, intravesicular, subcutaneous, intrathecal, intracranial, intracerebral, intracerebroventricular, intrapulmonary, intramuscular, intratracheal, intraocular, ophthalmic, intraportal, transdermal, intradermal, oral, sublingual, topical, or inhalation route.
- the composition is administered to the individual via an intravenous route.
- the composition is administered to the individual via an intravenous route.
- the composition is administered to the individual via an intravenous route.
- the one or more CRISPR system molecules are selected from the group consisting of CRISPR- associated proteins (e.g., RGENs, such as Cas9, including nucleic acids encoding the RGEN) and nucleic acids (e.g., gRNAs and donor nucleic acid).
- the cell is an immune cell, such as a granulocyte, a mast cell, a monocyte, a dendritic cell, a B cell, a T cell, or a natural killer cell.
- the cell is a fibroblast.
- the cell is a hepatocyte.
- the cell is a human lung progenitor cell (LPC). In some embodiments, the cell is a neuronal cell. In some embodiments, the individual has, or is at risk of developing, a disease, and the CRISPR system is useful for the treatment of the disease.
- the composition further comprises an expression complex comprising a cell- penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides) and a nucleic acid molecule encoding a chimeric antigen receptor. In some embodiments, the chimeric antigen receptor specifically binds to an antigen associated with the disease. In some embodiments, a cell- penetrating peptide (such as any of the cell-penetrating peptides described herein, including VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptide
- the cell-penetrating peptide is an ADGN-100 peptide or a VEPEP-3 peptide.
- the composition is a pharmaceutical composition, and further comprises a pharmaceutically acceptable carrier.
- the individual is a mammal. In some embodiments, the individual is human.
- a method of producing an engineered cell comprising a method described herein for delivering one or more molecules of a genome-editing system into a cell.
- the method is an improvement over previous methods of producing an engineered cell, such as methods involving the use of electroporation or viral transfection.
- the improvement includes, without limitation, increasing the efficiency of the method, reducing costs associated with the method, reducing cellular toxicity of the method, and/or reducing the complexity of the method (such as by eliminating the need for precautions necessary when using viral methods for cells intended for use in humans).
- a method of stabilizing one or more molecules of a genome-editing system comprising combining the one or more genome-editing system molecules with a CPP as described herein, thereby stabilizing the one or more genome-editing system molecules.
- the one or more genome-editing system molecules and the CPP form a genome- editing complex or nanoparticle as described herein.
- the one or more genome-editing system molecules includes a nucleic acid and the CPP stabilizes the supercoil structure of the nucleic acid.
- the one or more genome-editing system molecules are susceptible to degradation (for example by serum components or nucleases in vitro or in vivo), and the CPP protects the one or more genome-editing system molecules from the degradation.
- a first set of one or more molecules of a genome-editing system (such as CRISPR system molecules) and a second set of one or more molecules of a genome-editing system can be delivered into a cell by combining any of the methods described herein for delivering a plurality of genome-editing system molecules into a cell.
- Possible combinations contemplated include combinations of two or more of any of the methods described herein. Kits
- kits, reagents, and articles of manufacture useful for the methods described herein.
- Such kits may contain vials containing the CPPs, assembly molecules and/or other cell-penetrating peptides, separately from vials containing the one or more genome- editing system molecules (such as CRISPR system molecules).
- CRISPR system molecules such as CRISPR system molecules
- kits comprising: 1) a CPP, and optionally 2) one or more molecules of a genome-editing system.
- the kit further comprises assembly molecules and/or other cell-penetrating peptides.
- the kit further comprises a nucleic acid molecule encoding an exogenous molecule and optionally a cell-penetrating peptide, as described herein for use in an expression complex.
- the kit further comprises agents for determining gene expression profiles.
- the kit further comprises a pharmaceutically acceptable carrier.
- kits described herein may further comprise instructions for using the components of the kit to practice the subject methods (for example instructions for making the
- the instructions for practicing the subject methods are generally recorded on a suitable recording medium.
- the instructions may be printed on a substrate, such as paper or plastic, etc.
- the instructions may be present in the kits as a package insert, in the labeling of the container of the kits or components thereof (i.e., associated with the packaging or sub packaging) etc.
- the instructions are present as an electronic storage data file present on a suitable computer readable storage medium, e.g., CD- ROM, diskette, etc.
- the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, e.g., via the internet, are provided.
- An example of this embodiment is a kit that includes a web address where the instructions can be viewed and/or from which the instructions can be downloaded. As with the instructions, this means for obtaining the instructions is recorded on a suitable substrate
- the various components of the kit may be in separate containers, where the containers may be contained within a single housing, e.g., a box.
- Embodiment 1 there is provided a genome-editing complex for modifying a target polynucleotide comprising a cell-penetrating peptide and one or more molecules of a genome-editing system, wherein the cell-penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides, and wherein the one or more genome-editing system molecules are selected from the group consisting of:
- RNA-guided endonuclease RGEN
- gRNA guide RNA
- gDNA comprises a guide sequence complementary to a target sequence in the target polynucleotide
- ZFP zinc finger protein
- TALEN transcription activator-like effector nuclease
- Embodiment 2 The genome-editing complex of embodiment 1, wherein the cell- penetrating peptide is a VEPEP-3 peptide.
- Embodiment 3 The genome-editing complex of embodiment 2, wherein the cell- penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-14.
- Embodiment 4 The genome-editing complex of embodiment 2, wherein the cell- penetrating peptide comprises the amino acid sequence of SEQ ID NO: 75 or 76.
- Embodiment 5 The genome-editing complex of embodiment 1, wherein the cell- penetrating peptide is a VEPEP-6 peptide.
- Embodiment 6 The genome-editing complex of embodiment 5, wherein the cell- penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 15-40.
- Embodiment 7 The genome-editing complex of embodiment 5, wherein the cell- penetrating peptide comprises the amino acid sequence of SEQ ID NO: 77.
- Embodiment 8 The genome-editing complex of embodiment 1, wherein the cell- penetrating peptide is a VEPEP-9 peptide.
- Embodiment 9 The genome-editing complex of embodiment 8, wherein the cell- penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 41-52.
- Embodiment 10 The genome-editing complex of embodiment 8, wherein the cell- penetrating peptide comprises the amino acid sequence of SEQ ID NO: 78.
- Embodiment 11 The genome-editing complex of embodiment 1, wherein the cell- penetrating peptide is an ADGN-100 peptide.
- Embodiment 12 The genome-editing complex of embodiment 11, wherein the cell- penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 53-70.
- Embodiment 13 The genome-editing complex of embodiment 11, wherein the cell- penetrating peptide comprises the amino acid sequence of SEQ ID NO: 79 or 80.
- Embodiment 14 The genome-editing complex of any one of embodiments 1-13, wherein the cell-penetrating peptide further comprises one or more moieties covalently linked to the N-terminus of the cell-penetrating peptide, and wherein the one or more moieties are selected from the group consisting of an acetyl, a fatty acid, a cholesterol, a poly-ethylene glycol, a nuclear localization signal, nuclear export signal, an antibody, a polysaccharide and a targeting molecule.
- Embodiment 15 The genome-editing complex of embodiment 14, wherein the cell- penetrating peptide comprises an acetyl group covalently linked to its N-terminus.
- Embodiment 16 The genome-editing complex of any one of embodiments 1-15, wherein the cell-penetrating peptide further comprises one or more moieties covalently linked to the C-terminus of the cell-penetrating peptide, and wherein the one or more moieties are selected from the group consisting of a cysteamide, a cysteine, a thiol, an amide, a nitrilotriacetic acid optionally substituted, a carboxyl, a linear or ramified C 1 -C 6 alkyl optionally substituted, a primary or secondary amine, an osidic derivative, a lipid, a phospholipid, a fatty acid, a cholesterol, a poly-ethylene glycol, a nuclear localization signal, nuclear export signal
- Embodiment 17 The genome-editing complex of embodiment 16, wherein the cell- penetrating peptide comprises a cysteamide group covalently linked to its C-terminus.
- Embodiment 18 The genome-editing complex of any one of embodiments 1-17, wherein at least some of the cell-penetrating peptides in the genome-editing complex are linked to a targeting moiety by a linkage.
- Embodiment 19 The genome-editing complex of embodiment 18, wherein the linkage is covalent.
- Embodiment 20 The genome-editing complex of any one of embodiments 1-19, wherein the genome-editing complex comprises one or both of an RGEN and a gRNA.
- Embodiment 21 The genome-editing complex of embodiment 20, wherein the genome-editing complex comprises an RGEN and a gRNA.
- Embodiment 22 The genome-editing complex of embodiment 20 or 21, wherein the gRNA is a single guide RNA (sgRNA).
- sgRNA single guide RNA
- Embodiment 23 The genome-editing complex of any one of embodiments 20-22, wherein the RGEN is Cas9.
- Embodiment 24 The genome-editing complex of any one of embodiments 20-23, wherein the molar ratio of RGEN to gRNA is between about 1:10 and about 10:1.
- Embodiment 25 The genome-editing complex of any one of embodiments 20-24, wherein the molar ratio of the cell-penetrating peptide to the RGEN is between about 1:1 and about 80:1.
- Embodiment 26 The genome-editing complex of embodiment 25, wherein the molar ratio of the cell-penetrating peptide to the RGEN is between about 5:1 and about 20:1.
- Embodiment 27 The genome-editing complex of any one of embodiments 20-26, further comprising one or more additional gRNAs comprising different guide sequences.
- Embodiment 28 The genome-editing complex of embodiment 27, wherein the target sequence is present in a target gene, and the one or more additional gRNAs individually comprise a guide sequence complementary to a sequence in the target gene.
- Embodiment 29 The genome-editing complex of embodiment 27, wherein the target sequence is present in a first target gene, and the one or more additional gRNAs individually comprise a guide sequence complementary to a sequence present in one or more additional target genes.
- Embodiment 30 The genome-editing complex of any one of embodiments 1-19, wherein the genome-editing complex comprises one or both of a DGEN and a gDNA.
- Embodiment 31 The genome-editing complex of any one of embodiments 20, wherein the genome-editing complex comprises a DGEN and a gDNA.
- Embodiment 32 The genome-editing complex of any one of embodiments 1-19, wherein the genome-editing complex comprises a ZFP.
- Embodiment 33 The genome-editing complex of any one of embodiments 1-19, wherein the genome-editing complex comprises a TALEN.
- Embodiment 34 The genome-editing complex of any one of embodiments 1-19, wherein the genome-editing complex comprises a homing nuclease.
- Embodiment 35 The genome-editing complex of any one of embodiments 20-34, further comprising a donor nucleic acid for introducing a modification to the target
- the donor nucleic acid comprises a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification.
- Embodiment 36 The genome-editing complex of embodiment 35, wherein the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide.
- Embodiment 37 The genome-editing complex of embodiment 35 or 36, wherein the donor nucleic acid is a single-stranded DNA oligonucleotide.
- Embodiment 38 The genome-editing complex of embodiment 35, wherein the modification is insertion of a heterologous nucleic acid in the target polynucleotide.
- Embodiment 39 The genome-editing complex of embodiment 35 or 38, wherein the donor nucleic acid is a double-stranded DNA comprising the heterologous nucleic acid flanked by a 5’ homology arm and a 3’ homology arm, and wherein the 5’ homology arm and the 3’ homology arm are homologous to sequences flanking the region of the target polynucleotide to be modified.
- Embodiment 40 The genome-editing complex of any one of embodiments 35-39, further comprising one or more additional donor nucleic acids for introducing modifications to one or more additional target polynucleotides.
- Embodiment 41 The genome-editing complex of any one of embodiments 1-19, wherein the genome-editing complex comprises an integrase.
- Embodiment 42 The genome-editing complex of embodiment 41, further comprising a donor nucleic acid for insertion into the target polynucleotide, wherein the integrase recognizes a recombination site in the donor nucleic acid and is capable of mediating recombination between the recombination site in the target polynucleotide and the recombination site in the donor nucleic acid to insert the donor nucleic acid into the target polynucleotide.
- Embodiment 43 The genome-editing complex of any one of embodiments 1-42, wherein the average diameter of the genome-editing complex is between about 10 nm and about 300 nm.
- Embodiment 44 In some embodiments, there is provided a nanoparticle comprising a core comprising the genome-editing complex of any one of embodiments 1-43.
- Embodiment 45 The nanoparticle of embodiment 44, wherein the core further comprises one or more additional genome-editing complexes of any one of embodiments 1-43.
- Embodiment 46 The nanoparticle of embodiment 44 or 45, wherein the core further comprises a donor nucleic acid for introducing a modification to the target polynucleotide comprising a sequence corresponding to a portion of the target polynucleotide modified to comprise the modification, wherein the donor nucleic acid is complexed with a second cell- penetrating peptide.
- Embodiment 47 The nanoparticle of embodiment 46, wherein the second cell- penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- Embodiment 48 The nanoparticle of embodiment 47, wherein the second cell- penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-70 and 75-80.
- Embodiment 49 The nanoparticle of any one of embodiments 46-48, wherein the modification is addition, deletion, or substitution of one or more nucleotides in the target polynucleotide.
- Embodiment 50 The nanoparticle of embodiment 49, wherein the donor nucleic acid is a single-stranded DNA oligonucleotide.
- Embodiment 51 The nanoparticle of any one of embodiments 46-48, wherein the modification is insertion of a heterologous nucleic acid in the target polynucleotide.
- Embodiment 52 The nanoparticle of embodiment 51, wherein the donor nucleic acid is a double-stranded DNA comprising the heterologous nucleic acid flanked by a 5’ homology arm and a 3’ homology arm, and wherein the 5’ homology arm and the 3’ homology arm are homologous to sequences flanking the region of the target polynucleotide to be modified.
- Embodiment 53 The nanoparticle of any one of embodiments 46-52, wherein the core further comprises one or more additional donor nucleic acids for introducing modifications to one or more additional target polynucleotides.
- Embodiment 54 The nanoparticle of any one of embodiments 44-53, wherein at least some of the cell-penetrating peptides in the nanoparticle are linked to a targeting moiety by a linkage.
- Embodiment 55 The nanoparticle of any one of embodiments 44-53, wherein the core is coated by a shell comprising a peripheral cell-penetrating peptide.
- Embodiment 56 The nanoparticle of embodiment 55, wherein the peripheral cell- penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- Embodiment 57 The nanoparticle of embodiment 56, wherein the peripheral cell- penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-70 and 75-80.
- Embodiment 58 The nanoparticle of any one of embodiments 55-57, wherein at least some of the peripheral cell-penetrating peptides in the shell are linked to a targeting moiety by a linkage.
- Embodiment 59 The nanoparticle of embodiment 54 or 58, wherein the linkage is covalent.
- Embodiment 60 The nanoparticle of any one of embodiments 44-59, wherein the average diameter of the nanoparticle is between about 10 nm and about 400 nm.
- Embodiment 61 there is provided a pharmaceutical composition comprising the genome-editing complex of any one of embodiments 1-43 or the nanoparticle of any one of embodiments 44-60, and a pharmaceutically acceptable carrier.
- Embodiment 62 The pharmaceutical composition of embodiment 61, further comprising an expression complex comprising a third cell-penetrating peptide and a nucleic acid molecule encoding an exogenous protein.
- Embodiment 63 The pharmaceutical composition of embodiment 62, wherein the exogenous protein is a recombinant receptor capable of being expressed on the surface of a cell.
- Embodiment 64 The pharmaceutical composition of embodiment 63, wherein the recombinant receptor is a chimeric antigen receptor (CAR).
- CAR chimeric antigen receptor
- Embodiment 65 The pharmaceutical composition of any one of embodiments 62-64, wherein the third cell-penetrating peptide is selected from the group consisting of VEPEP-3 peptides, VEPEP-6 peptides, VEPEP-9 peptides, and ADGN-100 peptides.
- Embodiment 66 The pharmaceutical composition of embodiment 65, wherein the third cell-penetrating peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-70 and 75-80.
- Embodiment 67 there is provided a method of preparing the genome-editing complex of any one of embodiments 1-19, comprising combining the cell- penetrating peptide with the one or more genome-editing system molecules, thereby forming the genome-editing complex.
- Embodiment 68 The method of embodiment 67, wherein the one or more genome- editing system molecules include an RGEN and a gRNA, and wherein the cell-penetrating peptide and the RGEN are combined at a ratio from about 1:1 to about 80:1, respectively, and the RGEN and the gRNA are combined at a ratio from about 10:1 to about 1:10, respectively.
- the one or more genome- editing system molecules include an RGEN and a gRNA
- Embodiment 69 The method of embodiment 68, wherein the cell-penetrating peptide and the RGEN are combined at a ratio from about 5:1 to about 20:1, respectively.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Pharmacology & Pharmacy (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Diabetes (AREA)
- Physics & Mathematics (AREA)
- Immunology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Nanotechnology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Urology & Nephrology (AREA)
- Medical Informatics (AREA)
- Emergency Medicine (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP21170389.7A EP3910059A1 (en) | 2016-05-27 | 2017-05-26 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
| EP17733918.1A EP3464323B1 (en) | 2016-05-27 | 2017-05-26 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
| JP2018561967A JP2019521659A (ja) | 2016-05-27 | 2017-05-26 | ゲノム編集分子の細胞内送達のためのペプチドおよびナノ粒子 |
| ES17733918T ES2901215T3 (es) | 2016-05-27 | 2017-05-26 | Péptidos y nanopartículas para la liberación intracelular de moléculas de edición del genoma |
| MX2018014599A MX388294B (es) | 2016-05-27 | 2017-05-26 | Peptidos y nanoparticulas para suministro intracelular de moleculas editoras de genoma. |
| CN201780045854.3A CN109689677B (zh) | 2016-05-27 | 2017-05-26 | 用于基因组编辑分子的细胞内递送的肽和纳米颗粒 |
| AU2017268842A AU2017268842B2 (en) | 2016-05-27 | 2017-05-26 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
| CN202311385196.6A CN117431234A (zh) | 2016-05-27 | 2017-05-26 | 用于基因组编辑分子的细胞内递送的肽和纳米颗粒 |
| US16/305,003 US20190211317A1 (en) | 2016-05-27 | 2017-05-26 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
| CA3025523A CA3025523A1 (en) | 2016-05-27 | 2017-05-26 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
| ZA2018/07869A ZA201807869B (en) | 2016-05-27 | 2018-11-21 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
| JP2021184056A JP7379447B2 (ja) | 2016-05-27 | 2021-11-11 | ゲノム編集分子の細胞内送達のためのペプチドおよびナノ粒子 |
| AU2022206789A AU2022206789B9 (en) | 2016-05-27 | 2022-07-21 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
| JP2023169638A JP2023165986A (ja) | 2016-05-27 | 2023-09-29 | ゲノム編集分子の細胞内送達のためのペプチドおよびナノ粒子 |
| US18/984,678 US20250257342A1 (en) | 2016-05-27 | 2024-12-17 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
| JP2025079827A JP2025118829A (ja) | 2016-05-27 | 2025-05-12 | ゲノム編集分子の細胞内送達のためのペプチドおよびナノ粒子 |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662342823P | 2016-05-27 | 2016-05-27 | |
| US62/342,823 | 2016-05-27 | ||
| US201662394140P | 2016-09-13 | 2016-09-13 | |
| US62/394,140 | 2016-09-13 | ||
| US201762477357P | 2017-03-27 | 2017-03-27 | |
| US62/477,357 | 2017-03-27 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/305,003 A-371-Of-International US20190211317A1 (en) | 2016-05-27 | 2017-05-26 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
| US18/984,678 Continuation US20250257342A1 (en) | 2016-05-27 | 2024-12-17 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017205846A1 true WO2017205846A1 (en) | 2017-11-30 |
Family
ID=59239942
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/034862 Ceased WO2017205846A1 (en) | 2016-05-27 | 2017-05-26 | Peptides and nanoparticles for intracellular delivery of genome-editing molecules |
Country Status (9)
| Country | Link |
|---|---|
| EP (2) | EP3910059A1 (https=) |
| JP (4) | JP2019521659A (https=) |
| CN (2) | CN109689677B (https=) |
| AU (2) | AU2017268842B2 (https=) |
| CA (1) | CA3025523A1 (https=) |
| ES (1) | ES2901215T3 (https=) |
| MX (2) | MX388294B (https=) |
| WO (1) | WO2017205846A1 (https=) |
| ZA (1) | ZA201807869B (https=) |
Cited By (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019079215A1 (en) * | 2017-10-16 | 2019-04-25 | Aadigen, Llc | PEPTIDES AND NANOPARTICLES FOR INTRACELLULAR MRRNA DELIVERY |
| WO2019237387A1 (zh) * | 2018-06-16 | 2019-12-19 | 深圳市博奥康生物科技有限公司 | 用于敲除人ACT35基因的gRNA序列及其应用 |
| WO2019237384A1 (zh) * | 2018-06-16 | 2019-12-19 | 深圳市博奥康生物科技有限公司 | 用于敲除人CDw137基因的gRNA序列及其应用 |
| CN111363013A (zh) * | 2018-12-25 | 2020-07-03 | 深圳先进技术研究院 | 多组分纳米颗粒簇的构建方法 |
| WO2020174070A1 (en) | 2019-02-27 | 2020-09-03 | Cyca Oncosolutions Limited | Cell membrane penetrating conjugates for gene editing |
| WO2020214846A1 (en) * | 2019-04-17 | 2020-10-22 | Aadigen, Llc | Peptides and nanoparticles for intracellular delivery of molecules |
| US20210214729A1 (en) * | 2018-05-15 | 2021-07-15 | Messenger Biopharma | Substitution of the messenger rna cap with two rna sequences introduced at the 5-prime end thereof |
| EP3665285A4 (en) * | 2017-08-10 | 2021-08-11 | Aadigen, LLC | PEPTIDES AND NANOPARTICLES FOR INTRACELLULAR VIRUS ADMINISTRATION |
| WO2021217100A1 (en) * | 2020-04-24 | 2021-10-28 | Aadigen, Llc | Compositions for treating cancer with kras mutations and uses thereof |
| WO2022020782A1 (en) * | 2020-07-24 | 2022-01-27 | Aadigen, Llc | Compositions and methods for treating viral infections |
| JP2022530483A (ja) * | 2019-04-22 | 2022-06-29 | 交弘生物科技(上海)有限公司 | ヌクレアーゼ協同pcr原理に基づいて低存在比のdna突然変異を濃縮する検出技術システムおよび使用 |
| WO2023006704A3 (en) * | 2021-07-26 | 2023-03-09 | Imperial College Innovations Limited | Nanozyme-catalysed detection of nucleic acids |
| CN119119204A (zh) * | 2024-11-11 | 2024-12-13 | 南昌大学 | 温敏特异性多肽和基于温差特异性无损分离外泌体的方法 |
| WO2025059215A1 (en) | 2023-09-12 | 2025-03-20 | Aadigen, Llc | Methods and compositions for treating or preventing cancer |
| WO2025090926A1 (en) * | 2023-10-26 | 2025-05-01 | The Penn State Research Foundation | Ultrasound-sensitive peptide particles with surface-bound gene editing tools for spatially resolved molecule delivery |
| JP2025084877A (ja) * | 2019-01-04 | 2025-06-03 | ザ・ユニバーシティ・オブ・シカゴ | Rnaをモジュレートするためのシステムおよび方法 |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN120022385A (zh) * | 2019-05-07 | 2025-05-23 | 洛桑联邦理工学院 | Fmrp及癌症治疗 |
| CN110638789A (zh) * | 2019-10-31 | 2020-01-03 | 南开大学 | 一种可实现肿瘤靶向递送核糖核蛋白复合物的纳米粒子的制备方法和应用 |
| KR102500873B1 (ko) * | 2021-02-03 | 2023-02-17 | 한국과학기술연구원 | 자연살해세포 특이적 CRISPR/Cas 시스템을 위한 융합 단백질 및 이의 용도 |
Citations (56)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5356802A (en) | 1992-04-03 | 1994-10-18 | The Johns Hopkins University | Functional domains in flavobacterium okeanokoites (FokI) restriction endonuclease |
| US5436150A (en) | 1992-04-03 | 1995-07-25 | The Johns Hopkins University | Functional domains in flavobacterium okeanokoities (foki) restriction endonuclease |
| US5487994A (en) | 1992-04-03 | 1996-01-30 | The Johns Hopkins University | Insertion and deletion mutants of FokI restriction endonuclease |
| WO1996040958A1 (en) | 1995-06-07 | 1996-12-19 | Baylor College Of Medicine | Nucleic acid transporters for delivery of nucleic acids into a cell |
| WO2000014257A1 (en) | 1998-09-04 | 2000-03-16 | Sloan-Kettering Institute For Cancer Research | Fusion receptors specific for prostate-specific membrane antigen and uses thereof |
| US6410319B1 (en) | 1998-10-20 | 2002-06-25 | City Of Hope | CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies |
| US6453242B1 (en) | 1999-01-12 | 2002-09-17 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
| US6451995B1 (en) | 1996-03-20 | 2002-09-17 | Sloan-Kettering Institute For Cancer Research | Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods |
| US20020131960A1 (en) | 2000-06-02 | 2002-09-19 | Michel Sadelain | Artificial antigen presenting cells and methods of use thereof |
| US6503717B2 (en) | 1999-12-06 | 2003-01-07 | Sangamo Biosciences, Inc. | Methods of using randomized libraries of zinc finger proteins for the identification of gene function |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6599692B1 (en) | 1999-09-14 | 2003-07-29 | Sangamo Bioscience, Inc. | Functional genomics using zinc finger proteins |
| US6689558B2 (en) | 2000-02-08 | 2004-02-10 | Sangamo Biosciences, Inc. | Cells for drug discovery |
| US6794136B1 (en) | 2000-11-20 | 2004-09-21 | Sangamo Biosciences, Inc. | Iterative optimization in the design of binding proteins |
| US20050064474A1 (en) | 2003-08-08 | 2005-03-24 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| US20050267061A1 (en) | 2004-04-08 | 2005-12-01 | Sangamo Biosciences, Inc. | Methods and compositions for treating neuropathic and neurodegenerative conditions |
| US7030215B2 (en) | 1999-03-24 | 2006-04-18 | Sangamo Biosciences, Inc. | Position dependent recognition of GNN nucleotide triplets by zinc fingers |
| US7067317B2 (en) | 2000-12-07 | 2006-06-27 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
| US7070995B2 (en) | 2001-04-11 | 2006-07-04 | City Of Hope | CE7-specific redirected immune cells |
| US7070934B2 (en) | 1999-01-12 | 2006-07-04 | Sangamo Biosciences, Inc. | Ligand-controlled regulation of endogenous gene expression |
| US7253273B2 (en) | 2004-04-08 | 2007-08-07 | Sangamo Biosciences, Inc. | Treatment of neuropathic pain with zinc finger proteins |
| US7262054B2 (en) | 2002-01-22 | 2007-08-28 | Sangamo Biosciences, Inc. | Zinc finger proteins for DNA binding and gene regulation in plants |
| US20070218528A1 (en) | 2004-02-05 | 2007-09-20 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| US7361635B2 (en) | 2002-08-29 | 2008-04-22 | Sangamo Biosciences, Inc. | Simultaneous modulation of multiple genes |
| US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
| US7446179B2 (en) | 2000-11-07 | 2008-11-04 | City Of Hope | CD19-specific chimeric T cell receptor |
| US7514530B2 (en) | 2004-04-26 | 2009-04-07 | Centre National De La Recherche Scientifique | Peptide carrier for delivering siRNA into mammalian cells |
| US20100099626A2 (en) | 2005-12-06 | 2010-04-22 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2011015347A1 (en) | 2009-08-05 | 2011-02-10 | Biontech Ag | Vaccine composition comprising 5'-cap modified rna |
| US20110059502A1 (en) | 2009-09-07 | 2011-03-10 | Chalasani Sreekanth H | Multiple domain proteins |
| US20110301073A1 (en) | 2010-05-17 | 2011-12-08 | Sangamo Biosciences, Inc. | Novel DNA-binding proteins and uses thereof |
| WO2012129514A1 (en) | 2011-03-23 | 2012-09-27 | Fred Hutchinson Cancer Research Center | Method and compositions for cellular immunotherapy |
| WO2012137150A2 (en) | 2011-04-04 | 2012-10-11 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| US8324353B2 (en) | 2001-04-30 | 2012-12-04 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| US8339645B2 (en) | 2008-05-27 | 2012-12-25 | Canon Kabushiki Kaisha | Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match |
| EP2537416A1 (en) | 2007-03-30 | 2012-12-26 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| US8398282B2 (en) | 2011-05-12 | 2013-03-19 | Delphi Technologies, Inc. | Vehicle front lighting assembly and systems having a variable tint electrowetting element |
| WO2013071154A1 (en) | 2011-11-11 | 2013-05-16 | Fred Hutchinson Cancer Research Center | Cyclin a1-targeted t-cell immunotherapy for cancer |
| US20130149337A1 (en) | 2003-03-11 | 2013-06-13 | City Of Hope | Method of controlling administration of cancer antigen |
| US8479118B2 (en) | 2007-12-10 | 2013-07-02 | Microsoft Corporation | Switching search providers within a browser search box |
| WO2013123061A1 (en) | 2012-02-13 | 2013-08-22 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | Bispecific chimeric antigen receptors and therapeutic uses thereof |
| WO2013126726A1 (en) | 2012-02-22 | 2013-08-29 | The Trustees Of The University Of Pennsylvania | Double transgenic t cells comprising a car and a tcr and their methods of use |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| WO2013166321A1 (en) | 2012-05-03 | 2013-11-07 | Fred Hutchinson Cancer Research Center | Enhanced affinity t cell receptors and methods for making the same |
| WO2013176772A1 (en) * | 2012-05-25 | 2013-11-28 | The Regents Of The University Of California | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| WO2014031687A1 (en) | 2012-08-20 | 2014-02-27 | Jensen, Michael | Method and compositions for cellular immunotherapy |
| WO2014053882A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014053880A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014053881A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014053622A1 (en) * | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014055668A1 (en) | 2012-10-02 | 2014-04-10 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
| WO2014065596A1 (en) * | 2012-10-23 | 2014-05-01 | Toolgen Incorporated | Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof |
| WO2015026886A1 (en) | 2013-08-22 | 2015-02-26 | E. I. Du Pont De Nemours And Company | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| WO2015086795A1 (en) * | 2013-12-13 | 2015-06-18 | Cellectis | Cas9 nuclease platform for microalgae genome engineering |
| WO2016073433A1 (en) * | 2014-11-06 | 2016-05-12 | E. I. Du Pont De Nemours And Company | Peptide-mediated delivery of rna-guided endonuclease into cells |
| WO2016102687A1 (en) | 2014-12-24 | 2016-06-30 | Aadigen, Llc | Peptides and nanoparticles for intracellular delivery of molecules |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU5600194A (en) | 1992-11-13 | 1994-06-08 | Winalee G. Mitchell | Absorbent including super absorbent and capacity monitor |
| DE102008036364A1 (de) | 2008-08-05 | 2010-02-18 | Khs Ag | Verfahren zum Herstellen von Behälterzellen |
| US9526784B2 (en) * | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
-
2017
- 2017-05-26 CA CA3025523A patent/CA3025523A1/en active Pending
- 2017-05-26 EP EP21170389.7A patent/EP3910059A1/en active Pending
- 2017-05-26 ES ES17733918T patent/ES2901215T3/es active Active
- 2017-05-26 WO PCT/US2017/034862 patent/WO2017205846A1/en not_active Ceased
- 2017-05-26 EP EP17733918.1A patent/EP3464323B1/en active Active
- 2017-05-26 MX MX2018014599A patent/MX388294B/es unknown
- 2017-05-26 CN CN201780045854.3A patent/CN109689677B/zh active Active
- 2017-05-26 JP JP2018561967A patent/JP2019521659A/ja active Pending
- 2017-05-26 AU AU2017268842A patent/AU2017268842B2/en active Active
- 2017-05-26 CN CN202311385196.6A patent/CN117431234A/zh active Pending
-
2018
- 2018-11-21 ZA ZA2018/07869A patent/ZA201807869B/en unknown
- 2018-11-27 MX MX2021014704A patent/MX2021014704A/es unknown
-
2021
- 2021-11-11 JP JP2021184056A patent/JP7379447B2/ja active Active
-
2022
- 2022-07-21 AU AU2022206789A patent/AU2022206789B9/en active Active
-
2023
- 2023-09-29 JP JP2023169638A patent/JP2023165986A/ja not_active Withdrawn
-
2025
- 2025-05-12 JP JP2025079827A patent/JP2025118829A/ja active Pending
Patent Citations (64)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5436150A (en) | 1992-04-03 | 1995-07-25 | The Johns Hopkins University | Functional domains in flavobacterium okeanokoities (foki) restriction endonuclease |
| US5487994A (en) | 1992-04-03 | 1996-01-30 | The Johns Hopkins University | Insertion and deletion mutants of FokI restriction endonuclease |
| US5356802A (en) | 1992-04-03 | 1994-10-18 | The Johns Hopkins University | Functional domains in flavobacterium okeanokoites (FokI) restriction endonuclease |
| WO1996040958A1 (en) | 1995-06-07 | 1996-12-19 | Baylor College Of Medicine | Nucleic acid transporters for delivery of nucleic acids into a cell |
| US6451995B1 (en) | 1996-03-20 | 2002-09-17 | Sloan-Kettering Institute For Cancer Research | Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods |
| WO2000014257A1 (en) | 1998-09-04 | 2000-03-16 | Sloan-Kettering Institute For Cancer Research | Fusion receptors specific for prostate-specific membrane antigen and uses thereof |
| US6410319B1 (en) | 1998-10-20 | 2002-06-25 | City Of Hope | CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies |
| US6453242B1 (en) | 1999-01-12 | 2002-09-17 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7070934B2 (en) | 1999-01-12 | 2006-07-04 | Sangamo Biosciences, Inc. | Ligand-controlled regulation of endogenous gene expression |
| US7030215B2 (en) | 1999-03-24 | 2006-04-18 | Sangamo Biosciences, Inc. | Position dependent recognition of GNN nucleotide triplets by zinc fingers |
| US6599692B1 (en) | 1999-09-14 | 2003-07-29 | Sangamo Bioscience, Inc. | Functional genomics using zinc finger proteins |
| US6503717B2 (en) | 1999-12-06 | 2003-01-07 | Sangamo Biosciences, Inc. | Methods of using randomized libraries of zinc finger proteins for the identification of gene function |
| US6689558B2 (en) | 2000-02-08 | 2004-02-10 | Sangamo Biosciences, Inc. | Cells for drug discovery |
| US20020131960A1 (en) | 2000-06-02 | 2002-09-19 | Michel Sadelain | Artificial antigen presenting cells and methods of use thereof |
| US7446179B2 (en) | 2000-11-07 | 2008-11-04 | City Of Hope | CD19-specific chimeric T cell receptor |
| US6794136B1 (en) | 2000-11-20 | 2004-09-21 | Sangamo Biosciences, Inc. | Iterative optimization in the design of binding proteins |
| US7067317B2 (en) | 2000-12-07 | 2006-06-27 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
| US7070995B2 (en) | 2001-04-11 | 2006-07-04 | City Of Hope | CE7-specific redirected immune cells |
| US7265209B2 (en) | 2001-04-11 | 2007-09-04 | City Of Hope | CE7-specific chimeric T cell receptor |
| US7354762B2 (en) | 2001-04-11 | 2008-04-08 | City Of Hope | Method for producing CE7-specific redirected immune cells |
| US7446191B2 (en) | 2001-04-11 | 2008-11-04 | City Of Hope | DNA construct encoding CE7-specific chimeric T cell receptor |
| US8324353B2 (en) | 2001-04-30 | 2012-12-04 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
| US7262054B2 (en) | 2002-01-22 | 2007-08-28 | Sangamo Biosciences, Inc. | Zinc finger proteins for DNA binding and gene regulation in plants |
| US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
| US7361635B2 (en) | 2002-08-29 | 2008-04-22 | Sangamo Biosciences, Inc. | Simultaneous modulation of multiple genes |
| US20130149337A1 (en) | 2003-03-11 | 2013-06-13 | City Of Hope | Method of controlling administration of cancer antigen |
| US20050064474A1 (en) | 2003-08-08 | 2005-03-24 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| US20070218528A1 (en) | 2004-02-05 | 2007-09-20 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| US20050267061A1 (en) | 2004-04-08 | 2005-12-01 | Sangamo Biosciences, Inc. | Methods and compositions for treating neuropathic and neurodegenerative conditions |
| US7253273B2 (en) | 2004-04-08 | 2007-08-07 | Sangamo Biosciences, Inc. | Treatment of neuropathic pain with zinc finger proteins |
| US7514530B2 (en) | 2004-04-26 | 2009-04-07 | Centre National De La Recherche Scientifique | Peptide carrier for delivering siRNA into mammalian cells |
| US20100099626A2 (en) | 2005-12-06 | 2010-04-22 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| EP2537416A1 (en) | 2007-03-30 | 2012-12-26 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| US8389282B2 (en) | 2007-03-30 | 2013-03-05 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes |
| US8479118B2 (en) | 2007-12-10 | 2013-07-02 | Microsoft Corporation | Switching search providers within a browser search box |
| US8339645B2 (en) | 2008-05-27 | 2012-12-25 | Canon Kabushiki Kaisha | Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match |
| WO2011015347A1 (en) | 2009-08-05 | 2011-02-10 | Biontech Ag | Vaccine composition comprising 5'-cap modified rna |
| US20110059502A1 (en) | 2009-09-07 | 2011-03-10 | Chalasani Sreekanth H | Multiple domain proteins |
| US20110301073A1 (en) | 2010-05-17 | 2011-12-08 | Sangamo Biosciences, Inc. | Novel DNA-binding proteins and uses thereof |
| US20130287748A1 (en) | 2010-12-09 | 2013-10-31 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer |
| WO2012129514A1 (en) | 2011-03-23 | 2012-09-27 | Fred Hutchinson Cancer Research Center | Method and compositions for cellular immunotherapy |
| WO2012137150A2 (en) | 2011-04-04 | 2012-10-11 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| US8398282B2 (en) | 2011-05-12 | 2013-03-19 | Delphi Technologies, Inc. | Vehicle front lighting assembly and systems having a variable tint electrowetting element |
| WO2013071154A1 (en) | 2011-11-11 | 2013-05-16 | Fred Hutchinson Cancer Research Center | Cyclin a1-targeted t-cell immunotherapy for cancer |
| WO2013123061A1 (en) | 2012-02-13 | 2013-08-22 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | Bispecific chimeric antigen receptors and therapeutic uses thereof |
| WO2013126726A1 (en) | 2012-02-22 | 2013-08-29 | The Trustees Of The University Of Pennsylvania | Double transgenic t cells comprising a car and a tcr and their methods of use |
| WO2013166321A1 (en) | 2012-05-03 | 2013-11-07 | Fred Hutchinson Cancer Research Center | Enhanced affinity t cell receptors and methods for making the same |
| WO2013176772A1 (en) * | 2012-05-25 | 2013-11-28 | The Regents Of The University Of California | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| WO2014031687A1 (en) | 2012-08-20 | 2014-02-27 | Jensen, Michael | Method and compositions for cellular immunotherapy |
| WO2014055668A1 (en) | 2012-10-02 | 2014-04-10 | Memorial Sloan-Kettering Cancer Center | Compositions and methods for immunotherapy |
| WO2014053880A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014053881A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014053622A1 (en) * | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014053879A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014053882A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014065596A1 (en) * | 2012-10-23 | 2014-05-01 | Toolgen Incorporated | Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof |
| WO2015026886A1 (en) | 2013-08-22 | 2015-02-26 | E. I. Du Pont De Nemours And Company | Methods for producing genetic modifications in a plant genome without incorporating a selectable transgene marker, and compositions thereof |
| WO2015026885A1 (en) | 2013-08-22 | 2015-02-26 | Pioneer Hi-Bred International, Inc. | Genome modification using guide polynucleotide/cas endonuclease systems and methods of use |
| WO2015026887A1 (en) | 2013-08-22 | 2015-02-26 | E. I. Du Pont De Nemours And Company | A soybean u6 polymerase iii promoter and methods of use |
| WO2015026883A1 (en) | 2013-08-22 | 2015-02-26 | E. I. Du Pont De Nemours And Company | Plant genome modification using guide rna/cas endonuclease systems and methods of use |
| WO2015086795A1 (en) * | 2013-12-13 | 2015-06-18 | Cellectis | Cas9 nuclease platform for microalgae genome engineering |
| WO2016073433A1 (en) * | 2014-11-06 | 2016-05-12 | E. I. Du Pont De Nemours And Company | Peptide-mediated delivery of rna-guided endonuclease into cells |
| WO2016102687A1 (en) | 2014-12-24 | 2016-06-30 | Aadigen, Llc | Peptides and nanoparticles for intracellular delivery of molecules |
Non-Patent Citations (96)
| Title |
|---|
| A. R. GRUBER ET AL., CELL, vol. 106, no. 1, 2008, pages 23 - 24 |
| ARGOS ET AL., EMBOJ., vol. 5, 1986, pages 433 - 44 |
| BATZER, NUCLEIC ACID RES., vol. 19, 1991, pages 5081 |
| BEERLI ET AL., NATURE BIOTECHNOL., vol. 20, 2002, pages 135 - 141 |
| BIKARD ET AL., NUCLEIC ACIDS RESEARCH, vol. 41, no. 15, 2013, pages 7429 - 7437 |
| BRENTJENS ET AL., SCI TRANSL MED, vol. 5, no. 177, 2013 |
| BROOKS ET AL., SCIENCE, vol. 264, pages 569 |
| BURSHELL ET AL., CANCER RES., vol. 47, 1987, pages 5476 - 5482 |
| CHENG ET AL., FEBSLETT, vol. 588, 2014, pages 3954 - 3958 |
| CHOO ET AL., CURR. OPIN STRUCT. BIOL, vol. 10, 2000, pages 411 - 416 |
| CRITCHLOW; JACKSON, TRENDS BIOCHEM SCI., vol. 23, no. 10, October 1998 (1998-10-01), pages 394 - 8 |
| DAVILA ET AL., PLOS ONE, vol. 8, no. 4, 2013, pages e61338 |
| DIAZ ET AL., J. BIOL. CHEM, vol. 21 A, 1999, pages 6634 - 6640 |
| DOKUMO ET AL., J. MOL. BIOL., vol. 284, 1998, pages 713 - 728 |
| DOMINGUEZ ET AL., NATURE REVIEWS MOLECULAR CELL BIOLOGY, 2015 |
| DOW ET AL., NATURE BIOTECHNOLOGY, vol. 33, no. 4, 2015, pages 390 - 394 |
| FINKEL; JOHNSON, MOL. MICROBIOL., vol. 6, 1992, pages 3257 - 3265 |
| FRIEDMAN, CELL, vol. 55, 1988, pages 545 - 554 |
| FU ET AL., NATURE BIOTECHNOLOGY, vol. 31, no. 9, 2013, pages 822 - 826 |
| FUIREAL ET AL., SCIENCE, vol. 226, 1994, pages 120 - 122 |
| GAJ ET AL., TRENDS IN BIOTECHNOLOGY, vol. 31, no. 7, 2013, pages 397 - 405 |
| GAJ ET AL., TRENDS IN BIOTECHNOLOGY., vol. 31, no. 7, 2013, pages 397 - 405 |
| GAO ET AL., NATURE BIOTECHNOLOGY, 2016 |
| GIRLING ET AL., INT. J. CANCER, vol. 43, 1989, pages 1072 - 1076 |
| GROENEN ET AL., MOL. MICROBIOL., vol. 10, 1993, pages 1057 - 1065 |
| HANAHAN, SCIENCE, vol. 277, 1997, pages 48 |
| HAREUVEN I ET AL., EUR. J. BIOCHEM, vol. 189, pages 475 - 486 |
| HARRIS ET AL., GENE THERAPY, vol. 1, 1994, pages 170 - 175 |
| HART, T. ET AL., CELL, vol. 163, no. 6, 2015, pages 1515 - 1526 |
| HOE ET AL., EMERG. INFECT. DIS., vol. 5, 1999, pages 254 - 263 |
| ISALAN ET AL., NATURE BIOTECHNOL., vol. 19, 2001, pages 656 - 660 |
| ISHINO ET AL., J BACTERIOL, vol. 169, 1987, pages 5429 - 5433 |
| JANSEN ET AL., MOL. MICROBIOL., vol. 43, 2002, pages 1565 - 1575 |
| JANSSEN ET AL., OMICS J. INTEG. BIOL, vol. 6, 2002, pages 23 - 33 |
| JIA LIU ET AL: "Cell-Penetrating Peptide-Mediated Delivery of TALEN Proteins via Bioconjugation for Genome Engineering", PLOS ONE, vol. 9, no. 1, 20 January 2014 (2014-01-20), pages e85755, XP055396351, DOI: 10.1371/journal.pone.0085755 * |
| KANAI ET AL., CANCER RES., vol. 57, no. 46, 1997, pages 1 - 465 |
| KIM ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 31,978 - 31,982 |
| KIM ET AL., NATURE BIOTECHNOLOGY, vol. 31, 2013, pages 251 - 258 |
| KIM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 883 - 887 |
| KLEINSTIVER ET AL., NATURE, vol. 523, 2015, pages 481 - 485 |
| KOCHENDERFER ET AL., NATURE REVIEWS CLINICAL ONCOLOGY, vol. 10, 2013, pages 267 - 276 |
| KUCHERHPATI, R., & SMITH, G. R.: "Genetic Recombination", 1988, AM. SOC. MICROBIOL., article HATFULL; GRINDLEY: "Resolvases and DNA- invertases: a family of enzymes active in site-specific recombination", pages: 357 - 396 |
| LANDY, ANN. REV. BIOCHEM., vol. 58, 1989, pages 913 - 949 |
| LEDFORD, H., NATURE, vol. 522, no. 7554, 2015 |
| LEDFORD, H., NATURE, vol. 531, 2016, pages 156 - 159 |
| LI ET AL., HUMAN GENE THERAPY, vol. 26, no. 7, 2015, pages 452 - 462 |
| LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4275 - 4279 |
| LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2764 - 2768 |
| LIAO ET AL., NUCLEIC ACIDS RESEARCH, 2015 |
| LLOYD ET AL., FRONTEIRS IN IMMUNOLOGY, vol. 4, no. 221, 2013, pages 1 - 7 |
| MADDALO ET AL., NATURE, vol. 516, 2014, pages 423 - 427 |
| MAESER; KAHMANN, MOL. GEN. GENET., vol. 230, 1991, pages 170 - 176 |
| MALI ET AL., NATURE METHODS, vol. 10, no. 10, 2013, pages 957 - 63 |
| MALI ET AL., SCIENCE, vol. 339, no. 6121, 2013, pages 823 - 826 |
| MASEPOHL ET AL., BIOCHIM. BIOPHYS. ACTA, vol. 1307, 1996, pages 26 - 30 |
| MICHAEL ET AL., GENE THERAPY, vol. 2, 1995, pages 660 - 668 |
| MIKI ET AL., SCIENCE, vol. 226, 1994, pages 66 - 7 1 |
| MOJICA ET AL., MOL. MICROBIOL., vol. 17, 1995, pages 85 - 93 |
| MOJICA ET AL., MOL. MICROBIOL., vol. 36, 2000, pages 244 - 246 |
| NAKAMURA. Y ET AL.: "Codon usage tabulated from the international DNA sequence databases: status for the year 2000", NUCL. ACIDS RES., vol. 28, 2000, pages 292, XP002941557, DOI: doi:10.1093/nar/28.1.292 |
| NAKATA ET AL., J. BACTERIOL., vol. 171, 1989, pages 3553 - 3556 |
| OHLSUKA, J . BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608 |
| ONOUCHI ET AL., MOL GEN. GENET., vol. 247, 1995, pages 653 - 660 |
| OW, CURR. OPIN. BIOTECHNOL, vol. 7, 1996, pages 181 - 186 |
| P A CARR; G M CHURCH, NATURE BIOTECHNOLOGY, vol. 27, no. 12, 2009, pages 1151 - 62 |
| PABO ET AL., ANN. REV. BIOCHEM., vol. 70, 2001, pages 313 - 340 |
| POIAKIS, CURR. OPIN. GENET. DEV, vol. 5, 1995, pages 66 - 71 |
| POLSTEIN, L. R..; GERSBACH, C. A, NATURE CHEMICAL BIOLOGY, vol. 11, no. 3, 2015, pages 198 - 200 |
| QI ET AL., CELL, vol. 152, no. 5, 2013, pages 1173 - 1183 |
| ROITT, BROSTOFF AND MALE,: "Immunology, third edition", 1993, MOSBY |
| ROSSOLINI ET AL., MOL. CELL PROBES, vol. 8, 1994, pages 91 - 98 |
| S. RAMAKRISHNA ET AL: "Gene disruption by cell-penetrating peptide-mediated delivery of Cas9 protein and guide RNA", GENOME RESEARCH, vol. 24, no. 6, 2 April 2014 (2014-04-02), pages 1020 - 1027, XP055128944, ISSN: 1088-9051, DOI: 10.1101/gr.171264.113 * |
| SADELAIN ET AL., CANCER DISCOV., vol. 3, no. 4, April 2013 (2013-04-01), pages 388 - 398 |
| SADOWSKI, FASEB J., vol. 7, 1993, pages 760 - 767 |
| SADOWSKI, J. BACTERIOL., vol. 165, 1986, pages 341 - 347 |
| SAUER, CURR. OPIN. BIOTECHNOL., vol. 5, 1994, pages 521 - 527 |
| SCHREWE ET AL., MOL. CELL. BIOL., vol. 10, 1990, pages 2738 - 2748 |
| SEGAL ET AL., CURR. OPIN. BIOTECHNOL., vol. 12, 2001, pages 632 - 637 |
| STAMEY ET AL., NEW ENGLAND J. MED., vol. 317, 1987, pages 909 |
| STARK ET AL., TRENDS GENETICS, vol. 8, 1992, pages 432 - 439 |
| SWIECH ET AL., NAT. BIOTECHNOL., vol. 33, 2015, pages 102 - 106 |
| TIJSSEN: "Laboratory Techniques In Biochemistry And Molecular Biology-Hybridization With Nucleic Acid Probes Part I", 1993, ELSEVIER, article "Overview of principles of hybridization and the strategy of nucleic acid probe assay" |
| TURTLE ET AL., CURR OPIN. IMMUNOL.., vol. 24, no. 5, October 2012 (2012-10-01), pages 633 - 39 |
| VAN EMBDEN ET AL., J BACTERIOL, vol. 182, 2000, pages 2393 - 2401 |
| VILE ET AL., CANCER RES., vol. 53, 1993, pages 3860 - 3864 |
| VOZIYANOV ET AL., NUCL. ACIDS RES, vol. 27, 1999, pages 930 - 941 |
| WANG ET AL., CELL, vol. 153, 2013, pages 910 - 918 |
| WANG ET AL., J. IMMUNOTHER., vol. 35, no. 9, 2012, pages 689 - 701 |
| WANG ET AL., PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 113, no. 11, 2016, pages 2868 - 2873 |
| WEISBERG; LANDV ET AL.: "Lambda II", 1983, COLD SPRING HARBOR LABORATORY, article "Site-specific recombination in phage lambda", pages: 21 1 - 250 |
| WOOSTER ET AL., NATURE, vol. 378, 1995, pages 789 - 792 |
| WU ET AL., CANCER, vol. 18, no. 2, March 2012 (2012-03-01), pages 160 - 75 |
| ZETSCHE ET AL., CELL, vol. 163, no. 3, 2015, pages 759 - 771 |
| ZETSCHE ET AL., NATURE BIOTECHNOLOGY, vol. 33, no. 2, 2015, pages 139 - 142 |
| ZUKER; STIEGLER, NUCLEIC ACIDS RES, vol. 9, 1981, pages 133 - 148 |
| ZURIS ET AL., NATURE BIOTECHNOLOGY, vol. 33, no. 1, 2015, pages 73 - 80 |
Cited By (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3665285A4 (en) * | 2017-08-10 | 2021-08-11 | Aadigen, LLC | PEPTIDES AND NANOPARTICLES FOR INTRACELLULAR VIRUS ADMINISTRATION |
| AU2018352221B2 (en) * | 2017-10-16 | 2024-04-18 | Aadigen, Llc | Peptides and nanoparticles for intracellular delivery of mRNA |
| WO2019079215A1 (en) * | 2017-10-16 | 2019-04-25 | Aadigen, Llc | PEPTIDES AND NANOPARTICLES FOR INTRACELLULAR MRRNA DELIVERY |
| US20210214729A1 (en) * | 2018-05-15 | 2021-07-15 | Messenger Biopharma | Substitution of the messenger rna cap with two rna sequences introduced at the 5-prime end thereof |
| WO2019237387A1 (zh) * | 2018-06-16 | 2019-12-19 | 深圳市博奥康生物科技有限公司 | 用于敲除人ACT35基因的gRNA序列及其应用 |
| WO2019237384A1 (zh) * | 2018-06-16 | 2019-12-19 | 深圳市博奥康生物科技有限公司 | 用于敲除人CDw137基因的gRNA序列及其应用 |
| CN111363013A (zh) * | 2018-12-25 | 2020-07-03 | 深圳先进技术研究院 | 多组分纳米颗粒簇的构建方法 |
| CN111363013B (zh) * | 2018-12-25 | 2021-11-19 | 深圳先进技术研究院 | 多组分纳米颗粒簇的构建方法 |
| JP2025084877A (ja) * | 2019-01-04 | 2025-06-03 | ザ・ユニバーシティ・オブ・シカゴ | Rnaをモジュレートするためのシステムおよび方法 |
| WO2020174070A1 (en) | 2019-02-27 | 2020-09-03 | Cyca Oncosolutions Limited | Cell membrane penetrating conjugates for gene editing |
| WO2020214846A1 (en) * | 2019-04-17 | 2020-10-22 | Aadigen, Llc | Peptides and nanoparticles for intracellular delivery of molecules |
| CN114007654A (zh) * | 2019-04-17 | 2022-02-01 | 阿迪根有限公司 | 用于分子的细胞内递送的肽和纳米颗粒 |
| US12357695B2 (en) | 2019-04-17 | 2025-07-15 | Aadigen, Llc | Peptides and nanoparticles for intracellular delivery of molecules |
| JP2022530483A (ja) * | 2019-04-22 | 2022-06-29 | 交弘生物科技(上海)有限公司 | ヌクレアーゼ協同pcr原理に基づいて低存在比のdna突然変異を濃縮する検出技術システムおよび使用 |
| JP7384459B2 (ja) | 2019-04-22 | 2023-11-21 | 交弘生物科技(上海)有限公司 | ヌクレアーゼ協同pcr原理に基づいて低存在比のdna突然変異を濃縮する検出技術システムおよび使用 |
| WO2021217100A1 (en) * | 2020-04-24 | 2021-10-28 | Aadigen, Llc | Compositions for treating cancer with kras mutations and uses thereof |
| EP4139454A4 (en) * | 2020-04-24 | 2025-07-30 | Aadigen Llc | CANCER TREATMENT COMPOSITIONS WITH DEMUTATIONS AND THEIR USES |
| WO2022020782A1 (en) * | 2020-07-24 | 2022-01-27 | Aadigen, Llc | Compositions and methods for treating viral infections |
| WO2023006704A3 (en) * | 2021-07-26 | 2023-03-09 | Imperial College Innovations Limited | Nanozyme-catalysed detection of nucleic acids |
| WO2025059215A1 (en) | 2023-09-12 | 2025-03-20 | Aadigen, Llc | Methods and compositions for treating or preventing cancer |
| WO2025090926A1 (en) * | 2023-10-26 | 2025-05-01 | The Penn State Research Foundation | Ultrasound-sensitive peptide particles with surface-bound gene editing tools for spatially resolved molecule delivery |
| CN119119204A (zh) * | 2024-11-11 | 2024-12-13 | 南昌大学 | 温敏特异性多肽和基于温差特异性无损分离外泌体的方法 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3464323A1 (en) | 2019-04-10 |
| MX2018014599A (es) | 2019-02-28 |
| AU2022206789B2 (en) | 2025-09-04 |
| AU2022206789A1 (en) | 2022-10-06 |
| JP2022023229A (ja) | 2022-02-07 |
| CN117431234A (zh) | 2024-01-23 |
| AU2017268842B2 (en) | 2022-08-11 |
| CA3025523A1 (en) | 2017-11-30 |
| ZA201807869B (en) | 2022-08-31 |
| JP2019521659A (ja) | 2019-08-08 |
| JP2023165986A (ja) | 2023-11-17 |
| EP3464323B1 (en) | 2021-09-22 |
| JP7379447B2 (ja) | 2023-11-14 |
| MX2021014704A (es) | 2022-01-11 |
| CN109689677B (zh) | 2023-11-10 |
| CN109689677A (zh) | 2019-04-26 |
| MX388294B (es) | 2025-03-19 |
| ES2901215T3 (es) | 2022-03-21 |
| JP2025118829A (ja) | 2025-08-13 |
| AU2017268842A1 (en) | 2018-12-13 |
| EP3910059A1 (en) | 2021-11-17 |
| AU2022206789B9 (en) | 2025-09-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7379447B2 (ja) | ゲノム編集分子の細胞内送達のためのペプチドおよびナノ粒子 | |
| US20250257342A1 (en) | Peptides and nanoparticles for intracellular delivery of genome-editing molecules | |
| US20260002141A1 (en) | Methods and compositions for selectively eliminating cells of interest | |
| US20230365951A1 (en) | Tracking and Manipulating Cellular RNA via Nuclear Delivery of CRISPR/CAS9 | |
| US11713336B2 (en) | Peptides and nanoparticles for intracellular delivery of molecules | |
| US20200172913A1 (en) | Peptides and nanoparticles for intracellular delivery of virus | |
| US20210017518A1 (en) | Modified tracrrnas grnas, and uses thereof | |
| HK40064529A (en) | Peptides and nanoparticles for intracellular delivery of genome-editing molecules | |
| HK40006957B (en) | Peptides and nanoparticles for intracellular delivery of genome-editing molecules | |
| WO2025155753A2 (en) | Improved gene editing system, guides, and methods | |
| CN117597142A (zh) | Omni 90-99、101、104-110、114、116、118-123、125、126、128、129和131-138 crispr核酸酶 | |
| HK1244841B (en) | Methods and compositions for selectively eliminating cells of interest |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| ENP | Entry into the national phase |
Ref document number: 3025523 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2018561967 Country of ref document: JP Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17733918 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017268842 Country of ref document: AU Date of ref document: 20170526 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017733918 Country of ref document: EP Effective date: 20190102 |