WO2017175239A1 - A multifunctional recombinant nucleotide dependent glycosyltransferase protein and its method of glycosylation thereof - Google Patents
A multifunctional recombinant nucleotide dependent glycosyltransferase protein and its method of glycosylation thereof Download PDFInfo
- Publication number
- WO2017175239A1 WO2017175239A1 PCT/IN2017/050116 IN2017050116W WO2017175239A1 WO 2017175239 A1 WO2017175239 A1 WO 2017175239A1 IN 2017050116 W IN2017050116 W IN 2017050116W WO 2017175239 A1 WO2017175239 A1 WO 2017175239A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- glycosylated
- acceptor
- protein
- substrate
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1048—Glycosyltransferases (2.4)
- C12N9/1051—Hexosyltransferases (2.4.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1003—Extracting or separating nucleic acids from biological samples, e.g. pure separation or isolation methods; Conditions, buffers or apparatuses therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/005—Glycopeptides, glycoproteins
Definitions
- the present invention generally relates to a multifunctional recombinant nucleotide dependent glycosyltransferase protein and its method of glycosylation thereof.
- the invention relates to one pot synthesis of disaccharide glycan on to the acceptor substrate and thereby generating O- and/or S- glycosylated product including neo-glycopeptide and glycosylated antimicrobial peptide by using multifunctional recombinant nucleotide dependent glycosyltransferase.
- Glycosylation is the enzymatic process that attaches glycans to proteins, lipids or other organic molecules. Glycosylation is an important co-translational or post- translational modification. Many industrial and therapeutic proteins are glycoproteins harboring different types of glycans. Hence, glycosylation of these proteins is important for structure, function, host-pathogen interactions, biomimicry etc (Sola, R.J., and Griebenow, K. (2009). Effects of glycosylation on the stability of protein pharmaceuticals. J Pharm Sci 98, 1223-1245, Sola, R.J., and Griebenow, K. (2010). Glycosylation of therapeutic proteins: an effective strategy to optimize efficacy.
- neo-glycoproteins or neo- glycopeptides typically possess better bio-activity and stability.
- glycosylation can be achieved in vitro, either by enzymatic means or by chemical means.
- Enzymatic glycosylation is a preferred route for its specificity, affordability and process simplicity provided suitable and applicable glycosyltransferases are available.
- the advantage of using glycosyltransferases for generation of glyco -conjugate is that the glycosidic linkages formed by these enzymes are highly stereo and regio- specific (Hanson, S., Best, M., Bryan, M.C., and Wong, C.H. (2004). Chemoenzymatic synthesis of oligosaccharides and glycoproteins.
- glycosyltransferase catalyzes a specific linkage of specific sugar donor residues to other specific acceptor molecules, which include a peptide, protein, an oligosaccharide or lipid. Therefore, synthesis of a glyco-conjugate harboring a glycan that is composed of more than one sugar necessitates the use of more than one glycosyltransferases for each independent saccharide unit being transferred.
- known glycosyltransferases are eukaryotic proteins of which most are membrane bound and difficult for expression and purification. Accordingly, these eukaryotic proteins are less amenable for in vitro applications.
- the polypeptides of the invention include glyco-conjugates in which, a species, such as a water-soluble polymer, a therapeutic agent of a biomolecule is covalently linked through an intact O-linked glycosyl residue to the polypeptide. Accordingly, the invention provides polypeptides comprising mutated sites suitable for O-linked glycosylation and pharmaceutical compositions thereof. In addition, the invention provides method of making such polypeptides and using such polypeptides and/or pharmaceutical compositions thereof for therapeutic treatments. However, the invention primarily focuses on transfer of monosaccharide and thereby creating O-linked glycosylation.
- the invention involves method of transferring at least two saccharide units with a polyglycosyltransferase, which transfers both GlcNAc, and GalNAc, from the corresponding sugar nucleotides to a sugar acceptor.
- a polyglycosyltransferase which transfers both GlcNAc, and GalNAc
- the invention is specific for and focuses on biosynthesis of oligosaccharides using a polyglycosyltransferase.
- EP 2,049, 144 titled "Glycosylation of peptides via O-linked glycosylation sequences" discloses a method of preparing glycosylated polypeptides using short enzyme-recognized O-linked glycosylation sequences. Accordingly, the invention provides targeted glycosylation sequence introduced into a parent polypeptide (e.g., wild-type polypeptide) by mutation creating a mutant polypeptide that includes a glycosylation sequence, wherein this glycosylation sequence is not present, or not present at the same position, in the corresponding parent polypeptide (exogenous glycosylation sequence).
- a parent polypeptide e.g., wild-type polypeptide
- each glycosylation sequence is a substrate for an enzyme, such as a glycosyltransferase, such as a GalNAc-transferase (e.g., GalNAc-T2).
- a glycosyltransferase such as a GalNAc-transferase (e.g., GalNAc-T2).
- GalNAc-T2 GalNAc-T2
- the invention focuses on O-linked glycosylation and conjugation between a glycosylated or non-glycosylated sequon polypeptide and a polymeric modifying group such as poly (ethylene glycol) and methoxy-poly (ethylene glycol) (m-PEG).
- the PCT application numbered WO/2008/151258 titled O-linked glycosylation using N-Acetylglycosaminyl transferases ' " (U.S. Patent No. WO2008151258 A3 2/2009 Shawn Defrees et al C12N9/10) discloses covalent conjugates between a polypeptide and a modifying group, such as a water-soluble polymer (e.g., Poly Ethylene Glycol).
- the amino acid sequence of the polypeptide includes one or more O-linked glycosylation sequence, each being a substrate for a GIcNAc transferase.
- the modifying group is covalently linked to the polypeptide via a glycosyl-linking group interposed between and covalently linked to both the polypeptide and the modifying group.
- a glucosamine linking group is directly attached to an amino acid residue of the O-linked glycosylation sequence. Accordingly, each glycosylation sequence serves as a substrate for GIcNAc transferase, wherein the method involves transfer of one sugar to given residue at a time creating monosaccharide glycan.
- EP 1,981,977 titled "Production of poly sialic acid containing glyconjugates using a self-priming polysialyltransfera.se "
- E.P. Patent No. EP1981977A4 4/2010 Warren-wakarchuk et al C12N15/63, Lindhout, T., Iqbal, U., Willis, L.M., Reid, A.N., Li, J., Liu, X., Moreno, M., and Wakarchuk, W.W. (2011).
- ProcNatlAcadSci USA 108, 7397-7402 discloses site specific enzymatic polysialylation of therapeutic proteins using bacterial enzymes.
- the patent describes an enzyme which can transfer at least three sialic acid residues on to a glycoprotein having a terminal galactose residue pre attached to it.
- product(s) derived using our method can be useful input(s) for such enzyme.
- the NCBI article numbered 1002/chem.201405692 titled "Synthesis of the anti- microbial S-linked glycopeptide, glycocin F (Brimble, M.A., Edwards, P.J., Harris, P.W., Norris, G.E., Patchett, M.L., Wright, T.H., Yang, S.H., and Carley, S.E. (2015). Synthesis of the antimicrobial S-linked glycopeptide, glycocin F.
- glycocin F a uniquely di- glycosylated antimicrobial peptide bearing a rare S-linked N-acetylglucosamine (GlcNAc) moiety in addition to an O-linked GlcNAc, has been accomplished using a native chemical ligation strategy.
- the synthetic and naturally occurring peptides were compared by RP-HPLC, mass spectrometry, NMR and CD spectroscopy, and their stability towards chymotrypsin digestion and antimicrobial activity were measured. This is the first comprehensive structural and functional comparison of a naturally occurring glycocin with an active synthetic analogue.
- the NCBI article numbered 1021/ja2075168 and 1038/nchembio.509 titled "Substrate selectivity of the sublancin S-gly cosyltransfera.se (Wang, H., and van der Donk, W.A. (2011). Substrate selectivity of the sublancin S-glycosyltransferase. Journal of the American Chemical Society 133, 16394-16397) and Sublancin is not a lantibiotic but an S-linked glycopeptide (Oman, T.J., Boettcher, J.M., Wang, H., Okalibe, X.N., and van der Donk, W.A. (2011).
- Sublancin is not a lantibiotic but an S-linked glycopeptide.
- Nat ChemBiol 7, 78-80 disclose SunS a novel S-glycosyltransferase involved in the biosynthesis of the antimicrobial peptide sublancin.
- SunS selectively modifies cysteine22 in a 37 amino acid peptide substrate SunA and can accept a variety of NDP sugars.
- the study reports the substrate selectivity with regard to the peptide substrate and the antimicrobial activity of the resulting sublancin analogues (Garcia De Gonzalo, C.V., Zhu, L., Oman, T.J., and van der Donk, W.A. (2014). NMR structure of the S-linked glycopeptide sublancin 168.
- the NCBI article numbered 1021/ja411159k titled "The glycosyltransferase involved in thurandacin biosynthesis catalyzes both O- and S-gly cosylation " (Wang, H., Oman, T.J., Zhang, R., Garcia De Gonzalo, C.V., Zhang, Q., and van der Donk, W.A. (2014).
- the glycosyltransferase involved in thurandacin biosynthesis catalyzes both O- and S-glycosylation.
- ThuS S-glycosyltransferase
- the biosynthesis of the putative products of the thuS gene cluster are reconstituted in vitro and the resulting 5-glycosylated peptides thurandacin A and thurandacin B exhibit highly selective antimicrobial activity towards Bacillus thuringiensis.
- Angewandte Chemie International ed in English 45, 2585-2588 discloses glycosylation of a neo-glycoprotein achieved by quantitative yields by using a glycosynthase or a thioglycoligase.
- the resulting glycoproteins function as good acceptors for glycosyl transferases, and the thioglycoprotein is proved to be resistant to glycosidase digestion.
- the established technology will enable the remodeling of natural glycoproteins to make them more stable against degradation in serum.
- Thioglycoligases innovative biocatalytic tools for S -glycosylated proteins synthesis. In 11th Carbohydrate Bioengineering Meeting (Espoo, Finland).
- Enterocin 96 a novel class II bacteriocin produced by Enterococcus faecalis WHE 96, isolated from Munster cheese. Appl Environ Microbiol 75, 4273-4276, Maky, M.A., Ishibashi, N., Zendo, T., Perez, R.H., Doud, J.R., Karmi, M., and Sonomoto, K. (2015). Enterocin F4-9, a Novel O-Linked Glycosylated Bacteriocin.
- the present invention provides a multifunctional recombinant nucleotide dependent glycosyltransferase protein and its method of glycosylation thereof. It is an object of the present invention to provide O and/or S -linked di- glycosylated product by contacting donor substrate with acceptor substrate in the presence of multifunctional recombinant nucleotide dependent glycosyltransferase enzyme, which catalyzes the reaction.
- the present invention provides one pot synthesis of disaccharide glycan on to serine or threonine or cysteine residue in acceptor substrate.
- the method of glyco-diversification comprises the generation of a mixture of un-modified, mono-glucosylated or mono-galactosylated and di- glucosylated or di-galactosylated glycoforms as product, followed by separation and purification of these various glycoforms using RP-HPLC and then incubating the purified mono-glucosylated or mono-galactosylated glycoform with recombinant nucleotide dependent glycosyltransferase enzyme and UDP-galactose or UDP- glucose, respectively to obtain glyco-diversified (di-glycosylated) product .
- the present invention provides sugar enriched products by constructing a disaccharide and not just a monosaccharide glycan at a single site using single enzyme reaction.
- the invention also provides components to carry out glycosylation in vivo in a prokaryotic host and is useful for generating glycosylation in acceptor substrate where acceptor sites are not surface accessible in vitro.
- nucleotide dependent glycosyltransferase protein having amino acid sequence selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 2, SEQ ID NO. 3 and variants thereof.
- the present invention provides he multifunctional recombinant nucleotide dependent glycosyltransferase protein wherein the protein corresponding to SEQ ID NO: 1 is C-terminal 6x-His tagged recombinant glycosyltransferase protein.
- the present invention provides the multifunctional recombinant nucleotide dependent glycosyltransferase protein wherein the protein corresponding to SEQ ID NO: 2 is N-terminal 6x-His tagged recombinant glycosyltransferase protein. In an embodiment of the present invention it provides the multifunctional recombinant nucleotide dependent glycosyltransferase protein wherein the protein corresponding to SEQ ID NO: 3 is N-terminal MBP glycosyltransferase fusion protein. In an embodiment of the present invention it provides an in vitro one pot method for synthesis of O-linked and/or S-linked di-glycosylated products, wherein the method comprises of : a.
- the donor substrate is an activated nucleotide sugar selected from the group consisting of saccharide-UDP, saccharide-GDP, and related nucleotide sugars thereof and the acceptor substrate comprises a peptide or polypeptide having amino acid sequence selected from the group consisting of SEQ ID NO.: 4, SEQ ID NO.: 5, SEQ ID NO.: 6, SEQ ID NO.: 7, SEQ ID NO.: 8, SEQ ID NO.: 9, SEQ ID NO.: 10, SEQ ID NO.: 11, SEQ ID NO.:
- b providing a multifunctional recombinant nucleotide dependent glycosyltransferase protein having amino acid sequence selected from the group consisting of SEQ ID NO. 1, SEQ ID NO. 2, and SEQ ID NO. 3; c. contacting a multifunctional recombinant nucleotide dependent glycosyltransferase protein obtained in step (b) with the mixture obtained in step (a); d.
- the present invention provides the method wherein the donor substrate saccharide-UDP sugar is UDP-glucose or UDP-galactose and the GDP sugar is GDP-glucose or GDP-galactose.
- the acceptor substrate comprises peptide or polypeptide having at least one exogenous or endogenous copy of amino acid sequence corresponding to minimal acceptor sequence of SEQ ID NO.: 17 and variants thereof.
- the amino acid residue substituted in the variant of minimal acceptor sequence of SEQ ID NO.: 17 is selected from the group consisting of Dl IE, S 12T, S 12C, S 13T, S 14R and S 14A.
- an expression cassette consisting of a gene encoding multifunctional recombinant nucleotide dependent glycosyltransferase protein having sequence selected from the group consisting of SEQ ID No.: 18, SEQ ID No.: 19 and SEQ ID No.: 20.
- the di-glycosylated product is an antimicrobial peptide.
- the antimicrobial peptide is enterocin 96 and glycol-variant thereof.
- it provides a method of producing a mixture of glycosylated products of acceptor substrates comprising peptide or polypeptide having amino acid sequence selected from the group consisting of SEQ ID NO.: 4, SEQ ID NO.: 5, SEQ ID NO.: 6, SEQ ID NO.: 7, SEQ ID NO.: 8, SEQ ID NO.: 9, SEQ ID NO.: 10, SEQ ID NO.: 11, SEQ ID NO.: 12, SEQ ID NO.: 13, SEQ ID NO.: 14, SEQ ID NO.: 15, SEQ ID NO.: 16, SEQ ID NO.: 17 wherein the enzyme: substrate ratio in the method is modulated to produce a mixture of un-modified, mono-glycosylated and di-glycosylated product.
- the present invention provides a method of producing a mixture of glyco-diversified products using the di-glycosylated product to obtain a mixture of glyco-diversified products, wherein the mixture comprises mono-glycosylated and di-glycosylated products.
- the present invention provides the method wherein the di-glycosylated product is incubated with an exoglycosidase that catalyzes removal of terminal saccharide moieties from the di-glycosylated products to obtain mono-glycosylated products;
- the exoglycosidase is selected from ⁇ -glucosidase and ⁇ -galactosidase.
- the method additionally comprises separating and purifying the un- modified, mono- glycosylated and di-glycosylated product using RP-HPLC.
- Table 1 illustrates the table comprising details on cloning and expression of multifunctional recombinant nucleotide dependent glycosyltransferase in different bacterial expression vectors in accordance with the present invention.
- Table 2 illustrates the table comprising information on various amino acid sequences and nucleotide sequences in accordance with the present invention.
- Table 3 comprising information on In vitro glycosyltransferase activity status of the mutants.
- Fig. 1 illustrates the vector maps of protein expression vectors encoding multifunctional recombinant nucleotide dependent glycosyltransferase enzyme, described in Table 1, which include Figure la: GrpET28a encoding multifunctional recombinant nucleotide dependent glycosyltransferase enzyme in fusion with C-term His tag (GT-CTH), Figure lb: GrpNIC28-Bsa4 encoding multifunctional recombinant nucleotide dependent glycosyltransferase enzyme in fusion with N- term His tag (GT-NTH), Figure lc: GrpMAL-c2X encoding multifunctional recombinant nucleotide dependent glycosyltransferase enzyme in fusion with MBP tag at N-term (MBP-GT) in accordance with the present invention.
- Figure la GrpET28a encoding multifunctional recombinant nucleotide dependent glycosyltransferase enzyme in fusion with
- Fig. 2 illustrates the SDS-PAGE profile of purified proteins namely, GT-CTH (Panel a), GT-NTH (Panel b) and MBP-GT (Panel c), Gel filtration profile of purified GT-CTH (Panel d) and MALDI-TOF-MS profile (Panel e-Monomer, Panel f- Dimer) of GT-CTH.
- GT-CTH Panel a
- GT-NTH Panel b
- MBP-GT Panel c
- Gel filtration profile of purified GT-CTH Panel d
- MALDI-TOF-MS profile Panel e-Monomer, Panel f- Dimer
- FIG. 3 illustrates the schema of methods of a) optimized GT assay for generating di- glycosylated glycoform of the acceptor substrate according to this invention b) controlled GT assay for generating a mixture of glycoforms of acceptor substrate by modulating enzyme: substrate ratio OR by incubating di-glucosylated product with ⁇ -glucosidase (3b-left panel), wherein the ⁇ -glucosidase catalyzes the removal of terminal saccharide moiety; c) glyco-diversification of RP-HPLC separated and purified mono-glycosylated glycoform in accordance with the present invention.
- the present invention relates to a multifunctional recombinant nucleotide dependent glycosyltransferase and methods to glycosylate acceptor substrates in vitro.
- the invention relates to nucleotide diphosphate (UDP/GDP) dependent O- and/or S- glycosyltransferase protein from bacteria that catalyzes the transfer of at least two monosaccharides sequentially on to serine or threonine or cysteine residue of an acceptor thereby producing an O- linked and/ or S- linked di-glycosylated product.
- UDP/GDP nucleotide diphosphate
- the present invention relates to the ability of the recombinant nucleotide dependent glycosyltransferase to catalyze more than one type of glycosidic linkages and usefulness in one pot synthesis of di-glycosylated product including glycosylated antimicrobial peptide such as enterocin 96, in vitro.
- the invention is useful for glyco-diversification of mono-glycosylated glycoforms.
- Recombinant when used with reference to a cell indicates that the cell replicates a heterologous nucleic acid (plasmid/ vector), or expresses a peptide or protein encoded by a heterologous nucleic acid (recombinant vector/ recombinant expression vector).
- Recombinant cells also contain genes found in the native form of the cell wherein the genes are modified and re-introduced into the cell by artificial means.
- a "recombinant protein” is the one which has been produced by a recombinant cell.
- Gly co-randomization and “Glyco-diversification” are used interchangeably herein refer to rapid diversification of bioactive peptides, small molecules, drug leads and/or approved drugs through the attachment of sugars, thereby generating glyco -diversified glycoforms of the same
- Bocteriocin and “Antimicrobial peptides” are used interchangeably herein refer to natural peptides secreted by several bacteria that exert bioactivity against other bacterial species.
- Gly co-conjugate refers to general classification for carbohydrates covalently linked with other chemical species such as proteins, peptides, lipids and saccharides.
- Nucleotide refers to a ribonucleotide or a deoxyribonucleotide.
- Nucleic acid refers to a polymer of nucleotides and may be single-or double- stranded.
- Polynucleotide ' refers to nucleic acid that is twelve or more nucleotides in length.
- Donor substrate with reference to glycosyltransferases, which is an activated nucleotide sugar.
- activated sugars generally consist of uridine, guanosine, and cytidine monophosphate derivatives of the sugars (UMP, GMP and CMP, respectively) or diphosphate derivatives of the sugars (UDP, GDP and CDP, respectively), in which the nucleoside monophosphate or diphosphate serves as a leaving group.
- a donor substrate for fucosyltransferases is GDP- fucose.
- Donor substrates for sialyltransferases for example, are activated sugar nucleotides comprising the desired sialic acid. For instance, in the case of NeuAc, the activated sugar is CMP-NeuAc.
- glycosyltransferase which is an oligosaccharide, monosaccharides, polypeptides, peptide, lipids, small organic molecules, and even DNA.
- the acceptor substrate When the acceptor substrate is contacted with the corresponding glycosyltransferase and sugar donor substrate, and other necessary reaction mixture components, and the reaction mixture is incubated for a sufficient period of time, the glycosyltransferase transfers sugar residues from the sugar donor substrate to the acceptor substrate.
- the acceptor substrate will often vary for different types of a particular glycosyltransferase.
- glycosyltransferase which is the glycosylated form of acceptor (oligosaccharide, monosaccharides, polypeptides, peptide, lipids, small organic molecules, and even DNA).
- acceptor oligosaccharide, monosaccharides, polypeptides, peptide, lipids, small organic molecules, and even DNA.
- glycoforms with reference to acceptor or product, which is differentially glycosylated forms of oligosaccharide, monosaccharides, polypeptides, peptide, lipids, small organic molecules, and even DNA. Such forms differ in nature and or size of glycan attached. Mono-glycosylated and di-glycosylated forms of an un-glycosylated acceptor are the glycoforms of the product.
- glycosylated and glyco-diversified form of acceptor substrate oligosaccharide, monosaccharides, polypeptides, peptide, lipids, small organic molecules, and even DNA.
- acceptor substrate oligosaccharide, monosaccharides, polypeptides, peptide, lipids, small organic molecules, and even DNA.
- NDP-Sugar Peptide/Polypeptide
- Glycosylated Peptide/Polypeptide Glycosylated Peptide/Polypeptide
- the reaction involves contacting nucleotide dependent glycosyltransferase enzyme with donor substrate and acceptor substrate, wherein the glycosyltransferase catalyzes the transfer of plurality of saccharide moieties from donor substrate to the serine or threonine or cysteine residue in acceptor substrate thereby produces O-linked and/or S-linked di-glycosylated product including glycosylated antimicrobial peptide such as enterocin 96 in vitro.
- the donor substrate comprises activated nucleotide sugars such as UDP-glucose, UDP-galactose, UDP-GlcNAc, UDP-glucuronic acid, GDP-mannose, GDP-glucose, GDP-fucose and other related nucleotide sugars thereof.
- the acceptor substrate corresponds to the peptides or polypeptides with amino acid sequences SEQ ID NO's: (4-17), wherein the acceptor harbors at least one copy of minimal sequon (IHSLLNRLGG(D/E ⁇ G)(S/T/C ⁇ Y/N)(S/T/R/A ⁇ G/D) corresponding to SEQ ID NO: 17 and variants thereof.
- One of the aspects of the present invention provides an ability to catalyze transfer of at least two monosaccharide molecules sequentially on to serine or threonine or cysteine residue of an acceptor substrate.
- the invention provides one pot synthesis of a disaccharide glycan on to serine or threonine or cysteine residue in acceptor substrate.
- Yet another aspect of the present invention provides an ability to catalyze two different linkages in the disaccharide glycan, which includes proximal linkage and terminal linkage.
- proximal linkage serine or threonine or cysteine residue of peptide/polypeptide is defined as O-linked (serine- or threonine-linked) or S-linked (cysteine-linked) to the monosaccharide at proximal/ reducing end, whereas anomeric configuration of the linkage is yet undefined.
- the anomeric configuration of linkage/glycosidic bond between first monosaccharide (at proximal/ reducing end) and the second monosaccharide (at terminal/non-reducing end) of the disaccharide glycan is identified as ⁇ , which is susceptible to a ⁇ -glucosidase.
- the present invention is capable of creating thio-ether linkages (S- linkage) between glycan and acceptor, which are generally more useful and robust than other linkages.
- a disaccharide glycan provides more sugar enrichment over monosaccharide glycan through less reaction steps. Such sugar enrichment may affect associated bioactivity of acceptor favorably.
- Disaccharide glycan also provides longer arm/linker which is more useful for secondary modification. For example; pegylation of glycan in stereo-constrained contexts especially for any bulkier modification.
- the invention furthermore, provides recombinant DNA molecules (recombinant bacterial expression vectors) encoding proteins having novel glycosyltransferase activities, hybrid vectors comprising such recombinant DNA molecules, recombinant transformed hosts suitable for the multiplication and/or expression of the recombinant DNA molecules
- the present invention further includes processes for the preparation of the proteins, DNA molecules and hosts.
- recombinant bacterial expression vectors carrying the polypeptide sequences of recombinantly expressed nucleotide dependent glycosyltransferase comprise SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3.
- the recombinant bacterial expression vectors suitable for expression of multifunctional recombinant nucleotide dependent glycosyltransferase comprise GrpET28a, GrpNIC28-Bsa4 and GrpMAL-c2X, respectively (summarized in Table 1 and Figure 1).
- the expression host used here is Escherichia coli. Accordingly, the expression of multifunctional recombinant nucleotide dependent glycosyltransferase is optimized in E.
- the present invention provides an isolated host cell transformed by any of the above described recombinant expression vectors, wherein the cell expresses a protein, polypeptide or peptide of interest encoded by the nucleic acid.
- the host cell is a prokaryotic host cell, for example, Escherichia coli or a strain thereof.
- the invention describes the use of acceptor substrate peptides corresponding to SEQ ID NO's: 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17 which serve as acceptor substrate for monosaccharide or disaccharide glycan in the presence of multifunctional recombinant nucleotide dependent glycosyltransferase corresponding to SEQ ID NO's: 1, 2 and 3 (Table 2).
- the invention provides a minimal acceptor sequon (IHS LLNRLGG(D/E ⁇ G)(S/T/C ⁇ Y/N)(S/T/R/A ⁇ G/D), corresponding to SEQ ID NO: 17 and variants thereof, wherein minimal acceptor sequon is a sequence of consecutive amino acids in a protein that serves as the attachment site to a glycan (monosaccharide or multiples of it linked in various forms).
- an acceptor substrate contains at least one exogenous minimal acceptor sequon, but may also includes one or more endogenous (e.g., naturally occurring) minimal acceptor sequon (Table 2).
- the present invention is further useful for generating glyco-diversified (di- glycosylated) products as depicted in Figure 3.
- Example 1 Construction of recombinant nucleotide dependent glycosyltransf erase expression vector
- GT gene The DNA sequence of nucleotide dependent glycosyltransferase gene (locus NZ_GG668924/EntS) termed GT gene hereafter, is retrieved from NCBI and the gene is custom synthesized and obtained from Genscript. The gene is custom synthesized using pUC57 vector between Ncol and Xhol restriction sites. The gene is sub-cloned into pET28a vector in order to get a C-terminal 6x-His tagged recombinant protein. Further, pUC57 plasmid containing GT gene and pET28a plasmid are amplified and double digested using Ncol and Xhol to prepare insert DNA fragment and cloning vector, respectively.
- Both the digests are then further gel extracted using NucleoSpin extract II (Macherey-Nagel, Germany).
- the purified products are then ligated using T4 DNA ligase.
- the ligation mixture is then transformed into E. coli TOP10 (Invitrogen) cells using heat shock and cells are plated on LB-kanamycin agar plate and grown for 12 h at 37 °C. Following incubation for 12 h at temperature 37 °C, several colonies are screened using colony PCR and positive colonies are inoculated into LB broth and plasmid isolation is done using Miniprep kit (Qiagen).
- GT gene is subcloned into pNIC28-Bsa4 vector between Ncol and Xhol sites in order to get N-terminal 6x-His tagged recombinant nucleotide dependent glycosyltransferase (GT-NTH).
- FIG. 1 illustrates the vector maps of bacterial protein expression vectors encoding recombinant nucleotide dependent glycosyltransferase, in accordance with the present invention.
- the E. coli Lemo21 (DE3) (NEB) cells are transformed with GrpET28a construct using heat shock.
- a single colony is inoculated into 30 ml LB broth containing 50 ⁇ g/ml kanamycin and 35 ⁇ g/ml chloramphenicol.
- the primary culture is grown overnight at 37 °C and used to inoculate 3 L LB broth containing 50 ⁇ g/ml kanamycin, 35 ⁇ g/ml chloramphenicol and 25 ⁇ L-Rhamnose.
- the culture is then grown at 37 °C to OD 6 oo 3 ⁇ 4 0.6. Further, the culture is induced using 0.4 mM IPTG and incubated at 25 °C for 12 h. Cells are then harvested at 8000 x rpm for 20 min at 4 °C.
- GrpNIC-Bsa4 is transformed into E. coli BL21 (DE3) (NEB) for over expression wherein a single colony is inoculated into 30 ml LB broth containing 50 ⁇ g/ml kanamycin.
- the primary culture is grown overnight at 37 °C and used to inoculate 3 L LB broth.
- the culture is then grown at 37 °C to OD 6 oo 3 ⁇ 4 0.6. Further, the culture is induced using 0.5 mM IPTG and incubated at 18 °C for 16 h. Cells are then harvested at 8000 x rpm for 20 min at 4 °C.
- the cell pellet (GT-CTH/GT-NTH) is resuspended in 150 ml of start buffer (20 mM HEPES, pH 7.5, 500 mM NaCl, 2 mM DTT and 10 % Glycerol) and cell lysis is carried out using sonication with 10 sec on and 10 sec off pulse and 25 % amplitude.
- the cell debris is then removed by centrifuging at 12000 x rpm for 30 min at 4 °C.
- the supernatant is further subjected to metal affinity chromatography.
- washing buffer (20 mM HEPES, pH 7.5, 1 M NaCl, 2 mM DTT, 30 mM imidazole, 10 % glycerol).
- the salt concentration in washing buffer is gradually reduced upto 200 mM and elution is done with half column volume of elution buffer (20 mM HEPES, pH 7.5, 200 mM imidazole, 200 mM NaCl, 2 mM DTT).
- the fractions containing desired protein are pooled and concentrated using Amicon ultra membrane filters (30 KDa MWCO, Millipore).
- the desired protein is then further subjected to gel filtration chromatography.
- the concentrated protein sample is injected onto a FPLC system (AKTA, GE Healthcare life sciences) equipped with Superdex-200 10/300 GL (GE Healthcare life sciences) previously equilibrated with 20 mM HEPES, pH 7.5, 200 mM NaCl and 2 mM DTT.
- the elution is done at a flow rate of 0.5 ml/min and monitored at 280 nm.
- the desired fractions are then collected, pooled and concentrated using Amicon ultra membrane filters (30 KDa MWCO, Millipore).
- the concentration is estimated using Bradford reagent and protein is stored at -80 °C wherein the yield generated is approximately 12-15 mg of protein from 3 L culture.
- MBP-GT MBP tagged recombinant nucleotide dependent glycosyltransferase
- GrpMAL-c2x is transformed into E. coli RosettaTM (DE3) cells and for purification a single colony is inoculated into 30 ml LB broth containing 100 ⁇ / ⁇ ampicillin and 35 ⁇ g/ml chloramphenicol.
- the primary culture is grown overnight at 37 °C and used to inoculate 3 L LB broth containing 100 ⁇ g/ml ampicillin, 35 ⁇ g/ml chloramphenicol and 0.2 % D-glucose.
- the culture is then grown at 37 °C to OD 6 oo 3 ⁇ 4 0.6. Further, the culture is induced using 0.5 mM IPTG and incubated at 18 °C for 16 h.
- Cells are harvested at 8000 x rpm for 20 min at 4 °C.
- the cell lysate is left for binding with amylose resin previously washed and equilibrated with lysis buffer (20 mM HEPES, pH 7.5, 500 mM NaCl, 10 mM ⁇ - ⁇ and 10 % glycerol).
- the binding time is 1 h.
- Flow through is collected and bound beads are washed with washing buffer (20 mM HEPES, pH 7.5, 200 mM NaCl, 1 mM DTT).
- the elution is done using elution buffer (20 mM HEPES, pH 7.5, 200 mM NaCl, 1 mM DTT) containing gradually increasing concentrations of maltose (1 mM, 2 mM, 5 mM, 10 mM).
- elution buffer (20 mM HEPES, pH 7.5, 200 mM NaCl, 1 mM DTT) containing gradually increasing concentrations of maltose (1 mM, 2 mM, 5 mM, 10 mM).
- the fractions containing desired protein are pooled and concentrated using Amicon ultra membrane filters (30 KDa MWCO, Millipore).
- the desired protein is then further subjected to gel filtration chromatography using the above mentioned protocol.
- Fig. 2 illustrates the purification profile of various fusions of recombinant nucleotide dependent glycosyltransferase enzyme as described above.
- Panel a, Panel b and Panel c illustrate the SDS-PAGE profile of GT-CTH, GT-NTH and MBP-GT (in the presence of different concentrations of maltose i.e.
- Mass spectrometry has been used to detect glycosylation in product of glycosylation assay reactions using Matrix Assisted Laser Desorption Ionization Time of flight mass spectrometry (MALDI-TOF MS) and Liquid chromatography electrospray ionization mass spectrometry (LC/ESI-MS) techniques.
- MALDI-TOF MS Matrix Assisted Laser Desorption Ionization Time of flight mass spectrometry
- LC/ESI-MS Liquid chromatography electrospray ionization mass spectrometry
- MALDI-TOF MS has carried out at AB Sciex 5800 MALDI TOF/TOF and LC/ESI-MS has carried out at 6550 iFunnel QTOF LC/MS (Agilent Technologies) using Zorbax Eclipse plus C8 column (3.0 x 150 mm, 5 ⁇ ) of Agilent technologies.
- LC-ESI/MS analysis vacuum dried samples are reconstituted in water and 0.1 % formic acid respectively.
- the analyzer Prior to sample data acquisition, the analyzer was externally calibrated using a mixture of the peptides, angiotensin, bradykinin, Glu-l-Fibrinopeptide, ACTH fragment 1-17, ACTH fragment 18-39, and ACTH fragment 7-38 (Part No: 4333604, AB Sciex).
- MALDI-TOF MS analysis of salt-free samples 1 ⁇ , aliquot of analyte is combined with 1 ⁇ L ⁇ of matrix (a-cyano-4-hydroxy-cinnamic acid matrix in 50% ACN/50% water with 0.1% TFA) and the total volume is spotted onto a 384 well MALDI target plate and dried under ambient conditions prior to analysis.
- MS data acquisition is done in reflector and positive ion mode using laser intensity in the range of 3000 - 3400 V, keeping the mass range 400-700 Da, total number of shots 2000, bin size 0.5 ns and pulse rate 400 Hz. Further MSMS data was collected in mass range 10 - 4000 Da keeping the laser intensity in range of 4000 - 4200 V and adduct tolerance 0.03. Precursors having S/N and resolution below 20 and 200 respectively were excluded for MSMS. Post-acquisition, the raw data was extracted in the format of t2d files, imported in the Data Explorer software, version 4.9 of Applied Biosystems and converted in to text file format. The text files having the peaks list, imported and plotted in Origin (OriginPro 2015 b.9.2.214).
- the sample is then fractionated by employing a gradient of solvent B (40 %-100 %) over 12 min with 0.4 ml/min flow rate and directly subjected to ESI-Q/TOF MS.
- Data is acquired in Dual AJS ESI positive ion mode with the capillary voltage set to 4.5 kV.
- Nitrogen is used as sheath gas (11 L/min).
- the ionization source and sheath gas are heated to 200 °C and 300 °C, respectively.
- Nozzle and fragmentor voltage are kept at 1000V and 280V, respectively.
- MassHunter workstation software version B.05.00 by Agilent Technologies was used for data acquisition. Post-acquisition, the acquired raw data (.d files) were imported into MassHunter qualitative analysis software, version B.05.00 for further processing. The expected multiple charged ions of the peptides were observed between 2.5 - 3.5 minutes of retention time in the acquired LC chromatogram (TIC). The TIC corresponding to the expected multiple charged ions was integrated and deconvoluted to obtain MS spectrum and plotted in Origin (OriginPro 2015 b.9.2.214).
- the acceptor substrate having SEQ ID NO: 4 was incubated with recombinant nucleotide dependent glycosyltransferase in the presence of UDP-glucose and MgCl 2.
- the reaction was then analyzed using LC- ESI-Q/TOF, which showed observed average mass of di-glycosylated product as 5503.47 Da (Expected average mass 5503.00 Da) and observed average mass of un- glycosylated product as 5179.70 Da,( Expected average mass 5179.00 Da).
- the acceptor substrate having SEQ ID NO: 9 was incubated with recombinant nucleotide dependent glycosyltransferase in presence of UDP-glucose and MgCl 2.
- the reaction was then analyzed using MALDI-TOF, which showed observed (M+H) + of di-glycosylated product as 2424.65 Da (Expected (M+H) + 2424.07 Da) and observed (M+H) + of mono- glycosylated product as 2262.57 Da (Expected (M+H) + 2262.07 Da) and observed (M+H) + of un-glycosylated product as 2100.49 Da (Expected (M+H) + 2100.07 Da).
- the acceptor substrate having SEQ ID NO: 5 was incubated with recombinant nucleotide dependent glycosyltransferase in presence of UDP-glucose and MgCl 2.
- the reaction was then analyzed using LC-ESI- Q/TOF, which showed observed monoisotopic mass of di-glycosylated product as 5515.53 Da (Expected monoisotopic mass 5515.41 Da) and observed monoisotopic mass of un-glycosylated product as 5190.91 Da (Expected monoisotopic mass 5191.41 Da).
- chymotrypsin digestion of acceptor and product For glycosite annotation the glycosylated and their respective un-glycosylated acceptor are digested using chymotrypsin (Sigma) in presence of 100 mM Tris-Cl, pH 7.5, 10 mM CaCl 2 5 mM TCEP. The reactions are incubated at 30 °C for 5 h and quenched with 5 % TFA to pH 2. The reactions are then desalted using ZipTip C 18 and vacuum dried. For MALDI-TOF-MS and tandem MS analysis, the samples are reconstituted in water. Further the MS/MS is carried out for all the peaks of interest.
- MALDI-TOF-MS and tandem MS spectra analysis of chymotrypsin digested products MALDI-TOF-MS and tandem MS spectra of chymotrypsin digested products are acquired using the above mentioned method of acquisition and analysis of MALDI-TOF spectra. Tandem MS is performed of all the peaks of interest and the glycosylated residue is identified by manual de novo peptide sequencing.
- the acceptor substrates having SEQ ID NO: 4, SEQ ID NO: 9 and SEQ ID NO: 5 were in vitro glycosylated using recombinant nucleotide dependent glycosyltransferase, chymotrypsin digested and analyzed on MALDI-TOF.
- the resulting MSMS spectrum of 2774.39 Da peak of acceptor substrate corresponding to SEQ ID NO: 4 identified serine at 33 position to be the glycosite.
- the resulting MSMS spectrum of 2424.65 Da peak corresponding to SEQ ID NO: 9 identified threonine at 33 position to be the glycosite.
- the resulting MSMS spectrum of 2790.39 Da peak corresponding to SEQ ID NO: 5 identified cysteine at 33 position to be the glycosite.
- the GT assay conditions were optimized to get a mixture of un-glycosylated, mono- glycosylated and di-glycoyslated products.
- 100 ⁇ acceptor peptide SEQ ID NO: 4
- 100 ⁇ UDP-glucose/ UDP- galactose in presence of reaction buffer containing 20 mM HEPES, pH 7.5, 50 mM NaCl, 1 mM TCEP and 0.5 mM MgCl 2 for 1 h at 25 °C.
- Figure 3b illustrates the schema of generating a mixture of un-glycosylated, mono-glycosylated and di- glycoyslated products by incubating the acceptor substrate, donor substrate and recombinant nucleotide dependent glycosyltransferase under controlled GT assay conditions.
- the di-glucosylated product (SEQ ID NO: 4) is deglycosylated using suitable exoglycosidase ( ⁇ -glucosidase).
- the acceptor substrate is first di-glucosylated under aforesaid optimized GT assay conditions and the di-glucosylated product (5 ⁇ ) is incubated with 2 ⁇ / ⁇ of ⁇ -glucosidase (Catalogue No: 195197, MP Biomedicals) in reaction buffer containing 100 mM sodium acetate buffer, pH 5.0 and 1 X purified BSA for 18 h.
- the control reaction is carried out by incubating all reaction components in absence of ⁇ -glucosidase.
- FIG. 3b illustrates schema for deglycosylation of di-glucosylated product (SEQ ID NO: 4) in accordance with the present invention.
- the di-glucosylated product was incubated with ⁇ -glucosidase and the reaction was then analyzed using LC-ESI-Q/TOF, which showed that major population of di- glucosylated product (Observed average mass 5500.12 Da) is converted in to mono- glucosylated product (Observed average mass 5337.42 Da).
- the reactions are analyzed on analytical HPLC system (Shimadzu) using a reverse phase column of Phenomenex (Jupitor 5 ⁇ CI 8 column, 250 X 4.6 mm, 300 A) and RP-HPLC method is optimized to separate the mixture of un-glycosylated, mono-glycosylated and di-glycosylated products.
- 20 ⁇ ⁇ of the reaction mixture is injected on the column previously equilibrated with 5 % solvent B (solvent A: 0.1 % TFA in water, solvent B: 0.1 % TFA in ACN).
- solvent B solvent B
- the sample is fractionated by employing a gradient of solvent B (5-100 %) over 26 min with a flow rate of 1 ml/min and observed at wavelength of 220 nm.
- the masses of separated glycoforms are further checked by MALDI-TOF-MS, which confirms that di-glycosylated product elutes first, followed by mono-glycosylated and then un-glycosylated product.
- the purified HPLC fractions containing single species are lyophilized and stored at -80 °C. The similarly separation can also be achieved for species obtained upon exoglycosidase treatment of di-glycosylated product as stated further.
- the RP-HPLC purified mono-glucosylated product is glyco-diversified using UDP- galactose and recombinant nucleotide dependent glycosyltransferase under controlled GT assay conditions.
- mono-galactosylated product is glyco- diversified using UDP-glucose and recombinant nucleotide dependent glycosyltransferase under controlled GT assay conditions.
- the masses of all glyco- diversified products are confirmed by MALDI-TOF-MS.
- Figure 3c illustrates the approach used for glyco-diversification of acceptor substrate in accordance with the present invention.
- the di-glycosylated, mono-glycosylated and un-glycosylated glycoforms corresponding to enterocin 96 (known bacteriocin) peptide sequence are prepared under controlled GT assay conditions and purified using RP-HPLC based method.
- the lyophilized product glycoforms including glyco-diversified forms are re- suspended in 50 mM Tris-Cl, pH 7.5.
- the culture of Listeria monocytogenes EGD-e is grown in BHI media at 37 °C for 7-8 h.
- Agar plates are prepared by mixing 25 of saturated culture (A 6 oo ⁇ 1.5) and 100 mL of molten BHI agar (cooled to 40 - 45 °C) and pouring the mixture into sterile petri plates. The seeded agar plates are allowed to solidify for 30 - 45 min and agar wells are prepared using a sterile cork borer. 50 ⁇ of all glycoforms including glyco-diversified forms are poured in to the wells and plates are incubated at 37 °C for 12 h. The antimicrobial activity is determined by the presence and absence of zone of growth inhibition.
- glycoforms corresponding to SEQ ID NO: 4 in accordance with the present invention were checked against Listeria monocytogenes EGD-e where di-glucosylated product showed more antimicrobial activity than mono-glucosylated product.
- Mono-galactosylated product and glyco-diversified form where glucose was at proximal and galactose was at terminal position did not show bioactivity, whereas the glyco-diversified form where galactose was at proximal and glucose was at terminal position showed bioactivity.
- SEQ ID Encodes N- MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDK NO: 3 terminal MBP LEEKFPQVAATGDGPDI IFWAHDRFGGYAQSGLLAEI PDKAF tagged QDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKT recombinant WEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKY nucleotide ENGKYDIKDVGVDNAGAKAGL FLVDLIKNKHMNADTDYSIAE dependent AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKP
- AAAT AG C AAG C G
- AAG C G AAAAAGT AAAAAT AT T T GAT T AT AC T T GG C
- AAAC AGC AT AGT T T GT AT GAAC AAC AAT T T GAAT T T T T AAAAG
- AAT GAAT C AC SEQ ID Expression CATGGGCTATTCTGAAAATTTTATTGCTAATGACTGGTTTAAT
- AAAT AG C AAG C G
- AAG C G AAAAAGT AAAAAT AT T T GAT T AT AC T T GG C
- AAAC AGC AT AGT T T GT AT GAAC AAC AAT T T GAAT T T T T AAAAG
- AAAG AAT GGAT AT T AAT T AT T GAT GC AGAT G AAT AT GT AT C T T
- 0.2 ⁇ purified recombinant nucleotide dependent glycosyltransferase is incubated with 5 ⁇ acceptor substrate (SEQ ID NO: 4) in presence of an NDP sugar such as UDP-glucose, UDP-galactose, UDP-GlcNAc, UDP-GalNAc and GDP-mannose, GDP-glucose, GDP-fucose and UDP-glucuronic acid (in varying concentrations ranging 50 ⁇ , 100 ⁇ , 250 ⁇ and 500 ⁇ ) in a reaction buffer containing 20 mM HEPES, pH 7.5, 50 mM NaCl and 1 mM TCEP. The reaction is then incubated at 25°C for 12 hours. The reactions are quenched with 5 % TFA to pH 2. The samples are desalted and subjected to MS analysis.
- SEQ ID NO: 4 acceptor substrate
- NDP sugar such as UDP-glucose, UDP-galactose, U
- GT-CTH recombinant nucleotide dependent glycosyltransferase
- side directed mutagenesis Quick change lightning Mutagenesis kit, Agilent
- GrpET28a plasmid The sequence of mutants is verified through DNA sequencing.
- the mutated recombinant plasmids are transformed into E. coli Lemo21(DE3) and E. coli BL21(DE3) cells for expression.
- the over expression, purification and functional analysis of mutants of recombinant nucleotide dependent glycosyltransferase proteins are performed using the above mentioned methods.
- mutants of recombinant nucleotide dependent glycosyltransferase created in accordance with present invention identifies D102, R136, W147, D152, A153, D154 residues critical for activity of recombinant nucleotide dependent glycosyltransferase (GT-CTH). Replacement of these residues to alanine results into abolishment of the glycosyltransferase activity.
- GT-CTH recombinant nucleotide dependent glycosyltransferase
- the present invention provides more sugar enriched product by constructing a disaccharide and not just a monosaccharide glycan at one of three chemo-variant sites namely, serine or threonine or cysteine using single enzyme reaction. Furthermore, the invention is also capable of glyco-diversification thereby synthesizing at least four different disaccharide glycans and two different monosaccharide glycans on to the acceptor by using nucleotide dependent recombinant glycosyltransferase.
- the present invention is also useful to glycosylate and generates diversified glycoforms of bacteriocin like peptides or a polypeptide that harbor at least one exogenous or endogenous copy of minimal sequon corresponding to SEQ ID NO: 17 and variants thereof.
- the present invention provides components to carry out glycosylation in vivo in a suitable prokaryotic host, which is useful for generating glycosylation in acceptor substrates where acceptor sites are not surface accessible in vitro. Furthermore, the present invention also provides method/components to carry out glycosylation in a cell free in vitro environment using appropriate reagents thereby creating useful/important neo-glycopeptides and or neo-bacteriocins.
- This invention provides for one pot synthesis of a disaccharide glycan on to serine or threonine or cysteine residue in acceptor substrate.
- This invention provides for creation of thioether linkages (S- linkage) between glycan and acceptor which are more useful, robust than ether linkages.
- This invention provides for more sugar enriched product by constructing a disaccharide and not just a monosaccharide glycan at a single site using single enzyme reaction, wherein a disaccharide glycan or diglycan imparts better bioactivity than a monosaccharide glycan or mono-glycan in a glycosylated peptide like enterocin 96 peptide.
- a disaccharide glycan or diglycan imparts better bioactivity than a monosaccharide glycan or mono-glycan in a glycosylated peptide like enterocin 96 peptide.
- the effect of glycan is not limited to influencing the bioactivity only.
- Invention is capable of glyco-diversification and can synthesize at least four different disaccharide glycans and two monosaccharides on to the three different accepting residues namely, serine or threonine or cysteine in acceptor substrate, wherein nature and size of attached glycan affects the bioactivity of the glycosylated product but not limited to influencing bioactivity only.
- This invention can be used to glycosylate and generate diversified glycoforms of bacteriocin like peptides that harbor at least one exogenous or endogenous copy of minimal sequon corresponding to SEQ ID NO: 17 and variants thereof.
- This invention provides for useful components for directed evolution and for improvement of specificities of the invention described in.
- the invention also provides components to develop a system to carry out glycosylation in vivo in a prokaryotic host and could be useful for generating glycosylation in acceptor substrate where acceptor sites are not surface accessible in vitro.
- the present invention also provides method/components to carry out glycosylation in a cell free in vitro environment using appropriate reagents thereby creating useful/important neo-glycopeptides and neo-bacteriocins.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicinal Chemistry (AREA)
- Analytical Chemistry (AREA)
- Crystallography & Structural Chemistry (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP17737380.0A EP3423587B1 (en) | 2016-04-05 | 2017-03-30 | A multifunctional recombinant nucleotide dependent glycosyltransferase protein and its method of glycosylation thereof |
| CN201780031562.4A CN109312379B (zh) | 2016-04-05 | 2017-03-30 | 多功能重组核苷酸依赖性糖基转移酶蛋白及其糖基化的方法 |
| US16/091,186 US11485991B2 (en) | 2016-04-05 | 2017-03-30 | Multifunctional recombinant nucleotide dependent glycosyltransferase protein and its method of glycosylation thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IN201611011974 | 2016-04-05 | ||
| IN201611011974A IN201611011974A (https=) | 2016-04-05 | 2017-03-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2017175239A1 true WO2017175239A1 (en) | 2017-10-12 |
| WO2017175239A4 WO2017175239A4 (en) | 2017-12-28 |
Family
ID=59298493
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IN2017/050116 Ceased WO2017175239A1 (en) | 2016-04-05 | 2017-03-30 | A multifunctional recombinant nucleotide dependent glycosyltransferase protein and its method of glycosylation thereof |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US11485991B2 (https=) |
| EP (1) | EP3423587B1 (https=) |
| CN (1) | CN109312379B (https=) |
| IN (1) | IN201611011974A (https=) |
| WO (1) | WO2017175239A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020237226A1 (en) * | 2019-05-23 | 2020-11-26 | Arzeda Corp. | Compositions and methods for producing steviol glycosides |
| EP3844271A4 (en) * | 2018-08-29 | 2022-06-01 | Council of Scientific and Industrial Research | Recombinant microbial system for directed evolution of glycocins and a method of preparation thereof |
Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5641668A (en) | 1992-11-27 | 1997-06-24 | Ciba-Geigy Corporation | Proteins having glycosyltransferase activity |
| WO2000017226A1 (en) | 1998-09-23 | 2000-03-30 | The Regents Of The University Of California | Synthetic peptides, conjugation reagents and methods |
| WO2002000851A2 (en) | 2000-06-28 | 2002-01-03 | National Research Council Of Canada | Helicobacter dd-heptosyltransferase |
| US6379933B1 (en) | 1995-06-07 | 2002-04-30 | Neose Technologies, Inc. | Method of transferring at least two saccharide units with a polyglycosyltransferase |
| WO2004009793A2 (en) | 2002-07-23 | 2004-01-29 | Neose Technologies, Inc. | Synthesis of glycoproteins using bacterial gycosyltransferases |
| US6743606B1 (en) | 1998-03-25 | 2004-06-01 | Gesellschaft Für Erwerb und Verwertung von Schutzrechten-GVS mbH | Processive sugar transferase |
| US7338933B2 (en) | 2004-01-08 | 2008-03-04 | Neose Technologies, Inc. | O-linked glycosylation of peptides |
| EP1981977A1 (en) | 2006-01-31 | 2008-10-22 | National Research Council of Canada | Production of polysialic acid containing glyconjugates using a self-priming polysialyltransferase |
| WO2008151258A2 (en) | 2007-06-04 | 2008-12-11 | Neose Technologies, Inc. | O-linked glycosylation using n-acetylglucosaminyl transferases |
| EP2049144A2 (en) | 2006-07-21 | 2009-04-22 | Neose Technologies, Inc. | Glycosylation of peptides via o-linked glycosylation sequences |
| WO2011073438A2 (en) | 2009-12-17 | 2011-06-23 | L'oreal | Cosmetic method for treating body odours using a bacteriocin based composition |
| WO2013088194A1 (en) | 2011-12-13 | 2013-06-20 | Centre National De La Recherche Scientifique | Modified peptides and their use for treating autoimmune diseases |
| CN102389030B (zh) | 2011-09-16 | 2013-12-25 | 李叶青 | 枯草杆菌糖肽素168的用途 |
| US20140033369A1 (en) | 2011-01-14 | 2014-01-30 | Suntory Holdings Limited | Novel glycosyltransferase gene and use thereof |
| US8895014B2 (en) | 2008-02-20 | 2014-11-25 | Glycovaxyn Ag | Bioconjugates made from recombinant N-glycosylated proteins from procaryotic cells |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101151367B (zh) * | 2004-02-04 | 2013-04-10 | 诺和诺德公司 | 哺乳动物糖基转移酶的重折叠方法 |
| EP2479263B1 (en) * | 2011-01-20 | 2013-11-27 | Jennewein Biotechnologie GmbH | Novel Fucosyltransferases and their applications |
| BR122021015417B1 (pt) * | 2013-08-19 | 2022-11-08 | Syngulon Sa | Célula microbiana geneticamente engenheirada que compreende um ácido nucleico que codifica uma bacteriocina |
-
2017
- 2017-03-30 CN CN201780031562.4A patent/CN109312379B/zh not_active Expired - Fee Related
- 2017-03-30 EP EP17737380.0A patent/EP3423587B1/en not_active Not-in-force
- 2017-03-30 WO PCT/IN2017/050116 patent/WO2017175239A1/en not_active Ceased
- 2017-03-30 US US16/091,186 patent/US11485991B2/en active Active
- 2017-03-30 IN IN201611011974A patent/IN201611011974A/en unknown
Patent Citations (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5641668A (en) | 1992-11-27 | 1997-06-24 | Ciba-Geigy Corporation | Proteins having glycosyltransferase activity |
| US6379933B1 (en) | 1995-06-07 | 2002-04-30 | Neose Technologies, Inc. | Method of transferring at least two saccharide units with a polyglycosyltransferase |
| US6743606B1 (en) | 1998-03-25 | 2004-06-01 | Gesellschaft Für Erwerb und Verwertung von Schutzrechten-GVS mbH | Processive sugar transferase |
| WO2000017226A1 (en) | 1998-09-23 | 2000-03-30 | The Regents Of The University Of California | Synthetic peptides, conjugation reagents and methods |
| WO2002000851A2 (en) | 2000-06-28 | 2002-01-03 | National Research Council Of Canada | Helicobacter dd-heptosyltransferase |
| WO2004009793A2 (en) | 2002-07-23 | 2004-01-29 | Neose Technologies, Inc. | Synthesis of glycoproteins using bacterial gycosyltransferases |
| US7338933B2 (en) | 2004-01-08 | 2008-03-04 | Neose Technologies, Inc. | O-linked glycosylation of peptides |
| US8257949B2 (en) | 2006-01-31 | 2012-09-04 | National Research Council Of Canada | Self-priming polysialyltransferase |
| EP1981977A1 (en) | 2006-01-31 | 2008-10-22 | National Research Council of Canada | Production of polysialic acid containing glyconjugates using a self-priming polysialyltransferase |
| EP2049144A2 (en) | 2006-07-21 | 2009-04-22 | Neose Technologies, Inc. | Glycosylation of peptides via o-linked glycosylation sequences |
| EP2049144B1 (en) | 2006-07-21 | 2014-07-16 | Novo Nordisk A/S | Glycosylation of peptides via o-linked glycosylation sequences |
| WO2008151258A2 (en) | 2007-06-04 | 2008-12-11 | Neose Technologies, Inc. | O-linked glycosylation using n-acetylglucosaminyl transferases |
| US8895014B2 (en) | 2008-02-20 | 2014-11-25 | Glycovaxyn Ag | Bioconjugates made from recombinant N-glycosylated proteins from procaryotic cells |
| WO2011073438A2 (en) | 2009-12-17 | 2011-06-23 | L'oreal | Cosmetic method for treating body odours using a bacteriocin based composition |
| US20140033369A1 (en) | 2011-01-14 | 2014-01-30 | Suntory Holdings Limited | Novel glycosyltransferase gene and use thereof |
| CN102389030B (zh) | 2011-09-16 | 2013-12-25 | 李叶青 | 枯草杆菌糖肽素168的用途 |
| WO2013088194A1 (en) | 2011-12-13 | 2013-06-20 | Centre National De La Recherche Scientifique | Modified peptides and their use for treating autoimmune diseases |
Non-Patent Citations (36)
| Title |
|---|
| ANDRIY LUZHETSKYY ET AL: "Features and applications of bacterial glycosyltransferases: current state and prospects", APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, SPRINGER, BERLIN, DE, vol. 80, no. 6, 6 September 2008 (2008-09-06), pages 945 - 952, XP019654159, ISSN: 1432-0614, DOI: 10.1007/S00253-008-1672-2 * |
| BRIMBLE; M.A.; EDWARDS, P.J.; HARRIS, P.W.; NORRIS, G.E.; PATCHETT, M.L.; WRIGHT, T.H.; YANG, S.H.; CARLEY, S.E.: "Synthesis of the antimicrobial S-linked glycopeptide, glycocin F.", CHEMISTRY, vol. 21, 2015, pages 3556 - 3561 |
| COTTER, P.D.; ROSS, R.P.; HILL, C.: "Bacteriocins - a viable alternative to antibiotics?", NATURE REVIEWS MICROBIOLOGY, vol. 11, 2013, pages 95 - 105, XP055306514, DOI: doi:10.1038/nrmicro2937 |
| DATABASE EMBL [online] 29 March 2003 (2003-03-29), "Enterococcus faecalis V583 plasmid pTEF2, complete sequence.", XP002773411, retrieved from EBI accession no. EM_STD:AE016831 Database accession no. AE016831 * |
| DATABASE Geneseq [online] 9 April 2015 (2015-04-09), "Enterococcus faecalis Enterocin 96 polypeptide, SEQ 92.", XP002773162, retrieved from EBI accession no. GSP:BBU98419 Database accession no. BBU98419 * |
| GANTT, R.W; PELTIER-PAIN, P.; THORSON, J.S.: "Enzymatic methods for glyco (diversification/randomization) of drugs and small molecules", NATURAL PRODUCT REPORTS, vol. 28, 2011, pages 1811 - 1853 |
| GARCIA DE GONZALO, C.V.; ZHU, L.; OMAN, T.J.; VAN DER DONK, W.A.: "NMR structure of the S-linked glycopeptide sublancin 168.", ACS CHEMICAL BIOLOGY, vol. 9, 2014, pages 796 - 801 |
| GROUP 2 FAMILY PROTEIN GLYCOSYLATRANSFERASE: "UNIPROTKB-C0X1N2 )C0X1N2 ENTFL", ENTEROCOCCUS FAECALIS TX0104, 26 May 2009 (2009-05-26), XP055400908, Retrieved from the Internet <URL:www.uniprot.org/C0X1N2> [retrieved on 20170824] * |
| HANSON, S.; BEST, M.; BRYAN, M.C.; WONG, C.H.: "Chemoenzymatic synthesis of oligosaccharides and glycoproteins.", TRENDS IN BIOCHEMICAL SCIENCES, vol. 29, 2004, pages 656 - 663, XP004641484, DOI: doi:10.1016/j.tibs.2004.10.004 |
| HASSAN, M.; KJOS, M.; NES, I.F.; DIEP, D.B.; LOTFIPOUR, F.: "Natural antimicrobial peptides from bacteria: characteristics and potential applications to fight against antibiotic resistance", JOURNAL OF APPLIED MICROBIOLOGY, vol. 113, 2012, pages 723 - 736 |
| HSIEH, Y.S.; WILKINSON, B.L.; O'CONNELL, M.R.; MACKAY, J.P.; MATTHEWS, J.M.; PAYNE, R.J.: "Synthesis of the bacteriocin glycopeptide sublancin 168 and S-glycosylated variants.", ORGANIC LETTERS, vol. 14, 2012, pages 1910 - 1913 |
| IWAO, Y.; HIRAIKE, M.; KRAGH-HANSEN, U.; KAWAI, K.; SUENAGA, A.; MARUYAMA, T.; OTAGIRI, M.: "Altered chain-length and glycosylation modify the pharmacokinetics of human serum albumin.", BIOCHIMBIOPHYSACTA, vol. 1794, 2009, pages 634 - 641, XP025973226, DOI: doi:10.1016/j.bbapap.2008.11.022 |
| IZQUIERDO, E.; WAGNER, C.; MARCHIONI, E.; AOUDE-WERNER, D.; ENNAHAR, S.: "Enterocin 96, a novel class II bacteriocin produced by Enterococcus faecalis WHE 96, isolated from Munster cheese.", APPL ENVIRON MICROBIOL, vol. 75, 2009, pages 4273 - 4276 |
| KATAYAMA, H.; ASAHINA, Y.; HOJO, H.: "Chemical synthesis of the S-linked glycopeptide; sublancin", JOURNAL OF PEPTIDE SCIENCE: AN OFFICIAL PUBLICATION OF THE EUROPEAN PEPTIDE SOCIETY, vol. 17, 2011, pages 818 - 821 |
| KERR, A.P.: "The bacteriostatic spectrum and inhibitory mechanism of glycocin F, a bacteriocin from Lactobacillus plantarum KW30", MICROBIOLOGY, 2013 |
| LAURE GUILLOTIN, . P.L.; RICHARD DANIELLOU: "Enzymatic thioglycosylation", CURRENT KNOWLEDGE AND CHALLENGES, vol. 40, 2014 |
| LAURE GUILLOTIN, P.L.; RICHARD DANIELLOU: "Thioglycoligases: innovative biocatalytic tools for S-glycosylated proteins synthesis.", 11TH CARBOHYDRATE BIOENGINEERING MEETING (ESPOO, FINLAND, 2015 |
| LINDHOUT, T.; IQBAL, U.; WILLIS, L.M.; REID, A.N.; LI, J.; LIU, X.; MORENO, M.; WAKARCHUK, W.W.: "Site-specific enzymatic polysialylation of therapeutic proteins using bacterial enzymes", PROCNATLACADSCI USA, vol. 108, 2011, pages 7397 - 7402, XP055077840, DOI: doi:10.1073/pnas.1019266108 |
| MAIN, P.J.: "Investigating the bacteriocin library Lactobacillus plantarum A-l", MICROBIOLOGY, 2014 |
| MAKY, M.A; ISHIBASHI, N.; ZENDO, T.; PEREZ, R.H.; DOUD, J.R.; KARMI, M.; SONOMOTO, K.: "Enterocin F4-9, a Novel O-Linked Glycosylated Bacteriocin.", APPL ENVIRON MICROBIOL, vol. 81, 2015, pages 4819 - 4826 |
| MASIAS, E.; SANCHES, P.R.; DUPUY, F.G.; ACUNA, L.; BELLOMIO, A.; CILLI, E; SAAVEDRA, L.; MINAHK, C.: "28-mer Fragment Derived from Enterocin CRL35 Displays an Unexpected Bactericidal Effect on Listeria Cells.", PROTEIN AND PEPTIDE LETTERS, vol. 22, 2015, pages 482 - 488 |
| MULLEGGER, J.; CHEN, H.M.; WARREN, R.A.; WITHERS, S.G.: "Glycosylation of a neoglycoprotein by using glycosynthase and thioglycoligase approaches: the generation of a thioglycoprotein.", ANGEWANDTE CHEMIE (INTERNATIONAL ED IN ENGLISH, vol. 45, 2006, pages 2585 - 2588 |
| OMAN, T.J.; BOETTCHER, J.M.; WANG, H.; OKALIBE, X.N.; VAN DER DONK, W.A.: "Sublancin is not a lantibiotic but an S-linked glycopeptide", NAT CHEMBIOL, vol. 7, 2011, pages 78 - 80 |
| RICARDO J. SOLÁ ET AL: "Effects of glycosylation on the stability of protein pharmaceuticals", JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 98, no. 4, 1 April 2009 (2009-04-01), pages 1223 - 1245, XP055057795, ISSN: 0022-3549, DOI: 10.1002/jps.21504 * |
| RUPA NAGAR ET AL: "An iterative glycosyltransferase EntS catalyzes transfer and extension of O- and S-linked monosaccharide in enterocin 96", GLYCOBIOLOGY, vol. 27, no. 8, 25 May 2017 (2017-05-25), US, pages 766 - 776, XP055400739, ISSN: 0959-6658, DOI: 10.1093/glycob/cwx042 * |
| SHENTAL-BECHOR, D.; LEVY, Y.: "Effect of glycosylation on protein folding: a close look at thermodynamic stabilization.", PROCNATLACADSCI USA, vol. 105, 2008, pages 8256 - 8261 |
| SOLA, R.J.; GRIEBENOW, K.: "Effects of glycosylation on the stability of protein pharmaceuticals", J PHARM SCI, vol. 98, 2009, pages 1223 - 1245, XP055057795, DOI: doi:10.1002/jps.21504 |
| SOLA, R.J.; GRIEBENOW, K.: "Glycosylation of therapeutic proteins: an effective strategy to optimize efficacy.", BIODRUGS, vol. 24, 2010, pages 9 - 21 |
| STEPPER, J.; SHASTRI, S.; LOO, T.S.; PRESTON, J.C.; NOVAK, P.; MAN, P.; MOORE, C.H.; HAVLICEK, V.; PATCHETT, M.L.; NORRIS, G.E.: "Cysteine S-glycosylation, a new post-translational modification found in . glycopeptide bacteriocins.", FEBS LETT, vol. 585, 2011, pages 645 - 650 |
| TAKESHI TERAHARA; CHIAKI IMADA; TAKESHI KOBAYASHI: "Production of an antibacterial substance by Bacillus mojavensis strain F412 isolated from a Myanmar shrimp product fermented with boiled rice.", FISHERIES SCIENCE, vol. 81, 2015, pages 795 - 802 |
| TIWARI, S.K.; SUTYAK NOLL, K.; CAVERA, V.L.; CHIKINDAS, M.L.: "Improved antimicrobial activities of synthetic-hybrid bacteriocins designed from enterocin E50-52 and pediocin PA-1.", APPL ENVIRON MICROBIOL, vol. 81, 2015, pages 1661 - 1667 |
| VASUDEVAN, D.; HALTIWANGER, R.S.: "Novel roles for O-linked glycans in protein folding.", GLYCOCONJUGATE JOURNAL, vol. 31, 2014, pages 417 - 426 |
| WANG, H.; OMAN, T.J.; ZHANG, R.; GARCIA DE GONZALO, C.V; ZHANG, Q.; VAN DER DONK, W.A.: "The glycosyltransferase involved in thurandacin biosynthesis catalyzes both O- and S-glycosylation", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 136, 2014, pages 84 - 87 |
| WANG, H.; VAN DER DONK, W.A.: "Substrate selectivity of the sublancin S-glycosyltransferase", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 133, 2011, pages 16394 - 16397 |
| WANG, Q.; ZENG, X.; WANG, S.; HOU, C.; YANG, F.; MA, X.; THACKER, P.; QIAO, S.: "The bacteriocin sublancin attenuates intestinal injury in young mice infected with Staphylococcus aureus.", ANATOMICAL RECORD, vol. 297, 2014, pages 1454 - 1461 |
| ZHANG, Y.; MUTHANA, S.M.; FARNSWORTH, D.; LUDEK, O.; ADAMS, K.; BARCHI, J.J., JR.; GILDERSLEEVE, J.C.: "Enhanced epimerization of glycosylated amino acids during solid-phase peptide synthesis", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, vol. 134, 2012, pages 6316 - 6325 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3844271A4 (en) * | 2018-08-29 | 2022-06-01 | Council of Scientific and Industrial Research | Recombinant microbial system for directed evolution of glycocins and a method of preparation thereof |
| US12241058B2 (en) | 2018-08-29 | 2025-03-04 | Council Of Scientific & Industrial Research | Recombinant microbial system for directed evolution of glycocins and method of preparation thereof |
| WO2020237226A1 (en) * | 2019-05-23 | 2020-11-26 | Arzeda Corp. | Compositions and methods for producing steviol glycosides |
Also Published As
| Publication number | Publication date |
|---|---|
| CN109312379B (zh) | 2022-04-12 |
| EP3423587A1 (en) | 2019-01-09 |
| CN109312379A (zh) | 2019-02-05 |
| IN201611011974A (https=) | 2018-02-02 |
| US11485991B2 (en) | 2022-11-01 |
| EP3423587B1 (en) | 2020-06-24 |
| WO2017175239A4 (en) | 2017-12-28 |
| US20210071221A1 (en) | 2021-03-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN103201380B (zh) | 新岩藻糖基转移酶及它们的应用 | |
| JP6155196B2 (ja) | 新規フコシルトランスフェラーゼおよびそれらの用途 | |
| US11453901B2 (en) | Cell-free glycoprotein synthesis (CFGpS) in prokaryotic cell lysates enriched with components for glycosylation | |
| Li et al. | Donor substrate promiscuity of bacterial β1–3-N-acetylglucosaminyltransferases and acceptor substrate flexibility of β1–4-galactosyltransferases | |
| JP5645927B2 (ja) | N−グリカンコアβ−ガラクトシルトランスフェラーゼおよびその使用 | |
| HK1202896A1 (en) | A prokaryote-based cell-free system for the synthesis of glycoproteins | |
| Malekan et al. | One-pot multi-enzyme (OPME) chemoenzymatic synthesis of sialyl-Tn-MUC1 and sialyl-T-MUC1 glycopeptides containing natural or non-natural sialic acid | |
| WO2017010559A1 (ja) | 新規EndoS変異酵素 | |
| Lauber et al. | Expression of the functional recombinant human glycosyltransferase GalNAcT2 in Escherichia coli | |
| JP7000327B2 (ja) | 小分子グリコシル化のための方法 | |
| Kong et al. | N-Glycosyltransferase from Aggregatibacter aphrophilus synthesizes glycopeptides with relaxed nucleotide-activated sugar donor selectivity | |
| CN113614233A (zh) | 用于产生糖蛋白、鉴定糖基化途径的平台 | |
| US11898187B2 (en) | Protein glycosylation sites by rapid expression and characterization of N-glycosyltransferases | |
| Srichaisupakit et al. | Production of initial-stage eukaryotic N-glycan and its protein glycosylation in Escherichia coli | |
| US11485991B2 (en) | Multifunctional recombinant nucleotide dependent glycosyltransferase protein and its method of glycosylation thereof | |
| Choudhary et al. | SELECT-GLYCOCIN: a recombinant microbial system for expression and high-throughput screening of glycocins | |
| US20130065274A1 (en) | Recombinant Prokaryotes and Use Thereof for Production of O-Glycosylated Proteins | |
| Oh et al. | Enzymatic synthesis of vancomycin derivatives using galactosyltransferase and sialyltransferase | |
| Gao et al. | Exploration of human xylosyltransferase for chemoenzymatic synthesis of proteoglycan linkage region | |
| Zayni et al. | The dTDP-4-dehydro-6-deoxyglucose reductase encoding fcd gene is part of the surface layer glycoprotein glycosylation gene cluster of Geobacillus tepidamans GS5-97T | |
| Hwang et al. | Structural characterization of Escherichia coli sialic acid synthase | |
| JP2023534462A (ja) | 改変された特異性を有する工学操作されたn-グリコシルトランスフェラーゼ | |
| JP2016537980A (ja) | シアル酸結合に特異的なアミヒラタケ由来組み換えレクチン | |
| US20250388948A1 (en) | Cell-free enzymatic method for preparation of n-glycans | |
| Nagar et al. | In vitro synthesis of bioactive glycovariants of enterocin 96, an antimicrobial peptide from Enterococcus faecalis |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2017737380 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2017737380 Country of ref document: EP Effective date: 20181004 |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17737380 Country of ref document: EP Kind code of ref document: A1 |