WO2017015622A2 - Gdf11 binding proteins and uses thereof - Google Patents
Gdf11 binding proteins and uses thereof Download PDFInfo
- Publication number
- WO2017015622A2 WO2017015622A2 PCT/US2016/043712 US2016043712W WO2017015622A2 WO 2017015622 A2 WO2017015622 A2 WO 2017015622A2 US 2016043712 W US2016043712 W US 2016043712W WO 2017015622 A2 WO2017015622 A2 WO 2017015622A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- cdr
- amino acid
- human
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/04—Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/04—Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/32—Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present disclosure relates to GDFl 1 binding proteins, and to their uses, especially as it relates to the prevention and/or treatment of various diseases.
- GDFl 1 (Growth Differentiation Factor 11) is a member of the TGF-beta superfamily. This family of proteins is characterized generally by a polybasic proteolytic processing site which is cleaved from a prodomain-containing precursor to produce a mature protein containing seven conserved cysteine residues.
- GDFl 1 has been shown to play an important role in regulating cell growth and differentiation in both embryonic and adult tissues (McPherron et al 1999). Dussiot et al. have shown that GDFl 1 is a negative regulator of late-stage erythropoiesis. Dussiot et al., Nature Med. 20:398-409 (2014). It has also been reported that GDFl 1 administration results in anemia and erythroid hyperplasia, whereas administration of an ActrllA-Fc or a modified ActRIIB-Fc promotes erythropoiesis. Several studies have suggested that GDFl 1 may have deleterious effects on skeletal muscle and other tissues.
- Full-length GDF11 protein is expressed in an inactive state (proGDFl 1), with an N- terminal prodomain followed by a C-terminal growth factor domain ( Figure 1).
- proGDFl 1 is first converted to latent GDF11 via proteolytic cleavage by a proprotein convertase (such as PCSK5) at a dibasic site at the C terminus of the prodomain.
- a proprotein convertase such as PCSK5
- the two domains remain non-covalently associated, and the mature growth factor is unable to bind to cell surface receptors and initiate signaling events.
- Full GDF11 maturation is achieved by proteolysis of the prodomain by the tolloid family of proteases to liberate the mature GDF11 growth factor ( Figure 2).
- Binding proteins capable of binding to the prodomain of GDF11 may prevent proteolytic cleavage of GDF11 precursors (keeping GDF11 in its pro- or latent state), or lock the prodomain onto the growth factor domain, and thereby neutralize mature GDFl l functionality.
- GDF11 binding proteins e.g., prodomain complex binding proteins
- Binding proteins of the disclosure include, but are not limited to antibodies, antigen binding portions, and other antigen binding proteins capable of binding GDFl l (e.g., human pro- latent GDFl l complexes). Further, this disclosure provides methods of making and using GDFl l binding proteins (e.g., prodomain complex binding proteins) to treat disorders caused by aberrant levels and/or activities of GDFl l.
- the disclosure pertains to a binding protein capable of binding GDF11 prodomain complex.
- the binding protein binds human GDF11 prodomain complex.
- the binding protein is capable of modulating a biological function of GDF11.
- the binding protein is capable of inhibiting the release of mature GDF11 from the prodomain.
- the binding protein is capable of inhibiting proteolytic cleavage of a GDF11 prodomain complex by a proprotein convertase or tolloid protease.
- the disclosure relates to inhibitors (e.g., binding proteins and other molecules such as small molecules) of GDFl 1 activation by proteolysis.
- the binding protein is capable of binding GDF11 prodomain complex, and inhibits the binding of GDF11 to its target.
- One embodiment of the disclosure provides an isolated antibody, or antigen binding fragment thereof, wherein said antibody, or antigen binding fragment thereof binds human GDFl 1 prodomain complex and inhibits the binding of said GDFl 1 to its binding partner in a cell.
- the EC50s for the disclosed antibodies is from 10 "6 M to 10 "10 M, for example 10 "6 M, 10 "7 M, 10 "8 M, 10 "9 M, or 10 "10 M.
- the binding protein is an isolated antibody. In another embodiment, the binding protein is an isolated antibody.
- the disclosure provides an isolated antibody, or antigen binding fragment thereof, wherein the antibody, or antigen binding fragment thereof binds human GDF11 prodomain complex and modulates the levels and/or activities of GDF11.
- the antibody, or antigen binding fragment thereof inhibits the activities of GDFl 1 by 50%, 60%, 70%, 80%, 90% or 100% after being administered to a subject in a therapeutically effective amount.
- the antibody, or antigen binding fragment thereof reduces the levels of GDFl 1 by 50%, 60%, 70%, 80%, 90% or 100% after being administered to a subject in a therapeutically effective amount.
- the binding protein of the disclosure has an on rate constant (k on ) to GDFl 1 prodomain complex of at least about 10 2 M- " 1 s- " 1 , at least about 103 M - " 1 s - “ 1 , at least about 10 4 M ' V 1 , at least about 10 5 M ' V 1 , at least about 10 6 M ' V 1 , at least about 10 7 M ' V 1 , or at least about 10 8 M - " 1 s- " 1 , as measured by surface biolayer interferometry.
- k on on rate constant
- the binding protein of the disclosure has an off rate constant (k 0ff ) to GDF11 prodomain complex of at most about lO ' V 1 , at most about 10 ' V 1 , at most about
- the binding protein of the disclosure has a dissociation constant ( prodomain complex of at most about 10 - " 7 M; at most about 10 - " 8
- the binding protein comprises a binding domain capable of binding to the prodomain, for example to the ARM region or the straight jacket region, of the GDF11 prodomain complex.
- the binding protein comprises a binding domain capable of competitively inhibiting the binding proteins herein. More specifically, binding proteins capable of competitively inhibiting binding proteins are capable of binding to the ARM (e.g., Bin 1, or Bin 3) or the straightjacket (e.g., Bin 2) of the GDF11 prodomain complex ( Figure 3 A).
- the binding protein disclosed here further comprises human Fc region.
- the binding protein is a human antibody or antigen binding portion thereof capable of binding GDF11 prodomain complex.
- the binding protein disclosed here further comprises a human acceptor framework.
- the binding protein is a CDR grafted antibody or antigen binding portion thereof capable of binding GDF11 prodomain complex.
- the CDR grafted antibody or antigen binding portion thereof comprises one or more CDRs disclosed herein.
- the CDR grafted antibody or antigen binding portion thereof comprises a human acceptor framework.
- the disclosed binding protein is a humanized antibody or antigen binding portion thereof capable of binding GDF11 prodomain complex.
- the humanized antibody or antigen binding portion thereof comprise one or more CDRs disclosed above incorporated into a human antibody variable domain of a human acceptor framework.
- the human antibody variable domain is a consensus human variable domain.
- the human acceptor framework comprises at least one Framework Region amino acid substitution at a key residue, wherein the key residue is selected from the group consisting of a residue adjacent to a CDR; a glycosylation site residue; a rare residue; a residue capable of interacting with human GDF11 prodomain complex; a residue capable of interacting with a CDR; a canonical residue; a contact residue between heavy chain variable region and light chain variable region; a residue within a Vernier zone; and a residue in a region that overlaps between a Chothia-defined variable heavy chain CDR1 and a Kabat- defined first heavy chain framework.
- the key residue is selected from the group consisting of a residue adjacent to a CDR; a glycosylation site residue; a rare residue; a residue capable of interacting with human GDF11 prodomain complex; a residue capable of interacting with a CDR; a canonical residue; a contact residue between heavy chain variable region and light chain variable region; a residue within a Vernier zone; and
- the binding protein is a humanized antibody or antigen binding portion thereof capable of binding GDF11 prodomain complex.
- the humanized antibody, or antigen binding portion, thereof comprises one or more CDRs disclosed herein.
- the humanized antibody, or antigen binding portion, thereof comprises three or more CDRs disclosed herein.
- the humanized antibody, or antigen binding portion, thereof comprises six CDRs disclosed herein.
- the disclosure provides antibodies that specifically bind to a GDFl 1 prodomain complex.
- the disclosure includes an antibody that specifically binds to human proGDFl 1, murine proGDFl 1, human latent GDFl 1, and murine latent GDFl 1, but does not specifically bind to human proGDFl 1 ARM8, human proGDF8, human prodomain GDFl 1 AMR8, or mature GDFl 1.
- the human proGDFl 1 and the human latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 82.
- the murine proGDFl 1 and the murine latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 97.
- the proGDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 122.
- the human proGDF8 has an amino acid sequence as set forth in SEQ ID NO: 83.
- the human prodomain GDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 124.
- the mature GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 90.
- the antibody comprises a CDR-H3 amino acid sequence set forth in SEQ ID NO: 66, 72, 30, 36, or 42. In other embodiments, the antibody comprises a CDR-L3 amino acid sequence as set forth in SEQ ID NO: 69, 75, 33, 39, or 45. In another embodiment, the antibody comprises a CDR-H1 amino acid sequence as set forth in SEQ ID NO: 64, 70, 28, 34, or 40. In some embodiments, the antibody comprises a CDR-L1 amino acid sequence as set forth in SEQ ID NO: 67, 73, 31, 37, or 43.
- the antibody comprises a CDR-H2 amino acid sequence as set forth in SEQ ID NO: 65, 71, 29, 35, or 41. In another embodiment, the antibody comprises a CDR-L2 amino acid sequence as set forth in SEQ ID NO: 68, 74, 32, 38, or 44. In some embodiments, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 10, 12, or 14. In other embodiments, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 11, 13, or 15.
- Another aspect of the disclosure includes an antibody that specifically binds to human proGDFl 1, murine proGDFl 1, human latent GDFl 1, murine latent GDFl 1, human proGDF8, and human prodomain GDFl 1 AMR8, but does not specifically bind to human proGDFl 1 ARM 8, or mature GDFl 1.
- the human proGDFl 1 and the human latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 82.
- the murine proGDFl 1 and the murine latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 97.
- the proGDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 122. In other embodiments, the human proGDF8 has an amino acid sequence as set forth in SEQ ID NO: 83. In some embodiments, the human prodomain GDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 124. In another embodiment, the mature GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 90.
- the antibody comprises a CDR-H3 amino acid sequence set forth in SEQ ID NO: 66, 72, or 24. In other embodiments, the antibody comprises a CDR-L3 amino acid sequence as set forth in SEQ ID NO: 69, 75, or 27. In another embodiment, the antibody comprises a CDR-Hl amino acid sequence as set forth in SEQ ID NO: 64, 70, or 22. In some embodiments, the antibody comprises a CDR-L1 amino acid sequence as set forth in SEQ ID NO: 67, 73, or 25. In another embodiment, the antibody comprises a CDR-H2 amino acid sequence as set forth in SEQ ID NO: 65, 71, or 23.
- the antibody comprises a CDR-L2 amino acid sequence as set forth in SEQ ID NO: 68, 74, or 26. In some embodiments, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 8. In another embodiment, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 9.
- the instant disclosure includes an antibody that specifically binds to human proGDFl 1, murine proGDFl 1, human latent GDFl 1, murine latent GDFl 1, human proGDF8, human prodomain GDFl 1 AMR8, human proGDFl 1 ARM 8, and mature GDFl 1.
- the human proGDFl 1 and the human latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 82.
- the murine proGDFl 1 and the murine latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 97.
- the proGDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 122.
- the human proGDF8 has an amino acid sequence as set forth in SEQ ID NO: 83.
- the human prodomain GDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 124.
- the mature GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 90.
- the antibody comprises a CDR-H3 amino acid sequence set forth in SEQ ID NO: 66, 78, or 48.
- the antibody comprises a CDR-L3 amino acid sequence as set forth in SEQ ID NO: 69, 81, or 51.
- the antibody comprises a CDR-H1 amino acid sequence as set forth in SEQ ID NO: 64, 76, or 46.
- the antibody comprises a CDR-L1 amino acid sequence as set forth in SEQ ID NO: 67, 79, or 49.
- the antibody comprises a CDR-H2 amino acid sequence as set forth in SEQ ID NO: 65, 77, or 47. In another embodiment, the antibody comprises a CDR-L2 amino acid sequence as set forth in SEQ ID NO: 68, 80, or 50. In one embodiment, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 16. In other embodiments, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 17.
- the disclosure in another aspect, includes an antibody that specifically binds to human proGDFl 1, murine proGDFl 1, human latent GDFl 1, murine latent GDFl 1, human proGDF8, human prodomain GDFl 1 AMR8, and human proGDFl 1 ARM8, but does not specifically bind to mature GDFl 1.
- the human proGDFl 1 and the human latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 82.
- the murine proGDFl 1 and the murine latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 97.
- the proGDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 122.
- the human proGDF8 has an amino acid sequence as set forth in SEQ ID NO: 83.
- the human prodomain GDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 124.
- the mature GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 90.
- the antibody comprises a CDR-H3 amino acid sequence set forth in SEQ ID NO: 66, 78, or 60. In another embodiment, the antibody comprises a CDR-L3 amino acid sequence as set forth in SEQ ID NO: 69, 81, or 63. In one embodiment, the antibody comprises a CDR-H1 amino acid sequence as set forth in SEQ ID NO: 64, 76, or 58. In some embodiments, the antibody comprises a CDR-L1 amino acid sequence as set forth in SEQ ID NO: 67, 79, or 61. In another embodiment, the antibody comprises a CDR-H2 amino acid sequence as set forth in SEQ ID NO: 65, 77, or 59.
- the antibody comprises a CDR-L2 amino acid sequence as set forth in SEQ ID NO: 68, 80, or 62. In some embodiments, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 20. In other embodiments, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 21.
- the disclosure in another aspect, includes an antibody that specifically binds to human proGDFl 1, murine proGDFl 1, human latent GDFl 1, murine latent GDFl 1, and mature GDFl 1, but does not specifically bind to human proGDFl 1 ARM8, human proGDF8, or human prodomain GDF11 AMR8.
- the human proGDFl 1 and the human latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 82.
- the murine proGDFl 1 and the murine latent GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 97.
- the proGDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 122.
- the human proGDF8 has an amino acid sequence as set forth in SEQ ID NO: 83.
- the human prodomain GDFl 1 ARM8 has an amino acid sequence as set forth in SEQ ID NO: 124.
- the mature GDFl 1 has an amino acid sequence as set forth in SEQ ID NO: 90.
- the antibody comprises a CDR-H3 amino acid sequence set forth in SEQ ID NO: 66, or 54. In other embodiments, the antibody comprises a CDR-L3 amino acid sequence as set forth in SEQ ID NO: 69, or 57. In a further embodiment, the antibody comprises a CDR-Hl amino acid sequence as set forth in SEQ ID NO: 64, or 52. In some embodiments, the antibody comprises a CDR-L1 amino acid sequence as set forth in SEQ ID NO: 67, or 55. In other embodiments, the antibody comprises a CDR-H2 amino acid sequence as set forth in SEQ ID NO: 65, or 53.
- the antibody comprises a CDR-L2 amino acid sequence as set forth in SEQ ID NO: 68, or 56. In other embodiments, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 18. In another embodiment, the antibody comprises a variable heavy chain amino acid sequence as set forth in SEQ ID NO: 19.
- the disclosure in another aspect, provides an antibody comprising an antigen binding domain, said antigen binding domain comprising six CDRs: CDR-Hl, CDR-H2, CDR-H3, CDR- Ll, CDR-L2, and CDR-L3, wherein at least one of the CDR sequences is selected from the group consisting of; SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, and SEQ ID NO: 69. [0036] In some embodiments, at least one of the CDR sequences is selected from the group consisting of:
- CDRH1 sequence is X ! Y X 3 X 4 X 5 (SEQ ID NO: 64);
- X 3 is A, Y, G, or S
- X 4 is M, I, or W
- X 5 is H, S, Y, G, or N:
- CDRH2 sequence is X ⁇ X ⁇ Xs Xe X ⁇ g Xg Xio Y X12 X13 X14 X15 X16 X17 (SEQ ID NO:
- Xi is G, W, V, Y, or absent
- X 3 is S, N, R, or I
- X 4 is W, P, Y, A, or S
- X 5 is N, D, Y, H, or S
- X 6 is S, G, or N
- X 7 is G, or S
- X 8 is S, G, N, D, or T
- X9 is I, T, or E
- X 10 is G, N, or Y
- X 12 is A, or N
- X 13 is D, Q, or P
- X 15 is V, F, or L
- X 16 is K or Q
- X 17 is G, D, or S;
- CDRH3 sequence is Xi X 2 X X 4 X 5 Xe X? Xs X9 X10 X11 X12 X13 Xi4 X15 Xi6 X17 Xis (SEQ ID NO:
- X 2 is G, or absent
- X 3 is S, D, or absent
- X 4 is I, G, or absent
- X 5 is A, D, T, N, I, or absent
- X 6 is V, F, P, Y, or absent
- X 7 is A, W, P, D, Y, or absent
- X 8 is G, S, L, I, V, D, or absent
- X 9 is T, G, W, L, S, or absent
- Xio is L, Y, F, T, S, or absent
- X u is E, V, P, G, or S
- X 12 is V, D, Q, E, Y, or W
- X 13 is T, Y, Q, or E
- X i4 is G, Y, N, A, or D
- X 15 is D, G, W, A, P, Y, or L
- X 16 is L, M, or F
- X 17 is D, or G
- Xi8 is Y, V, P or l:
- CDRLl sequence is Xi X 2 S Q X 5 X 6 X ? X 8 X9 Y L X 12 (SEQ ID NO
- X 5 is F, D, S, R, or H
- X 6 is L, I, or V
- X 7 is S, I, or absent
- X9 is T, N, or absent
- X 12 is A, or N:
- CDRL2 sequence is Xj A S X 4 X 5 X 6 X 7 (SEQ ID NO: 68);
- Xi is S, D, G, K, or A
- X 4 is N, S, or T
- X 5 is R, or L
- X 6 is A, E, or Q:
- X 7 is T, or S
- CDRL3 sequence is Xi X 2 X 3 X 4 X 5 X 6 P Xs X9 (SEQ ID NO: 69);
- X 3 is A, Y, or S
- X 4 is T, S, G, Y, or Q
- X5 is H, T, S, or absent
- X 6 is W, A, T, Y, or absent
- X 8 is Y, L, I, P, or absent
- X9 is T, or absent.
- At least one of the CDR sequences is selected from the group consisting of:
- CDRH1 sequence is Xi Y X 3 X 4 X 5 (SEQ ID NO: 70)
- X 3 is A, Y, or G
- CDRH2 sequence is Xi I X 3 X 4 X 5 X 6 X 7 X 8 X 9 Xio Y A X 13 X 14 X 15 X 16 G (SEQ ID NO: 71) Wherein XI is G, W, or V
- X3 is S, or N
- X4 is W, P, Y, or A
- X5 is N, D, or Y
- X6 is S, G, or N
- X7 is G, or S
- X8 is S, G, or N
- X9 is I, T, or E
- X10 is G, N, or Y
- X15 is V, F, or L
- X16 is K or Q
- CDRH3 sequence is Xi X 2 X 3 X 4 X 5 Xe X? Xs X9 Xio X11 X12 X13 Xi4 X15 Xie D X i8 (SEQ ID NO: 72)
- X 5 is A, D, T, or absent
- X 7 is A, W, P, or absent
- X 8 is G, S, L, or absent
- X 9 is T, G, W, or absent
- X n is E, V, P, or G
- X 12 is V, D, Q, or E
- X 14 is G, Y, or N
- X 15 is D, G, W, or A
- X 16 is L, M, or F
- X is is Y, V, P or l
- CDRLl sequence is Xi A S Q X 5 X 6 X? S X 9 Y L Xn (SEQ ID NO: 73)
- X 5 is F, D, or S
- X 6 is L, I, or V
- X 12 is A, or N
- CDRL2 sequence is Xj A S N 4 X 5 X 6 T (SEQ ID NO: 74)
- X5 is R, or L
- CDRL3 sequence is Xi X 2 X 3 X 4 X 5 Xe P Xs T (SEQ ID NO: 75)
- X 3 is A, Y, or S Wherein X 4 is T, S, G, or Y
- X5 is H, T, or S
- X 6 is W, A, or T
- X 8 is Y, L, or I.
- At least one of the CDR sequences is selected from the group consisting of:
- CDRH1 sequence is Xi Y X 3 X 4 X 5 (SEQ ID NO: 76)
- X 1 is G, or S
- CDRH2 sequence isXi I X 3 X 4 X 5 S X 7 X 8 X 9 Xio Y A X 13 X 14 X 15 X 16 X 17 (SEQ ID NO: 77)
- X3 is R, or S
- X4 is P, or S
- X7 is G, or S
- X15 is F, or V
- X17 is D, or G
- CDRH3 sequence is Xi X 2 X 3 Y X 5 X 6 X 7 X 8 G Y Xu X i2 X13 Xi4 X15 Y (SEQ ID NO: 78)
- X 1 is D, or absent
- X 2 is G, or absent
- X 13 is P, or L
- X 15 is G, or D
- CDRLl sequence is R A S Q X 5 X 6 X 7 S X 9 Y L X (SEQ ID NO: 79)
- X 5 is R, or S
- X 12 is A, or N
- CDRL2 sequence is Xi A S S X 5 X 6 X 7 (SEQ ID NO: 80)
- X 5 is R, or L
- CDRL3 sequence is Q X 2 X 3 X 4 Xs Xe P Xs Xg (SEQ ID NO: 81)
- the antibody provided herein comprises the CDRH3 sequence of XiX 2 X 3 X4X5X6X 7 X 8 X9XioXnXi2Xi3Xi4Xi5Xi6Xi7Xi8 (SEQ ID NO: 66);
- X 2 is G, or absent
- X 3 is S, D, or absent
- X 4 is I, G, or absent
- X 5 is A, D, T, N, I, or absent
- X 6 is V, F, P, Y, or absent
- X 7 is A, W, P, D, Y, or absent
- X 8 is G, S, L, I, V, D, or absent
- X 9 is T, G, W, L, S, or absent
- Xio is L, Y, F, T, S, or absent
- Xn is E, V, P, G, or S
- X 12 is V, D, Q, E, Y, or W
- X 13 is T, Y, Q, or E
- X 14 is G, Y, N, A, or D
- X 15 is D, G, W, A, P, Y, or L
- X 1 ⁇ 2 is L, M, or F
- X i8 is Y, V, P or I;
- X 2 is G, or absent
- X 5 is A, D, T, or absent
- X 7 is A, W, P, or absent
- X 8 is G, S, L, or absent
- X9 is T, G, W, or absent
- Xn is E, V, P, or G
- X 12 is V, D, Q, or E
- X 14 is G, Y, or N
- X 15 is D, G, W, or A
- X 16 is L, M, or F
- X 18 is Y, V, P or I;
- X 2 is G, or absent
- X 13 is P, or L
- X ⁇ is G, or D.
- the antibody provided herein comprises the CDRL3 sequence of 3 X4 X 5 X 6 P Xs X9 (SEQ ID NO: 69);
- X 2 is Q, K, or H
- X 3 is A, Y, or S
- X 4 is T, S, G, Y, or Q
- X5 is H, T, S, or absent
- X 6 is W, A, T, Y, or absent
- X 8 is Y, L, I, P, or absent
- X9 is T, or absent
- X 3 is A, Y, or S
- X 4 is T, S, G, or Y
- X 5 is H, T, or S Wherein X 6 is W, A, or T
- X 8 is Y, L, or I;
- Xg is T, or absent.
- the present disclosure includes an antibody comprising an antigen binding domain, said antigen binding domain comprising six CDRs: CDR-Hl, CDR-H2, CDR- H3, CDR-L1, CDR-L2, and CDR-L3, wherein:
- CDR-Hl is selected from the group consisting of:
- CDR-H2 is selected from the group consisting of:
- CDR-H3 is selected from the group consisting of:
- CDR-Ll is selected from the group consisting of:
- CDR-L2 is selected from the group consisting of:
- CDR-L3 is selected from the group consisting of: SEQ ID NO:27;
- three of the six CDRs are selected from the group of variable domain CDR sets consisting of:
- VL GDF11 Inh-4 CDR Set CDR ⁇ LI: SEQ ID NO:43
- CDR -L3 SEQ ID NO:63.
- the antibody comprises at least two variable domain CDR sets. In other embodiments, the antibody comprises at least two variable domain CDR sets are selected from a group consisting of: VH GDF11 Inh-1 CDR Set and VL GDF11 Inh-1 CDR Set,
- VH GDF11 Inh-2 CDR Set and VL GDF11 Inh-2 CDR Set VH GDF11 Inh-2 CDR Set
- VH GDF11 Inh-3 CDR Set and VL GDF11 Inh-3 CDR Set VH GDF11 Inh-3 CDR Set
- VH GDF11 Inh-6 CDR Set and VL GDF11 Inh-6 CDR Set VH GDF11 Inh-6 CDR Set
- the antibody further comprising a human acceptor framework.
- the isolated antibody, or antigen binding fragment thereof comprises at least one variable domain having amino acid sequence selected from the group consisting of SEQ ID NOs: 8-21.
- the antibody comprises at least one heavy chain variable domain and at least one light chain variable domain, said heavy chain variable domain having amino acid sequence selected from the group consisting of SEQ ID NOs: 8, 10, 12, 14, 16, 18 and 20, and said light chain variable domain having amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 11, 13, 15, 17, 19 and 21.
- the antibody comprises two variable domains, wherein said two variable domains have amino acid sequences selected from the group consisting of:
- the antibody provided herein further comprises a heavy chain immunoglobulin constant domain selected from the group consisting of: a human IgM constant domain; a human IgGl constant domain; a human IgG2 constant domain; a human IgG3 constant domain; a human IgG4 constant domain; a human IgE constant domain and a human IgA constant domain.
- said heavy chain immunoglobulin constant domain is a human IgGl constant domain.
- the antibody further comprises a light chain immunoglobulin constant domain, wherein said light chain immunoglobulin constant domain is a human Ig kappa constant domain.
- the antibody further comprises a light chain immunoglobulin constant domain, wherein said light chain
- immunoglobulin constant domain is a human Ig lambda constant domain.
- the antibody is selected from the group consisting of: an immunoglobulin molecule, an scFv, a monoclonal antibody, a human antibody, a chimeric antibody, a humanized antibody, a single domain antibody, a Fab fragment, a Fab' fragment, an F(ab') 2 , an Fv, a disulfide linked Fv, a single domain antibody, a diabody, a multispecific antibody, a bispecific antibody, and a dual specific antibody.
- the antibody is a human antibody.
- the antibody is capable of modulating a biological function or levels of GDF11. In some embodiments, the antibody is capable of neutralizing GDF11. In another embodiment, said GDF11 is human GDF11. In one embodiment, said antibody is capable of enhancing erythropoiesis. In another embodiment, said antibody has a dissociation constant (KD) selected from the group consisting of: at most about 10 - " 7 M; at most about 10 - " 8 M; at most about 10 "9 M; at most about 10 "10 M; at most about 10 "11 M; at most about 10- 12 M; and at most 10 - " 13 M to a human GDF11 pro-domain complex.
- KD dissociation constant
- said antibody has an on rate selected from the group consisting of: at least about 10 2 M- " 1 s- " 1 ; at least about 103 M - " V 1 ; at least about lO'VfV 1 ; at least about lO ⁇ 1 ; and at least about lO ⁇ ' 1 to a human GDF11 pro -domain complex.
- said antibody has an off rate selected from the group consisting of: at most about 10 ' V 1 ; at most about 10 ' V 1 ; at most about 10 ' V 1 ; and at most about 10 ' V 1 to a human GDF11 pro-domain complex.
- the antibody is isolated.
- the antibody specifically binds human GDF11 pro-domain complex.
- the disclosure in another aspect, includes an antibody construct comprising the antibody provided herein and further comprising a linker polypeptide or an immunoglobulin constant domain.
- the antibody construct is selected from the group consisting of: an immunoglobulin molecule, a monoclonal antibody, a chimeric antibody, a CDR-grafted antibody, a humanized antibody, a Fab, a Fab', a F(ab') 2 , a Fv, a disulfide linked Fv, a scFv, a single domain antibody, a diabody, a multispecific antibody, a dual specific antibody, and a bispecific antibody.
- an immunoglobulin molecule a monoclonal antibody, a chimeric antibody, a CDR-grafted antibody, a humanized antibody, a Fab, a Fab', a F(ab') 2 , a Fv, a disulfide linked Fv, a scFv, a single domain antibody, a diabody, a multispecific antibody, a dual specific antibody, and a bispecific antibody.
- said antibody construct comprises a heavy chain
- immunoglobulin constant domain selected from the group consisting of: a human IgM constant domain, a human IgGl constant domain, a human IgG2 constant domain, a human IgG3 constant domain, a human IgG4 constant domain, a human IgE constant domain, a human IgA constant domain, and an IgG constant domain variant with one or more mutations altering binding strength to Fc neonatal receptor, Fc gamma receptors, or Clq.
- the disclosure in some aspects, includes an antibody conjugate comprising the antibody construct provided herein, wherein said antibody construct is conjugated to a therapeutic or cytotoxic agent.
- said therapeutic or cytotoxic agent is selected from the group consisting of: an anti-metabolite, an alkylating agent, an antibiotic, a growth factor, a cytokine, an anti-angiogenic agent, an anti-mitotic agent, an anthracycline, toxin, and an apoptotic agent.
- the disclosure in some aspects, includes a pharmaceutical composition comprising the binding proteins (antibody, antibody construct, or antibody construct) provided herein, and a pharmaceutically acceptable carrier.
- binding of the antibody, or the antibody construct, to a proGDFl 1 inhibits proteolytic cleavage of the proGDFl 1 by a proprotein convertase.
- the disclosure in another aspect, provides a method for reducing human GDFl 1 activity, comprising contacting human GDF11 prodomain complex with the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein, such that human GDF11 activity is reduced.
- Another aspect of the disclosure provides a method for reducing human GDFl 1 activity in a human subject suffering from a disorder in which GDFl 1 activity is detrimental, comprising administering to the human subject the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein, such that human GDFl 1 activity in the human subject is reduced.
- said disorder is selected from the group consisting of: anemia, and erythroid hyperplasia.
- An additional aspect of the disclosure provides a method of modulating growth factor activity in a biological system comprising contacting said biological system with the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein.
- said growth factor activity comprises GDF11 activity.
- the antibody is a stabilizing antibody and wherein contacting said biological system with said stabilizing antibody results in inhibition of release of at least 5% of total GDF11 mature growth factor in said biological system.
- binding of the antibody or antigen binding portion thereof, the antibody construct, or the antibody conjugate to a proGDFl 1 inhibits proteolytic cleavage of the proGDFl 1 by a proprotein convertase.
- the antibody inhibits proteolytic cleavage of the proGDFl 1 by a proprotein convertase.
- the present disclosure provides a method of treating a TGF-P-related indication in a subject comprising contacting said subject with the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein.
- said TGF-P-related indication comprises a cardiovascular indication selected from the group consisting of cardiac hypertrophy, cardiac atrophy, atherosclerosis and restenosis.
- said TGF-P-related indication comprises a GDF11-related indication.
- said GDF11-related indication comprises erythroid hyperplasia anemia and/or ⁇ -thalassemia.
- Another aspect of the disclosure includes a nucleic acid encoding the binding proteins (antibody, antibody construct, or the antibody conjugate) provided herein.
- a further aspect of the disclosure includes vector comprising the nucleic acid provided herein.
- An additional aspect of the disclosure includes a cell comprising the nucleic acid provided herein.
- Another aspect of the disclosure provides a kit comprising the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein and instructions for use thereof.
- One aspect of the disclosure includes an antibody that competes for binding to an epitope with the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein.
- Another aspect of the disclosure provides an antibody that binds to the same epitope as the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein.
- a further aspect of the disclosure includes an antibody that competes for binding to an epitope of human proGDFl 1 or an epitope of human latent GDF11 with the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein.
- the antibody specifically binds to an epitope of human proGDFl 1 or human latent GDF11 at the same epitope as the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein.
- the antibody competes for binding to the epitope with an equilibrium dissociation constant (Kd) between the antibody and the epitope of less than 10 ⁇ 6 M.
- Kd equilibrium dissociation constant
- the Kd is in a range of 10 "u M to 10 "6 M.
- Another aspect of the disclosure includes a composition comprising the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein and a carrier.
- the composition is a pharmaceutical composition comprising a therapeutically effective amount of the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein, and a pharmaceutically acceptable carrier.
- a pharmaceutical composition comprising a therapeutically effective amount of the binding proteins (antibody, antibody construct, or antibody conjugate) provided herein, and a pharmaceutically acceptable carrier.
- Another embodiment of the disclosure includes the composition provided herein for use in preventing erythroid hyperplasia anemia and/or ⁇ -thalassemia, comprising a therapeutically effective amount of the binding proteins (antibody, isolated antibody, or antigen binding fragment, antibody construct, or antibody conjugate) provided herein.
- the carrier is a pharmaceutically acceptable carrier.
- the antibody and carrier are in a lyophilized form. In one embodiment, the antibody and carrier are in solution. In some embodiments, wherein the antibody and carrier are frozen. In another embodiment, the antibody and carrier are frozen at a temperature less than or equal to -65°C.
- the antibody is a sweeping antibody. In other embodiments, the antibody is a recycling antibody. In another embodiment, the antibody comprises an Fc portion. In other embodiments, the antibody binds the neonatal Fc receptor FcRn. In another embodiment, the Fc portion binds the neonatal Fc receptor FcRn.
- the antibody binds FcRn at a pH greater than 6.0. In other embodiments, the antibody binds FcRn at a pH in a range from 7.0 to 7.5. [0074] In one embodiment, the Kd of binding of the antibody to the FcRN is in a range from 10 - " 3 M to 10 - " 8 M. In another embodiment, the Kd of binding of the antibody to the FcRN is
- FcRN is in a range fromlO - " 5 M to 10 - " 8 M.
- the Kd of binding of the antibody to the FcRN is in a range fromlO "6 M to 10 s M.
- the disclosure in another aspect, includes an antibody that specifically binds to a GDF11 prodomain complex and inhibits the release of mature GDF11 from the GDF11 prodomain complex.
- An additional aspect of the disclosure provides an antibody that specifically binds to a GDF11 prodomain complex and inhibits proteolytic cleavage of a proGDFl 1 or a latent GDF11 by a proprotein convertase or a tolloid protease.
- the antibody inhibits proteolytic cleavage of a tolloid protease cleavage site on the proGDFl 1 or latent GDF11.
- the tolloid protease is selected from the group consisting of BMP- 1, mammalian tolloid protein (mTLD), mammalian tolloid-like 1 (mTLLl), and mammalian tolloid-like 2 (mTLL2).
- the antibody binds within 10 amino acid residues of a tolloid protease cleavage site of proGDFl 1 or latent GDF11.
- the tolloid protease cleavage site comprises the amino acid sequence GD of proGDFl 1 or latent GDF11.
- the proGDFl 1 or latent GDF11 comprises the amino acid sequence as set forth in SEQ ID NO: 82, 86, 97, or 98.
- the antibody binds to the amino acid sequence
- KAPPLQQILDLHDFQGDALQPEDFLEEDEYHA (SEQ ID NO: 149).
- the antibody inhibits proteolytic cleavage of a proprotein convertase cleavage site on the proGDFl 1 or latent GDF11.
- the proprotein convertase is selected from the group consisting of furin and PCSK5.
- the antibody binds within 10 amino acid residues of a proprotein converrase cleavage site of proGDFl 1 or latent GDF11.
- the proprotein convertase cleavage site comprises the amino acid sequence RSRR (SEQ ID NO: 151), RELR (SEQ ID NO: 161), RSSR (SEQ ID NO: 152) of proGDFl l or latent GDF11.
- the proGDFl 1 or latent GDF11 comprises the amino acid sequence as set forth in SEQ ID NO: 82, 86, 97, or 98.
- the antibody binds to the amino acid sequence GLHPFMELRVLENTKRS RRNLGLDCDEHS S ES RC (SEQ ID NO: 153), PEPDGCPVC VWRQHSRELRLES IKS QILS KLRLK (SEQ ID NO: 154), or
- AAAAAAAAAAGVGGERSSRPAPSVAPEPDGCPVC (SEQ ID NO: 155).
- the antibody inhibits proteolytic cleavage of the proGDFl 1. In other embodiments, the antibody inhibits proteolytic cleavage of the latent GDF11. In another embodiment, the antibody inhibits the release of mature GDF11 from the GDF11 prodomain complex in a biological system by at least 5%, at least 10%, at least 20%, at least 40%, or at least
- the antibody inhibits proteolytic cleavage of a proGDFl 1 or a latent
- GDF11 by a proprotein convertase or a tolloid protease in a biological system by at least 5%, at least 10%, at least 20%, at least 40%, or at least 60%.
- the biological system is a cell or a subject.
- the antibody is a stabilizing antibody.
- any of the binding proteins, antibody constructs or antibody conjugates disclosed herein exists as a crystal.
- the crystal is a carrier- free pharmaceutical controlled release crystal.
- the crystallized binding protein, crystallized antibody construct or crystallized antibody conjugate has a greater half-life in vivo than its soluble counterpart.
- the crystallized binding protein, crystallized antibody construct or crystallized antibody conjugate retains biological activity after crystallization.
- a host cell is transformed with any of the vectors provided herein.
- the host cell is a prokaryotic cell.
- the host cell is E. coli.
- the host cell is a eukaryotic cell.
- the eukaryotic cell is selected from the group consisting of protist cell, animal cell, plant cell and fungal cell.
- the host cell is a mammalian cell including, but not limited to, HEK293, CHO and COS; or a fungal cell such as Saccharomyces cerevisiae; or an insect cell such as Sf9.
- a method of producing a binding protein that binds GDF11 prodomain complex may comprise culturing a host cell, ⁇ e.g., any of the host cells provided herein) in a culture medium under conditions sufficient to produce a binding protein that binds GDF11 prodomain complex.
- Another embodiment provides a binding protein produced according to the method disclosed above.
- a composition is disclosed for the release of a binding protein, wherein the composition comprises a formulation which in turn comprises a crystallized binding protein, crystallized antibody construct or crystallized antibody conjugate as disclosed above and an ingredient; and at least one polymeric carrier.
- the polymeric carrier is a polymer selected from one or more of the group consisting of: poly (acrylic acid), poly
- the ingredient is selected from the group consisting of albumin, sucrose, trehalose, lactitol, gelatin, hydroxypropyl-.beta.-cyclodextrin, methoxypolyethylene glycol and
- a method for treating a mammal comprising the step of administering to the mammal an effective amount of the composition disclosed herein.
- the disclosure also provides a pharmaceutical composition
- a pharmaceutical composition comprising a binding protein, antibody construct or antibody conjugate as disclosed herein and a pharmaceutically acceptable carrier.
- the pharmaceutical composition comprises at least one additional therapeutic agent for treating a disorder in which GDF11 activity is detrimental.
- the additional agent is selected from the group consisting of: therapeutic agent, imaging agent, cytotoxic agent, angiogenesis inhibitors (including but not limited to anti- VEGF antibodies or VEGF-trap); kinase inhibitors (including but not limited to KDR and TIE-2 inhibitors); co-stimulation molecule blockers (including but not limited to anti-B7.1, anti-B7.2, CTLA4-Ig, anti-CD20); adhesion molecule blockers (including but not limited to anti-LFA-1 Abs, anti-E/L selectin Abs, small molecule inhibitors); anti-cytokine antibody or functional fragment thereof (including but not limited to anti-IL-18, anti-TNF, anti-IL-6/cytokine receptor antibodies); methotrexate; cyclosporin; rapamycin; FK506; detectable label or reporter; a TNF antagonist; an antirheumatic; a muscle relaxant, a narcotic, a non-steroid anti-inflammatory drug (NSAID), an analgesic
- the instant disclosure provides a method for inhibiting human GDF11 activity comprising contacting human GDF11 prodomain complex with a binding protein disclosed herein such that human GDF11 activity is inhibited.
- the disclosure provides a method for inhibiting human GDF11 activity in a human subject suffering from a disorder in which GDF11 activity is detrimental, comprising administering to the human subject a binding protein disclosed herein such that human GDF11 activity in the human subject is inhibited and treatment is achieved.
- the disclosure provides a method of treating (e.g., curing, suppressing, ameliorating, delaying or preventing the onset of, or preventing recurrence or relapse of) or preventing a GDF11 -associated disorder, in a subject.
- the method includes:
- GDF11 prodomain complex binding agent e.g., an anti-GDFl l prodomain complex antibody or fragment thereof as described herein, in an amount sufficient to treat or prevent the GDF11-associated disorder.
- the GDF11 prodomain complex binding protein e.g., the anti-GDFl 1 prodomain complex antibody or fragment thereof, may be administered to the subject, alone or in combination with other therapeutic modalities as described herein.
- the subject is a mammal, e.g., a human suffering from one or more GDF11-associated disorders, including, e.g., respiratory disorders (e.g., asthma (e.g., allergic and nonallergic asthma), chronic obstructive pulmonary disease (COPD), and other conditions involving airway inflammation, eosinophilia, fibrosis and excess mucus production; atopic disorders (e.g., atopic dermatitis and allergic rhinitis); inflammatory and/or autoimmune conditions of, the skin, gastrointestinal organs (e.g., inflammatory bowel diseases (IBD), such as ulcerative colitis and/or Crohn's disease), and liver (e.g., cirrhosis, fibrosis); scleroderma; tumors or cancers, e.g., Hodgkin's lymphoma as described herein.
- respiratory disorders e.g., asthma (e.g., allergic and nonallergic asthma), chronic o
- the disclosure includes the use of a GDF11 prodomain complex binding agent (such as an anti-GDFl 1 prodomain complex antibody or fragment thereof described herein) for a treatment described herein and the use of a GDF11 binding prodomain complex agent (such as an anti-GDFl 1 prodomain complex antibody or fragment thereof described herein) for preparing a medicament for a treatment described herein.
- GDFl l-associated disorders include, but are not limited to, anemia, erythroid hyperplasia, beta thalassemia, as described herein.
- this disclosure provides a method of treating (e.g., reducing, ameliorating) or preventing one or more symptoms associated with anemia, or erythroid hyperplasia.
- the method comprises administering to the subject a GDF11 prodomain complex binding protein, e.g., a GDFl 1 prodomain complex antibody or a fragment thereof, in an amount sufficient to treat (e.g., reduce, ameliorate) or prevent one or more symptoms.
- the GDFl 1 prodomain complex antibody can be administered therapeutically or prophylactically, or both.
- the GDF11 prodomain complex binding protein e.g., the anti-GDFl 1 prodomain complex antibody, or fragment thereof, can be administered to the subject, alone or in combination with other therapeutic modalities as described herein.
- the subject is a mammal, e.g., a human suffering from a GDFl 1 -associated disorder as described herein.
- this application provides a method for detecting the presence of GDF11 prodomain complex in a sample in vitro (e.g., a biological sample, such as serum, plasma, tissue, and biopsy).
- the subject method can be used to diagnose a disorder.
- the method includes: (i) contacting the sample or a control sample with the anti-GDFl 1 prodomain complex antibody or fragment thereof as described herein; and (ii) detecting formation of a complex between the anti-GDFl 1 prodomain complex antibody or fragment thereof, and the sample or the control sample, wherein a statistically significant change in the formation of the complex in the sample relative to the control sample is indicative of the presence of the GDFl 1 prodomain complex in the sample.
- this application provides a method for detecting the presence of GDFl 1 prodomain complex in vivo (e.g., in viva imaging in a subject).
- the subject method can be used to diagnose a disorder, e.g., a GDFl l-associated disorder.
- the method includes: (i) administering the anti-GDFl 1 prodomain complex antibody or fragment thereof as described herein to a subject or a control subject under conditions that allow binding of the antibody or fragment to GDFl 1 prodomain complex; and (ii) detecting formation of a complex between the antibody or fragment and GDF11 prodomain complex, wherein a statistically significant change in the formation of the complex in the subject relative to the control subject is indicative of the presence of GDF11 prodomain complex.
- the disclosure provides at least one GDFl 1 prodomain complex anti-idiotype antibody to at least one GDFl 1 prodomain complex binding protein disclosed herein.
- the anti-idiotype antibody includes any protein or peptide containing molecule that comprises at least a portion of an immunoglobulin molecule such as, but not limited to, at least one complementarily determining region (CDR) of a heavy or light chain or a ligand binding portion thereof, a heavy chain or light chain variable region, a heavy chain or light chain constant region, a framework region, or; any portion thereof, that can be incorporated into a binding protein of the present disclosure.
- CDR complementarily determining region
- FIGs. 1A-1B show GDF11 domain structure and proGDFl l assembly.
- FIG. 1A is a schematic of GDFl l's domain structure. GDF11 is secreted as a proprotein, with an inhibitory prodomain followed by a C-terminal growth factor domain, which exists as a disulfide-linked dimer.
- FIG. IB shows the precursor protein, which is assembled in an inactive conformation where the prodomain (purple) encloses the growth factor (cyan) with a "straightjacket" assembly comprised of an alpha helix connected to a loop termed the latency lasso. This figure is an adaption from the structure of latent TGFbl (Shi et. al., 2011).
- FIG. 2 is a schematic illustrating that the activation of GDFl 1 requires two distinct proteolysis events.
- the biosynthetic precursor protein, proGDFl 1 is processed by two separate proteases.
- the first step shown in this schematic is performed by a member of the proprotein convertase family, such as Furin or PCSK5. This cleavage separates the prodomain from the mature growth factor and produces the latent form of GDFl 1.
- the second cleavage event by the tolloid family of proteases, cleaves within the prodomain. Both cleavage events are required for release of GDFl 1 and subsequent engagement of the GDFl 1 growth factor with the Type I and Type II signaling receptors.
- FIGs. 3A-3B show GDF11 activation blocking antibodies comprise three separate epitope groups which bind to the prodomain of proGDFl 1.
- FIG. 3A shows the results from cross-blocking experiments performed on a ForteBio Octet BLI, which identified three epitope groups. Pairwise binding events are indicated by shading in the boxes, where the first antibody added in the experiment is indicated on the Y axis, and the second antibody on the X axis. The extent of binding that was detected in these cross -blocking experiments is indicated as “no binding”, "some binding” and “unimpeded binding”.
- FIG. 3B shows the combination of cross- blocking results and epitope mapping studies utilizing chimeric GDFl l/Myostatin proteins. Antibodies within Bins 1 and 3 bind to the "ARM" region of the prodomain, which comprises the regions shaded in purple in the figure. Antibodies within Bin 2 bind to the "straightjacket" portion of the prodomain shaded in green.
- FIGs. 4A-4B show blockers of GDF11 activation. Following an overnight proteolysis reaction with enzymes from both the proprotein-convertase and tolloid protease families, the release of mature growth factor was measured in the presence of different concentrations of antibodies that inhibit GDFl 1 activation using a CAGA-based reporter assay in 293T cells (FIG. 4A). Calculated EC50 values are indicated in parentheses.
- FIG. 4B shows that the GDFl 1 inhibitory Ab, GDFl 1 Inh-5, does not block activation of human proGDF8. In this assay, the human proGDF8 concentration was 400 nM.
- FIG. 5 is a graph showing CAGA promoter-dependent luciferase activity is the presence of GDF-11 or proGDF-11 after treatment with proprotein convertase, Tolloid proteinase or a combination of proprotein convertase and Tolloid proteinase.
- FIG. 6 presents results of a luciferase-based growth factor activity assay.
- FIG. 7 is a stained gel showing separation of proteinase treated proGDF-11 under reducing and non-reducing conditions.
- This disclosure pertains to human GDFl 1 prodomain complex binding proteins, and more particularly to anti-GDFl l prodomain complex antibodies, or antigen-binding portions thereof, that bind GDFl 1 prodomain complex.
- Various aspects of the disclosure relate to antibodies and antibody fragments, and pharmaceutical compositions thereof, as well as nucleic acids, recombinant expression vectors and host cells for making such antibodies and fragments. Methods of using the antibodies of the disclosure to detect human GDFl 1 prodomain complex, to modulate human GDFl 1 activities and/or levels, either in vitro or in vivo are also disclosed.
- Polypeptide refers to any polymeric chain of amino acids.
- peptide and protein are used interchangeably with the term polypeptide and also refer to a polymeric chain of amino acids.
- polypeptide encompasses native or artificial proteins, protein fragments and polypeptide analogs of a protein sequence.
- a polypeptide may be monomeric or polymeric.
- isolated protein or "isolated polypeptide” is a protein or polypeptide (e.g., an antibody) that by virtue of its origin or source of derivation is not associated with naturally associated components that accompany it in its native state; is substantially free of other proteins from the same species; is expressed by a cell from a different species; or does not occur in nature.
- a polypeptide that is chemically synthesized or synthesized in a cellular system different from the cell from which it naturally originates will be “isolated” from its naturally associated components.
- a protein may also be rendered substantially free of naturally associated components by isolation, using protein purification techniques well known in the art.
- isolated is synonymous with “separated”, but carries with it the inference separation was carried out by the hand of man.
- an isolated substance or entity is one that has been separated from at least some of the components with which it was previously associated (whether in nature or in an experimental setting). Isolated substances may have varying levels of purity in reference to the substances from which they have been associated. Isolated substances and/or entities may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated.
- isolated agents are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
- a substance is "pure" if it is substantially free of other components.
- substantially isolated is meant that the compound is substantially separated from the environment in which it was formed or detected.
- Partial separation can include, for example, a composition enriched in the compound of the present disclosure.
- Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compound of the present disclosure, or salt thereof. Methods for isolating compounds and their salts are routine in the art.
- isolation of a substance or entity includes disruption of chemical associations and/or bonds.
- isolation includes only the separation from components with which the isolated substance or entity was previously combined and does not include such disruption.
- human GDF11 prodomain complex refers to the proGDFl 1 and the latent complex of GDF11 (prodomain complexed with the growth factor domain).
- the amino acid sequence of pro and latent GDF11 comprises SEQ ID NO: 82.
- "Biological activity” or “activity” of a protein, as used herein, refers to all inherent biological properties of the protein.
- antibody broadly refers to any immunoglobulin (Ig) molecule comprised of four polypeptide chains, two heavy (H) chains and two light (L) chains, or any functional fragment, mutant, variant, or derivation thereof, including antigen-binding portions, which retains the essential epitope binding features of an Ig molecule.
- Ig immunoglobulin
- Such mutant, variant, or derivative antibody formats are known in the art. Nonlimiting embodiments of which are discussed below.
- compounds and/or compositions of the present disclosure may comprise antibodies or fragments thereof.
- the term "antibody” refers to in the broadest sense and specifically covers various embodiments including, but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies formed from at least two intact antibodies), and antibody fragments such as diabodies so long as they exhibit a desired biological activity.
- Antibodies are primarily amino-acid based molecules but may also comprise one or more modifications (including, but not limited to the addition of sugar moieties, fluorescent moieties, chemical tags, etc.).
- each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FRl, CDRl, FR2, CDR2, FR3, CDR3, FR4.
- Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG 1, IgG2, IgG 3, IgG4, IgAl and IgA2) or subclass.
- antibody portion refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., hGDFl 1). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Such antibody embodiments may also be bispecific, dual specific, or multi- specific formats; specifically binding to two or more different antigens. Multispecific, dual specific, and bispecific antibody constructs are well known in the art and described and characterized in Kontermann (ed.), Bispecific Antibodies, Springer, NY (2011), and Spiess et al., Mol. Immunol. 67(2):96-106 (2015).
- binding fragments encompassed within the term "antigen -binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546, Winter et al., PCT publication WO 90/05144 Al herein incorporated by reference), which comprises a single variable domain; and (vi) an isolated complementarity determining region (CDR).
- CDR complementarity determining region
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term "antigen -binding portion" of an antibody.
- Other forms of single chain antibodies, such as diabodies are also encompassed.
- Diabodies are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2: 1121-1123).
- Such antibody binding portions are known in the art (Kontermann and Dubel eds., Antibody Engineering (2001) Springer- Verlag. New York. 790 pp. (ISBN 3-540-41354-5).
- antibody construct refers to a polypeptide comprising one or more antigen binding portions of the disclosure linked to a linker polypeptide or an
- Linker polypeptides comprise two or more amino acid residues joined by peptide bonds and are used to link one or more antigen binding portions. Such linker polypeptides are well known in the art (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2: 1121-1123).
- immunoglobulin constant domain refers to a heavy or light chain constant domain.
- Human IgG heavy chain and light chain constant domain amino acid sequences and their functional variations are known in the art.
- an antibody or antigen-binding portion thereof may be part of a larger immunoadhesion molecules, formed by covalent or noncovalent association of the antibody or antibody portion with one or more other proteins or peptides.
- immunoadhesion molecules include use of the streptavidin core region to make a tetrameric scFv molecule (Kipriyanov, S. M., et al. (1995) Human Antibodies and Hybridomas 6:93-101) and use of a cysteine residue, a marker peptide and a C-terminal polyhistidine tag to make bivalent and biotinylated scFv molecules (Kipriyanov, S. M., et al.
- Antibody portions such as Fab and F(ab') 2 fragments, can be prepared from whole antibodies using conventional techniques, such as papain or pepsin digestion, respectively, of whole antibodies.
- antibodies, antibody portions and immunoadhesion molecules can be obtained using standard recombinant DNA techniques, as described herein.
- an "isolated antibody”, as used herein, is intended to refer to an antibody that is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds hGDFl l prodomain complex is substantially free of antibodies that specifically bind antigens other than hGDFl 1 prodomain complex).
- An isolated antibody that specifically binds hGDFl l prodomain complex may, however, have cross -reactivity to other antigens, such as GDF11 prodomain complex molecules from other species.
- an isolated antibody may be substantially free of other cellular material and/or chemicals.
- the term "human antibody”, as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences.
- human antibodies of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3.
- human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- recombinant human antibody is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described in more details in this disclosure), antibodies isolated from a recombinant, combinatorial human antibody library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem. 35:425-445; Gavilondo J. V., and Larrick J. W. (2002) BioTechniques 29: 128-145; Hoogenboom H., and Chames P.
- such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- One embodiment of the disclosure provides fully human antibodies capable of binding human GDF11 prodomain complex which can be generated using techniques well known in the art, such as, but not limited to, using human Ig phage libraries such as those disclosed in Jermutus et al., PCT publication No. WO
- chimeric antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species and constant region sequences from another species, such as antibodies having murine heavy and light chain variable regions linked to human constant regions.
- CDR-grafted antibody refers to antibodies which comprise heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and/or VL are replaced with CDR sequences of another species, such as antibodies having murine heavy and light chain variable regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.
- humanized antibody refers to antibodies which comprise heavy and light chain variable region sequences from a non-human species (e.g., a mouse) but in which at least a portion of the VH and/or VL sequence has been altered to be more "human-like", i.e., more similar to human germline variable sequences.
- a non-human species e.g., a mouse
- humanized antibody is a CDR- grafted antibody, in which human CDR sequences are introduced into non-human VH and VL sequences to replace the corresponding nonhuman CDR sequences.
- humanized anti human GDF11 prodomain complex antibodies and antigen binding portions are provided.
- Such antibodies were generated by obtaining murine anti-hGDFl l prodomain complex monoclonal antibodies using traditional hybridoma technology followed by humanization using in vitro genetic engineering, such as those disclosed in Kasaian et al PCT publication No. WO 2005/123126 A2.
- Kabat numbering Kabat definitions and “Kabat labeling” are used interchangeably herein. These terms, which are recognized in the art, refer to a system of numbering amino acid residues which are more variable (i.e. hypervariable) than other amino acid residues in the heavy and light chain variable regions of an antibody, or an antigen binding portion thereof (Kabat et al. (1971) Ann. NY Acad, Sci. 190:382-391 and, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- the hypervariable region ranges from amino acid positions 31 to 35 for CDR1, amino acid positions 50 to 65 for CDR2, and amino acid positions 95 to 102 for CDR3.
- the hypervariable region ranges from amino acid positions 24 to 34 for CDR1, amino acid positions 50 to 56 for CDR2, and amino acid positions 89 to 97 for CDR3.
- the terms "acceptor” and "acceptor antibody” refer to the antibody or nucleic acid sequence providing or encoding at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or 100% of the amino acid sequences of one or more of the framework regions.
- the term “acceptor” refers to the antibody amino acid or nucleic acid sequence providing or encoding the constant region(s). In yet another embodiment, the term “acceptor” refers to the antibody amino acid or nucleic acid sequence providing or encoding one or more of the framework regions and the constant region(s). In a specific embodiment, the term “acceptor” refers to a human antibody amino acid or nucleic acid sequence that provides or encodes at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or 100% of the amino acid sequences of one or more of the framework regions.
- an acceptor may contain at least 1, at least 2, at least 3, least 4, at least 5, or at least 10 amino acid residues that does (do) not occur at one or more specific positions of a human antibody.
- An acceptor framework region and/or acceptor constant region(s) may be, e.g., derived or obtained from a germline antibody gene, a mature antibody gene, a functional antibody (e.g., antibodies well-known in the art, antibodies in development, or antibodies commercially available).
- CDR refers to the complementarity determining region within antibody variable sequences. There are three CDRs in each of the variable regions of the heavy chain and the light chain, which are designated CDR1, CDR2 and CDR3, for each of the variable regions.
- CDR set refers to a group of three CDRs that occur in a single variable region capable of binding the antigen. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md.
- CDRs may be referred to as Kabat CDRs. Chothia and coworkers (Chothia &Lesk, J. Mol. Biol. 196:901-917 (1987) and Chothia et al., Nature
- CDR boundary definitions may not strictly follow one of the above systems, but will nonetheless overlap with the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding.
- the methods used herein may utilize CDRs defined according to any of these systems, although preferred embodiments use Kabat or Chothia defined CDRs.
- canonical residue refers to a residue in a CDR or framework that defines a particular canonical CDR structure as defined by Chothia et al. (J. Mol. Biol. 196:901-907 (1987); Chothia et al., J. Mol. Biol. 227:799 (1992), both are incorporated herein by reference). According to Chothia et al., critical portions of the CDRs of many antibodies have nearly identical peptide backbone confirmations despite great diversity at the level of amino acid sequence. Each canonical structure specifies primarily a set of peptide backbone torsion angles for a contiguous segment of amino acid residues forming a loop.
- the terms “donor” and “donor antibody” refer to an antibody providing one or more CDRs.
- the donor antibody is an antibody from a species different from the antibody from which the framework regions are obtained or derived.
- the term “donor antibody” refers to a non-human antibody providing one or more CDRs.
- framework or “framework sequence” refers to the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems, the meaning of a framework sequence is subject to correspondingly different interpretations.
- the six CDRs also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3 and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4.
- a framework region represents the combined FR's within the variable region of a single, naturally occurring immunoglobulin chain.
- a FR represents one of the four sub-regions
- FRs represents two or more of the four sub-regions constituting a framework region.
- the term "germline antibody gene” or “gene fragment” refers to an immunoglobulin sequence encoded by non-lymphoid cells that have not undergone the maturation process that leads to genetic rearrangement and mutation for expression of a particular immunoglobulin. (See, e.g., Shapiro et al., Crit. Rev. Immunol. 22(3): 183-200 (2002); Marchalonis et al., Adv Exp Med. Biol. 484: 13-30 (2001)).
- One of the advantages provided by various embodiments of the present disclosure stems from the recognition that germline antibody genes are more likely than mature antibody genes to conserve essential amino acid sequence structures characteristic of individuals in the species, hence less likely to be recognized as from a foreign source when used therapeutically in that species.
- key residues refer to certain residues within the variable region that have more impact on the binding specificity and/or affinity of an antibody, in particular a humanized antibody.
- a key residue includes, but is not limited to, one or more of the following: a residue that is adjacent to a CDR, a potential glycosylation site (can be either N- or O-glycosylation site), a rare residue, a residue capable of interacting with the antigen, a residue capable of interacting with a CDR, a canonical residue, a contact residue between heavy chain variable region and light chain variable region, a residue within the Vernier zone, and a residue in the region that overlaps between the Chothia definition of a variable heavy chain CDR1 and the Kabat definition of the first heavy chain framework.
- the term "humanized antibody” is an antibody or a variant, derivative, analog or fragment thereof which immuno specific ally binds to an antigen of interest and which comprises a framework (FR) region having substantially the amino acid sequence of a human antibody and a complementary determining region (CDR) having substantially the amino acid sequence of a non-human antibody.
- FR framework
- CDR complementary determining region
- the term “substantially” in the context of a CDR refers to a CDR having an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to the amino acid sequence of a non-human antibody CDR.
- a humanized antibody comprises substantially all of at least one, and typically two, variable domains (Fab, Fab', F(ab') 2 , FabC, Fv) in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin (i.e., donor antibody) and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence.
- a humanized antibody also comprises at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- a humanized antibody contains both the light chain as well as at least the variable domain of a heavy chain.
- the antibody also may include the CHI, hinge, CH2, CH3, and CH4 regions of the heavy chain.
- a humanized antibody only contains a humanized light chain. In some embodiments, a humanized antibody only contains a humanized heavy chain. In another embodiment, a humanized antibody only contains a humanized variable domain of a light chain and/or humanized heavy chain.
- the humanized antibody can be selected from any class of immunoglobulins, including IgM, IgG, IgD, IgA and IgE, and any isotype, including without limitation IgG 1, IgG2, IgG3 and IgG4.
- the humanized antibody may comprise sequences from more than one class or isotype, and particular constant domains may be selected to optimize desired effector functions using techniques well-known in the art.
- the framework and CDR regions of a humanized antibody need not correspond precisely to the parental sequences, e.g., the donor antibody CDR or the consensus framework may be mutagenized by substitution, insertion and/or deletion of at least one amino acid residue so that the CDR or framework residue at that site does not correspond to either the donor antibody or the consensus framework. In another embodiment, such mutations, however, will not be extensive. Usually, at least 80%, 85%, 90%, and or 95% of the humanized antibody residues will correspond to those of the parental FR and CDR sequences.
- the term "consensus framework" refers to the framework region in the consensus immunoglobulin sequence.
- the term "consensus immunoglobulin sequence” refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related immunoglobulin sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987). In a family of immunoglobulins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. In another embodiment, if two amino acids occur equally frequently, either can be included in the consensus sequence. [00138] As used herein, “Vernier” zone refers to a subset of framework residues that may adjust CDR structure and fine-tune the fit to antigen as described by Foote and Winter (1992, J. Mol. Biol. 224:487-499, which is incorporated herein by reference). Vernier zone residues form a layer underlying the CDRs and may impact on the structure of CDRs and the affinity of the antibody.
- multivalent binding protein is used in this specification to denote a binding protein comprising two or more antigen binding sites.
- a multivalent binding protein may be engineered to have three or more antigen binding sites, and is generally not a naturally occurring antibody.
- multispecific binding protein refers to a binding protein capable of binding two or more related or unrelated targets.
- antibody constructs are well known in the art, and as described and characterized in Kontermann (ed.), Bispecific Antibodies, Springer, NY (2011), and Spiess et al., Mol. Immunol. 67(2):96-106 (2015).
- bispecific antibody constructs include but are not limited to those commonly known as, Minibodies, Nanobodies, Diabodies, Bites, Duobodies, Tandemabs, Knobs-into-holes Igs, DAFs, CT-Igs, DutamAbs, DVD-Igs, CoDVD-Igs, CoDV-Igs, FIT-Igs, CrossmAbs, CrossfAbs, SEEDbodies, TriomAbs, LUZ-Ys, Zybodies.
- Multispecific binding proteins as used herein are binding proteins that comprise two or more antigen binding sites and are tetravalent or multivalent binding proteins.
- Such DVDs may be monospecific, i.e. capable of binding one antigen or multispecific, i.e. capable of binding two or more antigens.
- multispecific antibody refers to an antibody wherein two or more variable regions bind to different epitopes.
- the epitopes may be on the same or different targets.
- a multi- specific antibody is a bispecific antibody, which recognizes two different epitopes on the same or different antigens.
- bispecific antibodies are capable of binding two different antigens.
- Such antibodies typically comprise antigen-binding regions from at least two different antibodies.
- a bispecific monoclonal antibody (BsMAb, BsAb) is an artificial protein composed of fragments of two different monoclonal antibodies, thus allowing the BsAb to bind to two different types of antigen.
- the binding protein may be a multispecific antibody, a dual specific antibody, and a bispecific antibody.
- antibody constructs are well known in the art, and as described and characterized in Kontermann (ed.), Bispecific Antibodies, Springer, NY (2011), and Spiess et al., Mol. Immunol. 67(2):96-106 (2015).
- bispecific antibody constructs comprise one of more binding domain capable of binding GDFl l prodomain complex and a second target.
- the second target is selected from the group consisting of GDF1, GDF3, GDF5, GDF6, GDF7, GDF8, GDF9, GDF10, BMP10, BMP9 (GDF2), nodal, BMP2, BMP4, BMP5, BMP6, BMP8A, BMP8B, BMP15, BMP3, TGFbeta 1, TGF beta 2, TGF beta 3, Inhibin beta A, Inhibin beta B, Inhibin beta C, Inhibin beta E, Lefty 1, Lefty 2, GDF15, Antimullerian hormone, Inhibin alpha.
- the second target is selected from the group consisting of CSF1, (MCSF), CSF2 (GM-CSF), CSF3 (GCSF), FGF2, IFN.alpha.l, IFN.beta. l, IFN.gamma., histamine and histamine receptors, IL-l .alpha., IL-l.beta., IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12.alpha., IL-12.beta., IL-14, IL-15, IL- 16, IL-17, IL-18, IL-19, KITLG, PDGFB, IL- 2R.alpha., IL-4R, IL-5R.alpha., IL-8R.alpha., IL-8R.beta., IL-12R.beta..
- the multispecifc binding protein is capable of recognizing GDFl l and IL-l.beta., GDFl l and IL-9; GDFl l and L-4; GDFl l and IL-5; GDFl l and IL-25; GDFl l and TARC; GDFl l and MDC; GDFl l and MIF; GDFl l and TGF- .beta.; GDFl l and LHR agonist; GDFl l and CL25; GDFl l and
- multispecifc binding protein is capable of binding GDFl l and TNF-alpha.
- neutralizing refers to neutralization of the biological activity of a target protein when a binding protein specifically binds the target protein.
- a neutralizing binding protein is a neutralizing antibody whose binding to hGDFl 1 prodomain complex results in inhibition of a biological activity of hGDFl 1.
- the neutralizing binding protein binds hGDFl 1 prodomain complex and reduces a biologically activity of GDF11 by at least about 20%, 40%, 60%, 80%, 85% or more. Inhibition of a biological activity of hGDFl 1 prodomain complex by a neutralizing binding protein can be assessed by measuring one or more indicators of the biological activity of hGDFl 1 well known in the art.
- the term "activity" includes activities such as the binding specificity/affinity of an antibody for an antigen.
- epitope includes any polypeptide determinant capable of specific binding to an immunoglobulin or T-cell receptor.
- epitope determinants include chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl, and, in certain embodiments, may have specific three dimensional structural characteristics, and/or specific charge characteristics.
- An epitope is a region of an antigen that is bound by an antibody.
- an antibody is said to specifically bind an antigen when it preferentially recognizes its target antigen in a complex mixture of proteins and/or macromolecules.
- surface biolayer interferometry refers to an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the Forte Bio Octet system.
- k on is intended to refer to the on rate constant for association of an antibody to the antigen to form the antibody/antigen complex as is known in the art.
- k 0ff is intended to refer to the off rate constant for dissociation of an antibody from the antibody/antigen complex as is known in the art.
- K D is intended to refer to the dissociation constant of a particular antibody- antigen interaction as is known in the art.
- label binding protein refers to a protein with a label incorporated that provides for the identification of the binding protein.
- the label is a detectable marker, e.g., incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (e.g., streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods).
- labels for polypeptides include, but are not limited to, the following: radioisotopes or radionuclides (e.g., 3 H, 14 C, 35 S, 90 Y, 99 Tc, m In, 125 I, 131 I, 177 Lu, 166 Ho, and 153 Sm); fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, luciferase, alkaline phosphatase); chemiluminescent markers; biotinyl groups; predetermined polypeptide epitopes recognized by a secondary reporter (e.g., leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags); and magnetic agents, such as gadolinium chelates.
- radioisotopes or radionuclides e.g., 3 H, 14 C, 35 S, 90 Y, 99 Tc,
- antibody conjugate refers to a binding protein, such as an antibody, chemically linked to a second chemical moiety, such as a therapeutic or cytotoxic agent.
- agent is used herein to denote a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials.
- the therapeutic or cytotoxic agents include, but are not limited to, pertussis toxin, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- crystal refers to an antibody, or antigen binding portion thereof, that exists in the form of a crystal.
- Crystals are one form of the solid state of matter, which is distinct from other forms such as the amorphous solid state or the liquid crystalline state. Crystals are composed of regular, repeating, three-dimensional arrays of atoms, ions, molecules (e.g., proteins such as antibodies), or molecular assemblies (e.g.,
- antigen/antibody complexes These three-dimensional arrays are arranged according to specific mathematical relationships that are well-understood in the field.
- the fundamental unit, or building block, that is repeated in a crystal is called the asymmetric unit. Repetition of the asymmetric unit in an arrangement that conforms to a given, well-defined crystallographic symmetry provides the "unit cell" of the crystal. Repetition of the unit cell by regular translations in all three dimensions provides the crystal. See Giege, R. and Ducruix, A. Barrett,
- polynucleotide as referred to herein means a polymeric form of two or more nucleotides, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide.
- the term includes single and double stranded forms of DNA
- isolated polynucleotide shall mean a polynucleotide (e.g., of genomic, cDNA, or synthetic origin, or some combination thereof) that, by virtue of its origin, is not associated with all or a portion of a polynucleotide with which the "isolated polynucleotide” is found in nature; is operably linked to a polynucleotide that it is not linked to in nature; or does not occur in nature as part of a larger sequence.
- a polynucleotide e.g., of genomic, cDNA, or synthetic origin, or some combination thereof
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- the disclosure is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- operably linked refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner.
- a control sequence "operably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
- "Operably linked” sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest.
- expression control sequence refers to polynucleotide sequences which are necessary to effect the expression and processing of coding sequences to which they are ligated.
- Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion.
- the nature of such control sequences differs depending upon the host organism; in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence; in eukaryotes, generally, such control sequences include promoters and transcription termination sequence.
- control sequences is intended to include components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
- Protein constructs of the present disclosure may be expressed, and purified using expression vectors and host cells known in the art, including expression cassettes, vectors, recombinant host cells and methods for the recombinant expression and proteolytic processing of recombinant polyproteins and pre-proteins from a single open reading frame (e.g., WO 2007/014162 incorporated herein by reference).
- Transformation refers to any process by which exogenous DNA enters a host cell. Transformation may occur under natural or artificial conditions using various methods well known in the art. Transformation may rely on any known method for the insertion of foreign nucleic acid sequences into a prokaryotic or eukaryotic host cell. The method is selected based on the host cell being transformed and may include, but is not limited to, viral infection, electroporation, lipofection, and particle bombardment. Such "transformed” cells include stably transformed cells in which the inserted DNA is capable of replication either as an autonomously replicating plasmid or as part of the host chromosome. They also include cells which transiently express the inserted DNA or RNA for limited periods of time.
- host cell (or simply “host cell”), as used herein, is intended to refer to a cell into which exogenous DNA has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell, but, to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term "host cell” as used herein.
- host cells include prokaryotic and eukaryotic cells selected from any of the Kingdoms of life.
- eukaryotic cells include protist, fungal, plant and animal cells.
- host cells include but are not limited to the prokaryotic cell line E. Coli;
- Standard techniques may be used for recombinant DNA, oligonucleotide synthesis, and tissue culture and transformation (e.g., electroporation, lipofection). Enzymatic reactions and purification techniques may be performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein. The foregoing techniques and procedures may be generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification. See e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989)), which is incorporated herein by reference for any purpose.
- Transgenic organism refers to an organism having cells that contain a transgene, wherein the transgene introduced into the organism (or an ancestor of the organism) expresses a polypeptide not naturally expressed in the organism.
- a “transgene” is a DNA construct, which is stably and operably integrated into the genome of a cell from which a transgenic organism develops, directing the expression of an encoded gene product in one or more cell types or tissues of the transgenic organism.
- the term “regulate” and “modulate” are used interchangeably, and, as used herein, refers to a change or an alteration in the activity of a molecule of interest (e.g., the biological activity of hGDFl 1). Modulation may be an increase or a decrease in the magnitude of a certain activity or function of the molecule of interest. Exemplary activities and functions of a molecule include, but are not limited to, binding characteristics, enzymatic activity, cell receptor activation, and signal transduction.
- the term "modulator,” as used herein, is a compound capable of changing or altering an activity or function of a molecule of interest (e.g., the biological activity of hGDFl 1).
- a modulator may cause an increase or decrease in the magnitude of a certain activity or function of a molecule compared to the magnitude of the activity or function observed in the absence of the modulator.
- a modulator is an inhibitor, which decreases the magnitude of at least one activity or function of a molecule.
- Exemplary inhibitors include, but are not limited to, proteins, peptides, antibodies, peptibodies,
- agonist refers to a modulator that, when contacted with a molecule of interest, causes an increase in the magnitude of a certain activity or function of the molecule compared to the magnitude of the activity or function observed in the absence of the agonist.
- Agonists of GDF11 may include, but are not limited to, proteins (e.g., Ab), nucleic acids, carbohydrates, or any other molecules, which bind to GDF11, or proGDFl 1.
- antagonists refer to a modulator that, when contacted with a molecule of interest causes a decrease in the magnitude of a certain activity or function of the molecule compared to the magnitude of the activity or function observed in the absence of the antagonist.
- antagonists of interest include those that block or modulate the biological or immunological activity of GDF11.
- Antagonists and inhibitors of hGDFl 1 prodomain complex may include, but are not limited to, proteins (e.g., Ab), nucleic acids, carbohydrates, or any other molecules, which bind to latent GDF11, or proGDFl 1.
- the term "effective amount” refers to the amount of a therapy which is sufficient to reduce or ameliorate the severity and/or duration of a disorder or one or more symptoms thereof, prevent the advancement of a disorder, cause regression of a disorder, prevent the recurrence, development, onset or progression of one or more symptoms associated with a disorder, detect a disorder, or enhance or improve the prophylactic or therapeutic effect(s) of another therapy (e.g., prophylactic or therapeutic agent).
- sample includes, but is not limited to, any quantity of a substance from a living thing or formerly living thing.
- living things include, but are not limited to, humans, mice, rats, monkeys, dogs, rabbits and other animals.
- substances include, but are not limited to, blood, serum, urine, synovial fluid, cells, organs, tissues, bone marrow, lymph nodes and spleen.
- TGFP family member proteins There are 33 different members of the TGF-beta family in humans. Members include, without limitation, the bone morphogenetic proteins (BMPs), inhibin, activin, growth and differentiation factors (GDFs), myostatin, nodal, anti-Mullerian hormone, and lefty proteins.
- BMPs bone morphogenetic proteins
- GDFs growth and differentiation factors
- myostatin nodal, anti-Mullerian hormone
- lefty proteins lefty proteins.
- mature growth factors are synthesized along with their prodomains as single polypeptide chains.
- such polypeptide chains may comprise cleavage sites for separation of prodomains from mature growth factors.
- such cleavage sites are furin cleavage sites recognized and cleaved by proprotein convertases.
- prodomain homology In general, homology among TGF- ⁇ family member growth factor domains is relatively high. Interestingly, prodomain homology is much lower. This lack of homology may be an important factor in altered growth factor regulation among family members. In some cases, prodomains may guide proper folding and/or dimerization of growth factor domains. Prodomains have very recently been recognized, in some cases, to have important functions in directing growth factors (after secretion) to specific locations in the extracellular matrix (ECM) and/or cellular matrix, until other signals are received that cause growth factor release from latency. Release from latency may occur in highly localized environments whereby growth factors may act over short distances (e.g.
- growth factor-prodomain complexes are secreted as homodimers.
- prodomain-growth factor complexes may be secreted as heterodimers.
- TGF-P-related protein refers to a TGF- ⁇ isoform, a TGF- ⁇ family member or a TGF- ⁇ family member-related protein.
- TGF- ⁇ family members may include, but are not limited to, any of those listed in Tables 1-6. These include, but are not limited to TGF- ⁇ proteins, BMPs, myostatin, GDFs and inhibins.
- aspects of the present invention provide tools and/or methods for characterizing and/or modulating cellular activities related to growth factor signaling.
- tools of the present invention may comprise antigens comprising one or more components of one or more TGF ⁇ -related proteins.
- Some tools may comprise antibodies directed toward antigens of the present invention.
- tools of the present invention may comprise assays for the detection and/or characterization of TGF-P-related proteins, the detection and/or characterization of antibodies directed toward TGF-P-related proteins and/or the detection and/or characterization of cellular activities and/or their cellular signaling related to TGF-P-related proteins.
- GDF growth differentiation factor
- TGF- ⁇ family member proteins involved in a number of cellular and developmental activities.
- GDF-modulatory antibodies are capable of distinguishing between various growth factor complexes allowing for growth factor activity modulation that occurs only at sites of specific complex formations.
- the present invention provides GDF-11 modulatory antibodies.
- Such antibodies may bind GDF-11 GPCs, GDF-11 prodomains, growth factors, or complexes comprising GDF-11 growth factor and activate or inhibit GDF-11 growth factor activity.
- these antibodies are specific for GDF-11, having reduced or no affect on GDF-8 growth factor activity.
- prodomains Some prodomains may remain associated with growth factors after cleavage. Such associations may form latent growth factor-prodomain complexes (GPCs) that modulate the availability of growth factors for cell signaling. Growth factors may be released from latency in GPCs through associations with one or more extracellular proteins. In some cases, growth factor release may rely on force applied to GPCs through extracellular protein interactions. Such forces may pull from C-terminal and/or N-terminal regions of GPCs resulting in the release of associated growth factors.
- GPCs latent growth factor-prodomain complexes
- the prodomain portion of the GPC is responsible for growth factor retention and blocking the interaction of retained growth factors with their receptors.
- Such GPCs where the bound growth factor is unable to promote signaling activity, are also referred to herein as "latent complexes.”
- Prodomain portions of GPCs that function to block growth factor signaling activity are referred to as latency associated peptides (LAPs).
- LAPs latency associated peptides
- TGF- ⁇ , 2 and 3 are know to comprise LAPs.
- GDF prodomains also function to block growth factor activity.
- Some prodomains may comprise LAP-like domains.
- LAP-like domain refers to prodomain portions of GPCs and/or free prodomains that may be structurally similar or synthesized in a similar manner to LAPs, but that may not function to prevent growth factor/receptor interactions.
- growth factor dimers may associate with prodomain modules to form a GPC.
- GPCs comprise protein modules necessary for different aspects of growth factor signaling, secretion, latency and/or release from latent GPCs.
- protein module refers to any component, region and/or feature of a protein. Protein modules may vary in length, comprising one or more amino acids.
- Protein modules may be from about 2 amino acid residues in length to about 50 amino acid residues in length, from about 5 amino acid residues in length to about 75 amino acid residues in length, from about 10 amino acid residues in length to about 100 amino acid residues in length, from about 25 amino acid residues in length to about 150 amino acid residues in length, from about 125 amino acid residues in length to about 250 amino acid residues in length, from about 175 amino acid residues in length to about 400 amino acid residues in length, from about 200 amino acid residues in length to about 500 amino acid residues in length and/or at least 500 amino acid residues in length.
- protein modules comprise one or more regions with known functional features (e.g. protein binding domain, nucleic acid binding domain, hydrophobic pocket, etc). Protein modules may comprise functional protein domains necessary for different aspects of growth factor signaling, secretion, latency and/or release from latent conformations.
- prodomains may associate with growth factors in GPCs. Some prodomains may sterically prevent growth factor association with one or more cellular receptors. Prodomains may comprise arm regions and/or straight jacket regions. Some prodomains may comprise C-terminal regions referred to herein as "bowtie regions.” In some prodomain dimers, bowtie regions of each monomer may associate and/or interact. Such associations may comprise disulfide bond formation, as is found between monomers of TGF- ⁇ isoform LAPs.
- arm regions may comprise trigger loop regions.
- Trigger loops may comprise regions that associate with integrins. Such regions may comprise amino acid sequences comprising RGD (Arg-Gly-Asp). Regions comprising RGD sequences are referred to herein as RGD sequence regions.
- prodomains comprise latency loops (also referred to herein as latency lassos). Some latency loops may maintain associations between prodomains and growth factors present within GPCs.
- Prodomains may also comprise fastener regions. Such fastener regions may promote associations between prodomains and growth factors present within GPCs by maintaining prodomain conformations that promote growth factor retention.
- GPCs may require enzymatic cleavage to promote dissociation of bound growth factors and growth factor activity. Such enzymatic cleavage events are referred to herein as "activating cleavage" events. Activating cleavage of GPCs may be carried out in some instances by members of the BMP-l/Tolloid-like proteinase (B/TP) family (Muir et al., 2011. J Biol Chem. 286(49) :41905-11, the contents of which are herein incorporated by reference in their entirety).
- B/TP BMP-l/Tolloid-like proteinase
- metaloproteinases may include, but are not limited to BMP-1, mammalian tolloid protein (mTLD), mammalian tolloid-like 1 (mTLLl) and mammalian tolloid-like 2 (mTLL2).
- mTLD mammalian tolloid protein
- mTLLl mammalian tolloid-like 1
- mTLL2 mammalian tolloid-like 2
- Exemplary GPCs that may be subjected to activating cleavage by such
- metalloproteinases may include, but are not limited to GDF-8 and GDF-11.
- GDF- 8 may be cleaved by mTLL2.
- activating cleavages may occur intracellularly. In some cases, activating cleavages may occur extracellularly.
- Growth factor release from GPCs may require cleavage by a proprotein convertase enzyme followed by an activating cleavage [e.g. by one or more members of the BMP-1 /Tolloid- like proteinase (B/TP) family.]
- GDF-8 and GDF-11 GPCs may be transformed by furin cleavage into a latent complex that further requires cleavage by BMP/Tolloid proteases for growth factor release.
- the present invention provides polypeptide inhibitors (e.g., antibodies) that inhibit one or more members of the B/TP family.
- Such inhibitors may block cleavage of BMP-1 /Tolloid cleavage sites, including, but not limited to BMP/Tolloid cleavage sites on one or more latent complexes (e.g., GDF-8 latent complexes and/or GDF-11 latent complexes).
- activating cleavage may not lead to dissociation of bound growth factor, but instead may promote an active conformation of the GPC.
- active conformation refers to a GPC protein confirmation that allows the growth factor to engage in receptor interaction.
- proBMP-7 and proBMP-9 See FIG. 1 .
- Primed complexes Active conformations of GDF-11 GPCs are referred to herein as "primed" complexes, and can be produced by the sequential cleavage of GPCs at the furin cleavage site and the BMP/Tolloid cleavage site.
- primed complexes may bind receptors resulting in receptor signaling.
- prodomains may be dissociated from growth factors upon receptor binding and/or signaling activity.
- prodomains may remain associated with growth factors upon receptor binding and/or signaling activity.
- prodomains may become partially dissociated from growth factors during receptor binding and/or signaling activity.
- primed complexes may bind preferentially to one or more receptors over one or more other receptors.
- receptor activity resulting from primed complex interactions may be quenched or competed for by excess prodomain or fragments thereof.
- the present invention provides polypeptide inhibitors (e.g., inhibiting antibodies) that block the formation of primed complexes from latent complexes.
- polypeptide inhibitors e.g., inhibiting antibodies
- such inhibitors bind BMP/Tolloid cleavage sites on latent GPCs (e.g., latent GDF- 11).
- such inhibitors prevent cleavage of the BMP/Tolloid cleavage site.
- Straight jacket regions may comprise alpha 1 helical regions.
- alpha 1 helical regions may be positioned between growth factor monomers.
- Some alpha 1 helical regions comprise N-terminal regions of prodomains.
- Alpha 1 helical regions may also comprise N-terminal regions for extracellular associations.
- Such extracellular associations may comprise extracellular matrix proteins and/or proteins associated with the extracellular matrix.
- Some extracellular associations may comprise associations with proteins that may include, but are not limited to LTBPs (e.g. LTBPl, LTBP2, LTBP3 and/or LTBP4), fibrillins (e.g. fibrillin- 1, fibrillin-2, fibrillin-3 and/or fibrillin-4), perlecan, decorin and/or GASPs.
- LTBPs e.g. LTBPl, LTBP2, LTBP3 and/or LTBP4
- fibrillins e.g. fibrillin- 1, fibrillin-2, fibrillin-3 and/or fibrillin-4
- extracellular associations may comprise disulfide bonds between cysteine residues.
- extracellular matrix proteins and/or proteins associated with the extraceullar matrix may comprise bonds or interactions with one or more regions of prodomains other than N-terminal regions.
- growth factor domains comprise one or more growth factor monomers. Some growth factor domains comprise growth factor dimers. Such growth factor domains may comprise growth factor homodimers or heterodimers (comprising growth factor monomers from different TGF-P-related proteins). Some growth factor domains may comprise fingers regions. Such fingers regions may comprise ⁇ -pleated sheets. Fingers regions may associate with prodomains. Some fingers regions may maintain association between growth factor domains and prodomains.
- recombinant proteins of the present invention may comprise protein modules from growth differentiation factor (GDF) proteins.
- GDF protein modules may comprise the protein modules and/or amino acid sequences listed in Table 2 or 4.
- protein modules of the present invention may comprise amino acid sequences similar to those in Table 2 or 4, but comprise additional or fewer amino acids than those listed.
- Some such amino acid sequences may comprise about 1 more or fewer amino acids, about 2 more or fewer amino acids, about 3 more or fewer amino acids, about 4 more or fewer amino acids, about 5 more or fewer amino acids, about 6 more or fewer amino acids, about 7 more or fewer amino acids, about 8 more or fewer amino acids, about 9 more or fewer amino acids, about 10 more or fewer amino acids or greater than 10 more or fewer amino acids on N-terminal and/or C-terminal ends.
- recombinant proteins of the present invention may comprise protein modules from activin subunits.
- Such protein modules may comprise the protein modules and/or amino acid sequences of the activin subunit inhibin beta A, listed in Table 4.
- protein modules of the present invention may comprise amino acid sequences similar to those in Table 4, but comprise additional or fewer amino acids than those listed.
- Some such amino acid sequences may comprise about 1 more or fewer amino acids, about 2 more or fewer amino acids, about 3 more or fewer amino acids, about 4 more or fewer amino acids, about 5 more or fewer amino acids, about 6 more or fewer amino acids, about 7 more or fewer amino acids, about 8 more or fewer amino acids, about 9 more or fewer amino acids, about 10 more or fewer amino acids or greater than 10 more or fewer amino acids on N-terminal and/or C-terminal ends.
- One aspect of the present disclosure provides antibodies, or portions thereof, that are isolated antibodies.
- One aspect of the present disclosure provides isolated monoclonal antibodies, or antigen-binding portions thereof, that bind to GDF11 prodomain complex with high affinity, a slow off rate and high neutralizing capacity.
- Another aspect of the disclosure provides antibodies that specifically bind hGDFl 1 prodomain complex.
- Another aspect of the disclosure provides fully human antibodies that bind GDF11 prodomain complex.
- Another aspect of the disclosure provides murine antibodies that bind GDF11 prodomain complex.
- Another aspect of the disclosure provides chimeric antibodies that bind GDF11 prodomain complex.
- Another aspect of the disclosure provides humanized antibodies, or antigen-binding portions thereof, that bind GDF11 prodomain complex.
- antibodies, or portions thereof specifically bind hGDFl 1 prodomain complex.
- the antibodies of the disclosure are neutralizing human anti-GDFl l antibodies. More specifically, antibodies of the disclosure are neutralizing human anti-hGDFl l antibodies.
- Antibodies of the present disclosure may be made by any of a number of techniques known in the art.
- Tables 1-6 include the amino acid sequences of TGFP family member proteins, protein modules of TGFP family member proteins, non-human TGFP family member proteins, and chimeric proteins (e.g., of the protein modules provided herein), which may be used in accordance with the disclosure. It should be appreciated that the amino acid sequences provided herein are not meant to be limiting and additional sequences of TGFP family member proteins are also within the scope of the disclosure. The sequences of additional TGFP family member proteins, as well as their domains, would be apparent to the skilled artisan in view of this disclosure and knowledge in the art.
- proGDFl l Mouse AEGPAAAAAAAAAAAGVGGERSSRPAPSAPPEPDG
- VVKQLLPKAPPLQQILDLHDFQGDALQPEDFLEEDE YHATTETVISMAQETDPAVQTDGSPLCCHFHFSPKV MFTKVLKAQLWVYLRPVPRPATVYLQILRLKPLTG EGTAGGGGGGRRHIRIRSLKIELHSRSGHWQSIDFK QVLHS WFRQPQSNWGIEINAFDPS GTDLA VTS LGPG AEGLHPFMELRVLENTKRSRR
- GDF8 244-352 DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKR
- Beta A TLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKV 119
- GDFl l Inhibin GDFl l AEGPAAAAAAAAAAAGVGGERSSRPAPSVAP (1-96) Beta A (275- EPDGCPVCVWRQHSRELRLESIKSQILSKLRLKEA 125
- GDFl l Inhibin GDFl l AEGPAAAAAAAAAAAGVGGERSSRPAPSVAP (1-86) Beta A (275- EPDGCPVCVWRQHSRELRLESIKSQILSKLRLKEA 126
- GDF11 Inhibin N/A AEGPAAAAAAAAAAAGVGGERSSRPAPSVAP (1-96) Beta A EPDGCPVCVWRQHSRELRLESIKSQILSKLRLKEA 127
- GDF8 GDF11 GDF8 NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKI 1-64) (87-274) (244- QILSKLRLETAPNISKDVIRQLLPKAPPLQQILDLH 130
- GDF8 GDF11 GDF8 NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKI 1-64) (87-274) (244- QILSKLRLETAPNISKDVIRQLLPKAPPLQQILDLH 132
- GDF11 Inhibin GDF11 Inhibin SPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEM Beta A (87-274) Beta A VEAVKKHILNMLHLKKRPDVTQPVPKAALLQQIL 142 (1-64) (291- DLHDFQGDALQPEDFLEEDEYHATTETVISMAQE
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Diabetes (AREA)
- Immunology (AREA)
- Hematology (AREA)
- Pulmonology (AREA)
- Cardiology (AREA)
- Molecular Biology (AREA)
- Physical Education & Sports Medicine (AREA)
- Virology (AREA)
- Oncology (AREA)
- Heart & Thoracic Surgery (AREA)
- Neurology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Obesity (AREA)
- Communicable Diseases (AREA)
- Urology & Nephrology (AREA)
- Dermatology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- AIDS & HIV (AREA)
- Biomedical Technology (AREA)
- Neurosurgery (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3031430A CA3031430A1 (en) | 2015-07-22 | 2016-07-22 | Gdf11 binding proteins and uses thereof |
| JP2018502692A JP2018527903A (ja) | 2015-07-22 | 2016-07-22 | Gdf11結合タンパク質およびその使用 |
| US15/746,467 US20180208648A1 (en) | 2015-07-22 | 2016-07-22 | Gdf11 binding proteins and uses thereof |
| EP16828657.3A EP3324996A4 (en) | 2015-07-22 | 2016-07-22 | GDF11 BINDING PROTEINS AND USES THEREOF |
| AU2016297248A AU2016297248A1 (en) | 2015-07-22 | 2016-07-22 | GDF11 binding proteins and uses thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562195504P | 2015-07-22 | 2015-07-22 | |
| US62/195,504 | 2015-07-22 | ||
| US201662275068P | 2016-01-05 | 2016-01-05 | |
| US62/275,068 | 2016-01-05 |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2017015622A2 true WO2017015622A2 (en) | 2017-01-26 |
| WO2017015622A3 WO2017015622A3 (en) | 2017-03-02 |
| WO2017015622A8 WO2017015622A8 (en) | 2017-04-27 |
Family
ID=57834686
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/043712 Ceased WO2017015622A2 (en) | 2015-07-22 | 2016-07-22 | Gdf11 binding proteins and uses thereof |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20180208648A1 (https=) |
| EP (1) | EP3324996A4 (https=) |
| JP (1) | JP2018527903A (https=) |
| AU (1) | AU2016297248A1 (https=) |
| CA (1) | CA3031430A1 (https=) |
| WO (1) | WO2017015622A2 (https=) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018112362A1 (en) * | 2016-12-16 | 2018-06-21 | Biogen Ma Inc. | Stabilized proteolytically activated growth differentiation factor 11 |
| WO2018204563A1 (en) * | 2017-05-03 | 2018-11-08 | The Johns Hopkins University | Intramuscular atovaquone for malaria prophylaxis |
| WO2020014460A1 (en) | 2018-07-11 | 2020-01-16 | Scholar Rock, Inc. | HIGH-AFFINITY, ISOFORM-SELECTIVE TGFβ1 INHIBITORS AND USE THEREOF |
| US10695405B2 (en) | 2016-07-15 | 2020-06-30 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| EP3677278A1 (en) | 2018-07-11 | 2020-07-08 | Scholar Rock, Inc. | Isoform selective tgfbeta1 inhibitors and use thereof |
| JP2021526155A (ja) * | 2018-07-30 | 2021-09-30 | エクソコバイオ インコーポレイテッド | 幹細胞由来のエキソソームの凍結乾燥製剤及びそれを有効成分として含む抗炎組成物 |
| US20210299255A1 (en) * | 2018-07-20 | 2021-09-30 | Momenta Pharmaceuticals, Inc. | Compositions of fcrn antibodies and methods of use thereof |
| US11337419B2 (en) | 2018-07-28 | 2022-05-24 | Exocobio Inc. | Method for lyophilizing exosome |
| US11377651B2 (en) | 2016-10-19 | 2022-07-05 | Flodesign Sonics, Inc. | Cell therapy processes utilizing acoustophoresis |
| US11730695B2 (en) | 2018-05-31 | 2023-08-22 | Exocobio Inc. | Composition for alleviating facial redness, comprising stem cell-derived exosomes as active ingredient |
| US12528867B2 (en) | 2018-07-20 | 2026-01-20 | Momenta Pharmaceuticals, Inc. | FCRN antibody compositions |
| US12583906B2 (en) | 2020-04-28 | 2026-03-24 | Acceleron Pharma Inc. | Actrii proteins and use in treating post-capillary pulmonary hypertension |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10704021B2 (en) | 2012-03-15 | 2020-07-07 | Flodesign Sonics, Inc. | Acoustic perfusion devices |
| US9458450B2 (en) | 2012-03-15 | 2016-10-04 | Flodesign Sonics, Inc. | Acoustophoretic separation technology using multi-dimensional standing waves |
| WO2015105955A1 (en) | 2014-01-08 | 2015-07-16 | Flodesign Sonics, Inc. | Acoustophoresis device with dual acoustophoretic chamber |
| US11708572B2 (en) | 2015-04-29 | 2023-07-25 | Flodesign Sonics, Inc. | Acoustic cell separation techniques and processes |
| US11459540B2 (en) | 2015-07-28 | 2022-10-04 | Flodesign Sonics, Inc. | Expanded bed affinity selection |
| US11474085B2 (en) | 2015-07-28 | 2022-10-18 | Flodesign Sonics, Inc. | Expanded bed affinity selection |
| US11085035B2 (en) | 2016-05-03 | 2021-08-10 | Flodesign Sonics, Inc. | Therapeutic cell washing, concentration, and separation utilizing acoustophoresis |
| US11214789B2 (en) | 2016-05-03 | 2022-01-04 | Flodesign Sonics, Inc. | Concentration and washing of particles with acoustics |
| KR102439221B1 (ko) | 2017-12-14 | 2022-09-01 | 프로디자인 소닉스, 인크. | 음향 트랜스듀서 구동기 및 제어기 |
| CN116199780A (zh) * | 2019-12-24 | 2023-06-02 | 美勒斯公司 | TGF-β-RII结合蛋白质 |
| RU2750267C1 (ru) * | 2020-02-07 | 2021-06-25 | Общество с ограниченной ответственностью «НАУЧНО-ПРОИЗВОДСТВЕННОЕ ОБЪЕДИНЕНИЕ ИН-ВЕТ» | Рекомбинантный ростовой дифференцировочный фактор роста 11 (GDF11), способ его получения, инъекционный препарат для повышения мышечной массы млекопитающих животных и птицы, а также способ использования препарата |
Family Cites Families (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030167492A1 (en) * | 1994-07-08 | 2003-09-04 | Johns Hopkins University School Of Medicine | Transgenic non-human animals expressing a gdf-11 dominant negative polypeptide, and methods of making and using same |
| EP1574577A3 (en) * | 1994-07-08 | 2006-06-14 | The Johns Hopkins University School Of Medicine | Growth differentiation factor-11 |
| CA2336536A1 (en) * | 1998-07-28 | 2000-02-10 | The Johns Hopkins University School Of Medicine | Growth differentiation factor-11 |
| WO2004009776A2 (en) * | 2002-07-19 | 2004-01-29 | Abbott Biotechnology Ltd. | TREATMENT OF TNFα RELATED DISORDERS |
| US7850962B2 (en) * | 2004-04-20 | 2010-12-14 | Genmab A/S | Human monoclonal antibodies against CD20 |
| TW200918553A (en) * | 2007-09-18 | 2009-05-01 | Amgen Inc | Human GM-CSF antigen binding proteins |
| JP5841845B2 (ja) * | 2009-02-24 | 2016-01-13 | ソーク・インステチュート・フォー・バイオロジカル・スタディーズSalk Institute For Biological Studies | TGF−βスーパーファミリーのデザイナーリガンド |
| PT3904391T (pt) * | 2010-03-10 | 2024-10-14 | Genmab As | Anticorpos monoclonais contra c-met |
| WO2013071056A2 (en) * | 2011-11-11 | 2013-05-16 | Duke University | Combination drug therapy for the treatment of solid tumors |
| WO2013148284A1 (en) * | 2012-03-29 | 2013-10-03 | Genentech, Inc. | Antibodies that bind to a pcsk9 cleavage site and methods of use |
| WO2013165972A2 (en) * | 2012-04-30 | 2013-11-07 | Cell Signaling Technology, Inc. | Anti-hepatitis b virus antibodies and use thereof |
| JP2016500704A (ja) * | 2012-11-06 | 2016-01-14 | スカラー ロック インコーポレイテッドScholar Rock,Inc. | 細胞シグナル伝達を変調するための組成物及び方法 |
| RS61778B1 (sr) * | 2013-05-06 | 2021-06-30 | Scholar Rock Inc | Kompozicije i postupci za modulaciju faktora rasta |
| WO2016073906A2 (en) * | 2014-11-06 | 2016-05-12 | Scholar Rock, Inc. | Transforming growth factor-related immunoassays |
-
2016
- 2016-07-22 WO PCT/US2016/043712 patent/WO2017015622A2/en not_active Ceased
- 2016-07-22 JP JP2018502692A patent/JP2018527903A/ja active Pending
- 2016-07-22 AU AU2016297248A patent/AU2016297248A1/en not_active Abandoned
- 2016-07-22 CA CA3031430A patent/CA3031430A1/en not_active Abandoned
- 2016-07-22 US US15/746,467 patent/US20180208648A1/en not_active Abandoned
- 2016-07-22 EP EP16828657.3A patent/EP3324996A4/en not_active Withdrawn
Cited By (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11318188B2 (en) | 2016-07-15 | 2022-05-03 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US10946067B2 (en) | 2016-07-15 | 2021-03-16 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US12343378B2 (en) | 2016-07-15 | 2025-07-01 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US10695405B2 (en) | 2016-07-15 | 2020-06-30 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US11622992B2 (en) | 2016-07-15 | 2023-04-11 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US10722558B2 (en) | 2016-07-15 | 2020-07-28 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US11219666B2 (en) | 2016-07-15 | 2022-01-11 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US10973880B2 (en) | 2016-07-15 | 2021-04-13 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US11065303B2 (en) | 2016-07-15 | 2021-07-20 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US11497794B2 (en) | 2016-07-15 | 2022-11-15 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US11377651B2 (en) | 2016-10-19 | 2022-07-05 | Flodesign Sonics, Inc. | Cell therapy processes utilizing acoustophoresis |
| WO2018112362A1 (en) * | 2016-12-16 | 2018-06-21 | Biogen Ma Inc. | Stabilized proteolytically activated growth differentiation factor 11 |
| WO2018204563A1 (en) * | 2017-05-03 | 2018-11-08 | The Johns Hopkins University | Intramuscular atovaquone for malaria prophylaxis |
| US11730695B2 (en) | 2018-05-31 | 2023-08-22 | Exocobio Inc. | Composition for alleviating facial redness, comprising stem cell-derived exosomes as active ingredient |
| EP4019046A1 (en) | 2018-07-11 | 2022-06-29 | Scholar Rock, Inc. | Isoform selective tgfbeta1 inhibitors and use thereof |
| EP3677278A1 (en) | 2018-07-11 | 2020-07-08 | Scholar Rock, Inc. | Isoform selective tgfbeta1 inhibitors and use thereof |
| WO2020014460A1 (en) | 2018-07-11 | 2020-01-16 | Scholar Rock, Inc. | HIGH-AFFINITY, ISOFORM-SELECTIVE TGFβ1 INHIBITORS AND USE THEREOF |
| US20210299255A1 (en) * | 2018-07-20 | 2021-09-30 | Momenta Pharmaceuticals, Inc. | Compositions of fcrn antibodies and methods of use thereof |
| AU2019312139B2 (en) * | 2018-07-20 | 2025-02-06 | Momenta Pharmaceuticals, Inc. | Compositions of FcRn antibodies and methods of use thereof |
| US12528867B2 (en) | 2018-07-20 | 2026-01-20 | Momenta Pharmaceuticals, Inc. | FCRN antibody compositions |
| US11337419B2 (en) | 2018-07-28 | 2022-05-24 | Exocobio Inc. | Method for lyophilizing exosome |
| US11529306B2 (en) | 2018-07-30 | 2022-12-20 | Exocobio Inc. | Lyophilized formulation of stem cell-derived exosomes and anti-inflammatory composition including the same as active ingredient |
| JP2021526155A (ja) * | 2018-07-30 | 2021-09-30 | エクソコバイオ インコーポレイテッド | 幹細胞由来のエキソソームの凍結乾燥製剤及びそれを有効成分として含む抗炎組成物 |
| US12583906B2 (en) | 2020-04-28 | 2026-03-24 | Acceleron Pharma Inc. | Actrii proteins and use in treating post-capillary pulmonary hypertension |
Also Published As
| Publication number | Publication date |
|---|---|
| US20180208648A1 (en) | 2018-07-26 |
| WO2017015622A8 (en) | 2017-04-27 |
| EP3324996A4 (en) | 2019-04-17 |
| AU2016297248A1 (en) | 2018-02-15 |
| WO2017015622A3 (en) | 2017-03-02 |
| JP2018527903A (ja) | 2018-09-27 |
| CA3031430A1 (en) | 2017-01-26 |
| EP3324996A2 (en) | 2018-05-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20180208648A1 (en) | Gdf11 binding proteins and uses thereof | |
| US10899842B2 (en) | 4-1BB binding proteins and uses thereof | |
| TWI496790B (zh) | 介白素-13結合蛋白質 | |
| US8624002B2 (en) | Prostaglandin E2 binding proteins and uses thereof | |
| JP5918275B2 (ja) | 変形性関節症及び疼痛の治療 | |
| US9226983B2 (en) | TNF-α binding proteins | |
| JP2013507929A (ja) | Il−1結合蛋白質 | |
| AU2015200579A1 (en) | TNF-alpha binding proteins | |
| AU2014202979A1 (en) | Prostaglandin E2 binding proteins and uses thereof | |
| HK1168110A (en) | Il-1 binding proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16828657 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2018502692 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15746467 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016297248 Country of ref document: AU Date of ref document: 20160722 Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16828657 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 3031430 Country of ref document: CA |