WO2017009469A1 - Il22 immunoconjugates - Google Patents
Il22 immunoconjugates Download PDFInfo
- Publication number
- WO2017009469A1 WO2017009469A1 PCT/EP2016/066979 EP2016066979W WO2017009469A1 WO 2017009469 A1 WO2017009469 A1 WO 2017009469A1 EP 2016066979 W EP2016066979 W EP 2016066979W WO 2017009469 A1 WO2017009469 A1 WO 2017009469A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- conjugate
- antibody
- antigen
- conjugate according
- antibody molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6813—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin the drug being a peptidic cytokine, e.g. an interleukin or interferon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/626—Diabody or triabody
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
Definitions
- the present invention relates to a conjugate comprising interleukin-22 (IL22) and an antibody molecule.
- the antibody molecule preferably binds an antigen associated with angiogenesis, such as the ED-A isoform of fibronectin.
- the present invention relates to the therapeutic use of such conjugates in the treatment of a disease/disorder, such as autoimmune diseases, including inflammatory bowel disease (IBD).
- a disease/disorder such as autoimmune diseases, including inflammatory bowel disease (IBD).
- Cytokines are key mediators of innate and adaptive immunity. Many cytokines have been used for therapeutic purposes in patients, such as those with advanced cancer, but their administration is typically associated with severe toxicity, hampering dose escalation to therapeutically active regimens and their development as anticancer drugs, for example. To overcome these problems, the use of 'immunocytokines' (i.e. cytokines fused to antibodies or antibody fragments) has been proposed, with the aim to concentrate the immune-system stimulating activity at the site of disease while sparing normal tissues (Savage et al., 1993; Schrama et al., 2006; Neri et al. 2005; Dela Cruz er a/., 2004; Reisfeld er a/., 1997;
- pro-inflammatory immunocytokines e.g., those based on IL2, IL12, IL15, TNF
- pro-inflammatory immunocytokines have been shown to display a potent anti-tumoural effect in mouse models of cancer (Borsi et al. 2003; Carnemolla et al., 2002; Frey et al., 2010; Kaspar er al., 2007; Pasche et al., 2012).
- anti-inflammatory immunocytokines e.g., those based on IL10
- have been shown to be capable of conferring a therapeutic benefit in mouse models of chronic inflammatory conditions rheumatoid arthritis, endometriosis [Schwager et al. 201 ; Schwager et al., 2009]
- Antibodies specific to splice-isoforms of fibronectin and of tenascin-C have been described as vehicles for pharmacodelivery applications, as these antigens are virtually undetectable in the normal healthy adult (with the exception of the placenta, endometrium and some vessels in the ovaries) while being strongly expressed in the majority of solid tumours and lymphomas, as well as other diseases (Brack et al., 2006; Pedretti et al., 2009; Schliemann et al. 2009).
- antibodies F8 and L19 specific to the alternatively-spliced EDA and EDB domains of fibronectin, respectively, and anti-tenascin C antibody F16 (Brack et al.
- Interleukin 22 is a 17 kDa globular cytokine belonging to the IL-10 family, which is mainly secreted by NK cells, dendritic cells and T-cells (Murphy 2012). It contains two intramolecular disulfide bonds and three N-linked glycosylation sites. Biological functions of IL22 include involvement in tissue protection, autoimmunity and inflammation. Secreted by lamina limbal effector T-cells in the intestine, it induces mucin production, antimicrobial, proliferative and antiapoptotic pathways, which prevent tissue damage and promote epithelial repair.(Li et al. 2014). We investigated whether IL22 could be successfully fused to a vascular targeting antibody.
- Cytokines can be conjugated to antibody molecules to produce immunocytokines as mentioned above. However, not all immunocytokines retain, for example, the in vivo targeting properties of the parental antibody (Pasche & Neri 2012) or expected activities. The preparation of immunocytokines with therapeutic effects, such as anti-inflammatory activity, is therefore far from straightforward.
- conjugates comprising a mouse lgG1 Fc fused to the N-terminus or C- terminus of mouse IL-22 is described in Smith et al. 2013. These conjugates were prepared with a view to providing a more potent and longer-lasting IL-22R agonist compared with rlL- 22. The purpose of the Fc region in this instance was therefore not to target IL22 to regions of disease as was the case with the immunocytokines described in the preceding paragraph.
- IL22 can be conjugated to antibodies, which bind ED-A, while retaining not only the targeting properties of the unconjugated antibody but also the biological activity of IL22.
- the present invention therefore relates to a conjugate comprising interleukin- 22 (IL22) and an antibody molecule, or antigen-binding fragment thereof, which binds an antigen associated with angiogenesis.
- the present invention also relates to a nucleic acid molecule encoding such a conjugate, as well as an expression vector comprising such a nucleic acid.
- a host cell comprising such a vector is also contemplated.
- the present invention also relates to a conjugate of the invention for use in a method for treatment of the human body by therapy.
- the invention relates to a conjugate of the invention for use in a method of treating an autoimmune disease in a patient and to a conjugate of the invention for use in delivering IL22 to sites of autoimmune disease in a patient is also contemplated.
- a method of treating of an autoimmune disease in a patient, the method comprising administering a therapeutically effective amount of a conjugate of the invention to the patient also forms part of the inventions, as does a method of delivering IL22 to sites of autoimmune disease in a patient comprising administering the conjugate of the invention to the patient.
- the present invention further relates to a conjugate of the invention for use in a method of treating an inflammation in a patient and to a conjugate of the invention for use in delivering IL22 to sites of inflammation in a patient is also contemplated.
- a method of treating inflammation in a patient, the method comprising administering a therapeutically effective amount of a conjugate of the invention to the patient also forms part of the inventions, as does a method of delivering IL22 to sites of inflammation in a patient comprising
- the inflammation is preferably the result of an inflammatory disease and/or disorder.
- Figure 1 shows a schematic diagram of the mammalian cell expression vectors used to express the mulL22-F8 ( Figure 1A) and F8-mulL22 conjugates ( Figure 1B).
- Figure 2 A and B show the results of an SDS-PAGE analysis of the mulL22-F8 and F8- mulL22 conjugates, respectively, under reducing and non-reducing conditions (lanes 1 and 2, respectively), and in the presence of PNGase F (lanes 3 and 4, respectively).
- C and D show the results of size exclusion chromatography of the mull_22-F8 and F8-mull_22 conjugates, respectively. The fact that only single peaks were visible confirms the
- Figure 3 A and B show the results of surface plasmon resonance (Biacore) using an ED-A coated chip and the mulL22-F8 and F8-mulL22 fusion proteins, respectively, and demonstrate that the mull_22-F8 and F8-mulL22 fusion proteins are capable of binding ED-A.
- C and D show the results of an ELISA using ED-A coated wells and the mulL22-F8 and F8-mull_22 fusion proteins, respectively, and further confirms that the mull_22-F8 and F8-mulL22 fusion proteins are capable of binding ED-A.
- Figure 4 shows the results of a bioactivity assay using the F8-mulL22 and mulL22-F8 fusion proteins and demonstrates that the mulL22 in the F8-mulL22 and mulL22-F8 fusion proteins retains the ability to induce phosphorylation of STAT3 upon binding to the receptor on colon carcinoma cells.
- the concentration of the fusion proteins employed in the experiments (5 pg/ml, 0.5 Mg/ml, and 0.05 pg/ml) is indicated at the top of the figure. "0" indicates the lanes comprising negative controls. The location of the band corresponding to phosphorylated STAT3 is indicated.
- Figure 5 shows the results of tumour targeting studies using the mulL22-F8 and F8-mulL22 fusion proteins in F9 tumour-bearing mice.
- the fusion proteins primarily localized to the tumour tissue, which is known to express ED-A in the tumour neovasculature, with minimal amounts of fusion protein found in other (healthy) tissues of the mice, which are not expected to express ED-A.
- the y-axis shows the percentage of the injected dose of the fusion protein per gram of tissue (%ID/g).
- Antibody Molecule This describes an immunoglobulin whether natural or partly or wholly synthetically produced.
- the term also relates to any polypeptide or protein comprising an antibody antigen-binding site. It must be understood here that the antibody molecules may have been isolated or obtained by purification from natural sources, or else obtained by genetic recombination, or by chemical synthesis, and that they can contain unnatural amino acids.
- antibody molecule should be construed as covering any specific binding member or substance having an antibody antigen-binding site with the required specificity and/or binding to antigen.
- this term covers antibody fragments, in particular antigen-binding fragments, and derivatives, including any polypeptide comprising an antibody antigen-binding site, whether natural or wholly or partially synthetic.
- Chimeric molecules comprising an antibody antigen-binding site, or equivalent, fused to another polypeptide (e.g. belonging to another antibody class or subclass) are therefore included. Cloning and expression of chimeric antibodies are described in EP-A-0120694 and EP-A-0125023, and a large body of subsequent literature.
- binding fragments are (i) the Fab fragment consisting of VL, VH, CL and CH1 domains; (ii) the Fd fragment consisting of the VH and CH1 domains; (iii) the Fv fragment consisting of the VL and VH domains of a single antibody; (iv) the dAb fragment (Ward er a/. (1989) Nature 341 , 544-546; McCafferty ef a/., (1990) Nature, 348, 552-554; Holt ef al.
- diabodies multivalent or multispecific fragments constructed by gene fusion (W094/13804; Holliger et al. (1993a), Proc. Natl. Acad. Sci. USA 90 6444-6448).
- Fv, scFv or diabody molecules may be stabilized by the incorporation of disulphide bridges linking the VH and VL domains (Reiter ef al. (1996), Nature Biotech, 14, 1239-1245).
- Minibodies comprising a scFv joined to a CH3 domain may also be made (Hu er al. (1996), Cancer Res.,
- binding fragments are Fab', which differs from Fab fragments by the addition of a few residues at the carboxyl terminus of the heavy chain CH1 domain, including one or more cysteines from the antibody hinge region, and Fab'-SH, which is a Fab' fragment in which the cysteine residue(s) of the constant domains bear a free thiol group.
- the half-life of antibody molecules for use in the present invention, or conjugates of the invention may be increased by a chemical modification, especially by PEGylation, or by incorporation in a liposome.
- An antibody molecule for use in the present invention preferably is, or comprises, an scFv.
- Diabodies for example, comprise two scFv molecules.
- the antibody molecule for use in the present invention is a diabody.
- Diabodies and scFvs do not comprise an antibody Fc region, thus potentially reducing the effects of anti-idiotypic reactions.
- the VH and VL domains are preferably linked by a 5 to 12 amino acid linker.
- a diabody comprises two VH-VL molecules which associate to form a dimer.
- the VH and VL domains of each VH-VL molecule are preferably linked by a 5 to 12 amino acid linker.
- the VH and VL domains may be linked by an amino acid linker which is 5, 6, 7, 8, 9, 10, 11 , or 12 amino acid in length.
- the amino acid linker is 5 amino acids in length.
- Suitable linker sequences are known in the art and include the linker sequence set forth in SEQ ID NO: 9.
- the VH and VL domains of the antibody are preferably linked by a 14 to 20 amino acid linker.
- the VH and VL domains may be linked by an amino acid linker which is 14, 15, 16, 17, 18, 19, or 20 amino acid in length.
- Suitable linker sequences are known in the art and include the linker sequence set forth in SEQ ID NO: 43. The present inventors have shown that a conjugate comprising IL22 and an antibody molecule which binds the Extra-Domain A (ED-A) of fibronectin can successfully, and specifically, target tumour tissue in vivo.
- the ED-A isoform of fibronectin is known to be expressed in neovasculature, such as the neovasculature found in tumours, but not in healthy tissues.
- This data therefore provides evidence that a conjugate comprising IL22 and an antibody molecule which binds the ED-A of fibronectin can be used to target sites of angiogenesis.
- IL22 conjugates therefore are suitable for treating inflammation and autoimmune diseases in an individual. Many autoimmune diseases, as well as diseases associated with inflammation, are known to involve and/or be characterised by angiogenesis.
- conjugates comprising IL22 and an antibody molecule which binds an antigen associated with angiogenesis will similarly be suitable to target IL22 to sites of angiogenesis and thus find application in the treatment of autoimmune diseases and/or inflammation.
- antigens are known in the art, as are antibodies capable of binding such antigens.
- antibodies against a given antigen can be generated using well- known methods such as those described in the present application.
- the antigen may be an extra-cellular matrix component associated with angiogenesis, such as a fibronectin, including the Extra-Domain A (ED-A) isoform of fibronectin (A-FN), the Extra- Domain B (ED-B) isoform of fibronectin (B-FN), tenascin C, the ED-A of fibronectin, the ED- B of fibronectin, or the A1 Domain of Tenascin C.
- ED-A Extra-Domain A
- ED-B Extra- Domain B
- tenascin C the ED-A of fibronectin
- the ED- B of fibronectin the ED- B of fibronectin
- A1 Domain of Tenascin C tenascin C
- Antibodies which bind the ED-A of fibronectin, and thus also A-FN are known in the art and include antibody F8.
- Antibodies which bind the ED-B of fibronectin, or the A1 Domain of Tenascin C (and thus also the B-FN and tenascin C) are also known in the art and include antibodies L19 and F16, respectively.
- Antibodies which bind the ED-B of fibronectin, or the A1 Domain of Tenascin C, including antibodies L19 and F16, have been shown to be capable of specifically targeting
- conjugates comprising IL22 and an antibody molecule which binds B-FN, tenascin C, the ED-B of fibronectin, or the A1 Domain of Tenascin C, will be capable of targeting IL22 to neovasculature, in the same way as a conjugate comprising IL22 and an antibody molecule which binds A-FN, as demonstrated using antibody F8 herein and thus find application in the treatment of autoimmune diseases and/or inflammation.
- an antibody molecule for use in the invention binds an antigen associated with angiogenesis.
- antibody molecule for use in the invention binds an extra-cellular matrix component associated with angiogenesis, such as A-FN, B-FN, tenascin C, the ED-A of fibronectin, the ED-B of fibronectin, or the A1 Domain of Tenascin C.
- an antibody molecule for use in the invention binds the A-FN or the ED-A of fibronectin.
- an antibody molecule for use in the invention binds the ED-A of fibronectin.
- an antibody molecule for use in the invention may have the CDRs and/or the VH and/or VL domains of antibodies F8, L19 or F16 described herein.
- An antibody molecule for use in the invention preferably has the CDRs of antibody F8 set forth in SEQ ID NOs 1-6. More preferably, an antibody for use in the invention comprises the VH and/or VL domains of antibody F8 set forth in SEQ ID NOs 7 and 8. Yet more preferably, an antibody for use in the invention comprises the VH and VL domains of antibody F8 set forth in SEQ ID NOs 7 and 8.
- the F8 antibody is preferably in diabody or scFv format, most preferably in diabody format. Where the F8 antibody is in diabody format, the antibody molecule for use in the invention preferably has the amino acid sequence set forth in SEQ ID NO: 10.
- An antibody molecule for use in the invention may bind the A-FN and/or the ED-A of fibronectin, with the same affinity as anti-ED-A antibody F8 e.g. in diabody format, or with an affinity that is better.
- An antibody molecule for use in the invention may bind the B-FN and/or the ED-B of fibronectin, with the same affinity as anti-ED-B antibody L19 e.g. in diabody format, or with an affinity that is better.
- An antibody molecule for use in the invention may bind the Tenascin C and/or the A1 domain of tenascin C, with the same affinity as anti-ED-A antibody F16 e.g. in diabody format, or with an affinity that is better.
- An antibody molecule for use in the invention may bind to the same epitope on A-FN and/or the ED-A of fibronectin as anti-ED-A antibody F8.
- An antibody molecule for use in the invention may bind to the same epitope on B-FN and/or the ED-B of fibronectin as anti-ED-A antibody L19.
- An antibody molecule for use in the present invention may bind to the same epitope on tenascin C and/or the A1 domain of tenascin C as antibody F16.
- Variants of antibody molecules disclosed herein may be produced and used in the present invention.
- the techniques required to make substitutions within amino acid sequences of CDRs, antibody VH or VL domains, in particular the framework regions of the VH and VL domains, and antibody molecules generally are available in the art.
- Variant sequences may be made, with substitutions that may or may not be predicted to have a minimal or beneficial effect on activity, and tested for ability to bind A-FN and/or the ED-A of fibronectin, B-FN and/or the ED-B of fibronectin, tenascin C and/or the A1 domain of tenascin C, and/or for any other desired property.
- an antibody molecule which binds the FN- A, FN-B, or tenascin C may comprise the CDRs and/or the VH and/or the VL domain of antibody F8, L19, or F16 described herein with 5 or fewer, for example, 5, 4, 3, 2 or 1 amino acid alterations within the CDRs and/or the VH and/or the VL domain.
- an antibody molecule which binds the FN-A, FN-B, or tenascin C may comprise the VH and/or the VL domain of antibody F8, L19, or F16 described herein with 5 or fewer, for example, 5, 4, 3, 2 or 1 amino acid alterations within the framework region of the VH and/or VL domain.
- An antibody molecule that binds the FN-A or ED-A of fibronectin, as referred to herein thus may comprise the VH domain shown in SEQ ID NO: 7 and/or the VL domain set forth in SEQ ID NO: 8 with 5 or fewer, for example, 5, 4, 3, 2 or 1 amino acid alterations within the framework region of the VH and/or VL domain.
- Such an antibody molecule may bind the ED-A isoform or ED-A of fibronectin with the same or substantially the same, affinity as an antibody molecule comprising the VH domain set forth in SEQ ID NO: 7 and the VL domain shown in SEQ ID NO: 8 or may bind the ED-A isoform or ED-A of fibronectin with a higher affinity than an antibody molecule comprising the VH domain set forth in SEQ ID NO: 7 and the VL domain set forth in SEQ ID NO: 8.
- An antibody molecule for use in the invention may comprise a VH and/or VL domain that has at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%o, sequence identity to the VH and/or VL domain, as applicable, of antibody F8, L19, or F16 set forth in SEQ ID NOs 7, 8, 31 , 32, 40, and 41.
- An antibody molecule for use in the invention may have at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, sequence identity to the amino acid sequence of the F8, L19, or F16 antibodies set forth in SEQ ID NOs 10, 33, and 42, respectively.
- GAP Garnier GAP (1990) J. Mol. Biol. 215: 405-4 0
- FASTA Pearson and Lipman (1988) PNAS USA 85: 2444-2448
- Smith-Waterman algorithm Smith and Waterman (1981 ) J. Mol Biol.
- an antibody antigen-binding site comprises the part of the antibody that binds to and is complementary to all or part of the target antigen.
- An antibody antigen-binding site may be provided by one or more antibody variable domains.
- An antibody antigen-binding site preferably comprises an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
- An antigen binding site may be provided by means of arrangement of complementarity determining regions (CDRs).
- CDRs complementarity determining regions
- the structure for carrying a CDR or a set of CDRs will generally be an antibody heavy or light chain sequence or substantial portion thereof in which the CDR or set of CDRs is located at a location corresponding to the CDR or set of CDRs of naturally occurring VH and VL antibody variable domains encoded by rearranged immunoglobulin genes.
- the structures and locations of immunoglobulin variable domains may be determined by reference to Kabat et al. (1987) (Sequences of Proteins of
- CDR region or CDR it is intended to indicate the hypervariable regions of the heavy and light chains of the immunoglobulin as defined by Kabat et al. (1987) Sequences of Proteins of Immunological Interest, 4 th Edition, US Department of Health and Human Services (Kabat et al., (1991a), Sequences of Proteins of Immunological Interest, 5 th Edition, US Department of Health and Human Services, Public Service, NIH, Washington, and later editions).
- An antibody typically contains 3 heavy chain CDRs and 3 light chain CDRs.
- CDR or CDRs is used here in order to indicate, according to the case, one of these regions or several, or even the whole, of these regions which contain the majority of the amino acid residues responsible for the binding by affinity of the antibody for the antigen or the epitope which it recognizes.
- HCDR3 the third CDR of the heavy chain (HCDR3) has a greater size variability (greater diversity essentially due to the mechanisms of arrangement of the genes which give rise to it). It can be as short as 2 amino acids although the longest size known is 26. Functionally, HCDR3 plays a role in part in the determination of the specificity of the antibody (Segal et al., (1974), PNAS, 71 :4298-4302; Amit et al., (1986), Science, 233:747-753; Chothia et al., (1987), J. Mol.
- An antigen binding site forming part of an antibody molecule for use in the invention preferably has the CDRs of antibody F8 set forth in SEQ ID NOs 1-6, the CDRs of antibody L19 set forth in SEQ ID NOs 25-30, or the CDRs of antibody F16 set forth in SEQ ID NOs 34-39. Most preferably, an antigen binding site forming part of an antibody molecule for use in the invention has the CDRs of antibody F8 set forth in SEQ ID NOs 1-6.
- the antibody molecules for use in the present invention are preferably monoclonal antibodies, especially of human, murine, chimeric or humanized origin, which can be obtained according to the standard methods well known to the person skilled in the art.
- An antibody molecule for use in the present invention is most preferably a human antibody molecule. It is possible to take monoclonal and other antibodies and use techniques of recombinant DNA technology to produce other antibodies or chimeric molecules that bind the target antigen. Such techniques may involve introducing DNA encoding the immunoglobulin variable region, or the CDRs, of an antibody molecule to the constant regions, or constant regions plus framework regions, of a different immunoglobulin.
- a hybridoma or other cell producing an antibody may also be subject to genetic mutation or other changes, which may or may not alter the binding specificity of antibodies produced.
- Monoclonal antibodies can be obtained, for example, from an animal cell immunized against the an antigen associated with angiogenesis, such as A-FN, B-FN, tenascin C, the ED-A of fibronectin, the ED-B of fibronectin, or the A1 Domain of Tenascin C, according to the usual working methods, by genetic recombination starting with a nucleic acid sequence contained in the cDNA sequence coding for A-FN, B-FN, or tenascin C, or fragment thereof, or by peptide synthesis starting from a sequence of amino acids comprised in the peptide sequence of the A-FN, B-FN, or tenascin C, and/or a fragment thereof.
- an antigen associated with angiogenesis such as A-FN, B-FN, tenascin C, the ED-A of fibronectin, the ED-B of fibronectin, or the A1 Domain of Tenascin C
- Synthetic antibody molecules may be created by expression from genes generated by means of oligonucleotides synthesized and assembled within suitable expression vectors, for example as described by Knappik et al. (2000) J. Mol. Biol. 296, 57-86 or Krebs et al. (2001 ) Journal of Immunological Methods, 254 67-84.
- one or more antibody molecules for an antigen associated with angiogenesis such as the A-FN, the ED-A, B-FN, the ED-B, tenascin C, or the A1 domain of tenascin C may be obtained by bringing into contact a library of antibody molecules and the antigen or a fragment thereof, e.g. a fragment comprising or consisting of ED-A, ED-B, or the A1 domain of tenascin C, or a peptide fragment thereof, and selecting one or more antibody molecules of the library able to bind the antigen.
- a library of antibody molecules and the antigen or a fragment thereof e.g. a fragment comprising or consisting of ED-A, ED-B, or the A1 domain of tenascin C, or a peptide fragment thereof
- An antibody library may be screened using Iterative Colony Filter Screening (ICFS).
- ICFS Iterative Colony Filter Screening
- bacteria containing the DNA encoding several binding specificities are grown in a liquid medium and, once the stage of exponential growth has been reached, some billions of them are distributed onto a growth support consisting of a suitably pre-treated membrane filter which is incubated until completely confluent bacterial colonies appear.
- a second trap substrate consists of another membrane filter, pre-humidified and covered with the desired antigen.
- the trap membrane filter is then placed onto a plate containing a suitable culture medium and covered with the growth filter with the surface covered with bacterial colonies pointing upwards.
- the sandwich thus obtained is incubated at room temperature for about 16 h. It is thus possible to obtain the expression of the genes encoding antibody fragments scFv having a spreading action, so that those fragments binding specifically with the antigen which is present on the trap membrane are trapped.
- the trap membrane is then treated to point out bound antibody fragments scFv with colorimetric techniques commonly used to this purpose. The position of the coloured spots on the trap filter allows one to go back to the
- a library may also be displayed on particles or molecular complexes, e.g. replicable genetic packages such bacteriophage (e.g. T7) particles, or other in vitro display systems, each particle or molecular complex containing nucleic acid encoding the antibody VH variable domain displayed on it, and optionally also a displayed VL domain if present.
- Phage display is described in WO92/01047 and e.g. US patents US5969108, US5565332, US5733743, US5858657, US5871907, US5872215, US5885793, US5962255, US6140471 , US6172197, US6225447, US6291650, US6492 60 and US6521404.
- nucleic acid may be taken from a bacteriophage or other particle or molecular complex displaying a said selected antibody molecule.
- nucleic acid may be used in subsequent production of an antibody molecule or an antibody VH or VL variable domain by expression from nucleic acid with the sequence of nucleic acid taken from a bacteriophage or other particle or molecular complex displaying a said selected antibody molecule.
- an antigen associated with angiogenesis such as the A-FN, B-FN, the ED-A, or the ED-B of fibronectin, tenascin C or the A1 domain of tenascin C or other target antigen or isoform may be further tested, e.g. ability to compete with an antibody specific for the A- FN, B-FN, the ED-A, or the ED-B of fibronectin, tenascin C or the A1 domain of tenascin C, such as antibody F8, L19, or F16.
- Novel VH or VL regions carrying CDR-derived sequences for use in the invention may be also generated using random mutagenesis of one or more selected VH and/or VL genes to generate mutations within the entire variable domain.
- one or two amino acid substitutions are made within an entire variable domain or set of CDRs.
- Another method that may be used is to direct mutagenesis to CDR regions of VH or VL genes.
- Variable domains employed in the invention may be obtained or derived from any germ-line or rearranged human variable domain, or may be a synthetic variable domain based on consensus or actual sequences of known human variable domains.
- a variable domain can be derived from a non-human antibody.
- a CDR sequence for use in the invention e.g.
- CDR3 may be introduced into a repertoire of variable domains lacking a CDR (e.g. CDR3), using recombinant DNA technology.
- CDR3 a repertoire of variable domains lacking a CDR
- Marks et al. (1992) describe methods of producing repertoires of antibody variable domains in which consensus primers directed at or adjacent to the 5' end of the variable domain area are used in conjunction with consensus primers to the third framework region of human VH genes to provide a repertoire of VH variable domains lacking a CDR3. Marks et al. further describe how this repertoire may be combined with a CDR3 of a particular antibody.
- the CDR3- derived sequences of the present invention may be shuffled with repertoires of VH or VL domains lacking a CDR3, and the shuffled complete VH or VL domains combined with a cognate VL or VH domain to provide antibody molecules for use in the invention.
- the repertoire may then be displayed in a suitable host system such as the phage display system of WO92/01047, or any of a subsequent large body of literature, including Kay, Winter & McCafferty (1996), so that suitable antibody molecules may be selected.
- a repertoire may consist of from anything from 10 4 individual members upwards, for example at least 10 5 , at least 10 s , at least 10 7 , at least 10 8 , at least 10 9 or at least 10 10 members.
- An antigen associated with angiogenesis such as the A-FN, B-FN, the ED-A, or the ED-B of fibronectin, tenascin C or the A1 domain of tenascin C may be used in a screen for antibody molecules, e.g. antibody molecules, for use in the invention.
- the screen may a screen of a repertoire as disclosed elsewhere herein.
- one or more, or all three CDRs may be grafted into a repertoire of VH or VL domains that are then screened for an antibody molecule or antibody molecules for an antigen associated with angiogenesis, such as A-FN, B-FN, the ED-A, or the ED-B of fibronectin, tenascin C or the A1 domain of tenascin C.
- angiogenesis such as A-FN, B-FN, the ED-A, or the ED-B of fibronectin, tenascin C or the A1 domain of tenascin C.
- One or more of the HCDR1 , HCDR2 and HCDR3 of antibody F8, L19, or F16, or the set of HCDRs of antibody F8, L19, or F16 may be employed, and/or one or more of the LCDR1 , LCDR2 and LCDR3 of antibody F8, L19, or F16 the set of LCDRs of antibody F8, L19, or F16 may be employed.
- a substantial portion of an immunoglobulin variable domain may comprise at least the three CDR regions, together with their intervening framework regions.
- the portion may also include at least about 50% of either or both of the first and fourth framework regions, the 50% being the C-terminal 50% of the first framework region and the N-terminal 50% of the fourth framework region. Additional residues at the N-terminal or C-terminal end of the substantial part of the variable domain may be those not normally associated with naturally occurring variable domain regions.
- construction of antibody molecules of the present invention made by recombinant DNA techniques may result in the introduction of N- or C-terminal residues encoded by linkers introduced to facilitate cloning or other
- manipulation steps include the introduction of linkers to join variable domains disclosed elsewhere herein to further protein sequences including antibody constant regions, other variable domains (for example in the production of diabodies) or detectable/functional labels as discussed in more detail elsewhere herein.
- antibody molecules may comprise a pair of VH and VL domains
- single binding domains based on either VH or VL domain sequences may also be used in the invention. It is known that single immunoglobulin domains, especially VH domains, are capable of binding target antigens in a specific manner. For example, see the discussion of dAbs above.
- these domains may be used to screen for complementary domains capable of forming a two-domain antibody molecule able to bind an antigen associated with angiogenesis, such as A-FN, B-FN, the ED-A, or the ED-B of fibronectin, tenascin C or the A1 domain of tenascin C.
- angiogenesis such as A-FN, B-FN, the ED-A, or the ED-B of fibronectin, tenascin C or the A1 domain of tenascin C.
- phage display screening methods using the so-called hierarchical dual combinatorial approach as disclosed in WO92/01047, in which an individual colony containing either an H or L chain clone is used to infect a complete library of clones encoding the other chain (L or H) and the resulting two-chain antibody molecule is selected in accordance with phage display techniques such as those described in that reference. This technique is also disclosed in Marks 1992. Fragments of whole antibodies for use in the invention can be obtained starting from any of the antibody molecules described herein, e.g.
- antibody molecules comprising VH and/or VL domains or CDRs of any of antibodies described herein, by methods such as digestion by enzymes, such as pepsin or papain and/or by cleavage of the disulfide bridges by chemical reduction.
- enzymes such as pepsin or papain
- cleavage of the disulfide bridges by chemical reduction.
- antibody fragments may be obtained by techniques of genetic recombination likewise well known to the person skilled in the art or else by peptide synthesis by means of, for example, automatic peptide synthesizers such as those supplied by the company Applied Biosystems, etc., or by nucleic acid synthesis and expression.
- a conjugate according to the present invention comprises IL22 and an antibody molecule which binds an antigen associated with angiogenesis, as described herein.
- the antibody molecule is preferably a diabody or an scFv, most preferably a diabody, as described herein.
- the IL22 is preferably human IL22.
- IL22 has at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, sequence identity to the amino acid sequence set forth in SEQ ID NO: 1.
- IL22 in conjugates of the invention retains a biological activity of human IL22, e.g. the ability to inhibit inflammation.
- the IL22 comprises or consist of the sequence set forth in SEQ ID NO: 11. The inventors expect that IL22 is glycosylated at the asparagine residues at positions 21 , 35 and 64 in SEQ ID NO:1 1.
- a conjugates of the present invention and in particular the IL22 present in a conjugate of the present invention, is not glycosylated.
- IL22 may comprise or consist of the sequence shown in SEQ ID NO: 11 , except that the residue at position 21 , and/or position 35, and/or position 64 of SEQ ID NO: 11 is a glutamine residue rather than an asparagine residue.
- the antibody molecule is connected to the IL22 through a linker, preferably an amino acid linker.
- the antibody molecule and IL22 may be connected directly, e.g. through a chemical bond.
- IL22 may be connected to one or more polypeptide chains in the antibody molecule by means of an amino acid linker, or connected directly to one or more polypeptide chains in the antibody molecule.
- the chemical bond may be, for example, a covalent or ionic bond. Examples of covalent bonds include peptide bonds (amide bonds) and disulphide bonds.
- the antibody molecule and IL22 may be covalently linked, for example by peptide bonds (amide bonds).
- the conjugate may be or comprise a fusion protein.
- fusion protein is meant a polypeptide that is a translation product resulting from the fusion of two or more genes or nucleic acid coding sequences into one open reading frame (ORF).
- ORF open reading frame
- the conjugate comprises a diabody
- the two scFv molecules making up the diabody may each be expressed as a fusion protein and then allowed to associate to form a dimer.
- the amino acid linker connecting the antibody molecule and IL22 may be a flexible amino acid linker. Suitable examples of amino acid linker sequences are known in the art.
- the linker may be 10-20 amino acids, preferably 10-15 amino acids in length. Most preferably, the linker is 11 -15 amino acids in length.
- the linker may have the sequence set forth in SEQ ID NO: 12.
- IL22 from mus musculus was conjugated via an amino acid linker to either the VH domains or the VL domains of two scFv molecules making up a diabody, as shown in SEQ ID NOs 23 and 24. Both conjugates were shown to be capable of specifically targeting neovasculature.
- the antibody molecule is, or comprises, an scFv
- IL22 may be linked to the N-terminus of the VH domain of the scFv via an amino acid linker or to the C-terminus of the VL domain of the scFv via an amino acid linker.
- the conjugate of the present invention may comprise or consist of the sequence shown in SEQ ID NO: 16 or 17.
- the conjugate may have at least 70%, more preferably one of at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, sequence identity to the amino acid sequence shown in SEQ ID NO: 16 or 17.
- the conjugate of the present invention may be deglycosylated. Methods for deglycosylating a polypeptide are known in the art and include treatment with Peptide-N-Glycosidase F (PNGase F). Nucleic acids
- nucleic acid molecules may comprise DNA and/or RNA and may be partially or wholly synthetic.
- Reference to a nucleotide sequence as set out herein encompasses a DNA molecule with the specified sequence, and encompasses a RNA molecule with the specified sequence in which U is substituted for T, unless context requires otherwise.
- Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator sequences, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
- Vectors may be plasmids e.g. phagemid, or viral e.g. 'phage, as appropriate.
- Sambrook & Russell 2001 Molecular Cloning: a Laboratory Manual: 3rd edition, Cold
- a recombinant host cell that comprises one or more constructs as described above is also provided.
- Suitable host cells include bacteria, mammalian cells, plant cells, filamentous fungi, yeast and baculovirus systems and transgenic plants and animals.
- a conjugate according to the present invention may be produced using such a recombinant host cell.
- the production method may comprise expressing a nucleic acid or construct as described above. Expression may conveniently be achieved by culturing the recombinant host cell under appropriate conditions for production of the conjugate. Following production the conjugate may be isolated and/or purified using any suitable technique, and then used as appropriate.
- the conjugate may be formulated into a composition including at least one additional component, such as a pharmaceutically acceptable excipient.
- Systems for cloning and expression of a polypeptide in a variety of different host cells are well known.
- the expression of antibodies, including conjugates thereof, in prokaryotic cells is well established in the art. For a review, see for example Pluckthun (1991 ),
- Bio/Technology 9: 545-551 A common bacterial host is E.coli. Expression in eukaryotic cells in culture is also available to those skilled in the art as an option for production of conjugates for example Chadd et al. (2001), Current Opinion in Biotechnology 12: 188-194); Andersen et al. (2002) Current Opinion in Biotechnology 13: 1 17; Larrick & Thomas (2001 ) Current Opinion in Biotechnology 12:411-418.
- Mammalian cell lines available in the art for expression of a heterologous polypeptide include Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney cells, NS0 mouse melanoma cells, YB2/0 rat myeloma cells, human embryonic kidney cells, human embryonic retina cells and many others.
- a method comprising introducing a nucleic acid or construct disclosed herein into a host cell is also described.
- the introduction may employ any available technique.
- suitable techniques may include calcium phosphate transfection, DEAE-Dextran, electroporation, liposome-mediated transfection and transduction using retrovirus or other virus, e.g. vaccinia or, for insect cells, baculovirus.
- Introducing nucleic acid in the host cell, in particular a eukaryotic cell may use a viral or a plasmid based system.
- the plasmid system may be maintained episomally or may be incorporated into the host cell or into an artificial chromosome.
- Incorporation may be either by random or targeted integration of one or more copies at single or multiple loci.
- suitable techniques may include calcium chloride transformation, electroporation and transfection using bacteriophage.
- the nucleic acid may or construct be integrated into the genome (e.g. chromosome) of the host cell. Integration may be promoted by inclusion of sequences that promote
- conjugates of the invention, antibodies for use in the invention, or nucleic acid encoding such conjugates will generally be in accordance with the present invention.
- conjugates of the present invention, antibodies for use in the invention, or nucleic acid encoding such conjugates may be provided in isolated and/or purified, e.g. from the environment in which they are prepared (such as cell culture), in substantially pure or homogeneous form, or, in the case of nucleic acid, free or substantially free of nucleic acid other than the sequence encoding a polypeptide with the required function.
- Isolated members and isolated nucleic acids will be free or substantially free of material with which they are found in the environment in which they are prepared (e.g.
- conjugates and nucleic acids may be formulated with diluents or adjuvants and still for practical purposes be isolated - for example the members may be mixed with pharmaceutically acceptable carriers or diluents when used in therapy.
- Specific conjugates may be glycosylated, either naturally or by systems of heterologous eukaryotic cells (e.g. CHO or NS0 (ECACC 85110503) cells, or they may be (for example if produced by expression in a prokaryotic cell) unglycosylated. Heterogeneous preparations of conjugates may also be used in the invention.
- such preparations may be mixtures of conjugates comprising antibody molecules with full- length heavy chains and heavy chains lacking the C-terminal lysine, with various degrees of glycosylation and/or with derivatized amino acids, such as cyclization of an N-terminal glutamic acid to form a pyroglutamic acid residue.
- Fibronectin is an antigen subject to alternative splicing, and a number of alternative isoforms of fibronectin are known, including alternatively spliced isoforms A-FN and B-FN, comprising domains ED-A or ED-B respectively, which are known markers of angiogenesis.
- An antibody molecule as referred to herein, may selectively bind to isoforms of fibronectin selectively expressed in the neovasculature.
- An antibody molecule may bind fibronectin isoform A-FN, e.g. it may bind domain ED-A (extra domain A).
- An antibody molecule may bind ED-B (extra domain B).
- Fibronectin Extra Domain-A (ED-A or ED-A) is also known as ED, extra type III repeat A (EIIIA) or EDI.
- the sequence of human ED-A has been published by Kornblihtt et al. (1984), Nucleic Acids Res. 12, 5853-5868 and Paolella et al . (1988), Nucleic Acids Res. 16, 3545- 3557.
- the sequence of human ED-A is also available on the SwissProt database as amino acids 1631 -1720 (Fibronectin type-Ill 12; extra domain 2) of the amino acid sequence deposited under accession number P02751.
- the sequence of mouse ED-A is available on the SwissProt database as amino acids 1721-1810 (Fibronectin type-Ill 13; extra domain 2) of the amino acid sequence deposited under accession number P1 1276.
- the ED-A isoform of fibronectin contains the Extra Domain-A (ED-A).
- the sequence of the human A-FN can be deduced from the corresponding human fibronectin precursor sequence which is available on the SwissProt database under accession number P02751.
- the sequence of the mouse A-FN can be deduced from the corresponding mouse fibronectin precursor sequence which is available on the SwissProt database under accession number P11276.
- the A-FN may be the human ED-A isoform of fibronectin.
- the ED-A may be the Extra Domain-A of human fibronectin.
- ED-A is a 90 amino acid sequence which is inserted into fibronectin (FN) by alternative splicing and is located between domain 11 and 12 of FN (Borsi et al. (1987), J. Cell. Biol., 104, 595-600). ED-A is mainly absent in the plasma form of FN but is abundant during angiogenesis, embryogenesis, tissue remodelling, fibrosis, cardiac transplantation and solid tumour growth.
- Fibronectin isoform B-FN is one of the best known markers angiogenesis (US 10/382,107, WO01/62298).
- An extra domain "ED-B" of 91 amino acids is found in the B-FN isoform and is identical in mouse, rat, rabbit, dog and man.
- B-FN accumulates around neovascular structures in aggressive tumours and other tissues undergoing angiogenesis, such as the endometrium in the proliferative phase and some ocular structures in pathological conditions, but is otherwise undetectable in normal adult tissues.
- Tenascin-C is a large hexameric glycoprotein of the extracellular matrix which modulates cellular adhesion. It is involved in processes such as cell proliferation and cell migration and is associated with changes in tissue architecture as occurring during morphogenesis and embryogenesis as well as under tumourigenesis or angiogenesis.
- Several isoforms of tenascin-C can be generated as a result of alternative splicing which may lead to the inclusion of (multiple) domains in the central part of this protein, ranging from domain Al to domain D (Borsi L et al Int J Cancer 1992; 52:688-692, Carnemolla B er a/. Eur J Biochem 992; 205:561-567, WO2006/050834).
- An antibody molecule as referred to herein, may bind tenascin-C.
- An antibody molecule may bind tenascin-C domain A1.
- An autoimmune disease is preferably associated with and/or characterised by angiogenesis.
- An autoimmune disease may be an autoimmune disease characterised by angiogenesis, wherein the neovasculature expresses the ED-A isoform of fibronectin, the ED-B isoform of fibronectin and/or tenascin C.
- the autoimmune disease may be an inflammatory
- autoimmune disease i.e. an autoimmune disease associated with and/or characterised by inflammation.
- the conjugate used in the treatment of an autoimmune disease, or delivery of IL22 to sites of autoimmune disease in a patient may be selected based on the expression of the ED-A isoform of fibronectin, ED-B isoform of fibronectin and/or tenascin C in said autoimmune disease.
- the autoimmune disease may be selected from the group consisting of:
- IBD inflammatory bowel disease
- RA rheumatoid arthritis
- MS multiple sclerosis
- endometriosis autoimmune diabetes (such as diabetes mellitus type 1), psoriasis, psoriatic arthritis, and periodontitis.
- the autoimmune disease is IBD.
- IBD is a group of inflammatory conditions that affect the colon and small intestine.
- the major types of IBD are Crohn's disease (CD) and ulcerative colitis (UC), while other types of IBD include collagenous colitis, lymphocytic colitis, ischaemic colitis, diversion colitis, Behcet's disease and indeterminate colitis.
- CD can affect any part of the gastrointestinal tract, whereas UC is typically restricted to the colon and rectum.
- IBD as referred to herein, may be CD, UC, collagenous colitis, lymphocytic colitis, ischaemic colitis, diversion colitis, Behcet's disease or indeterminate colitis.
- CD, UC collagenous colitis, lymphocytic colitis, ischaemic colitis, diversion colitis, Behcet's disease and indeterminate colitis
- IBD may be CD or UC. Inflammatory Diseases and/or Disorders
- Inflammatory disease and/or disorder refers to disease and/or disorders which are accompanied and/or characterised by inflammation.
- An inflammatory disease and/or disorder is preferably associated with and/or characterised by angiogenesis.
- inflammatory disease and/or disorder may be an inflammatory disease and/or disorder characterised by angiogenesis, wherein the neovasculature expresses the ED-A isoform of fibronectin, the ED-B isoform of fibronectin and/or tenascin C.
- the conjugate used in the treatment of an inflammatory disease and/or disorder, or delivery of IL22 to sites of an inflammatory disease and/or disorder in a patient may be selected based on the expression of the ED-A isoform of fibronectin, ED-B isoform of fibronectin and/or tenascin C in said inflammatory disease and/or disorder.
- the inflammatory disease and/or disorder may be selected from the group consisting of: graft versus host disease; wound healing; and ulcers, in particular diabetic foot ulcers.
- conjugates of the invention will have anti-inflammatory activity and thus find application in the treatment of inflammation and/or autoimmune diseases. Without being limited by any theoretical explanation, it is expected that the conjugates of the invention will show potent anti-inflammatory activity as a result of excellent targeting of neovasculature, as demonstrated in the examples.
- the conjugates of the present invention are thus designed to be used in methods of treatment of patients, preferably human patients.
- the invention provides methods of treatment comprising administration of a conjugate according to the present invention, pharmaceutical compositions comprising such conjugates, and use of such a conjugates in the manufacture of a medicament for administration, for example in a method of making a medicament or pharmaceutical composition comprising formulating the conjugate with a pharmaceutically acceptable excipient.
- Pharmaceutically acceptable vehicles are well known and will be adapted by the person skilled in the art as a function of the nature and of the mode of administration of the active compound(s) chosen.
- Conjugates according to the present invention will usually be administered in the form of a pharmaceutical composition, which may comprise at least one component in addition to the antibody molecule.
- compositions described herein, and for use in accordance with the present invention may comprise, in addition to active ingredient, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
- a pharmaceutically acceptable excipient such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
- the precise nature of the carrier or other material will depend on the route of administration, which may be by injection, e.g.
- the conjugate of the present invention is administered intravenously.
- Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil.
- a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil.
- Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
- the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- Suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection. Preservatives, stabilizers, buffers, antioxidants and/or other additives may be employed, as required.
- Many methods for the preparation of pharmaceutical formulations are known to those skilled in the art. See e.g. Robinson ed., Sustained and Controlled Release Drug Delivery Systems, Marcel Dekker, Inc., New York, 1978.
- a conjugate of the invention may be used in combination with an existing therapeutic agent for inflammation and/or an autoimmune disease.
- a conjugate according to the invention may be used in the manufacture of a medicament.
- the medicament may be for separate or combined administration to an individual, and accordingly may comprise the conjugate and the additional component as a combined preparation or as separate preparations. Separate preparations may be used to facilitate separate and sequential or simultaneous administration, and allow administration of the components by different routes.
- compositions provided may be administered to mammals, preferably humans. Administration may be in a "therapeutically effective amount", this being sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom.
- treatment of a specified disease refers to amelioration of at least one symptom.
- the actual amount administered, and rate and time- course of administration will depend on the nature and severity of what is being treated, the particular patient being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the composition, the type of conjugate, the method of administration, the scheduling of administration and other factors known to medical practitioners. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and may depend on the severity of the symptoms and/or progression of a disease being treated. Appropriate doses of antibody are well known in the art (Ledermann et al. (1991 ) Int. J. Cancer 47: 659-664; and Bagshawe et al.
- a therapeutically effective amount or suitable dose of a conjugate for use in the invention can be determined by comparing its in vitro activity and in vivo activity in an animal model. Methods for extrapolation of effective dosages in mice and other test animals to humans are known. The precise dose will depend upon a number of factors, including whether the antibody is for diagnosis, prevention or for treatment, the size and location of the area to be treated, the precise nature of the conjugate. A typical conjugate dose will be in the range 100 pg to 1 g for systemic applications.
- An initial higher loading dose, followed by one or more lower doses, may be administered.
- This is a dose for a single treatment of an adult patient, which may be proportionally adjusted for children and infants, and also adjusted according to conjugate format in proportion to molecular weight.
- Treatments may be repeated at daily, twice-weekly, weekly or monthly intervals, at the discretion of the physician.
- Treatments may be every two to four weeks for subcutaneous administration and every four to eight weeks for intravenous administration.
- treatment is periodic, and the period between administrations is about two weeks or more, e.g. about three weeks or more, about four weeks or more, or about once a month.
- treatment may be given before, and/or after surgery, and may be administered or applied directly at the anatomical site of surgical treatment.
- the genes encoding the antibody fusion proteins comprising mulL22 (from mus musculus) and anti-ED-A antibody F8 were generated using PCR assembly.
- the sequence encoding IL22 (lacking the signal peptide sequence) was linked via a sequence encoding a 15 amino acid glycine-serine-linker [(G 4 S)3] either to the C-terminus (F8-IL22) or the N-terminus (IL22- F8) of the gene encoding the F8 antibody in diabody format (heavy chain and light connected via a GGSGG-linker).
- a sequence encoding an IgG-derived signal peptide was added at the N-terminus to enable high yield production of the encoded fusion proteins.
- FIG. 1 A schematic illustration of the gene assembly is shown in Figure 1.
- the sequences of the genes used to encode the mulL22-F8 and F8-mulL22 fusion proteins are shown in SEQ ID NOs: 21 and 22, respectively, while the amino acid sequences of the mature mull_22-F8 and F8-mulL22 fusion proteins employed in the experiments reported below are shown in SEQ ID NOs: 23 and 24, respectively.
- the signal peptides are cleaved after expression of the fusion proteins and thus are not part of the mature fusion proteins.
- the signal peptides encoded by the nucleic acid sequences shown in SEQ ID NOs 14 and 15 are cleaved after expression of the fusion proteins and thus will not be part of the mature fusion proteins.
- Fusion proteins comprising mulL22 were expressed transiently in CHO-S cells via PEI mediated transfection. 500 x 10 6 cells were resuspended in 250 ml_ of pre-warmed ProCHO- 2 medium (supplemented with 10% FBS, 2% HT supplement, 4% Ultraglutamine, 1 % antibiotics-antimycotics solution). 625 pg of plasmid containing the gene encoding the fusion protein was diluted with a sterile 150 mM solution of NaCI to reach a total volume of 12.5 ml.
- sterile PEI solution polyethylenimine, 1 g/L linear, MW 25 ⁇ 00
- filtered water 10 ml sterile 150 mM NaCI.
- the PEI mixture was added to the plasmid mixture and incubated for 10 minutes at room temperature. After the required incubation time, the mixture was added to the prepared cells and the cells were placed on a 37°C shaker at 160 rpm for 4 hours. After 4 hours 250 mL of prewarmed PowerCHO-2 medium (supplemented with 10% FBS, 2% HT supplement, 4% Ultraglutamine, 1 % antibiotics- antimycotics solution) was added and the cells were placed on a 31 °C shaker at 140 rpm for 6 days. This was followed by purification of the fusion protein. The same methodology could be employed to express fusion proteins comprising hulL22. Purification of fusion proteins using protein A resin
- the protein A column was washed with 400 mL of "wash A” (100 mM NaCI (Sodium chloride for analysis, EmsureTM, 7547-14-5), 0.5 mM EDTA pH 8.0 (kindly provided by Franziska Bootz), 0.1 % Tween 20 (Polyoxyethylenesorbitan monolaurate, Sigma-AldrichTM, #SZBA3190V) in PBS) until the optical density of the wash as determined with a spectrophotometer (NanoDrop 2000c, witec ag, OD280nm) was below 0.1 and then washed with 400 mL of "wash B” (100 mM NaCI 0.5 mM EDTA in PBS) until the optical density at 280nm of the wash as determined with the spectrophotometer NanoDrop was below 0.05.
- wash A 100 mM NaCI (Sodium chloride for analysis, EmsureTM, 7547-14-5), 0.5 mM EDTA pH 8.0 (kindly provided by Franziska Bootz
- the fusion protein comprising mulL22 was eluted by gravity flow with 10 mL of 0.1 M glycine (pH3, FlukaTM, #BCBB2819). The fractions were collected as 1 mL aliquots in 1.5 mL Eppendorf tubes and immediately put on ice. Fractions containing the fusion protein, as confirmed by UV spectrometry, were pooled, transferred into a dialysis membrane (Spectra/PorTM Dialysis Membrane, MWCO 12 ⁇ 00-14 ⁇ 00, Spectrum laboratories) and dialysed overnight in 3-4 L of PBS.
- a dialysis membrane Spectra/PorTM Dialysis Membrane, MWCO 12 ⁇ 00-14 ⁇ 00, Spectrum laboratories
- fusion protein solution was transferred to an Eppendorf tube and stored at 4°C for 1-2 days for further analysis or snap frozen in liquid nitrogen and transferred to a -80°C freezer.
- the same method could be used to purify fusion proteins comprising hulL22.
- Deglycosylation of fusion proteins comprising mulL22 was performed using Peptide-N- Glycosidase F (PNGase F, NEB P0704S) to remove complex oligosaccharides from N- linked glycoproteins.
- PNGase F Peptide-N- Glycosidase F
- NEB P0704S Peptide-N- Glycosidase F
- 15 ⁇ g of fusion protein were incubated with 10x Glycoprotein Denaturing Buffer (NEB) in a total volume of 30 ⁇ for 10 minutes at 99°C.
- the denatured fusion protein was mixed with 6 ⁇ 10x Glycobuffer 2 (NEB), 6 ⁇ of 10 % NP-40 and deionized water in a total volume of 60 ⁇ .
- Size exclusion chromatography of fusion proteins was performed using a superdex 200 5/150 column (GE healthcare) with phosphate buffered saline as running buffer on a AKTA- FPLC system (GE healthcare). 100 ⁇ protein solutions were injected into a loop and automatically injected onto the column. UV absorbance at 280 nm was assessed over time.
- mull_22 in the mulL22 containing fusion proteins was verified by STAT3 phosphorylation in HT29cells. Cells were incubated with the fusion proteins and
- HT29 cells were seeded with a density of 0.1 x 10 6 cells per well in 300 ⁇ of McCoy's medium (GIBCO, supplemented with 10% FBS and 1 % antibiotics-antimycotics solution) in a sterile 96 well plate. When cells were attached to the flask, the medium was replaced by serum-free medium and cells were incubated over night at 37°C. The following day, mulL22 fusion proteins were added in a ten-fold serial dilution and starting with a concentration of 5 Mg/ml as shown in Figure 4.
- the membrane was blocked in 4 % milk PBS for 1 h at 25°C.
- the secondary antibody a-mouse-horseradish peroxidase (Invitrogen) was added to the membrane at a dilution of 1 :1000 in 2% milk PBS and incubated for 1 hour at 25°C on a shaker. After incubation with the secondary antibody, a washing procedure was performed with PBS + 0.1 % Tween for 5 minutes two times and afterwards two times with PBS for 5 minutes. For signal detection, the membrane was covered with ECL reagent (Amersham Prime, GE healthcare) and exposed to a film and then developed. The activity of hulL22 in fusion proteins comprising hulL22 could be determined in the same way.
- the in vivo targeting performance of fusion proteins comprising mulL22 was assessed by quantitative biodistribution studies in F9 tumour bearing mice. Proteins were labelled with 25 l using the lodogen method. 15 g of radioiodinated fusion protein was injected intra venously (i.v.) into the lateral tail vein. Mice were sacrificed 24 h after injection, organs were excised, weighed and radioactivity was measured using a Packard Cobra ⁇ counter. Radioactivity of organs was expressed as percentage of injected dose per gram of tissue (%ID/g ⁇ SEM). The same approach could be used to determine the in vivo targeting performance of fusion proteins comprising hulL22.
- the purified fusion proteins exhibited favourable biochemical properties as confirmed using (1 ) SDS-PAGE and (2) size exclusion chromatography.
- SDS-PAGE analysis using coomassie staining revealed broad protein bands slightly higher than the estimated 44kDa ( Figure 2A and B). This shift was caused by the presence of N-linked glycans, which could be removed using PNGase F, leading to a band shift to the expected size for the fusion proteins ( Figure 2A and B).
- Size exclusion chromatography analysis using a Superdex S200 5/150 column further confirmed the homogeneity of the conjugate preparations ( Figure 2C and D).
- the mull_22 also retained its biological activity after fusion with the F8 antibody in the mull_22-F8 and F8-mulL22 fusion proteins, as determined using western blot analysis on of phosphorylated STAT3 in HT29 cells after induction using the mull_22 fusion proteins
- Amino acid sequence of the F8 diabody (SEQ ID NO: 10) EVQLLESGGGLVQPGGSLRLSCAASGFTFSLFTMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSTHLYLFDYWGQGTLVTVSSGGSGGEIVLTQSPGT LSLSPGERATLSCRASQSVSMPFLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISR LEPEDFAVYYCQQMRGRPPTFGQGT VEIK
- the below sequence shows (in order) the sequence encoding: (i) hulL22 [underlined], (ii) a 15 amino acid linker [bold]; (iii) the F8 VH domain [itallics]; (iv) a 5 amino acid linker [bold and underlined]; (v) the F8 VL domain; and (vi) the stop codon [bold] hulL22 - 15AA Linker - F8VH - 5AA Linker - F8V L
- the below sequence shows (in order) the sequence encoding: (i) the F8 VH domain [itallics]; (ii) a 5 amino acid linker [bold and underlined]; (iii) the F8 VL domain; (iv) a 15 amino acid linker [bold]; hulL22 [underlined]; and (vi) the stop codon [bold]
- the below sequence shows (in order) the amino acid sequence of: (i) hulL22 [underlined], (ii) a 15 amino acid linker [bold]; (iii) the F8 VH domain [itallics]; (iv) a 5 amino acid linker [bold and underlined]; and (v) the F8 VL domain.
- the below sequence shows (in order) the amino acid sequence of: (i) the F8 VH domain [itallics]; (ii) a 5 amino acid linker [bold and underlined]; (iii) the F8 VL domain; (iv) a 15 amino acid linker [bold]; and hulL22 [underlined].
- Amino acid sequence of mus musculus IL22 (mull_22) (SEQ ID NO: 18)
- the below sequence shows (in order) the sequence encoding: (i) mulL22 [underlined], (ii) a 15 amino acid linker [bold]; (iii) the F8 VH domain [itallics]; (iv) a 5 amino acid linker [bold and underlined]; (v) the F8 VL domain; and (vi) the stop codon [bold]
- the below sequence shows (in order) the sequence encoding: (i) the F8 VH domain [itallics]; (ii) a 5 amino acid linker [bold and underlined]; (iii) the F8 VL domain; (iv) a 15 amino acid linker [bold]; mulL22 [underlined]; and (vi) the stop codon [bold]
- the below sequence shows (in order) the amino acid sequence of: (i) mulL22 [underlined], (ii) a 15 amino acid linker [bold]; (iii) the F8 VH domain [itallics]; (iv) a 5 amino acid linker [bold and underlined]; and (v) the F8 VL domain.
- the below sequence shows (in order) the amino acid sequence of: (i) the F8 VH domain [itallics]; (ii) a 5 amino acid linker [bold and underlined]; (iii) the F8 VL domain; (iv) a 15 amino acid linker [bold]; and mull_22 [underlined].
- Glu lie Val Leu Thr Gin Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gin Ser Val Ser Ser Ser Phe Leu Ala Trp Tyr Gin Gin Lys Pro Gly Gin Ala Pro Arg Leu Leu He Tyr Tyr Ala Ser Ser Arg Ala Thr Gly He Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr lie Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gin Gin Thr Gly Arg lie Pro Pro Thr Phe Gly Gin Gly Thr Lys Val Glu lie Lys
- VH and VL domain linker sequence is shown underlined
- F16 CDR3 VL - NSSVYTMPPW (SEQ ID NO: 39) Amino acid sequence F16 VH domain (SEQ ID NO: 40)
- VH and VL domain linker sequence is shown underlined
- VH and VL domain linker sequence in an scFv molecule (SEQ ID NO: 43)
- Schliemann C Palumbo A, Zuberbuhler K, « Villa A, Kaspar M, Trachsel E, et al. Complete eradication of human B-cell lymphoma xenografts using rituximab in combination with the immunocytokine L19- IL2. Blood. 2009;1 13:2275-83.
- Schliemann C Wiedmer A, Pedretti M, Szczepanowski M, Klapper W, Neri D, Three clinical-stage tumor targeting antibodies reveal differential expression of oncofetal fibronectin and tenascin-C isoforms in human lymphoma. Leuk Res. 2009;33:1718-22.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Cell Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Diabetes (AREA)
- Rheumatology (AREA)
- Cardiology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Dermatology (AREA)
- Pain & Pain Management (AREA)
- Emergency Medicine (AREA)
- Heart & Thoracic Surgery (AREA)
- Vascular Medicine (AREA)
- Physical Education & Sports Medicine (AREA)
Priority Applications (17)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2016293114A AU2016293114A1 (en) | 2015-07-16 | 2016-07-15 | IL22 immunoconjugates |
| BR112018000909A BR112018000909A2 (pt) | 2015-07-16 | 2016-07-15 | imunoconjugados de il22 |
| EP16739166.3A EP3322719B1 (en) | 2015-07-16 | 2016-07-15 | Il22 immunoconjugates |
| KR1020187004633A KR20180030180A (ko) | 2015-07-16 | 2016-07-15 | Il22 면역컨쥬게이트 |
| JP2018521710A JP6735822B2 (ja) | 2015-07-16 | 2016-07-15 | Il22免疫コンジュゲート |
| RU2018105687A RU2018105687A (ru) | 2015-07-16 | 2016-07-15 | Иммуноконъюгаты на основе il22 |
| HK18109660.0A HK1250237A1 (zh) | 2015-07-16 | 2016-07-15 | Il22免疫缀合物 |
| MX2018000687A MX2018000687A (es) | 2015-07-16 | 2016-07-15 | Inmunoconjugados de il22. |
| CR20180087A CR20180087A (es) | 2015-07-16 | 2016-07-15 | Inmunoconjugados de il22 |
| ES16739166T ES2778430T3 (es) | 2015-07-16 | 2016-07-15 | Inmunoconjugados de IL22 |
| CN201680041884.2A CN108137667A (zh) | 2015-07-16 | 2016-07-15 | Il22免疫缀合物 |
| CA2992366A CA2992366A1 (en) | 2015-07-16 | 2016-07-15 | Il22 immunoconjugates |
| US15/608,689 US10246502B2 (en) | 2015-07-16 | 2017-05-30 | IL22 immunoconjugates |
| IL256849A IL256849A (en) | 2015-07-16 | 2018-01-11 | Il22 immunoconjugates |
| PH12018500131A PH12018500131A1 (en) | 2015-07-16 | 2018-01-16 | Il22 immunoconjugates |
| CONC2018/0000414A CO2018000414A2 (es) | 2015-07-16 | 2018-01-17 | Inmunoconjugados de il22 |
| US16/280,427 US10858411B2 (en) | 2015-07-16 | 2019-02-20 | IL22 immunoconjugates |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB1512486.0A GB201512486D0 (en) | 2015-07-16 | 2015-07-16 | IL22 immunoconjugates |
| GB1512486.0 | 2015-07-16 | ||
| GBGB1517649.8A GB201517649D0 (en) | 2015-10-06 | 2015-10-06 | IL22 Immunoconjugates |
| GB1517649.8 | 2015-10-06 | ||
| GBGB1521470.3A GB201521470D0 (en) | 2015-12-04 | 2015-12-04 | IL22 immunoconjugates |
| GB1521470.3 | 2015-12-04 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/608,689 Continuation US10246502B2 (en) | 2015-07-16 | 2017-05-30 | IL22 immunoconjugates |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017009469A1 true WO2017009469A1 (en) | 2017-01-19 |
Family
ID=56413683
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/066979 Ceased WO2017009469A1 (en) | 2015-07-16 | 2016-07-15 | Il22 immunoconjugates |
Country Status (21)
| Country | Link |
|---|---|
| US (2) | US10246502B2 (https=) |
| EP (1) | EP3322719B1 (https=) |
| JP (1) | JP6735822B2 (https=) |
| KR (1) | KR20180030180A (https=) |
| CN (1) | CN108137667A (https=) |
| AU (1) | AU2016293114A1 (https=) |
| BR (1) | BR112018000909A2 (https=) |
| CA (1) | CA2992366A1 (https=) |
| CL (1) | CL2018000131A1 (https=) |
| CO (1) | CO2018000414A2 (https=) |
| CR (1) | CR20180087A (https=) |
| DO (1) | DOP2018000019A (https=) |
| EC (1) | ECSP18010616A (https=) |
| ES (1) | ES2778430T3 (https=) |
| HK (1) | HK1250237A1 (https=) |
| IL (1) | IL256849A (https=) |
| MX (1) | MX2018000687A (https=) |
| PE (1) | PE20180797A1 (https=) |
| PH (1) | PH12018500131A1 (https=) |
| RU (1) | RU2018105687A (https=) |
| WO (1) | WO2017009469A1 (https=) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020249757A1 (en) | 2019-06-14 | 2020-12-17 | Philogen S.P.A | Immunoconjugates comprising a single chain diabody and interleukin-15 or interleukin-15 and a sushi domain of interleukin-15 receptor alpha |
| WO2022018126A1 (en) | 2020-07-22 | 2022-01-27 | Philogen S.P.A. | Treatment of pulmonary hypertension |
| WO2022073038A1 (en) * | 2020-10-02 | 2022-04-07 | Abbvie Inc. | Interleukin-22 (il-22) fusion proteins and uses thereof |
| WO2023175077A1 (en) | 2022-03-17 | 2023-09-21 | Philogen S.P.A | Anti-ed-a antibodies for the treatment of pulmonary hypertension |
| WO2026003203A1 (en) | 2024-06-27 | 2026-01-02 | Philogen S.P.A. | Combination of an immunocytokine comprising targeted il2 and a jak inhibitor |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20200123118A (ko) * | 2018-02-21 | 2020-10-28 | 제넨테크, 인크. | IL-22 Fc 융합 단백질로 치료를 위한 투약 |
| TW202221019A (zh) * | 2020-07-30 | 2022-06-01 | 美商安維塔生物科學股份有限公司 | 介白素-22融合蛋白及其藥物組合物及治療應用 |
| CN115703841A (zh) * | 2021-08-10 | 2023-02-17 | 复旦大学 | 白介素17a抗体与白介素22细胞因子融合蛋白及其制备方法与用途 |
| WO2025101842A1 (en) * | 2023-11-09 | 2025-05-15 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for targeted delivery of therapeutic agents |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014145016A2 (en) * | 2013-03-15 | 2014-09-18 | Genentech, Inc. | Il-22 polypeptides and il-22 fc fusion proteins and methods of use |
| WO2014173570A1 (en) * | 2013-04-26 | 2014-10-30 | Philogen S.P.A. | Il4 conjugated to antibodies against extracellular matrix components |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1702069A2 (en) | 2004-01-05 | 2006-09-20 | EMD Lexigen Research Center Corp. | Interleukin-12 targeted to oncofoetal fibronectin |
| ES2388068T3 (es) | 2004-12-23 | 2012-10-08 | Molmed Spa | Producto de conjugación |
| CA2593648A1 (en) * | 2005-01-10 | 2006-07-13 | Research Development Foundation | Targeted chimeric molecules for cancer therapy |
| CA2607954A1 (en) | 2005-05-11 | 2006-11-16 | Philogen S.P.A. | Conjugate for targeting of drug |
| WO2008120101A2 (en) | 2007-04-02 | 2008-10-09 | Philogen S.P.A. | The ed-a antigen of fibrinogen is associated with the neovasculature of tumour metastases |
| EP2167541B1 (en) | 2007-07-25 | 2012-12-19 | Philogen S.p.A. | The ed-a antigen of fibronectin is associated with the neovasculature of tumour metastases |
| DK3281952T3 (da) | 2007-10-30 | 2020-08-03 | Philogen Spa | Antigen, der er forbundet med reumatoid artritis |
| AU2011205531B2 (en) | 2010-01-13 | 2013-10-10 | Amgen Inc. | IL-22-Fc and hepcidin activity |
| AR081246A1 (es) * | 2010-05-14 | 2012-07-18 | Abbott Lab | Proteinas de union a il-1 |
| CN104623639A (zh) * | 2013-11-07 | 2015-05-20 | 健能隆医药技术(上海)有限公司 | 白介素22二聚体在制备治疗胰腺炎药物中的应用 |
-
2016
- 2016-07-15 CR CR20180087A patent/CR20180087A/es unknown
- 2016-07-15 JP JP2018521710A patent/JP6735822B2/ja not_active Expired - Fee Related
- 2016-07-15 ES ES16739166T patent/ES2778430T3/es active Active
- 2016-07-15 AU AU2016293114A patent/AU2016293114A1/en not_active Abandoned
- 2016-07-15 PE PE2018000073A patent/PE20180797A1/es unknown
- 2016-07-15 CN CN201680041884.2A patent/CN108137667A/zh active Pending
- 2016-07-15 CA CA2992366A patent/CA2992366A1/en not_active Abandoned
- 2016-07-15 WO PCT/EP2016/066979 patent/WO2017009469A1/en not_active Ceased
- 2016-07-15 BR BR112018000909A patent/BR112018000909A2/pt not_active Application Discontinuation
- 2016-07-15 MX MX2018000687A patent/MX2018000687A/es unknown
- 2016-07-15 KR KR1020187004633A patent/KR20180030180A/ko not_active Withdrawn
- 2016-07-15 HK HK18109660.0A patent/HK1250237A1/zh unknown
- 2016-07-15 RU RU2018105687A patent/RU2018105687A/ru not_active Application Discontinuation
- 2016-07-15 EP EP16739166.3A patent/EP3322719B1/en active Active
-
2017
- 2017-05-30 US US15/608,689 patent/US10246502B2/en not_active Expired - Fee Related
-
2018
- 2018-01-11 IL IL256849A patent/IL256849A/en unknown
- 2018-01-15 CL CL2018000131A patent/CL2018000131A1/es unknown
- 2018-01-15 DO DO2018000019A patent/DOP2018000019A/es unknown
- 2018-01-16 PH PH12018500131A patent/PH12018500131A1/en unknown
- 2018-01-17 CO CONC2018/0000414A patent/CO2018000414A2/es unknown
- 2018-02-09 EC ECIEPI201810616A patent/ECSP18010616A/es unknown
-
2019
- 2019-02-20 US US16/280,427 patent/US10858411B2/en not_active Expired - Fee Related
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014145016A2 (en) * | 2013-03-15 | 2014-09-18 | Genentech, Inc. | Il-22 polypeptides and il-22 fc fusion proteins and methods of use |
| WO2014173570A1 (en) * | 2013-04-26 | 2014-10-30 | Philogen S.P.A. | Il4 conjugated to antibodies against extracellular matrix components |
Non-Patent Citations (8)
| Title |
|---|
| C. HESS ET AL: "Tumor-targeting properties of novel immunocytokines based on murine IL1 and IL6", PROTEIN ENGINEERING, DESIGN AND SELECTION, vol. 27, no. 6, 2 May 2014 (2014-05-02), GB, pages 207 - 213, XP055307661, ISSN: 1741-0126, DOI: 10.1093/protein/gzu013 * |
| FRANZISKA BOOTZ ET AL: "Alternatively Spliced EDA Domain of Fibronectin Is a Target for Pharmacodelivery Applications in Inflammatory Bowel Disease", INFLAMMATORY BOWEL DISEASES, vol. 21, no. 8, 19 May 2015 (2015-05-19), US, pages 1908 - 1917, XP009191937, ISSN: 1078-0998, DOI: 10.1097/MIB.0000000000000440 * |
| FRANZISKA BOOTZ ET AL: "Antibody-Based Targeted Delivery of Interleukin-22 Promotes Rapid Clinical Recovery in Mice With DSS-Induced Colitis", INFLAMMATORY BOWEL DISEASES, vol. 22, no. 9, 2 August 2016 (2016-08-02), US, pages 2098 - 2105, XP055307423, ISSN: 1078-0998, DOI: 10.1097/MIB.0000000000000851 * |
| FRANZISKA BOOTZ: "ANTIBODY-BASED PHARMACODELIVERY OF IMMUNOMODULATORS FOR THE TREATMENT OF ULCERATIVE COLITIS", 1 January 2016 (2016-01-01), XP055307428, Retrieved from the Internet <URL:http://e-collection.library.ethz.ch/eserv/eth:49100/eth-49100-01.pdf> [retrieved on 20161004] * |
| HEMMERLE TERESA ET AL: "Antibody-mediated delivery of interleukin 4 to the neo-vasculature reduces chronic skin inflammation", JOURNAL OF DERMATOLOGICAL SCIENCE, ELSEVIER SCIENCE PUBLISHERS, SHANNON, IE, vol. 76, no. 2, 15 August 2014 (2014-08-15), pages 96 - 103, XP029074445, ISSN: 0923-1811, DOI: 10.1016/J.JDERMSCI.2014.07.012 * |
| HESS CHRISTIAN ET AL: "The antibody-mediated targeted delivery of interleukin-13 to syngeneic murine tumors mediates a potent anticancer activity", CANCER IMMUNOLOGY, IMMUNOTHERAPY, SPRINGER, vol. 64, no. 5, 27 February 2015 (2015-02-27), pages 635 - 644, XP035485748, ISSN: 0340-7004, [retrieved on 20150227], DOI: 10.1007/S00262-015-1666-8 * |
| KEN SUGIMOTO ET AL: "IL-22 ameliorates intestinal inflammation in a mouse model of ulcerative colitis", JOURNAL OF CLINICAL INVESTIGATION, 1 February 2008 (2008-02-01), US, XP055307663, ISSN: 0021-9738, DOI: 10.1172/JCI33194 * |
| TERESA HEMMERLE ET AL: "The antibody-based targeted delivery of interleukin-4 and 12 to the tumor neovasculature eradicates tumors in three mouse models of cancer", INTERNATIONAL JOURNAL OF CANCER, vol. 134, no. 2, 2 July 2013 (2013-07-02), pages 467 - 477, XP055121200, ISSN: 0020-7136, DOI: 10.1002/ijc.28359 * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020249757A1 (en) | 2019-06-14 | 2020-12-17 | Philogen S.P.A | Immunoconjugates comprising a single chain diabody and interleukin-15 or interleukin-15 and a sushi domain of interleukin-15 receptor alpha |
| WO2022018126A1 (en) | 2020-07-22 | 2022-01-27 | Philogen S.P.A. | Treatment of pulmonary hypertension |
| WO2022073038A1 (en) * | 2020-10-02 | 2022-04-07 | Abbvie Inc. | Interleukin-22 (il-22) fusion proteins and uses thereof |
| WO2023175077A1 (en) | 2022-03-17 | 2023-09-21 | Philogen S.P.A | Anti-ed-a antibodies for the treatment of pulmonary hypertension |
| WO2026003203A1 (en) | 2024-06-27 | 2026-01-02 | Philogen S.P.A. | Combination of an immunocytokine comprising targeted il2 and a jak inhibitor |
Also Published As
| Publication number | Publication date |
|---|---|
| RU2018105687A (ru) | 2019-08-16 |
| PH12018500131A1 (en) | 2018-07-23 |
| CO2018000414A2 (es) | 2018-04-10 |
| CR20180087A (es) | 2018-05-14 |
| US10246502B2 (en) | 2019-04-02 |
| MX2018000687A (es) | 2018-08-01 |
| US20190169250A1 (en) | 2019-06-06 |
| US10858411B2 (en) | 2020-12-08 |
| DOP2018000019A (es) | 2018-10-15 |
| ECSP18010616A (es) | 2018-04-30 |
| BR112018000909A2 (pt) | 2018-09-11 |
| US20170305989A1 (en) | 2017-10-26 |
| EP3322719A1 (en) | 2018-05-23 |
| JP2018525032A (ja) | 2018-09-06 |
| EP3322719B1 (en) | 2019-12-18 |
| JP6735822B2 (ja) | 2020-08-05 |
| CA2992366A1 (en) | 2017-01-19 |
| CL2018000131A1 (es) | 2018-06-01 |
| HK1250237A1 (zh) | 2018-12-07 |
| KR20180030180A (ko) | 2018-03-21 |
| PE20180797A1 (es) | 2018-05-09 |
| IL256849A (en) | 2018-03-29 |
| CN108137667A (zh) | 2018-06-08 |
| ES2778430T3 (es) | 2020-08-10 |
| AU2016293114A1 (en) | 2018-02-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11274133B2 (en) | IL2 and TNF immunoconjugates | |
| US10858411B2 (en) | IL22 immunoconjugates | |
| CA3043146C (en) | Il2 and tnf mutant immunoconjugates | |
| EP3728324B1 (en) | Antibodies to tumour antigens | |
| US20160200789A1 (en) | Il4 conjugated to antibodies against extracellular matrix components | |
| US20200270322A1 (en) | Novel interleukin 4 immunoconjugates | |
| WO2020249757A1 (en) | Immunoconjugates comprising a single chain diabody and interleukin-15 or interleukin-15 and a sushi domain of interleukin-15 receptor alpha | |
| HK40051742A (en) | Immunoconjugates comprising il-2, anti-fibronectin antibody and mutant tnf-alpha |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16739166 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 256849 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2992366 Country of ref document: CA Ref document number: 2018521710 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 000073-2018 Country of ref document: PE Ref document number: 11201800372R Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12018500131 Country of ref document: PH Ref document number: MX/A/2018/000687 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2018/0000414 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 2016293114 Country of ref document: AU Date of ref document: 20160715 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: CR2018-000087 Country of ref document: CR |
|
| ENP | Entry into the national phase |
Ref document number: 20187004633 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201801493 Country of ref document: UA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2018105687 Country of ref document: RU Ref document number: 2016739166 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018000909 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112018000909 Country of ref document: BR Kind code of ref document: A2 Effective date: 20180116 |