WO2016090038A1 - Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof - Google Patents

Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof Download PDF

Info

Publication number
WO2016090038A1
WO2016090038A1 PCT/US2015/063510 US2015063510W WO2016090038A1 WO 2016090038 A1 WO2016090038 A1 WO 2016090038A1 US 2015063510 W US2015063510 W US 2015063510W WO 2016090038 A1 WO2016090038 A1 WO 2016090038A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
antibiotic
seq
conjugate compound
chain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/063510
Other languages
English (en)
French (fr)
Inventor
Eric Brown
Wouter HAZENBOS
Isidro Hotzel
Kimberly Kajihara
Sophie M. Lehar
Sanjeev Mariathasan
Thomas Pillow
Leanna STABEN
Vishal Verma
Binqing Wei
Min Xu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
F Hoffmann La Roche AG
Genentech Inc
Original Assignee
F Hoffmann La Roche AG
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to HK18103430.2A priority Critical patent/HK1243931A1/zh
Priority to CN201580075298.5A priority patent/CN107206102A/zh
Priority to MX2017007055A priority patent/MX2017007055A/es
Priority to BR112017011325-2A priority patent/BR112017011325A2/pt
Priority to CA2965540A priority patent/CA2965540A1/en
Priority to RU2017118793A priority patent/RU2731055C2/ru
Priority to JP2017528894A priority patent/JP6742314B2/ja
Priority to KR1020177014576A priority patent/KR20170086536A/ko
Priority to EP15820347.1A priority patent/EP3226911A1/en
Application filed by F Hoffmann La Roche AG, Genentech Inc filed Critical F Hoffmann La Roche AG
Publication of WO2016090038A1 publication Critical patent/WO2016090038A1/en
Priority to US15/611,985 priority patent/US20180021450A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6807Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
    • A61K47/6809Antibiotics, e.g. antitumor antibiotics anthracyclins, adriamycin, doxorubicin or daunomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/445Non condensed piperidines, e.g. piperocaine
    • A61K31/4468Non condensed piperidines, e.g. piperocaine having a nitrogen directly attached in position 4, e.g. clebopride, fentanyl
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/496Non-condensed piperazines containing further heterocyclic rings, e.g. rifampin, thiothixene or sparfloxacin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/40Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum bacterial
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents

Definitions

  • the invention relates to anti-wall teichoic acid ("anti-WTA”) antibodies conjugated to rifamycin-type antibiotics and to use of the resultant antibody-antibiotic conjugates in the treatment of Staphylococcus infections.
  • anti-WTA anti-wall teichoic acid
  • Staphylococcus aureus (S. aureus; SA) is the leading cause of bacterial infections in humans worldwide and represents a major health problem in both hospital and community settings.
  • S. aureus is not exclusively a pathogen and commonly colonizes the anterior nares and skin of healthy individuals. When infection does occur, the most serious infections such as endocarditis, osteomyelitis, necrotizing pneumonia and sepsis occur following dissemination of the bacteria into the bloodstream ( Lowy, F.D. (1998)
  • Vancomycin, linezolid and daptomycin have thus become the few antibiotics of choice for treating invasive MRSA infections (Boucher, H., Miller, L.G. & Razonable, R.R. (2010) "Serious infections caused by methicillin-resistant Staphylococcus aureus” Clin Infect Dis 51 Suppl 2, S183-197).
  • Staphylococcus aureus live-in and let die" Front Cell Infect Microbiol !, 43); Garzoni, C. & Kelley, W.L. (2011) “Return of the Trojan horse: intracellular phenotype switching and immune evasion by Staphylococcus aureus” EMBO Mol Med 3, 115-1 17).
  • S. aureus is taken up by host phagocytic cells, primarily neutrophils and macrophages, within minutes following intravenous infection (Rogers, D.E. (1956) "Studies on Bacterimia: Mechanisms Relating to the Persistence of Bacteremia in Rabbits Following the Intravanous Injection of Staphylococci” JEM 103, 713).
  • Ansamycins are a class of antibiotics, including rifamycin, rifampin, rifampicin, rifabutin, rifapentine, rifalazil, ABI-1657, and analogs thereof, that inhibit bacterial RNA polymerase and have exceptional potency against gram-positive and selective gram-negative bacteria (Rothstein, D.M., et al (2003) Expert Opin. Invest. Drugs 12(2):255-271; US 7342011; US 7271165).
  • ADC Antibody-drug conjugates
  • ADC are targeted chemotherapeutic molecules which combine ideal properties of both antibodies and cytotoxic drugs by targeting potent cytotoxic drugs to antigen-expressing tumor cells (Teicher, B.A. (2009) Curr. Cancer Drug Targets 9:982-1004), thereby enhancing the therapeutic index by maximizing efficacy and minimizing off-target toxicity (Carter, P.J. and Senter P.D. (2008) The Cancer J.. 14(3): 154-169; Chari, R.V. (2008) Acc. Chem. Res. 41 :98-107.
  • ADC comprise a targeting antibody covalently attached through a linker unit to a cytotoxic drug moiety.
  • Immunoconjugates allow for the targeted delivery of a drug moiety to a tumor, and intracellular accumulation therein, where systemic administration of unconjugated drugs may result in unacceptable levels of toxicity to normal cells as well as the tumor cells sought to be eliminated (Polakis P. (2005) Curr. Opin. Pharmacol. 5:382-387).
  • Non-specific immunoglobulin-antibiotic conjugates are described that bind to the surface of target bacteria via the antibiotic for treating sepsis (US 5,545,721; US 6,660,267).
  • Antibiotic-conjugated antibodies are described that have an antigen-binding portion specific for a bacterial antigen (such as SA capsular polysaccharide), but lack a constant region that reacts with a bacterial Fc-binding protein, e.g., staphylococcal protein A (US 7569677).
  • the present invention satisfies this need, and provides compositions and methods that overcome the limitations of current therapeutic compositions as well as offer additional advantages that will be apparent from the detailed description below.
  • the present invention provides a unique therapeutic that includes the elimination of intracellular bacteria.
  • the present invention demonstrates that such a therapeutic is efficacious in-vivo where conventional antibiotics like vancomycin fail.
  • compositions referred to as "antibody-antibiotic conjugates,” or “AAC”) comprising an antibody conjugated by a covalent attachment to one or more rifamycin-type antibiotic moieties.
  • An aspect of the invention is an antibody-antibiotic conjugate compound comprising an anti-wall teichoic acid (WTA) antibody, covalently attached by a protease-cleavable, non- peptide linker to a rifamycin-type antibiotic.
  • WTA anti-wall teichoic acid
  • An exemplary embodiment of the invention is an antibody-antibiotic conjugate of claim 1 having the formula:
  • Ab is the anti-wall teichoic acid antibody
  • PML is a protease-cleavable, non-peptide linker having the formula:
  • Str is a stretcher unit
  • PM is a peptidomimetic unit
  • Y is a spacer unit
  • abx is the rifamycin-type antibiotic
  • p is an integer from 1 to 8.
  • the antibody-antibiotic conjugate compounds of any of the preceding embodiments can comprise any one of the anti-wall teichoic acid (WTA) Abs described herein. These anti- WTA antibodies bind to Staphylococcus aureus. In one embodiment, the antibody is an anti- WTAa monoclonal antibody.
  • WTA anti-wall teichoic acid
  • the Ab is a monoclonal antibody comprising a light (L) chain and a heavy (H) chain, the L chain comprising CDR LI, CDR L2, and CDR L3 and the H chain comprising CDR HI, CDR H2 and CDR H3, wherein the CDR LI, CDR L2, and CDR L3 and CDR HI, CDR H2 and CDR H3 comprise the amino acid sequences of the CDRs of each of Abs 4461 (SEQ ID NO. 1-6), 4624 (SEQ ID NO. 7-12), 4399 (SEQ ID NO. 13-18), and 6267 (SEQ ID NO. 19-24) respectively, as shown in Tables 1A and IB.
  • the anti-WTA antibody comprises a heavy chain variable region (VH), wherein the VH comprises at least 95% sequence identity over the length of the VH region selected from the VH sequence of SEQ ID N0.26, SEQ ID N0.28, SEQ ID NO.30, SEQ ID N0.32 of antibodies 4461, 4624, 4399, and 6267, respectively.
  • the antibodies may further comprise a L chain variable region (VL) wherein the VL comprises at least 95% sequence identity over the length of the VL region selected from the VL sequence of SEQ ID N0.25, SEQ ID N0.27, SEQ ID N0.29, SEQ ID N0.31 of antibodies 4461, 4624, 4399, and 6267, respectively.
  • the antibody-antibiotic conjugate compound of the invention comprises an anti-WTA monoclonal antibody.
  • An exemplary anti-WTAP antibody comprises a light chain and a H chain, the L chain comprising CDR LI, CDR L2, and CDR L3 and the H chain comprising CDR HI, CDR H2 and CDR H3, wherein the CDR LI, CDR L2, and CDR L3 and CDR HI, CDR H2 and CDR H3 comprise the amino acid sequences of the corresponding CDRs of each of Abs shown in Figure 12 (SEQ ID NO. 33- 110).
  • Another anti-WTAp antibody useful to generate the AACs of the invention comprises a L chain variable region (VL) wherein the VL comprises at least 95% sequence identity over the length of the VL region selected from the VL sequence corresponding to each of the antibodies 6078, 6263, 4450, 6297, 6239, 6232, 6259, 6292, 4462, 6265, 6253, 4497, and 4487 respectively, as shown in Figure 15A-1, 15A-2, 15A-3 at abat positions 1- 107.
  • VL L chain variable region
  • This antibody may further comprise a heavy chain variable region (VH), wherein the VH comprises at least 95% sequence identity over the length of the VH region selected from the VH sequences corresponding to each of the antibodies 6078, 6263, 4450,6297, 6239, 6232, 6259, 6292, 4462, 6265, 6253, 4497, and 4487 respectively, as shown in Figure 15B-1 to 15B-6 at Kabat positions 1-113.
  • VH heavy chain variable region
  • the VL comprises the sequence of SEQ ID NO. I l l and the VH comprises the sequence of SEQ ID NO. 112 wherein X is Q or E and Xi is M, I or V.
  • the invention provides an anti-WTAp useful to generate an AAC of the invention wherein the antibody light chain contains an engineered cysteine and comprises the sequence of SEQ ID NO. 115 and the H chain comprises the SEQ ID NO. 116 wherein X is M, I or V.
  • the antibody light chain comprises the sequence of SEQ ID NO. 113 and the H chain contains an engineered cysteine and comprises the SEQ ID NO. 117 wherein X is M, I or V.
  • a Cys may be engineered into each of the L and H chains; in one example of such a ⁇ antibody, light chain contains an engineered cysteine and comprises the sequence of SEQ ID NO. 115, and the H chain contains an engineered cysteine and comprises the SEQ ID NO. 117 wherein X is M, I or V.
  • Another anti-WTAp antibody useful for conjugation comprises a VH and a VL, wherein the VH comprises at least 95% sequence identity over the length of the VH of SEQ ID NO. 156 and the VL comprises at least 95% sequence identity over the length of the VL of sequence SEQ ID NO. 119.
  • the anti-WTAp antibody comprises a VH comprising the sequence of SEQ ID NO. 156 and a VL comprising the sequence of the SEQ ID NO. 119.
  • the anti-WTAp antibody of the invention may comprise a L chain comprising the sequence of SEQ ID NO.121 and a H chain comprising the sequence of SEQ ID NO. 124.
  • the anti-WTA antibody comprises a L chain comprising the sequence of SEQ ID NO. 123 and a H chain comprising the sequence of SEQ ID NO. 157 or SEQ ID NO. 124.
  • the antibody comprises: i) L chain and H chain CDRs of SEQ ID NOs 99-104 or the L chain and H chain CDRs of SEQ ID NOs. 33-38; or ii) the VL of SEQ ID NO.119 or SEQ ID NO. 123 paired with the VH of SEQ ID NO.120 or SEQ ID NO. 156; or iii) the VL of SEQ ID NO.111 paired with the VH of SEQ ID NO.112.
  • the antibody binds to the same epitope as the antibody of any one of the preceding embodiments.
  • the antibody of any one of the preceding embodiments may be an antigen-binding fragment lacking a Fc region.
  • the antibody is a F(ab) or F(ab') 2 .
  • the antibody further comprises a heavy chain constant region and/or a light chain constant region, wherein the heavy chain constant region and/or the light chain constant region comprise one or more amino acids that are substituted with cysteine residues.
  • the heavy chain constant region comprises amino acid substitution Al 18C and/or S400C, and/or the light chain constant region comprises amino acid substitution V205C, wherein the numbering system is according to EU numbering.
  • the antibody is not an IgM isotype. In some embodiments of any of the antibodies described above, the antibody is an IgG (e.g., IgGl, IgG2, IgG3, IgG4), IgE, IgD, or IgA (e.g., IgAl or IgA2) isotype.
  • IgG e.g., IgGl, IgG2, IgG3, IgG4
  • IgE IgE
  • IgD IgD
  • IgA e.g., IgAl or IgA2 isotype.
  • An exemplary embodiment of the invention is pharmaceutical composition comprising the antibody-antibiotic conjugate compound, and a pharmaceutically acceptable carrier, glidant, diluent, or excipient.
  • the anti-WTA-AACs of the invention are useful as antimicrobial agents effective to treat human and veterinary Staphylococci, for example S. aureus, S. saprophyticus and S. simulans as well as Listeria, for example Listeria monocytogenes.
  • the AACs of the invention are useful to treat S. aureus infections.
  • the invention also provides a method of treating a Staphylococcal infection in a human or veterinary patient comprising administering to the patient a therapeutically-effective amount of an antibody- antibiotic conjugate of any one of the preceding embodiments.
  • the bacterial infection is a Staphylococcus aureus infection.
  • the patient has been diagnosed with a S.
  • treating the bacterial infection comprises reducing the bacterial load or counts.
  • the method of treatment is administered to patients where the bacterial infection including S. aureus has led to bacteremia.
  • the method is used to treat Staphylococcal endocarditis or osteomyelitis.
  • the antibody-antibiotic conjugate compound is administered to the infected patient at a dose in the range of about 0mg/kg to lOOmg/kg.
  • Another method is provided for killing persister Staphylococcal bacterial cells (e.g, S. aureus) in vivo by contacting the persister bacteria with an AAC of any of the preceding embodiments.
  • the method of treatment further comprises administering a second therapeutic agent.
  • the second therapeutic agent is an antibiotic including an antibiotic against Staph aureus in general or MRSA in particular.
  • the second antibiotic administered in combination with the antibody-antibiotic conjugate compound of the invention is selected from the structural classes: (i) aminoglycosides; (ii) beta-lactams; (iii) macrolides/cyclic peptides; (iv) tetracyclines; (v) fluoroquinolines/fiuoroquinolones; (vi) and oxazolidinones.
  • the second antibiotic administered in combination with the antibody-antibiotic conjugate compound of the invention is selected from clindamycin, novobiocin, rumblemulin, daptomycin, GSK-2140944, CG-400549, sitafloxacin, teicoplanin, triclosan, napthyridone, radezolid, doxorubicin, ampicillin, vancomycin, imipenem, doripenem, gemcitabine, dalbavancin, and azithromycin.
  • the bacterial load in the infected patient has been reduced to an undetectable level after the treatment.
  • the patient's blood culture is negative after treatment as compared to a positive blood culture before treatment.
  • the bacterial resistance in the subject is undetectable or low.
  • the subject is not responsive to treatment with methicillin or vancomycin.
  • An exemplary embodiment of the invention is a process for making the antibody- antibiotic conjugate comprising conjugating a rifamycin-type antibiotic to an anti-wall teichoic acid (WTA) antibody.
  • An exemplary embodiment of the invention is a kit for treating a bacterial infection, comprising:
  • the pharmaceutical composition comprising the antibody-antibiotic conjugate compound, and a pharmaceutically acceptable carrier, glidant, diluent, or excipient; and b) instructions for use.
  • An aspect of the invention is an antibiotic-linker intermediate having Formula II:
  • R is H, C1-C12 alkyl, or C(0)CH 3 ;
  • R 1 is OH
  • R 1 and R 2 form a five- or six-membered fused heteroaryl or heterocyclyl, and optionally forming a spiro or fused six-membered heteroaryl, heterocyclyl, aryl, or carbocyclyl ring, wherein the spiro or fused six-membered heteroaryl, heterocyclyl, aryl, or carbocyclyl ring is optionally substituted H, F, CI, Br, I, C 1 -C 12 alkyl, or OH;
  • PML is a protease-cleavable, non-peptide linker attached to R 2 or the fused heteroaryl or heterocyclyl formed by R 1 and R 2 ; and having the formula:
  • Str is a stretcher unit
  • PM is a peptidomimetic unit
  • Y is a spacer unit
  • X is a reactive functional group selected from maleimide, thiol, amino, bromide, bromoacetamido, iodoacetamido, p-toluenesulfonate, iodide, hydroxyl, carboxyl, pyridyl disulfide, and N-hydroxysuccinimide.
  • Figure 1 Intracellular stores of MRS A are protected from vancomycin in vivo and in vitro.
  • Figure 1A shows a schematic of the experimental design for generating free bacteria (planktonic) vs. intracellular bacteria.
  • Four cohorts of mice were infected by intravenous injection with roughly equivalent doses of viable free bacteria or intracellular bacteria and selected groups were treated with vancomycin immediately after infection and then once per day (see Example 2).
  • Figure IB and Figure 1C show bacterial loads in kidney and brain, respectively of infected mice 4 days post infection. The dashed line indicates the limit of detection for the assay.
  • Figure IE and Figure IF show that MRSA is able to grow in the presence of vancomycin when cultured on a monolayer of infectable cells.
  • MRSA free bacteria
  • MRSA was seeded in media, media + vancomycin, or media + vancomycin and plated on a monolayer of MG63 osteoblasts ( Figure IE) or Human Brain Microvascular Endothelial Cells (HBMEC, Figure IF).
  • Extracellular bacteria free bacteria
  • Wells containing a monolayer of mammalian cells Intracellular + vanco) a fraction of the bacteria were protected from vancomycin during the first 8 hours after infection and were able to expand within the intracellular compartment over 24 hours. Error bars show standard deviation for triplicate wells.
  • Figure 2 shows the concept of an Antibody Antibiotic Conjugate (AAC).
  • AAC Antibody Antibiotic Conjugate
  • the AAC consists of an antibody directed against an epitope on the surface of S. aureus linked to a potent rifamycin-type antibiotic (e.g. Rifalog) via a linker that is cleaved by lysosomal proteases.
  • FIG 3 shows a possible mechanism of drug activation for antibody-antibiotic conjugates (AAC).
  • AACs bind to extracellular bacteria via the antigen binding domain (Fab) of the antibody and promote uptake of the opsonized bacteria via Fc-mediated phagocytosis.
  • the linker is cleaved by lysosomal proteases such as cathepsin B. Following cleavage of the linker, the linker is hydrolyzed releasing free antibiotic inside the phagolysosome. The free antibiotic kills the opsonized and phagocytosed bacteria along with any previously internalized bacteria residing in the same compartment.
  • Figure 4 shows the cell wall of Gram-positive bacteria, such as S. aureus with a cartoon representation of wall teichoic acids (WTA), Lipo teichoic acid (LTA) and the Peptidoglycan (PGN) sheaths that stabilize the cell membrane and provide attachment sites.
  • WTA wall teichoic acids
  • FIG. 5 shows the chemical structure and glycosyl modifications of Wall Teichoic Acid (WTA), described in detail under Definitions.
  • Figures 6A and 6B summarize the characteristics of the Abs from the primary screening of a library of mAbs showing positive ELISA binding to cell wall preparations from US A300 or Wood46 strain S. aureus strains, as described in Example 3.
  • Abs that bind to WTA 4 are specific to WTA alpha and 13 bind specifically to WTA beta.
  • Figure 7A shows titration of Alexa-488 labeled anti-P-GlcNAC WTA or anti- - GlcNAC WTA antibody on MRSA isolated directly from infected mouse kidneys.
  • the anti- CMV-gD antibody served as an antibody isotype control.
  • Figure 7B shows that the antibody used to generate the AAC recognizes an epitope on Wall Teichoic Acid that is mediated by the glycosyltransferase TarS.
  • Figure 8 shows selection of a potent rifamycin-type antibiotic (rifalog)
  • dimethylpipBOR for its ability to kill non-replicating MRSA.
  • FIG. 9 Growth inhibition assay demonstrating that intact TAC (a form of AAC) does not kill planktonic bacteria unless the antibiotic is released by treatment with cathepsin B.
  • TAC was incubated in buffer alone (open circles) or treated with cathepsin B (closed circles). The intact TAC was not able to prevent bacterial growth after overnight incubation.
  • Pretreatment of the TAC with cathepsin B released sufficient antibiotic activity to prevent bacterial growth at .6 ⁇ g mL of TAC, which is predicted to contain .006 ⁇ g mL of antibiotic.
  • Figure 10 shows treatment of S.
  • FIG. 10A is a schematic showing the timeline of the experiment and injection time points as described in Example 10.
  • Figure 10B shows treatment with AAC (DAR2) from Table 3 reduced bacterial load in the kidneys by approximately 7,000-fold.
  • Figure IOC shows that treatment with AAC (DAR2) reduced bacterial burdens in the heart by approximately 500-fold.
  • Figure 11 A provides an amino acid sequence alignment of the light chain variable regions (VL) of four human anti-WTA alpha antibodies, 4461. 4624, 4399, 6267 (SEQ ID NOS 25, 27, 29 and 31, respectively, in order of appearance).
  • the CDR sequences CDRL1, L2 and L3 according to Kabat numbering are underlined.
  • Figure 1 IB shows an amino acid sequence alignment of the heavy chain variable regions (VH) of the four human anti-WTA alpha antibodies of Figure 11A.
  • the CDR sequences CDR HI, H2 and H3 according to Kabat numbering are underlined (SEQ ID NOS 26, 28, 30 and 32, respectively, in order of appearance).
  • Figure 12 shows the CDR sequences of the L and H chains of 13 human anti-WTA beta antibodies (SEQ ID NOS 33-110).
  • Figures 13A-1 and 13A-2 show an alignment of the full length L chain (light chain) of anti-WTA beta Ab 6078 (unmodified) and its variants, v2, v3, v4 (SEQ ID NOS 113, 113, 115, 113, 115, 113, 115 and 115, respectively, in order of appearance).
  • the CDR sequences CDRL1, L2 and L3 according to Kabat numbering are underlined. Boxes show the contact residues and CDR residues according to Kabat and Chothia.
  • L chain variants that contain an engineered Cys are indicated by the C in the black box near the end of the constant region (at EU residue no. 205 in this case).
  • the variant designation, e.g., v2LC-Cys means variant 2 containing a Cys engineered into the L chain.
  • HCLC-Cys means each of the H and L chains contain an engineered Cys.
  • Variants 2, 3 and 4 have changes in the beginning of the H chain as shown in Figures 13B.
  • Figures 13B-1, 13B-2, 13B-3, 13B-4 show an alignment of the full length H chain (heavy chain) of anti-WTA beta Ab 6078 (unmodified) and its variants, v2, v3, v4 (SEQ ID NOS 114, 139-144 and 143, respectively, in order of appearance) which have changes in the beginning of the H chain.
  • H chain variants that contain an engineered Cys are indicated by the C in the black box at the start of the constant region (at EU residue no. 118 in this case).
  • Figures 14A-1 and 14A-2 show an alignment of the full length L chain of anti-WTA beta Ab 4497 (unmodified) and Cys engineered L chains (SEQ ID NOS 121, 123, 145 and 145, respectively, in order of appearance).
  • the CDR sequences CDRL1, L2 and L3 according to Kabat numbering are underlined. Boxes show the contact residues and CDR residues according to Kabat and Chothia.
  • L chain variants that contain an engineered Cys are indicated by the C in the dotted box near the end of the constant region (at EU residue no. 205 in this case).
  • Figures 14B-1, 14B-2, 14B-3 show an alignment of the full length H chain of anti- WTA beta Ab 4497 (unmodified) and its v8 variant with D altered to E in CDR H3 position 96, with or without the engineered Cys (SEQ ID NOS 146-147, 157 and 147, respectively, in order of appearance).
  • H chain variants that contain an engineered Cys are indicated by the C in the black box at the start of the constant region (at EU residue no. 118 in this case).
  • Figures 15A-1, 15A-2, 1 A-3 show an amino acid sequence alignment of the full length light chain of the thirteen human anti-WTA beta antibodies (SEQ ID NOS 113, 158- 167, 121 and 168, respectively, in order of appearance).
  • the variable region (VL) spans Kabat amino acid positions 1 to 107.
  • the CDR sequences CDRL1, L2 and L3 according to Kabat numbering are underlined.
  • Figures 15B-1 to 15B-6 show an amino acid sequence alignment of the full length heavy chain of the thirteen human anti-WTA beta antibodies of Figures 15A-1, 15A-2, 15A-3 (SEQ ID NOS 114, 169-176, 133-134, 138 and 127, respectively, in order of appearance).
  • the variable region (VH) spans Kabat amino acid positions 1-113.
  • the CDR sequences CDR HI, H2 and H3 according to Kabat numbering are underlined.
  • H chain Eu position 118 marked by an asterisk can be changed to Cys for drug conjugation. Residues highlighted in black can be replaced with other residues that do not affect antigen binding to avoid deamidation, aspartic acid isomerization, oxidation or N-linked glycosylation.
  • Figure 16 shows a comparison of Ab 4497 and its mutants in the highlighted amino acid positions and their relative antigen binding strength as tested by ELISA.
  • Figure 16 discloses SEQ ID NOS 177, 177, 177, 178, 178, 179, 179, 180, 180 and 180, respectively, in order of appearance.
  • Figure 17 shows that pre-treatment with 50 mg/kg of free antibodies is not efficacious in an intravenous infection model.
  • Balb/c mice were given a single dose of vehicle control (PBS) or 50 mg/Kg of antibodies by intravenous injection 30 minutes prior to infection with 2xl0 7 CFU of USA300.
  • Treatment groups included an isotype control antibody that does not bind to S. aureus (gD), an antibody directed against the beta modification of wall teichoic acid (4497) or an antibody directed against the alpha modification of wall teichoic acid (7578).
  • Control mice were given twice daily treatments with 110 mg/Kg of vancomycin by intraperitoneal injection (Vanco).
  • Antibody Antibiotic Conjugate is a compound composed of an antibody that is chemically linked to an antibiotic by a linker.
  • the antibody binds an antigen or epitope on a bacterial surface, for example, a bacterial cell wall component.
  • the linker is a protease-cleavable, non-peptide linker that is designed to be cleaved by proteases, including cathepsin B, a lysosomal protease found in most mammalian cell types
  • TAC Antibiotic Conjugate
  • AAC is a form of AAC in which the antibody is chemically conjugated to a linker-antibiotic unit via one or more cysteines, generally a cysteine that is recombinantly engineered into the antibody at specific site(s) on the antibody to not interfere with the antigen binding function.
  • WTA wall teichoic acid
  • WTA is anionic glycopolymers that are covalently attached to peptidoglycan via phosphodiester linkage to the C6 hydroxyl of the N- acetyl muramic acid sugars. While the precise chemical structure can vary among organisms, in one embodiment, WTA is a ribitol teichoic acid with repeating units of 1,5 -phosphodiester linkages of D-ribitol and D-alanyl ester on position 2 and glycosyl substituents on position 4.
  • the glycosyl groups may be N-acetylglucosaminyl a (alpha) or ⁇ (beta) as present in S.
  • WTA comprises a compound of the formula:
  • WTA is covalently linked to the 6-OH of N-acetyl muramic acid (MurNAc) via a disaccharide composed of N-acetylglucosamine (GlcNAc)-l-P and N- acetylmannoseamine (ManNAc), which is followed by two or three units of glycerol- phosphates.
  • the actual WTA polymer is then composed of 11-40 ribitol-phosphate (Rbo-P) repeating units.
  • the step-wise synthesis of WTA is first initiated by the enzyme called TagO, and S. aureus strains lacking the TagO gene (by artificial deletion of the gene) do not make any WTA.
  • the repeating units can be further tailored with D-alanine (D-Ala) at C2-OH and/or with N-acetylglucosamine (GlcNAc) at the C4-OH position via a- (alpha) or P-(beta) glycosidic linkages.
  • D-Ala D-alanine
  • GlcNAc N-acetylglucosamine
  • the glycosidic linkages could be ⁇ -, ⁇ -, or a mixture of the two anomers.
  • WTA antibody refers to any antibody that binds WTA whether WTA alpha or WTA beta.
  • anti-wall teichoic acid alpha antibody or “anti-WTA alpha antibody” or “anti-aWTA” or “anti-aGlcNac WTA antibody” are used interchangeably to refer to an antibody that specifically binds wall teichoic acid (WTA) alpha.
  • anti-wall teichoic acid beta antibody or “anti-WTA beta antibody” or “anti-pWTA” or “anti-PGlcNac WTA antibody” are used interchangeably to refer to an antibody that specifically binds wall teichoic acid (WTA) beta.
  • antibiotic includes any molecule that specifically inhibits the growth of or kill micro-organisms, such as bacteria, but is non-lethal to the host at the concentration and dosing interval administered.
  • an antibiotic is nontoxic to the host at the administered concentration and dosing intervals.
  • Antibiotics effective against bacteria can be broadly classified as either bactericidal (i.e., directly kills) or bacteriostatic (i.e., prevents division). Anti-bactericidal antibiotics can be further
  • a broad-spectrum antibiotic is one effective against a broad range of bacteria including both Gram-positive and Gram-negative bacteria, in contrast to a narrow-spectrum antibiotic, which is effective against a smaller range or specific families of bacteria.
  • antibiotics include: (i) aminoglycosides, e.g., amikacin, gentamicin, kanamycin, neomycin, netilmicin, streptomycin, tobramycin, paromycin, (ii) ansamycins, e.g., geldanamycin, herbimycin, (iii) carbacephems, e.g., loracarbef, (iv), carbapenems, e.g., ertapenum, doripenem, imipenem/cilastatin, meropenem, (v) cephalosporins (first generation), e.g., cefadroxil, cefazolin, cefalotin, cefalexin, (vi) cephalosporins (second generation), e.g., ceflaclor, cefamandole, cefoxitin, cefprozil, cefuroxime, (vi) cephalosporins (first
  • axithromycin clarithromycin, dirithromycine, erythromycin, roxithromycin, troleandomycin, telithromycin, spectinomycin
  • monobactams e.g. , axtreonam
  • penicilins e.g., amoxicillin, ampicillin, axlocillin, carbenicillin, cloxacillin, dicloxacillin, flucloxacillin, mezlocillin, meticillin, nafcilin, oxacillin, penicillin, peperacillin, ticarcillin
  • antibiotic polypeptides e.g., bacitracin, colistin, polymyxin B
  • quinolones e.g., ciprofloxacin, enoxacin, gatifloxacin, levofloxacin, lemefloxacin, moxif
  • Staphylococcus aureus is also referred to herein as Staph A or S. aureus in short.
  • MRSA methicillin-resistant Staphylococcus aureus
  • RSA oxacillin-resistant Staphylococcus aureus
  • (MSSA) refers to any strain of Staphylococcus aureus that is sensitive to beta-lactam antibiotics.
  • anti-Staph a antibody and “an antibody that binds to Staph a” refer to an antibody that is capable of binding an antigen on Staphylococcus aureus ( “S. aureus”) with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting S. aureus.
  • the extent of binding of an anti-Staph a antibody to an unrelated, non-Staph a protein is less than about 10% of the binding of the antibody to MRSA as measured, e.g., by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an antibody that binds to Staph a has a dissociation constant (Kd) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, , ⁇ 5 Nm, , ⁇ 4 nM, , ⁇ 3 nM, , ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g., 10 "8 M or less, e.g. from 10 "8 M to 10 "13 M, e.g., from 10 "9 M to 10 "13 M).
  • an anti-Staph a antibody binds to an epitope of Staph a that is conserved among Staph from different species.
  • MIC minimum inhibitory concentration
  • antibody herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), and antigen binding antibody fragments thereof, (Miller et al (2003) J. of Immunology 170:4854-4861). Antibodies may be murine, human, humanized, chimeric, or derived from other species. An antibody is a protein generated by the immune system that is capable of recognizing and binding to a specific antigen (Janeway, C, Travers, P., Walport, M., Shlomchik (2001) Immuno Biology, 5th Ed., Garland Publishing, New York).
  • a target antigen generally has numerous binding sites, also called epitopes, recognized by CDRs on multiple antibodies. Each antibody that specifically binds to a different epitope has a different structure. Thus, one antigen may be recognized and bound by more than one corresponding antibody.
  • An antibody includes a full-length
  • immunoglobulin molecule or an immunologically active portion of a full-length
  • immunoglobulin molecule i.e., a molecule that contains an antigen binding site that immunospecifically binds an antigen of a target of interest or part thereof, such targets including but not limited to, cancer cell or cells that produce autoimmune antibodies associated with an autoimmune disease, an infected cell or a microorganism such as a bacterium.
  • the immunoglobulin (Ig) disclosed herein can be of any isotype except IgM (e.g., IgG, IgE, IgD, and IgA) and subclass (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2.
  • the immunoglobulins can be derived from any species.
  • the Ig is of human, murine, or rabbit origin. In a specific embodiment, the Ig is of human origin.
  • the "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
  • the heavy chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • Native antibodies refer to naturally occurring immunoglobulin molecules with varying structures.
  • native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulftde-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2, and CH3). Similarly, from - to C-terminus, each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain.
  • VH variable region
  • VL variable region
  • the light chain of an antibody may be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
  • full length antibody “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
  • an "antigen-binding fragment" of an antibody refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
  • antibody fragments include but are not limited to Fv, Fab, Fab', Fab'-SH, F(ab') 2 ; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation (e.g., natural variation in glycosylation), such variants generally being present in minor amounts.
  • One such possible variant for IgGl antibodies is the cleavage of the C-terminal lysine (K) of the heavy chain constant region.
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
  • the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies.
  • chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
  • a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody- encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • a “humanized antibody” refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
  • a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
  • a "humanized form" of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
  • variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen.
  • the variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs).
  • FRs conserved framework regions
  • HVRs hypervariable regions
  • antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al, Nature 352:624-628 (1991).
  • hypervariable region refers to the regions of an antibody variable domain which are hypervariable in sequence
  • antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
  • H3 and L3 display the most diversity of the six HVRs, and H3 in particular is believed to play a unique role in conferring fine specificity to antibodies. See, e.g., Xu et al, Immunity 13:37-45 (2000); Johnson and Wu, in Methods in Molecular Biology 248: 1-25 (Lo, ed., Human Press, Totowa, NJ, 2003).
  • camelid antibodies consisting of a heavy chain only are functional and stable in the absence of light chain (Hamers-Casterman et al, (1993) Nature 363:446-448; Sheriff et al., (1996) Nature Struct. Biol. 3:733-736).
  • CDRs Complementarity Determining Regions
  • H3 H95-H102 H95-H102 H96-H101 H93-H101 HVRs may comprise "extended HVRs" as follows: 24-36 or 24-34 (LI), 46-56 or 50- 56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (HI), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH.
  • HVR residues, CDR residues and other residues in the variable domain are numbered herein according to Kabat et al., supra.
  • variable-domain residue-numbering as in Kabat or “amino-acid- position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy-chain variable domains or light-chain variable domains of the compilation of antibodies in Kabat et al., supra. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain.
  • a heavy-chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc. according to Kabat) after heavy-chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • FR Framework or "FR” refers to variable domain residues other than hypervariable region (HVR) residues.
  • the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
  • acceptor human framework for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
  • An acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
  • the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
  • a "human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat et al, Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3.
  • the subgroup is subgroup kappa I as in Kabat et al, supra.
  • the subgroup is subgroup III as in Kabat et al., supra.
  • Fc region herein is used to define a C-terminal region of an
  • immunoglobulin heavy chain The term includes native-sequence Fc regions and variant Fc regions. Although the boundaries of the Fc region of an immunoglobulin heavy chain might vary, the human IgG heavy-chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
  • Fc receptor or "FcR” also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus. Guyer et al., J. Immunol. 117: 587 (1976) and Kim et al., J.
  • Binding to FcRn in vivo and serum half-life of human FcRn high-affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates to which the polypeptides having a variant Fc region are administered.
  • WO 2004/42072 (Presta) describes antibody variants which improved or diminished binding to FcRs. See also, e.g., Shields et al., J. Biol. Chem. 9(2): 6591-6604 (2001).
  • an “affinity matured” antibody refers to an antibody with one or more alterations in one or more hypervariable regions (HVRs), compared to a parent antibody which does not possess such alterations, such alterations resulting in an improvement in the affinity of the antibody for antigen.
  • HVRs hypervariable regions
  • epitope refers to the particular site on an antigen molecule to which an antibody binds.
  • an "antibody that binds to the same epitope” as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50%> or more.
  • An exemplary competition assay is provided herein.
  • naked antibody refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel.
  • the naked antibody may be present in a pharmaceutical formulation.
  • Antibody effector functions refer to those biological activities attributable to the Fc region of an antibody, which vary with the antibody isotype. Examples of antibody effector functions include: C 1 q binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • FcRs Fc receptors
  • cytotoxic cells e.g., natural killer (NK) cells, neutrophils and macrophages
  • NK cells natural killer cells
  • neutrophils and macrophages enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins.
  • the antibodies “arm" the cytotoxic cells and are required for killing of the target cell by this mechanism.
  • the primary cells for mediating ADCC NK cells, express Fey(gamma)RIII only, whereas monocytes express Fcy(gamma)RI,
  • Fcy(gamma)RII and Fcy(gamma)RIII Fc expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9: 457-92 (1991).
  • an in vitro ADCC assay such as that described in US 5,500,362 or US 5,821,337 may be performed.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and natural killer (NK) cells.
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al., PNAS USA 95:652-656 (1998).
  • Phagocytosis refers to a process by which a pathogen is engulfed or internalized by a host cell (e.g., macrophage or neutrophil).
  • Phagocytes mediate phagocytosis by three pathways: (i) direct cell surface receptors (for example, lectins, integrins and scavenger receptors) (ii) complement enhanced - using complement receptors (including CRI, receptor for C3b, CR3 and CR4) to bind and ingest complement opsonized pathogens, and (iii) antibody enhanced - using Fc Receptors (including FcygammaRI, FcygammaRIIA and FcygammaRIIIA) to bind antibody opsonized particles which then become internalized and fuse with lysosomes to become phagolysosomes.
  • direct cell surface receptors for example, lectins, integrins and scavenger receptors
  • complement enhanced - using complement receptors including CRI, receptor for C3b, CR3 and CR4
  • Fc Receptors including FcygammaRI, FcygammaRII
  • pathway (iii) plays a significant role in the delivery of the anti-MRSA AAC therapeutics to infected leukocytes, e.g., neutrophils and macrophages (Phagocytosis of Microbes:
  • “Complement dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C 1 q) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
  • C 1 q the first component of the complement system
  • a CDC assay e.g., as described in Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996), may be performed.
  • the carbohydrate attached to the Fc region may be altered.
  • Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. (1997) TIBTECH 15:26-32.
  • the oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GIcNAc), galactose, and sialic acid, as well as a fucose attached to a GIcNAc in the "stem" of the biantennary oligosaccharide structure.
  • modifications of the oligosaccharide in an IgG may be made in order to create IgGs with certain additionally improved properties.
  • antibody modifications are provided having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. Such modifications may have improved ADCC function. See, e.g. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd).
  • Examples of cell lines capable of producing defucosylated antibodies include 13 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat. Appl. Pub. No. 2003/0157108 Al, Presta, L; and WO 2004/056312 Al, Adams et al., especially at Example 11), and knockout cell lines, such as alpha- 1,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al, Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al, Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
  • an “isolated antibody” is one which has been separated from a component of its natural environment.
  • an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC).
  • electrophoretic e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis
  • chromatographic e.g., ion exchange or reverse phase HPLC
  • isolated nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment.
  • An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
  • isolated nucleic acid encoding an anti-WTA beta antibody refers to one or more nucleic acid molecules encoding antibody heavy and light chains, including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
  • the term “specifically binds to” or is “specific for” refers to measurable and reproducible interactions such as binding between a target and an antibody, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
  • an antibody that specifically binds to a target (which can be an epitope) is an antibody that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
  • the extent of binding of an antibody to a target unrelated to WTA-beta is less than about 10% of the binding of the antibody to the target as measured, e.g., by a radioimmunoassay (RIA).
  • an antibody that specifically binds to WTA beta has a dissociation constant (Kd) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
  • Kd dissociation constant
  • an antibody specifically binds to an epitope on that is conserved from different species.
  • specific binding can include, but does not require exclusive binding.
  • Binding affinity generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity that reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein.
  • Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer.
  • a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
  • the "Kd" or “Kd value” according to this invention is measured by a radiolabeled antigen-binding assay (RIA) performed with the Fab version of an antibody of interest and its antigen as described by the following assay.
  • RIA radiolabeled antigen-binding assay
  • Solution-binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of ( 12 I)- labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., (1999) J. Mol. Biol. 293:865-881).
  • microtiter plates DYNEX
  • a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
  • a non-adsorbent plate (Nunc #269620) 100 pM or 26 pM [ 125 I] -antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of the anti-VEGF antibody, Fab- 12, in Presta et al, Cancer Res. 57:4593-4599 (1997)).
  • the Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed and the plate washed eight times with 0.1% TWEEN-20TM surfactant in PBS. When the plates have dried, 150 ⁇ /well of scintillant (MICROSCLNT-20TM; Packard) is added, and the plates are counted on a TOPCOUNT gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays.
  • MICROSCLNT-20TM MICROSCLNT-20TM
  • Packard TOPCOUNT gamma counter
  • the d is measured by using surface-plasmon resonance assays using a BIACORE ® -2000 or a BIACORE ® -3000 instrument (BIAcore, Inc., Piscataway, NJ) at 25°C with immobilized antigen CM5 chips at ⁇ 10 response units (RU).
  • CM5 carboxymethylated dextran biosensor chips
  • EDC N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride
  • NHS N- hydroxysuccinimide
  • Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 ⁇ g/ml (-0.2 ⁇ ) before injection at a flow rate of 5 ⁇ /minute to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, 1 M ethanolamine is injected to block unreacted groups. For kinetics measurements, two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% TWEEN 20TM surfactant (PBST) at 25°C at a flow rate of approximately 25 ⁇ /min.
  • PBST TWEEN 20TM surfactant
  • association rates (k on ) and dissociation rates (k off ) are calculated using a simple one-to-one Langmuir binding model (BIAcore ® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams.
  • the equilibrium dissociation constant (Kd) is calculated as the ratio k off /k OI1 . See, e.g., Chen et al., J. Mol. Biol. 293:865-881 (1999).
  • BIACORE ® -3000 system (BIAcore, Inc., Piscataway, NJ).
  • host cell "host cell line,” and “host cell culture” are used interchangeably.
  • Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages.
  • Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
  • vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
  • the term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
  • Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as "expression vectors”.
  • Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
  • the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office,
  • the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y, where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B.
  • rifamycin-type antibiotic means the class or group of antibiotics having the structure of, or similar structure to, rifamycin.
  • rifalazil-type antibiotic means the class or group of antibiotics having the structure of, or similar structure to, rifalazil.
  • substituent When indicating the number of substituents, the term “one or more” refers to the range from one substituent to the highest possible number of substitution, i.e. replacement of one hydrogen up to replacement of all hydrogens by substituents.
  • substituted denotes an atom or a group of atoms replacing a hydrogen atom on the parent molecule.
  • substituted denotes that a specified group bears one or more substituents. Where any group may carry multiple substituents and a variety of possible substituents is provided, the substituents are independently selected and need not to be the same.
  • unsubstituted means that the specified group bears no substituents.
  • optionally substituted means that the specified group is unsubstituted or substituted by one or more substituents, independently chosen from the group of possible substituents.
  • substituents independently chosen from the group of possible substituents.
  • one or more means from one substituent to the highest possible number of substitution, i.e. replacement of one hydrogen up to replacement of all hydrogens by substituents.
  • alkyl refers to a saturated linear or branched-chain monovalent hydrocarbon radical of one to twelve carbon atoms (Ci-C 12 ), wherein the alkyl radical may be optionally substituted independently with one or more substituents described below.
  • an alkyl radical is one to eight carbon atoms (Ci-Cs), or one to six carbon atoms (Ci-C 6 ).
  • alkyl groups include, but are not limited to, methyl (Me, -CH 3 ), ethyl (Et, -CH 2 CH 3 ), 1 -propyl (n-Pr, n-propyl, -CH 2 CH 2 CH 3 ), 2-propyl (i-Pr, i-propyl, -CH(CH 3 ) 2 ), 1 -butyl (n-Bu, n-butyl, -CH 2 CH 2 CH 2 CH 3 ), 2-methyl-l -propyl (i- Bu, i-butyl, -CH 2 CH(CH 3 ) 2 ), 2-butyl (s-Bu, s-butyl, -CH(CH 3 )CH 2 CH 3 ), 2-methyl-2-propyl (t-Bu, t-butyl, -C(CH 3 ) ), 1-pentyl (n-pentyl, -CH 2 CH 2 CH 2 CH 2 CH ), 2-pentyl (
  • alkylene refers to a saturated linear or branched-chain divalent hydrocarbon radical of one to twelve carbon atoms (Ci-Ci 2 ), wherein the alkylene radical may be optionally substituted independently with one or more substituents described below.
  • an alkylene radical is one to eight carbon atoms (Ci-Cg), or one to six carbon atoms (Ci-C 6 ).
  • alkylene groups include, but are not limited to, methylene (-CH 2 -), ethylene (-CH 2 CH 2 -), propylene (-CH 2 CH 2 CH 2 -), and the like.
  • alkynyl refers to a linear or branched monovalent hydrocarbon radical of two to eight carbon atoms (C 2 -Cs) with at least one site of unsaturation, i.e., a carbon-carbon, sp triple bond, wherein the alkynyl radical may be optionally substituted independently with one or more substituents described herein. Examples include, but are not limited to, ethynyl (-C ⁇ CH), propynyl (propargyl, -CH 2 C ⁇ CH), and the like.
  • alkynylene refers to a linear or branched divalent hydrocarbon radical of two to eight carbon atoms (C 2 -C 8 ) with at least one site of unsaturation, i.e., a carbon-carbon, sp triple bond, wherein the alkynylene radical may be optionally substituted independently with one or more substituents described herein. Examples include, but are not limited to, ethynylene (-C ⁇ C-), propynylene (propargylene, -C13 ⁇ 4C ⁇ C-), and the like.
  • carrier refers to a monovalent non-aromatic, saturated or partially unsaturated ring having 3 to 12 carbon atoms (C3-C12) as a monocyclic ring or 7 to 12 carbon atoms as a bicyclic ring.
  • Bicyclic carbocycles having 7 to 12 atoms can be arranged, for example, as a bicyclo [4,5], [5,5], [5,6] or [6,6] system, and bicyclic carbocycles having 9 or 10 ring atoms can be arranged as a bicyclo [5,6] or [6,6] system, or as bridged systems such as bicyclo[2.2.1]heptane, bicyclo[2.2.2]octane and bicyclo[3.2.2]nonane. Spiro moieties are also included within the scope of this definition.
  • Examples of monocyclic carbocycles include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, 1-cyclopent-l-enyl, 1 -cyclopent-2-enyl, l-cyclopent-3- enyl, cyclohexyl, 1-cyclohex-l-enyl, 1 -cyclohex-2-enyl, l-cyclohex-3-enyl, cyclohexadienyl, cycloheptyl, cyclooctyl, cyclononyl, cyclodecyl, cycloundecyl, cyclododecyl, and the like.
  • Carbocyclyl groups are optionally substituted independently with one or more substituents described herein.
  • Aryl means a monovalent aromatic hydrocarbon radical of 6-20 carbon atoms (C 6 - C20) derived by the removal of one hydrogen atom from a single carbon atom of a parent aromatic ring system. Some aryl groups are represented in the exemplary structures as "Ar”. Aryl includes bicyclic radicals comprising an aromatic ring fused to a saturated, partially unsaturated ring, or aromatic carbocyclic ring.
  • Typical aryl groups include, but are not limited to, radicals derived from benzene (phenyl), substituted benzenes, naphthalene, anthracene, biphenyl, indenyl, indanyl, 1 ,2-dihydronaphthalene, 1,2,3,4-tetrahydronaphthyl, and the like.
  • Aryl groups are optionally substituted independently with one or more substituents described herein.
  • Arylene means a divalent aromatic hydrocarbon radical of 6-20 carbon atoms (C 6 - C20) derived by the removal of two hydrogen atom from a two carbon atoms of a parent aromatic ring system. Some arylene groups are represented in the exemplary structures as "Ar”. Arylene includes bicyclic radicals comprising an aromatic ring fused to a saturated, partially unsaturated ring, or aromatic carbocyclic ring.
  • Typical arylene groups include, but are not limited to, radicals derived from benzene (phenylene), substituted benzenes, naphthalene, anthracene, biphenylene, indenylene, indanylene, 1 ,2-dihydronaphthalene, 1,2,3,4-tetrahydronaphthyl, and the like.
  • Arylene groups are optionally substituted with one or more substituents described herein.
  • heterocycle heterocyclyl
  • heterocyclic ring heterocyclic ring
  • a heterocycle may be a monocycle having 3 to 7 ring members (2 to 6 carbon atoms and 1 to 4 heteroatoms selected from N, O, P, and S) or a bicycle having 7 to 10 ring members (4 to 9 carbon atoms and 1 to 6 heteroatoms selected from N, O, P, and S), for example: a bicyclo [4,5], [5,5], [5,6], or [6,6] system. Heterocycles are described in Paquette, Leo A.;
  • Heterocyclyl also includes radicals where heterocycle radicals are fused with a saturated, partially unsaturated ring, or aromatic carbocyclic or heterocyclic ring.
  • heterocyclic rings include, but are not limited to, morpholin-4-yl, piperidin-l-yl, piperazinyl, piperazin-4-yl-2-one, piperazin-4-yl-3-one, pyrrolidin-l-yl, thiomorpholin-4-yl, S-dioxothiomorpholin-4-yl, azocan-l-yl, azetidin-l-yl, octahydropyrido[l,2-a]pyrazin-2-yl, [l,4]diazepan-l-yl, pyrrolidinyl, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothienyl, tetrahydropyranyl, dihydropyranyl, tetrahydrothiopyranyl, piperidino, morpholino, thiomorpholino, thioxanyl, piperazinyl, homopipe
  • Spiro moieties are also included within the scope of this definition.
  • the heterocycle groups herein are optionally substituted independently with one or more substituents described herein.
  • heteroaryl refers to a monovalent aromatic radical of 5-, 6-, or 7- membered rings, and includes fused ring systems (at least one of which is aromatic) of 5-20 atoms, containing one or more heteroatoms independently selected from nitrogen, oxygen, and sulfur.
  • heteroaryl groups are pyridinyl (including, for example, 2- hydroxypyridinyl), imidazolyl, imidazopyridinyl, pyrimidinyl (including, for example, 4- hydroxypyrimidinyl), pyrazolyl, triazolyl, pyrazinyl, tetrazolyl, furyl, thienyl, isoxazolyl, thiazolyl, oxadiazolyl, oxazolyl, isothiazolyl, pyrrolyl, quinolinyl, isoquinolinyl,
  • benzothiazolyl benzoxazolyl, quinazolinyl, quinoxalinyl, naphthyridinyl, and furopyridinyl.
  • Heteroaryl groups are optionally substituted independently with one or more substituents described herein.
  • the heterocycle or heteroaryl groups may be carbon (carbon-linked), or nitrogen (nitrogen-linked) bonded where such is possible.
  • carbon bonded heterocycles or heteroaryls are bonded at position 2, 3, 4, 5, or 6 of a pyridine, position 3, 4, 5, or 6 of a pyridazine, position 2, 4, 5, or 6 of a pyrimidine, position 2, 3, 5, or 6 of a pyrazine, position 2, 3, 4, or 5 of a furan, tetrahydrofuran, thiofuran, thiophene, pyrrole or tetrahydropyrrole, position 2, 4, or 5 of an oxazole, imidazole or thiazole, position 3, 4, or 5 of an isoxazole, pyrazole, or isothiazole, position 2 or 3 of an aziridine, position 2, 3, or 4 of an azetidine, position 2, 3, 4, 5, 6, 7, or 8 of a quinoline or position 1, 3, 4, 5, 6,
  • nitrogen bonded heterocycles or heteroaryls are bonded at position 1 of an aziridine, azetidine, pyrrole, pyrrolidine, 2-pyrroline, 3- pyrroline, imidazole, imidazolidine, 2-imidazoline, 3-imidazoline, pyrazole, pyrazoline, 2- pyrazoline, 3-pyrazoline, piperidine, piperazine, indole, indoline, lH-indazole, position 2 of a isoindole, or isoindoline, position 4 of a morpholine, and position 9 of a carbazole, or ⁇ - carboline.
  • a “metabolite” is a product produced through metabolism in the body of a specified compound or salt thereof. Metabolites of a compound may be identified using routine techniques known in the art and their activities determined using tests such as those described herein. Such products may result for example from the oxidation, reduction, hydrolysis, amidation, deamidation, esterification, deesteriftcation, enzymatic cleavage, and the like, of the administered compound. Accordingly, the invention includes metabolites of compounds of the invention, including compounds produced by a process comprising contacting a Formula I compound of this invention with a mammal for a period of time sufficient to yield a metabolic product thereof.
  • pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • a "sterile" formulation is aseptic or free from all living microorganisms and their spores.
  • a “stable" formulation is one in which the protein therein essentially retains its physical and chemical stability and integrity upon storage.
  • Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein
  • Stability can be measured at a selected temperature for a selected time period.
  • the formulation may be kept at 40 °C for 2 weeks to 1 month, at which time stability is measured.
  • the formulation should be stable at 30 °C or 40 °C for at least 1 month and/or stable at 2-8°C for at least 2 years.
  • the formulation is to be stored at 30 °C, generally the formulation should be stable for at least 2 years at 30 °C and/or stable at 40 °C for at least 6 months.
  • a "stable" formulation may be one wherein less than about 10% and preferably less than about 5% of the protein are present as an aggregate in the formulation. In other embodiments, any increase in aggregate formation during storage of the formulation can be determined.
  • An "isotonic" formulation is one which has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure from about 250 to 350 mOsm.
  • the term “hypotonic” describes a formulation with an osmotic pressure below that of human blood.
  • the term “hypertonic” is used to describe a formulation with an osmotic pressure above that of human blood. Isotonicity can be measured using a vapor pressure or ice-freezing type osmometer, for example.
  • the formulations of the present invention are hypertonic as a result of the addition of salt and/or buffer.
  • Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
  • physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN ® , polyethylene glycol (PEG), and PLURONICSTM.
  • buffers such as phosphate, citrate, and other organic acids
  • antioxidants including ascorbic acid
  • proteins such as serum album
  • a “pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
  • pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
  • a "pharmaceutically acceptable acid” includes inorganic and organic acids which are nontoxic at the concentration and manner in which they are formulated.
  • suitable inorganic acids include hydrochloric, perchloric, hydrobromic, hydroiodic, nitric, sulfuric, sulfonic, sulfuric, sulfanilic, phosphoric, carbonic, etc.
  • Suitable organic acids include straight and branched-chain alkyl, aromatic, cyclic, cycloaliphatic, arylaliphatic, heterocyclic, saturated, unsaturated, mono, di- and tricarboxylic, including for example, formic, acetic, 2-hydroxyacetic, trifluoroacetic, phenylacetic, trimethylacetic, t-butyl acetic, anthranilic, propanoic, 2-hydroxypropanoic, 2- oxopropanoic, propandioic, cyclop entanepropionic, cyclopentane propionic, 3- phenylpropionic, butanoic, butandioic, benzoic, 3-(4-hydroxybenzoyl)benzoic, 2-acetoxy- benzoic, ascorbic, cinnamic, lauryl sulfuric, stearic, muconic, mandelic, succinic, embonic, fumaric, malic, maleic, byd
  • “Pharmaceutically-acceptable bases” include inorganic and organic bases which are non-toxic at the concentration and manner in which they are formulated.
  • suitable bases include those formed from inorganic base forming metals such as lithium, sodium, potassium, magnesium, calcium, ammonium, iron, zinc, copper, manganese, aluminum, N-methylglucamine, morpholine, piperidine and organic nontoxic bases including, primary, secondary and tertiary amines, substituted amines, cyclic amines and basic ion exchange resins, [e.g., N(R') 4 + (where R' is independently H or C 1-4 alkyl, e.g., ammonium, Tris)], for example, isopropylamine, trimethylamine, diethyl amine, triethylamine, tripropylamine, ethanolamine, 2-diethylaminoethanol, trimethamine, dicyclohexylamine, lysine, arginine, histidine, caffeine,
  • organic non-toxic bases are isopropylamine, diethylamine, ethanolamine, trimethamine,
  • dicyclohexylamine dicyclohexylamine, choline, and caffeine.
  • Additional pharmaceutically acceptable acids and bases useable with the present invention include those which are derived from the amino acids, for example, histidine, glycine, phenylalanine, aspartic acid, glutamic acid, lysine and asparagine.
  • “Pharmaceutically acceptable” buffers and salts include those derived from both acid and base addition salts of the above indicated acids and bases. Specific buffers and/ or salts include histidine, succinate and acetate.
  • a “pharmaceutically acceptable sugar” is a molecule which, when combined with a protein of interest, significantly prevents or reduces chemical and/or physical instability of the protein upon storage.
  • “pharmaceutically acceptable sugars” may also be known as a "lyoprotectant”.
  • Exemplary sugars and their corresponding sugar alcohols include: an amino acid such as monosodium glutamate or histidine; a methylamine such as betaine; a lyotropic salt such as magnesium sulfate; a polyol such as trihydric or higher molecular weight sugar alcohols, e.g.
  • glycerin dextran, erythritol, glycerol, arabitol, xylitol, sorbitol, and mannitol; propylene glycol; polyethylene glycol; PLURONICS ® ; and combinations thereof.
  • Additional exemplary lyoprotectants include glycerin and gelatin, and the sugars mellibiose, melezitose, raffinose, mannotnose and stachyose.
  • reducing sugars include glucose, maltose, lactose, maltulose, iso-maltulose and lactulose.
  • non-reducing sugars include non-reducing glycosides of polyhydroxy compounds selected from sugar alcohols and other straight chain polyalcohols.
  • Preferred sugar alcohols are monoglycosides, especially those compounds obtained by reduction of disaccharides such as lactose, maltose, lactulose and maltulose.
  • the glycosidic side group can be either glucosidic or galactosidic.
  • Additional examples of sugar alcohols are glucitol, maltitol, lactitol and iso-maltulose.
  • the preferred pharmaceutically-acceptable sugars are the non-reducing sugars trehalose or sucrose.
  • compositions are added to the formulation in a "protecting amount" (e.g. pre-lyophilization) which means that the protein essentially retains its physical and chemical stability and integrity during storage (e.g., after reconstitution and storage).
  • a protecting amount e.g. pre-lyophilization
  • the "diluent" of interest herein is one which is pharmaceutically acceptable (safe and non-toxic for administration to a human) and is useful for the preparation of a liquid formulation, such as a formulation reconstituted after lyophilization.
  • exemplary diluents include sterile water, bacteriostatic water for injection (BWFI), a pH buffered solution (e.g. phosphate-buffered saline), sterile saline solution, Ringer's solution or dextrose solution.
  • BWFI bacteriostatic water for injection
  • a pH buffered solution e.g. phosphate-buffered saline
  • sterile saline solution e.g. phosphate-buffered saline
  • Ringer's solution or dextrose solution e.g. phosphate-buffered saline
  • diluents can include aqueous solutions of salts and/or buffers.
  • a "preservative” is a compound which can be added to the formulations herein to reduce bacterial activity.
  • the addition of a preservative may, for example, facilitate the production of a multi-use (multiple-dose) formulation.
  • potential preservatives include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride,
  • benzalkonium chloride (a mixture of alkylbenzyldimethylammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride.
  • Other types of preservatives include aromatic alcohols such as phenol, butyl and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m-cresol.
  • the most preferred preservative herein is benzyl alcohol.
  • mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats).
  • domesticated animals e.g., cows, sheep, cats, dogs, and horses
  • primates e.g., humans and non-human primates such as monkeys
  • rabbits e.g., mice and rats
  • rodents e.g., mice and rats.
  • the individual or subject is a human.
  • treatment and grammatical variations thereof such as “treat” or
  • treating refers to clinical intervention designed to alter the natural course of the individual, tissue or cell being treated during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, decreasing the rate of disease progression, ameliorating or palliating the disease state, and remission or improved prognosis, all measurable by one of skill in the art such as a physician.
  • treatment can mean alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, decreasing the rate of infectious disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • the AACs, TACs of the invention are used to delay development of a disease or to slow the progression of an infectious disease or reduce the bacterial load in the blood stream and/or in infected tissues and organs.
  • conjunction with refers to administration of one treatment modality in addition to another treatment modality.
  • in conjunction with refers to administration of one treatment modality before, during or after administration of the other treatment modality to the individual.
  • bacteria refers to the presence of bacteria in the bloodstream which is most commonly detected through a blood culture. Bacteria can enter the bloodstream as a severe complication of infections (like pneumonia or meningitis), during surgery (especially when involving mucous membranes such as the gastrointestinal tract), or due to catheters and other foreign bodies entering the arteries or veins. Bacteremia can have several consequences. The immune response to the bacteria can cause sepsis and septic shock, which has a relatively high mortality rate. Bacteria can also use the blood to spread to other parts of the body, causing infections away from the original site of infection. Examples include endocarditis or osteomyelitis.
  • a “therapeutically effective amount” is the minimum concentration required to effect a measurable improvement of a particular disorder.
  • a therapeutically effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the antibody to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody are outweighed by the therapeutically beneficial effects.
  • a therapeutically effective amount is an amount effective to reduce bacteremia in an in vivo infection.
  • a “therapeutically effective amount” is at least the amount effective to reduce the bacterial load or colony forming units (CFU) isolated from a patient sample such as blood by at least one log relative to prior to drug administration.
  • CFU colony forming units
  • the reduction is at least 2 logs. In another aspect, the reduction is at least 3, 4, 5 logs. In yet another aspect, the reduction is to below detectable levels using assays known in the art including assays exemplified herein.
  • a therapeutically effective amount is the amount of an AAC in one or more doses given over the course of the treatment period, that achieves a negative blood culture (i.e., does not grow out the bacteria that is the target of the AAC) as compared to the positive blood culture before or at the start of treatment of the infected patient.
  • prophylactically effective amount refers to an amount effective, at the dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to, at the earlier stage of disease, or even prior to exposure to conditions where the risk of infection is elevated, the prophylactically effective amount can be less than the therapeutically effective amount. In one embodiment, a prophylactically effective amount is at least an amount effective to reduce, prevent the occurrence of or spread of infection from one cell to another.
  • Chronic administration refers to administration of the medicament(s) in a continuous as opposed to acute mode, so as to maintain the initial therapeutic effect (activity) for an extended period of time.
  • Intermittent administration is treatment that is not consecutively done without interruption, but rather is cyclic in nature.
  • package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
  • chiral refers to molecules which have the property of non-superimposability of the mirror image partner, while the term “achiral” refers to molecules which are superimposable on their mirror image partner.
  • stereoisomers refers to compounds which have identical chemical constitution, but differ with regard to the arrangement of the atoms or groups in space.
  • Diastereomer refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, and reactivities. Mixtures of diastereomers may separate under high resolution analytical procedures such as electrophoresis and chromatography.
  • Enantiomers refer to two stereoisomers of a compound which are non- superimposable mirror images of one another. Stereochemical definitions and conventions used herein generally follow S. P. Parker, Ed., McGraw-Hill Dictionary of Chemical Terms (1984) McGraw-Hill Book Company, New York; and Eliel, E. and Wilen, S., Stereochemistry of Organic Compounds (1994) John Wiley & Sons, Inc., New York. Many organic compounds exist in optically active forms, i.e., they have the ability to rotate the plane of plane-polarized light. In describing an optically active compound, the prefixes D and L, or R and S, are used to denote the absolute configuration of the molecule about its chiral center(s).
  • d and 1 or (+) and (-) are employed to designate the sign of rotation of plane-polarized light by the compound, with (-) or 1 meaning that the compound is levorotatory.
  • a compound prefixed with (+) or d is dextrorotatory.
  • these stereoisomers are identical except that they are mirror images of one another.
  • a specific stereoisomer may also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture.
  • a 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which may occur where there has been no stereoselection or stereospeciflcity in a chemical reaction or process.
  • racemic mixture and racemate refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
  • protecting group refers to a substituent that is commonly employed to block or protect a particular functionality while other functional groups react on the compound.
  • an "amino-protecting group” is a substituent attached to an amino group that blocks or protects the amino functionality in the compound.
  • Suitable amino- protecting groups include, but are not limited to, acetyl, trifluoroacetyl, t-butoxycarbonyl (BOC), benzyloxycarbonyl (CBZ) and 9-fluorenylmethylenoxycarbonyl (Fmoc).
  • the experimental results herein are a strong indication that therapies aimed at eliminating intracellular bacteria will improve clinical success.
  • the present invention provides a unique therapeutic that selectively kills S. aureus organisms that have invaded intracellular compartments of host cells.
  • the present invention demonstrates that such a therapeutic is efficacious in in-vivo models where conventional antibiotics like vancomycin fail.
  • the invention provides an antibacterial therapy that aims to prevent antibiotic escape by targeting populations of bacteria that evade conventional antibiotic therapy.
  • the novel antibacterial therapy is achieved with an Antibody- Antibiotic Conjugate (AAC) in which an antibody specific for cell wall components found on S. aureus (including MRSA) is chemically linked to a potent antibiotic (a derivative of rifamycin).
  • AAC Antibody- Antibiotic Conjugate
  • the antibiotic is joined to the antibody via a protease-cleavable, non-peptide linker that is designed to be cleaved by proteases, including cathepsin B, a lysosomal protease found in most mammalian cell types (Dubowchik et al (2002) Bioconj. Chem. 13:855-869).
  • a diagram of the AAC with its 3 components is depicted in Figure 2. Not to be limited by any one theory, one mechanism of action of the AAC is schematized in Figure 3.
  • the AAC acts as a pro-drug in that the antibiotic is inactive (due to the large size of the antibody) until the linker is cleaved. Since a significant proportion of S. aureus found in a natural infection is taken up by host cells, primarily neutrophils and macrophages, at some point during the course of infection in the host, the time spent inside host cells provides a significant opportunity for the bacterium to evade antibiotic activity.
  • the AACs of the invention are designed to bind to S. aureus and release the antibiotic inside the phagolysosome after bacteria are taken up by host cells.
  • AAC are able to concentrate the active antibiotic specifically in a location where S. aureus is poorly treated by conventional antibiotics. While the invention is not limited or defined by an particular mechanism of action, the AACs improve antibiotic activity via three potential mechanisms: (1) The AAC delivers antibiotic inside mammalian cells that take up the bacteria, thereby increasing the potency of antibiotics that diffuse poorly into the phagolysosomes where bacteria are sequestered. (2) AAC opsonize bacteria thereby increasing uptake of free bacteria by phagocytic cells, and release the antibiotic locally to kill the bacteria while they are sequestered in the phagolysosome.
  • AAC improve the half-life of antibiotics in vivo (improved pharmacokinetics) by linking the antibiotic to an antibody, as compared to antibiotics which are cleared rapidly from serum. Improved pharmacokinetics of AAC enable delivery of sufficient antibiotic in regions where S. aureus is concentrated while limiting the overall dose of antibiotic that needs to be administered systemically. This property should permit long-term therapy with AAC to target persistent infection with minimal antibiotic side effects.
  • An antibody-antibiotic conjugate compound comprising an anti-wall teichoic acid (WTA) antibody, covalently attached by a protease-cleavable, non-peptide linker to a rifamycin-type antibiotic.
  • WTA anti-wall teichoic acid
  • Ab is the anti-wall teichoic acid antibody
  • PML is the protease-cleavable, non-peptide linker having the formula:
  • Str is a stretcher unit
  • PM is a peptidomimetic unit
  • Y is a spacer unit
  • abx is the rifamycin-type antibiotic
  • p is an integer from 1 to 8.
  • the rifamycin-type antibiotic may be a rifalazil-type antibiotic.
  • the rifamycin-type antibiotic may comprise a quaternary amine attached to the protease-cleavable, non-peptide linker.
  • R is H, C1-C12 alkyl, or C(0)CH 3 ;
  • R 1 is OH
  • R 1 and R 2 form a five- or six-membered fused heteroaryl or heterocyclyl, and optionally forming a spiro or fused six-membered heteroaryl, heterocyclyl, aryl, or carbocyclyl ring, wherein the spiro or fused six-membered heteroaryl, heterocyclyl, aryl, or carbocyclyl ring is optionally substituted H, F, CI, Br, I, Cr-C 12 alkyl, or OH;
  • PML is the protease-cleavable, non-peptide linker attached to R or the fused heteroaryl or heterocyclyl formed by R 1 and R 2 ;
  • WTA anti-wall teichoic acid
  • antibiotic moieties which may be conjugated via a reactive linker moiety to an antibody molecule may be limited by the number of free cysteine residues, which are introduced by the methods described herein.
  • Exemplary AAC comprise antibodies which have 1, 2, 3, or 4 engineered cysteine amino acids (Lyon, R. et al (2012) Methods in Enzym. 502: 123-138).
  • Anti-WTA Abs and conjugated anti-WTA antibodies that bind to WTA expressed on a number of Gm+ bacteria including Staphylococcus aureus.
  • Anti-WTA antibodies may be selected and produced by the methods taught in US 8283294; Meijer PJ et al (2006) J Mol Biol. 358(3):764-72; Lantto J, et al (2011) J Virol. 85(4):1820-33, and in Examples 3-4 below.
  • the cell wall of Gram-positive bacteria is comprised of thick layer of multiple peptidoglycan (PGN) sheaths that not only stabilize the cell membrane but also provide many sites to which other molecules could be attached (Figure 4).
  • PPN peptidoglycan
  • a major class of these cell surface glycoproteins are teichoic acids ("TA”), which are phosphate-rich molecules found on many glycan-binding proteins (GPB).
  • TA come in two types: (1) lipo teichoic acid (“LTA”), which are anchored to the plasma membrane and extend from the cell surface into the peptidoglycan layer; and (2) wall TA (“WTA”), which are covalently attached to peptidoglycan and extend through and beyond the cell wall (Figure 4).
  • LTA lipo teichoic acid
  • WTA wall TA
  • WTA can account for as much as 60% of the total cell wall mass in GPB. As a result, it presents a highly expressed cell surface antigen.
  • WTA The chemical structures of WTAs vary among organisms.
  • S. aureus WTA is covalently linked to the 6-OH of N-acetyl muramic acid (MurNAc) via a disaccharide composed of N-acetylglycosamine (GlcNAc)-l-P and N-acetylmannoseamine (ManNAc), which is followed by about two or three units of glycerol-phosphates (Figure 5)
  • the actual WTA polymer is then composed of about 11-40 ribitol-phosphate (Rbo-P) repeating units.
  • the step-wise synthesis of WTA is first initiated by the enzyme called TagO, and S.
  • the repeating units can be further tailored with D-alanine (D-Ala) at C2-OH and/or with N- acetylglucosamine (GlcNAc) at the C4-OH position via a- (alpha) or -(beta) glycosidic linkages.
  • D-Ala D-alanine
  • GlcNAc N- acetylglucosamine
  • the glycosidic linkages could be -, ⁇ -, or a mixture of the two anomers.
  • Gtfs aureus-derived glycosyltransferases
  • the novel therapeutic compositions of the invention were developed to prevent this method of antibiotic evasion by using a S. aureus specific antibody to tether an antibiotic onto the bacteria such that when the bacteria is engulfed or otherwise internalized by a host cell in vivo, it brings the antibiotic along into the host cell.
  • the anti-WTA antibody of an AAC of the present invention can be an anti-WTAa or anti-WTAp antibody.
  • the exemplary anti-WTA Abs provided throughout the specification were cloned from B cells from S. aureus infected patients (as taught in the Examples below).
  • the anti-WTA and anti-Staph aureus Abs are human monoclonal antibodies.
  • the AAC or TAC of the invention encompass chimeric Abs and humanized Abs comprising the CDRs of the present WTA Abs.
  • the WTA Abs conjugated to antibiotics to generate AACs can be of any isotype except IgM.
  • the WTA Abs are of the human IgG isotype.
  • the WTA Abs are human IgGl .
  • S4497 may also be referred to with a preceding "S", e.g., S4497; both names refer to the same antibody which is the wild type (WT) unmodified sequence of the antibody.
  • Variants of the antibody are indicated by a "v" following the antibody no., e.g., 4497v8.
  • the amino acid sequences shown are the original, unmodified/unaltered sequences.
  • These Abs can be altered at one or more residues, for example to improve the pK, stability, expression, manufacturability (e.g., as described in the Examples below), while maintaining substantially about the same or improved binding affinity to the antigen as compared to the wild type, unmodified antibody.
  • Variants of the present WTA antibodies having conservative amino acid substitutions are encompassed by the invention.
  • the CDR numbering is according to Kabat and the Constant domain numbering is according to EU numbering.
  • the anti-WTA antibodies of the invention may comprise engineered Cys in one or both L and H chains for conjugation to linker-antibiotic intermediate, as taught below.
  • Figure 11A and Figure 1 IB provide the amino acid sequence alignment of the Light chain Variable regions (VL) and the Heavy chain Variable region (VH), respectively of four human anti-WTA alpha antibodies.
  • the CDR sequences CDR LI, L2, L3 and CDR HI, H2, H3 according to Kabat numbering are underlined.
  • Table 1A Light chain CDR sequences of the anti-WTAa.
  • Table IB Heavy chain CDR sequences of the anti-WTAa.
  • DIQMTOSPDSLAVSLGERATF CKSSOSVLSRANNNYYVAWYQHKPGOPPKLLIYW ASTREFGVPDRFSGSGSGTDFTLTINSLQAEDVAVYYCOOYYTSRRTFGOGTKVEIK
  • OVQLOQSRVEVKRPGTSVKVSC TSGYTFSDYYIHWVRLAPGOGLELMGWINPNTG GTYYAOKFRDRVTMTRDTSIATAYLEMSSLTSDDTAVYYCAKDCGRGGLRDIWGPG TMVTVSS (SEQ ID NO. 28)
  • EVOLVOSGAEVKKPGTSVKVSCI ASGYTFTDYYIHWVRLAPGOGLELMGWF PNTG GTNYAOKFQGRVTMTRDTSIATAYMELSSLTSDDTAVYYCAKDCGNAGLRDIWGQ GTTVTVSS (SEQ ID NO. 30)
  • the invention provides an isolated monoclonal antibody that binds wall teichoic acid alpha (WTAa) comprising a light chain and a H chain, the L chain comprising CDR LI, L2, L3 and the H chain comprising CDR HI, H2, H3 wherein the CDR LI, L2, L3 and HI, H2, H3 comprise the amino acid sequences of the CDRs of each of Abs 4461 (SEQ ID NO. 1-6), 4624 (SEQ ID NO. 7-12), 4399 (SEQ ID NO. 13-18), and 6267 (SEQ ID NO. 19-24) respectively, as shown in Table 1A and Table IB above.
  • WTAa wall teichoic acid alpha
  • the isolated monoclonal Ab that binds WTAa comprises a H chain variable region (VH) and a L chain variable region (VL), wherein the VH comprises at least 95% sequence identity over the length of the VH region sequence of the each of antibodies 4461, 4624, 4399, and 6267, respectively.
  • the sequence identity is 96%, 97%, 98%, 99% or 100%.
  • the present invention also provides an AAC comprising an anti-WTA beta antibody from the list of Abs exemplified in Figure 12.
  • the isolated anti-WTA beta monoclonal Ab comprises the CDR LI, L2, L3 and HI, H2, H3 selected from the group consisting of the CDRs of each of the 13 Abs in Figure 12.
  • the invention provides an isolated anti-WTA beta Abs comprising at least 95% sequence identity over the length of the V region domains of each of 13 antibodies.
  • the sequence identity is 96%, 97%, 98%, 99% or 100%.
  • Figures 13A-1 and 13A-2 provide the amino acid sequence of the full length L chain of anti-WTA beta Ab 6078 (unmodified) and its variants, v2, v3, v4.
  • L chain variants that contain an engineered Cys are indicated by the C in the black box the end of the constant region (at EU residue no. 205 in this case).
  • the variant designation, e.g., v2LC-Cys means variant 2 containing a Cys engineered into the L chain.
  • HCLC-Cys means both the H and L chains of the antibody contain an engineered Cys.
  • Figures 13B-1 to 13B-4 show an alignment of the full length H chain of anti-WTA beta Ab 6078 (unmodified) and its variants, v2, v3, v4 which have changes in the first or first 2 residues of the H chain.
  • H chain variants that contain an engineered Cys are indicated by the C in the black box the end of the constant region (at EU residue no. 118).
  • VL Light Chain Variable Region
  • G (SEQ ID NO.l 16) wherein X can be M, I or V.
  • the invention provides an isolated anti-WTA beta antibody comprising a heavy chain and a light, wherein the heavy chain comprises a VH having at least 95% sequence identity to SEQ ID NO. 112. In an additional embodiment, this antibody further comprises a VL having at least 95% sequence identity to SEQ ID NO. 111.
  • the anti-WTA beta antibody comprises a light chain and a heavy chain, wherein the L chain comprises a VL of SEQ ID NO. I l l and the H chain comprises a VH of SEQ ID NO. 112.
  • the isolated anti-WTA beta antibody comprises a L chain of SEQ ID NO. 113 and a H chain of SEQ ID NO. 114.
  • the 6078 Cys-engineered H and L chain variants can be paired in any of the following combinations to form full Abs for conjugating to linker- Abx intermediates to generate anti-WTA AACs of the invention.
  • the unmodified L chain (SEQ ID NO.l 13) can be paired with a Cys-engineered H chain variant of SEQ ID NO. 117; the variant can be one wherein X is M, I or V.
  • the Cys-engineered L chain of SEQ ID NO. 115 can be paired with: the H chain of SEQ ID NO.l 14; a H chain variant of SEQ ID NO.l 16; or a Cys-engineered H chain variant of SEQ ID NO.117 (in this version, both H and L chains are Cys engineered).
  • the anti-WTA beta antibody and the anti-WTA beta AAC of the invention comprises a L chain of SEQ ID NO. 115 and H chain of SEQ ID NO.116.
  • Figures 14A-1 and 14A-2 provide the full length L chain of anti-WTA beta Ab 4497 (unmodified) and its v8 variants.
  • L chain variants that contain an engineered Cys are indicated by the C in the black box near the end of the constant region (at EU residue no. 205).
  • Figures 14B-1, 14B-2, 14B-3 show an alignment of the full length H chain of anti- WTA beta Ab 4497 (unmodified) and its v8 variant with D altered to E in CDR H3 position 96, with or without the engineered Cys.
  • H chain variants that contain an engineered Cys are indicated by the C in the black box at the beginning of the constant region CHI (at EU residue no. 118 in this case).
  • Unmodified CDR H3 is GDGGLDD (SEQ ID NO.104); 4497v8 CDR H3 is GEGGLDD (SEQ ID NO.l 18).
  • Another isolated anti-WTA beta antibody provided by the invention comprises a heavy chain and a light, wherein the heavy chain comprises a VH having at least 95% sequence identity to SEQ ID NO. 120. In an additional embodiment, this antibody further comprises a VL having at least 95% sequence identity to SEQ ID NO. 119.
  • the anti-WTA beta antibody comprises a light chain and a heavy chain, wherein the L chain comprises a VL of SEQ ID NO. 119 and the H chain comprises a VH of SEQ ID NO. 120.
  • the isolated anti-WTA beta antibody comprises a L chain of SEQ ID NO. 121 and a H chain of SEQ ID NO. 122.
  • the 4497 Cys-engineered H and L chain variants can be paired in any of the following combinations to form full Abs for conjugating to linker- Abx intermediates to generate anti-WTA AACs of the invention.
  • the unmodified L chain (SEQ ID NO.121) can be paired with a Cys-engineered H chain variant of SEQ ID NO. 124.
  • the Cys-engineered L chain of SEQ ID NO. 123 can be paired with: the H chain variant of SEQ ID NO.157; or a Cys-engineered H chain variant of SEQ ID NO.124 (in this version, both H and L chains are Cys engineered).
  • the anti-WTA beta antibody and the anti-WTA beta AAC of the invention comprises a L chain of SEQ ID NO. 123.
  • Yet another embodiment is an antibody that binds to the same epitope as each of the anti-WTA alpha Abs of Figure 1 1A and Figure 1 IB. Also provided is an antibody that binds to the same epitope as each of the anti-WTA beta Abs of Figure 12, Figures 13A and 13B, and Figures 14A and 14B.
  • Binding of anti-WTA antibodies to WTA is influenced by the anomeric orientation of GlcNAc-sugar modifications on WTA.
  • WTA are modified by N-acetylglucosamine (GlcNAc) sugar modifications at the C4-OH position via a- or ⁇ -glycosidic linkages, by
  • TarM glycosyltransferase or TarS glycosyltransferase were subjected to immunob lotting analysis with antibodies against WTA.
  • WTA antibody (S7 74) specific to a-GlcNAc modifications on WTA does not bind to cell wall preparation from ATarM strain (Meijer, P. J., et al. (2006) "Isolation of human antibody repertoires with preservation of the natural heavy and light chain pairing.” Journal of molecular biology 358, 764-772).
  • a WTA antibody (S4462) specific to ⁇ -GlcNAc modifications on WTA does not bind to cell wall preparation from ATarS strain.
  • both these antibodies do not bind to cell wall preparations from a deletion strain lacking both glycosyltransferases (ATarM/ATarS) and also the strain lacking any WTA (ATagO).
  • ATagO glycosyltransferases
  • antibodies have been characterized as anti- ot-GlcNAc WTA mAbs, or as anti- ⁇ -GlcNAc WTA mAbs as listed in the Table in Figures 6 A and 6B.
  • Cysteine amino acids may be engineered at reactive sites in an antibody and which do not form intrachain or intermolecular disulfide linkages (Junutula, et al., 2008b Nature
  • the engineered cysteine thiols may react with linker reagents or the linker-antibiotic intermediates of the present invention which have thiol-reactive, electrophilic groups such as maleimide or alpha-halo amides to form AAC with cysteine engineered antibodies (THIOMABTM or thioMabs) and the antibiotic (abx) moieties.
  • the location of the antibiotic moiety can thus be designed, controlled, and known.
  • the antibiotic loading can be controlled since the engineered cysteine thiol groups typically react with thiol-reactive linker reagents or linker-antibiotic intermediates in high yield.
  • cysteine engineered anti-WTA antibodies e.g., "thioMAbs”
  • cysteine residues occur at accessible sites of the antibody.
  • reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as antibiotic moieties or linker-antibiotic moieties, to create an immunoconjugate, as described further herein.
  • any one or more of the following residues may be substituted with cysteine, including V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region.
  • cysteine engineered heavy chain Al 18C (SEQ ID NO: 149) and light chain V205C (SEQ ID NO: 151) mutants of an anti-WTA antibody are shown.
  • Cysteine engineered anti-WTA antibodies may be generated as described (Junutula, et al, 2008b Nature Biotech., 26(8):925-932; US 7521541; US- 2011/0301334.
  • the invention provides an isolated anti-WTA antibody for conjugation to produce an AAC, the antibody comprising a heavy chain and a light, wherein the heavy chain comprises a wild-type heavy chain constant region sequence or cysteine- engineered mutant (ThioMab) and the light chain comprises a wild-type light chain constant region sequence or cysteine-engineered mutant (ThioMab).
  • the heavy chain has at least 95% sequence identity to:
  • the AAC of the invention include cysteine engineered anti-WTA antibodies where one or more amino acids of a wild-type or parent anti-WTA antibody are replaced with a cysteine amino acid. Any form of antibody may be so engineered, i.e. mutated.
  • a parent Fab antibody fragment may be engineered to form a cysteine engineered Fab, referred to herein as "ThioFab.”
  • a parent monoclonal antibody may be engineered to form a "ThioMab.”
  • a single site mutation yields a single engineered cysteine residue in a ThioFab, while a single site mutation yields two engineered cysteine residues in a ThioMab, due to the dimeric nature of the IgG antibody.
  • Mutants with replaced (“engineered”) cysteine (Cys) residues are evaluated for the reactivity of the newly introduced, engineered cysteine thiol groups.
  • the antibodies described herein may be produced using host cells in culture.
  • Host cells may be transformed with vectors (expression or cloning vectors) comprising one or more nucleic acids encoding the antibodies described herein.
  • the cells may be cultured under conditions suitable for producing the antibodies, and antibodies produced by the cell may be further purified.
  • Suitable cells for producing antibodies may include prokaryotic, yeast, or higher eukaryotic (e.g., mammalian) cells.
  • a mammalian cell a human or a non-human mammalian cell
  • a Chinese Hamster Ovary (CHO) cell is used.
  • Mammalian cells may be cultured, and propagation of mammalian cells in culture (tissue culture) has become a routine procedure.
  • mammalian host cell lines may include, without limitation, monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); mouse Sertoli cells (TM4, Mather, Biol. Reprod.
  • monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3 A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et ah, Annals N. Y. Acad. Sci.
  • MRC 5 cells MRC 5 cells
  • FS4 cells a human hepatoma line
  • Hep G2 human hepatoma line
  • Other useful mammalian host cell lines include myeloma cell lines such as NS0 and Sp2/0.
  • Yazaki and Wu Methods in Molecular Biology, Vol. 248 (B. . C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 255-268.
  • Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, duckweed (Leninaceae), alfalfa (M. truncatula), and tobacco can also be utilized as hosts.
  • Suitable prokaryotic cells for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis ⁇ e.g., B. licheniformis 4 IP disclosed in DD 266,710 published 12 Apr. 1989), Pseudomonas such as P.
  • Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus
  • Salmonella e.g., Salmonella typhimurium
  • Serratia e.g.
  • E. coli 294 ATCC 31,446
  • E. coli B E. coli XI 776
  • s. coli W3110 ATCC 27,325
  • eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors.
  • Saccharomyces cerevisiae or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms.
  • Kluyveromyces hosts such as, e.g., K. lactis, K.fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24, 178), K. waltii (ATCC 56,500), K. drosophilarum (ATCC 36,906), K.
  • thermotolerans, and marxianus yarrowia (EP 402,226); Pichia pastoris (EP 183,070); Candida; Trichoderma reesia (EP 244,234); Neurospora crassa; Schwanniomyces such as Schwanniomyces occidentalis; and filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium, and Aspergillus hosts such as A. nidulans and A. niger.
  • the antibiotic moiety (abx) of the antibody-antibiotic conjugates (AAC) of the invention is a rifamycin-type antibiotic or group that has a cytotoxic or cytostatic effect.
  • the rifamycins are a group of antibiotics that are obtained either naturally by the bacterium, Nocardia mediterranei, Amycolatopsis mediterranei or artificially. They are a subclass of the larger Ansamycin family which inhibit bacterial RNA polymerase (Fujii et al (1995)
  • Rifamycins are particularly effective against mycobacteria, and are therefore used to treat tuberculosis, leprosy, and mycobacterium avium complex (MAC) infections.
  • the rifamycin-type group includes the "classic" rifamycin drugs as well as the rifamycin derivatives rifampicin (rifampin, CA Reg. No. 13292-46-1), rifabutin (CA Reg. No.
  • Rifamycin-type antibiotics share the detrimental property of resistance development (Wichelhaus et al (2001) J. Antimicrob. Chemother. 47:153-156).
  • Rifamycins were first isolated in 1957 from a fermentation culture of Streptomyces mediterranei. About seven rifamycins were discovered, named Rifamycin A, B, C, D, E, S, and SV (US 3150046).
  • Rifamycin B was the first introduced commercially and was useful in treating drug-resistant tuberculosis in the 1960s.
  • Rifamycins have been used for the treatment of many diseases, the most important one being HIV-related Tuberculosis.
  • rifamycins Due to the large number of available analogues and derivatives, rifamycins have been widely utilized in the elimination of pathogenic bacteria that have become resistant to commonly used antibiotics. For instance, Rifampicin is known for its potent effect and ability to prevent drug resistance. It rapidly kills fast-dividing bacilli strains as well as "persisters" cells, which remain biologically inactive for long periods of time that allow them to evade antibiotic activity. In addition, rifabutin and rifapentine have both been used against tuberculosis acquired in HIV-positive patients.
  • Antibiotic moieties (abx) of the Formula I antibody-antibiotic conjugates are rifamycin-type moieties having the structure:
  • R is H, C1-C12 alkyl, or C(0)CH 3 ;
  • R 1 is OH
  • R 1 and R 2 form a five- or six-membered fused heteroaryl or heterocyclyl, and optionally forming a spiro or fused six-membered heteroaryl, heterocyclyl, aryl, or carbocyclyl ring, wherein the spiro or fused six-membered heteroaryl, heterocyclyl, aryl, or carbocyclyl ring is optionally substituted H, F, CI, Br, I, C1-C12 alkyl, or OH; and
  • non-peptide linker PML is covalently attached to R 2 .
  • R 3 is independently selected from H and C1-C12 alkyl
  • R 4 is selected from H, F, CI, Br, I, C1-C12 alkyl, and OH
  • Z is selected from H, N(Ci-C 12 alkyl), O and S; and where the non-peptide linker PML is covalently attached to the nitrogen atom of N(R 3 ) 2 .
  • R is selected from H and C 1 -C 12 alkyl; and where the non-peptide linker PML is covalently attached to the nitrogen atom of NR 5 .
  • R 5 is selected from H and C - C 12 alkyl; and where the non-peptide linker PML is covalently attached to the nitrogen atom of NR 5 .
  • R 5 is selected from H and Cr-C 12 alkyl; and where the non-peptide linker PML is covalently attached to the nitrogen atom of NR 5 .
  • pipBOR An embodiment of a benzoxazinorifamycin-type moiety, referred to herein as pipBOR, is:
  • R is independently selected from H and C1-C12 alkyl; and where the peptide linker PML is covalently attached to the nitrogen atom of N(R ) 2 .
  • dimethylpipBOR An embodiment of a benzoxazinorifamycin-type moiety, referred to herein as dimethylpipBOR, is:
  • non-peptide linker PML is covalently attached to the dimethylamino nitrogen atom.
  • the semi-synthetic derivative rifamycin S, or the reduced, sodium salt form rifamycin SV can be converted to Rifalazil-type antibiotics in several steps, where R is H, or Ac, R 3 is independently selected from H and Ci-Ci 2 alkyl; R 4 is selected from H, F, CI, Br, I, C1-C12 alkyl, and OH; and Z is selected from H, N(Ci-C 12 alkyl), O and S (see, e.g., Fig. 23A and B, and Fig. 25A and B in WO 2014/194247) .
  • Benzoxazinorifamycin (BOR), benzthiazinorifamycin (BTR), and benzdiazinorifamycin (BDR) analogs that contain substituents are numbered according to the numbering scheme provided in formula A at column 28 in US 7271165, which is incorporated by reference for this purpose.
  • 25-O-deacetyl rifamycin is meant a rifamycin analog in which the acetyl group at the 25-position has been removed.
  • Analogs in which this position is further derivatized are referred to as a "25-0-deacetyl-25-(substituent)rifamycin", in which the nomenclature for the derivatizing group replaces "substituent" in the complete compound name.
  • Rifamycin-type antibiotic moieties can be synthesized by methods analogous to those disclosed in US 4610919; US 4983602; US 5786349; US5981522; US 4859661; US
  • Rifamycin-type antibiotic moieties can be screened for antimicrobial activity by measuring their minimum inhibitory concentration (MIC), using standard MIC in vitro assays (Tomioka et al., (1993) Antimicrob. Agents Chemother. 37:67).
  • a "protease-cleavable, non-peptide linker” is a bifunctional or multifunctional moiety which is covalently attached to one or more antibiotic moieties (abx) and an antibody unit (Ab) to form antibody-antibiotic conjugates (AAC) of Formula I.
  • Protease-cleavable, non-peptide linkers in AAC are substrates for cleavage by intracellular proteases, including under lysosomal conditions.
  • Proteases includes various cathepsins and caspases. Cleavage of the non-peptide linker of an AAC inside a cell may release the rifamycin-type antibiotic with anti-bacterial effects.
  • Antibody-antibiotic conjugates can be conveniently prepared using a linker reagent or linker-antibiotic intermediate having reactive functionality for binding to the antibiotic (abx) and to the antibody (Ab).
  • a cysteine thiol of a cysteine engineered antibody (Ab) can form a bond with a functional group of a linker reagent, an antibiotic moiety or antibiotic-linker intermediate.
  • the PML moiety of an AAC may comprise one amino acid residue.
  • the PML moiety of an AAC comprises a peptidomimetic unit.
  • a linker reagent or linker-antibiotic intermediate has a reactive site which has an electrophilic group that is reactive to a nucleophilic cysteine present on an antibody.
  • the cysteine thiol of the antibody is reactive with an electrophilic group on a linker reagent or linker-antibiotic, forming a covalent bond.
  • Useful electrophilic groups include, but are not limited to, maleimide and haloacetamide groups.
  • Cysteine engineered antibodies react with linker reagents or linker-antibiotic intermediates, with electrophilic functional groups such as maleimide or a-halo carbonyl, according to the conjugation method at page 766 of Klussman, et al (2004), Bioconjugate Chemistry 15(4):765-773, and according to the protocol of Example 19.
  • the reactive group of a linker reagent or linker-antibiotic intermediate contains a thiol-reactive functional group that can form a bond with a free cysteine thiol of an antibody.
  • thiol-reaction functional groups include, but are not limited to, maleimide, a-haloacetyl, activated esters such as succinimide esters,
  • a linker reagent or antibiotic-linker intermediate has a reactive functional group which has a nucleophilic group that is reactive to an electrophilic group present on an antibody.
  • Useful electrophilic groups on an antibody include, but are not limited to, pyridyl disulfide, aldehyde and ketone carbonyl groups.
  • the heteroatom of a nucleophilic group of a linker reagent or antibiotic-linker intermediate can react with an electrophilic group on an antibody and form a covalent bond to an antibody unit.
  • nucleophilic groups on a linker reagent or antibiotic-linker intermediate include, but are not limited to, hydrazide, oxime, amino, thiol, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide.
  • the electrophilic group on an antibody provides a convenient site for attachment to a linker reagent or antibiotic-linker intermediate.
  • a PML moiety may comprise one or more linker components.
  • linker components include a single amino acid such as citrulline (“cit”), 6-maleimidocaproyl (“MC”), maleimidopropanoyl (“MP”), and p-aminobenzyloxycarbonyl (“PAB”), N- succinimidyl 4-(2-pyridylthio) pentanoate (“SPP”), and 4-(N-maleimidomethyl) cyclohexane-1 carboxylate (“MCC”).
  • cit citrulline
  • MC 6-maleimidocaproyl
  • MP maleimidopropanoyl
  • PAB p-aminobenzyloxycarbonyl
  • SPP N- succinimidyl 4-(2-pyridylthio) pentanoate
  • MCC 4-(N-maleimidomethyl) cyclohexane-1 carboxylate
  • the linker may be substituted with groups that modulate solubility or reactivity.
  • a charged substituent such as sulfonate (-SO 3 ) or ammonium, may increase water solubility of the reagent and facilitate the coupling reaction of the linker reagent with the antibody or the antibiotic moiety, or facilitate the coupling reaction of Ab-L (antibody-linker intermediate) with abx, or abx-L (antibiotic-linker intermediate) with Ab, depending on the synthetic route employed to prepare the AAC.
  • the AAC of the invention expressly contemplate, but are not limited to, those prepared with linker reagents: BMPEO, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, sulfo-SMPB, SVSB (succinimidyl-(4- vinylsulfone)benzoate), and bis-maleimide reagents such as DTME, BMB, BMDB, BMH, BMOE, BM(PEG) 2 , and BM(PEG) 3 .
  • linker reagents such as DTME, BMB, BMDB, BMH, BMOE, BM(PEG) 2 ,
  • Bis-maleimide reagents allow the attachment of the thiol group of a cysteine engineered antibody to a thiol-containing antibiotic moiety, label, or linker intermediate, in a sequential or convergent fashion.
  • Other functional groups besides maleimide, which are reactive with a thiol group of a cysteine engineered antibody, antibiotic moiety, or linker-antibiotic intermediate include iodoacetamide, bromoacetamide, vinyl pyridine, disulfide, pyridyl disulfide, isocyanate, and isothiocyanate.
  • Useful linker reagents can also be obtained via other commercial sources, such as Molecular Biosciences Inc. (Boulder, CO), or synthesized in accordance with procedures described in Toki et al (2002) J. Org. Chem. 67:1866-1872; Dubowchik, et al. (1997) Tetrahedron Letters, 38:5257-60; Walker, M.A. (1995) J. Org. Chem. 60:5352-5355; Frisch et al (1996) Bioconjugate Chem. 7: 180-186; US 6214345; WO 02/088172; US 2003130189; US2003096743; WO 03/026577; WO 03/043583; and WO 04/032828.
  • the PML moiety of an AAC comprises a dendritic type linker for covalent attachment of more than one antibiotic moiety through a branching
  • Dendritic linkers can increase the molar ratio of antibiotic to antibody, i.e. loading, which is related to the potency of the AAC.
  • a cysteine engineered antibody bears only one reactive cysteine thiol group, a multitude of antibiotic moieties may be attached through a dendritic linker.
  • the protease-cleavable, non-peptide linker PML has the formula:
  • Str is a stretcher unit
  • PM is a peptidomimetic unit
  • Y is a spacer unit
  • abx is the rifamycin-type antibiotic
  • p is an integer from 1 to 8.
  • a stretcher unit "Str” has the formula:
  • PM has the formula:
  • R 7 and R 8 together form a C3-C7 cycloalkyl ring
  • AA is an amino acid side chain selected from H, -CH3, -CL ⁇ CeHs),
  • spacer unit Y comprises para-aminobenzyl (PAB) or para- aminobenzyloxycarbonyl (PABC).
  • PAB para-aminobenzyl
  • PABC para- aminobenzyloxycarbonyl
  • a spacer unit allows for release of the antibiotic moiety without a separate hydrolysis step.
  • a spacer unit may be "self-immolative" or a "non-self-immolative.”
  • a spacer unit of a linker comprises a p-aminobenzyl unit (PAB).
  • PAB p-aminobenzyl unit
  • a p-aminobenzyl alcohol is attached to an amino acid unit via an amide bond, a carbamate, methylcarbamate, or carbonate between the p-aminobenzyl group and the antibiotic moiety (Hamann et al. (2005) Expert Opin. Ther. Patents (2005) 15: 1087-1103).
  • the spacer unit is p-aminobenzyloxycarbonyl (PAB).
  • the antibiotic forms a quaternary amine, such as the
  • linker-antibiotic intermediates PLA-1 to 4 from Table 2.
  • the quaternary amine group may modulate cleavage of the antibiotic moiety to optimize the antibacterial effects of the AAC.
  • the antibiotic is linked to the PABC spacer unit of the non-peptide linker PML, forming a carbamate functional group in the AAC.
  • carbamate functional group may also optimize the antibacterial effects of the AAC.
  • PABC carbamate linker-antibiotic intermediates PLA-5 and PLA-6 from Table 2.
  • self-immolative spacers include, but are not limited to, aromatic compounds that are electronically similar to the PAB group such as 2-aminoimidazol-5- methanol derivatives (US 7375078; Hay et al. (1999) Bioorg. Med. Chem. Lett. 9:2237) and ortho- or para-aminobenzylacetals.
  • Spacers can be used that undergo cyclization upon amide bond hydrolysis, such as substituted and unsubstituted 4-aminobutyric acid amides
  • Elimination of amine-containing drugs that are substituted at glycine is also exemplary of self-immolative spacers useful in AAC.
  • the amount of active antibiotic released from cleavage of AAC can be measured by the Caspase release assay of Example 8.
  • PML Linker-antibiotic intermediates (PLA) of Formula II and Table 2 were prepared by coupling a rifamycin-type antibiotic moiety with a linker reagent, Examples 11-21.
  • Linker reagents were prepared by methods described in WO 2012/113847; US 7659241; US 7498298; US 20090111756; US 2009/0018086; US 6214345; Dubowchik et al (2002) Bioconjugate Chem. 13(4):855-869
  • Cysteine engineered, anti-WTA antibodies were linked via the free cysteine thiol group to derivatives of rifamycin, termed pipBOR and others, via a protease cleavable, non- peptide linker to form the antibody-antibiotic conjugate compounds (AAC) in Table 3.
  • the linker is designed to be cleaved by lysosomal proteases including cathepsins B, D and others, Generation of the linker-antibiotic intermediate consisting of the antibiotic and the PML linker and others, is described in detail in Examples 11-21.
  • the linker is designed such that cleavage of the amide bond at the PAB moiety separates the antibody from the antibiotic in an active state.
  • dimethylpipBOR is identical to the "pipBOR” AAC except for the dimethylated amino on the antibiotic and the oxycarbonyl group on the linker.
  • Figure 3 shows a possible mechanism of drug activation for antibody-antibiotic conjugates (AAC).
  • Active antibiotic Ab
  • the Fab portion of the antibody in AAC binds S. aureus whereas the Fc portion of the AAC enhances uptake of the bacteria by Fc-receptor mediated binding to phagocytic cells including neutrophils and macrophages.
  • the linker may be cleaved by lysosomal proteases releasing the active antibiotic inside the phagolysosome.
  • AAC antibody-antibiotic conjugate
  • R is H, C1-C12 alkyl, or C(0)CH 3 ;
  • R 1 is OH
  • R 1 and R 2 form a five- or six-membered fused heteroaryl or heterocyclyl, and optionally forming a spiro or fused six-membered heteroaryl, heterocyclyl, aryl, or carbocyclyl ring, wherein the spiro or fused six-membered heteroaryl, heterocyclyl, aryl, or carbocyclyl ring is optionally substituted H, F, CI, Br, I, C 1 -C 12 alkyl, or OH;
  • PML is the protease-cleavable, non-peptide linker attached to R or the fused heteroaryl or heterocyclyl formed by R 1 and R 2 ;
  • WTA anti-wall teichoic acid
  • p is an integer from 1 to 8.
  • AAC antibody-antibiotic conjugate
  • R 3 is independently selected from H and C1-C12 alkyl
  • n 1 or 2;
  • R 4 is selected from H, F, CI, Br, I, C 1 -C 12 alkyl, and OH;
  • Z is selected from H, N(Ci-Ci 2 alkyl), O and S.
  • AAC antibody-antibiotic conjugate
  • R 5 is selected from H and C 1 -C 12 alkyl
  • n 0 or 1.
  • AAC antibody-antibiotic conjugate
  • R 5 is selected from H and C 1 -C 12 alkyl
  • n 0 or 1.
  • AAC antibody-antibiotic conjugate
  • R 5 is independently selected from H and C 1 -C 12 alkyl
  • n 0 or 1.
  • AAC antibody-antibiotic conjugate
  • R 3 is independently selected f om H and Cr-C 12 alkyl
  • n 1 or 2.
  • AAC antibody-antibiotic conjugate
  • AAC antibody-antibiotic conjugate
  • AAC antibody-antibiotic conjugate
  • AAC antibody-antibiotic conjugate
  • AAC antibody-antibiotic conjugate
  • Antibiotic loading is represented by p, the number of antibiotic (abx) moieties per antibody in a molecule of Formula I.
  • Antibiotic loading may range from 1 to 20 antibiotic moieties (D) per antibody.
  • the AAC of Formula I include collections or a pool of antibodies conjugated with a range of antibiotic moieties, from 1 to 20.
  • the average number of antibiotic moieties per antibody in preparations of AAC from conjugation reactions may be characterized by conventional means such as mass spectroscopy, ELISA assay, and HPLC.
  • the quantitative distribution of AAC in terms of p may also be determined. In some instances, separation, purification, and characterization of homogeneous AAC where p is a certain value from AAC with other antibiotic loadings may be achieved by means such as reverse phase HPLC or electrophoresis.
  • p may be limited by the number of attachment sites on the antibody.
  • an antibody may have only one or several cysteine thiol groups, or may have only one or several sufficiently reactive thiol groups through which a linker may be attached.
  • higher antibiotic loading e.g. p >5
  • the antibiotic loading for an AAC of the invention ranges from 1 to about 8; from about 2 to about 6; from about 2 to about 4; or from about 3 to about 5; about 4; or about 2.
  • an antibody may contain, for example, lysine residues that do not react with the antibiotic-linker intermediate or linker reagent, as discussed below. Generally, antibodies do not contain many free and reactive cysteine thiol groups which may be linked to an antibiotic moiety; indeed most cysteine thiol residues in antibodies exist as disulfide bridges. In certain embodiments, an antibody may be reduced with a reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine
  • DTT dithiothreitol
  • TCEP cysteine thiol groups
  • an antibody is subjected to denaturing conditions to reveal reactive nucleophilic groups such as lysine or cysteine.
  • AAC antibiotic/antibody ratio
  • DAR drug to antibody ratio
  • the resulting product is a mixture of AAC compounds with a distribution of one or more antibiotic moieties attached to an antibody.
  • the average number of antibiotics per antibody may be calculated from the mixture by a dual ELISA antibody assay, which is specific for antibody and specific for the antibiotic.
  • Individual AAC molecules may be identified in the mixture by mass spectroscopy and separated by HPLC, e.g. hydrophobic interaction chromatography (see, e.g., McDonagh et al (2006) Prot. Engr. Design & Selection 19(7):299- 307; Hamblett et al (2004) Clin. Cancer Res.
  • a homogeneous AAC with a single loading value may be isolated from the conjugation mixture by electrophoresis or chromatography.
  • Cysteine-engineered antibodies of the invention enable more homogeneous preparations since the reactive site on the antibody is primarily limited to the engineered cysteine thiol.
  • the average number of antibiotic moieties per antibody is in the range of about 1 to about 20. In some embodiments the range is selected and controlled from about 1 to 4.
  • An AAC of Formula I may be prepared by several routes employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1) reaction of a nucleophilic group of an antibody with a bivalent linker reagent to form Ab-L via a covalent bond, followed by reaction with an antibiotic moiety (abx); and (2) reaction of a nucleophilic group of an antibiotic moiety with a bivalent linker reagent, to form L-abx, via a covalent bond, followed by reaction with a nucleophilic group of an antibody.
  • Exemplary methods for preparing an AAC of Formula I via the latter route are described in US 7498298, which is expressly incorporated herein by reference.
  • Nucleophilic groups on antibodies include, but are not limited to: (i) N-terminal amine groups, (ii) side chain amine groups, e.g. lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated.
  • Amine, thiol, and hydroxyl groups are nucleophilic and capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents including: (i) active esters such as NHS esters, HOBt esters, haloformates, and acid halides; (ii) alkyl and benzyl halides such as haloacetamides; (iii) aldehydes, ketones, carboxyl, and maleimide groups.
  • active esters such as NHS esters, HOBt esters, haloformates, and acid halides
  • alkyl and benzyl halides such as haloacetamides
  • aldehydes, ketones, carboxyl, and maleimide groups are nucleophilic and capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents including: (i) active esters such as NHS esters, HOBt esters, hal
  • Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges.
  • Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol) or tricarbonylethylphosphine (TCEP), such that the antibody is fully or partially reduced.
  • a reducing agent such as DTT (dithiothreitol) or tricarbonylethylphosphine (TCEP)
  • TCEP tricarbonylethylphosphine
  • Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles.
  • Additional nucleophilic groups can be introduced into antibodies through modification of lysine residues, e.g., by reacting lysine residues with 2-iminothiolane (Traut's reagent), resulting in conversion of an amine into a thiol.
  • Reactive thiol groups may be
  • Antibody-antibiotic conjugates of the invention may also be produced by reaction between an electrophilic group on an antibody, such as an aldehyde or ketone carbonyl group, with a nucleophilic group on a linker reagent or antibiotic.
  • an electrophilic group on an antibody such as an aldehyde or ketone carbonyl group
  • nucleophilic groups on a linker reagent or antibiotic include, but are not limited to, hydrazide, oxime, amino, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide.
  • an antibody is modified to introduce electrophilic moieties that are capable of reacting with nucleophilic substituents on the linker reagent or antibiotic.
  • the sugars of glycosylated antibodies may be oxidized, e.g. with periodate oxidizing reagents, to form aldehyde or ketone groups which may react with the amine group of linker reagents or antibiotic moieties.
  • the resulting imine Schiff base groups may form a stable linkage, or may be reduced, e.g. by borohydride reagents to form stable amine linkages.
  • reaction of the carbohydrate portion of a glycosylated antibody with either galactose oxidase or sodium meta-periodate may yield carbonyl (aldehyde and ketone) groups in the antibody that can react with appropriate groups on the antibiotic (Hermanson, Bioconjugate Techniques).
  • antibodies containing N-terminal serine or threonine residues can react with sodium meta-periodate, resulting in production of an aldehyde in place of the first amino acid (Geoghegan & Stroh, (1992) Bioconjugate Chem. 3:138-146; US 5362852).
  • an aldehyde can be reacted with an antibiotic moiety or linker nucleophile.
  • Nucleophilic groups on an antibiotic moiety include, but are not limited to: amine, thiol, hydroxyl, hydrazide, oxime, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide groups capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents including: (i) active esters such as NHS esters, HOBt esters, haloformates, and acid halides; (ii) alkyl and benzyl halides such as haloacetamides; (iii) aldehydes, ketones, carboxyl, and maleimide groups.
  • AAC antibody-antibiotic conjugates
  • Table 3 The antibody-antibiotic conjugates (AAC) in Table 3 were prepared by conjugation of the described anti-WTA antibodies and linker-antibiotic intermediates of Table 2, and according to the described methods in Example 7.
  • AAC were tested for efficacy by in vitro macrophage assay (Example 9) and in vivo mouse kidney model (Example 10).
  • the anti-WTA-AACs of the invention are useful as antimicrobial agents effective against human and veterinary Staphylococci, for example S. aureus, S. saprophytics and S. simulans.
  • the AACs of the invention are useful to treat S. aureus infections.
  • S. aureus can cause metastatic infection in almost any organ. Secondary infections occur in about one-third of cases before the start of therapy (Fowler et al, (2003) Arch. Intern. Med. 163:2066-2072), and even in 10% of patients after the start of therapy (Khatib et al., (2006) Scand. J. Infect. Dis., 38:7-14).
  • Hallmarks of infections are large reservoirs of pus, tissue destruction, and the formation of abcesses (all of which contain large quantities of neutrophils). About 40% of patients develop complications if the bacteremia persists beyond three days.
  • the proposed mechanism of action of an AAC has been described above (under subheading Antibody- Antibiotic Conjugates).
  • the anti-WTA antibody-antibiotic conjugates (AAC) of the invention have significant therapeutic advantages for treating intracellular pathogens.
  • the AAC linker is cleaved by exposure to phagolysosomal enzymes, releasing an active antibiotic. Due to the confined space and relatively high local antibiotic concentration (about 10 4 per bacterium), the result is that the phagolysosome no longer supports the survival of the intracellular pathogen. Because the AAC is essentially an inactive prodrug, the therapeutic index of the antibiotic can be extended relative to the free (unconjugated) form.
  • the antibody provides pathogen specific targeting, while the cleavable linker is cleaved under conditions specific to the intracellular location of the pathogen.
  • the effect can be both directly on the opsonized pathogen as well as other pathogens that are co-localized in the phagolysosome.
  • Antibiotic tolerance is the ability of a disease-causing pathogen to resist killing by antibiotics and other antimicrobials and is mechanistically distinct from multidrug resistance (Lewis K (2007). "Persister cells, dormancy and infectious disease”. Nature Reviews Microbiology 5 (1): 48-56. doi: 10.1038/nrmicrol557).
  • the anti-WTA-AAC of the invention may be used to treat infection regardless of the intracellular compartment in which the pathogen survives.
  • anti-WTA-AACs of the invention could also be used to target Staphylococci bacteria in planktonic or biofilm form.
  • Bacterial infections treatable with antibody-antibiotic conjugates (AAC) of the invention include treating bacterial pulmonary infections, such as S.
  • aureus pneumonia can be in other parts of the body like the urinary tract, the bloodstream, a wound or a catheter insertion site.
  • the AACs of the invention are useful for difficult-to-treat infections that involve biofilms, implants or sanctuary sites (e.g., osteomyelitis and prosthetic joint infections), and high mortality infections such as hospital acquired pneumonia and bacteremia.
  • Vulnerable patient groups that can be treated to prevent Staphylococcal aureus infection include hemodialysis patients, immune-compromised patients, patients in intensive care units, and certain surgical patients.
  • the invention provides a method of killing, treating, or preventing a microbial infection in an animal, preferably a mammal, and most preferably a human, that includes administering to the animal an anti-WTA AAC or pharmaceutical formulation of an AAC of the invention.
  • the invention further features treating or preventing diseases associated with or which opportunistically result from such microbial infections.
  • Such methods of treatment or prevention may include the oral, topical, intravenous, intramuscular, or subcutaneous administration of a composition of the invention.
  • the AAC of the invention may be administered to prevent the onset or spread of infection.
  • the bacterial infection may be caused by bacteria with an active and inactive form, and the AAC is administered in an amount and for a duration sufficient to treat both the active and the inactive, latent form of the bacterial infection, which duration is longer than is needed to treat the active form of the bacterial infection.
  • WTA beta expressed on all S. aureus, including MRSA and MSSA strains, as well as Staph strains such as S. saprophyticus and S. simulans.
  • WTA alpha Alpha-GLcNAc ribitol WTA
  • WTA is present on most, but not all S. aureus, and also present on Listeria monocytogenes. WTA is not present on Gram- bacteria.
  • one aspect of the invention is a method of treating a patient infected with one or more of S. aureus, S. saprophyticus or S. simulans by administering a therapeutically effective amount of an anti-WTA beta-AAC of the invention.
  • Another aspect of the invention is a method of treating a patient infected with S. aureus and/or Listeria
  • the invention also contemplates a method of preventing infections by one or more of S. aureus or S. saprophyticus or S. simulans by administering a therapeutically effective amount of an anti-WTA beta-AAC of the invention in hospital settings such as surgery, burn patient, and organ transplantation.
  • the patient needing treatment for a bacterial infection as determined by a physician of skill in the art may have already been, but does not need to be diagnosed with the kind of bacteria that he/she is infected with. Since a patient with a bacterial infection can take a turn for the worse very quickly, in a matter of hours, the patient upon admission into the hospital can be administered the anti-WTA-AACs of the invention along with one or more standard of care Abx such as vancomycin or ciprofloxacin. When the diagnostic results become available and indicate the presence of, e.g., S. aureus in the infection, the patient can continue with treatment with the anti-WTA AAC. Therefore, in one embodiment of the method of treating a bacterial infection or specifically a S.
  • an anti-WTA beta AAC in the methods of treatment or prevention of the present invention, can be administered as the sole therapeutic agent or in conjunction with other agents such as those described below.
  • the AACs of the invention show superiority to vancomycin in the treatment of MRSA in preclinical models. Comparison of AACs to SOC can be measured, e.g., by a reduction in mortality rate. The patient being treated would be assessed for responsiveness to the AAC treatment by a variety of measurable factors.
  • Examples of signs and symptoms that clinicians might use to assess improvement in their patients includes the following: normalization of the white blood cell count if elevated at diagnosis, normalization of body temperature if elevated (fever) at the time of diagnosis, clearance of blood cultures, visual improvement in wound including less erythema and drainage of pus, reduction in ventilator requirements such as requiring less oxygen or reduced rate of ventilation in a patient who is ventilated, coming off of the ventilator entirely if the patient is ventilated at the time of diagnosis, use of less medications to support a stable blood pressure if these medications were required at the time of diagnosis, normalization of lab abnormalities that suggest end-organ failure such as elevated creatinine or liver function tests if they were abnormal at the time of diagnosis, and improvement in radiologic imaging (e.g.
  • a patient with a bacterial infection is considered to be treated if there is significant measurable improvement as assessed by the physician of skill in the art, in at least two or more of the preceding factors compared to the values, signs or symptoms before or at the start of treatment or at the time of diagnosis. In some embodiments, there is measurable improvement in 3, 4, 5, 6 or more of the aforementioned factors. If some embodiments, the improvement in the measured factors is by at least 50%, 60%, 70%, 80%, 90%, 95% or 100% compared to the values before treatment. Typically, a patient can be considered completely treated of the bacterial infection (e.g., S.
  • aureus infection if the patient's measurable improvements include the following: i) repeat blood or tissue cultures (typically several) that do not grow out the bacteria that was originally identified ; ii) fever is normalized; iii) WBC is normalized; and iv) evidence that end-organ failure (heart, lungs, liver, kidneys, vascular collapse) has resolved either fully or partially given the pre-existent co-morbidities that the patient had.
  • the dosage of an AAC is normally about 0.001 to 1000 mg/kg/day.
  • the patient with a bacterial infection is treated at an AAC dose in the range of about 1 mg/kg to about 150mg/kg, typically about 5mg/kg to about 150mg kg, more specifically about 25mg/kg to 125 mg/kg, 50mg/kg to 125mg/kg , even more specifically at about 50mg/kg to lOOmg/kg.
  • the AAC may be given daily (e.g., a single dose of 5 to 50 mg/kg/day) or less frequently (e.g., a single dose of 5, 10, 25 or 50 mg/kg/week).
  • One dose may be split over 2 days, for example, 25mg/kg on one day and 25mg/kg the next day.
  • the patient can be administered a dose once every 3 days (q3D), once a week to every other week (qOW), for a duration of 1-8 weeks.
  • the patient is administered an AAC of the invention via IV once a week for 2-6 weeks with standard of care (SOC) to treat the bacterial infection such as a staph A infection.
  • Treatment length would be dictated by the condition of the patient or the extent of the infection, e.g. a duration of 2 weeks for uncomplicated bacteremia, or 6 weeks for bacteremia with endocarditis.
  • the AACs of the invention can be administered at any of the preceding dosages intravenously (i.v.) or subcutaneously.
  • the WTA-AAC is administered intravenously.
  • the WTA-AAC administered via i.v. is a WTA-beta AAC, more specifically, wherein the WTA-beta antibody is one selected from the group of Abs with amino acid sequences as disclosed in Figure 12, Figure 13A1 and A2 & Figure 13B1-B4, Figure 14A1-A2 & Figure 14B1-B3, and Figure 15A1-A3 and Figure 15B1-B6.
  • An AAC may be administered in conjunction with one or more additional, e.g.
  • the second antibiotic administered in combination with the antibody- antibiotic conjugate compound of the invention is selected from the structural classes: : (i) aminoglycosides; (ii) beta-lactams; (iii) macrolides/cyclic peptides; (iv) tetracyclines; (v) fluoroquinolines/fluoroquinolones; (vi) and oxazolidinones.
  • structural classes : : (i) aminoglycosides; (ii) beta-lactams; (iii) macrolides/cyclic peptides; (iv) tetracyclines; (v) fluoroquinolines/fluoroquinolones; (vi) and oxazolidinones.
  • the second antibiotic administered in combination with the antibody-antibiotic conjugate compound of the invention is selected from clindamycin, novobiocin, rumblemulin, daptomycin, GSK-2140944, CG-400549, sitafloxacin, teicoplanin, triclosan, napthyridone, radezolid, doxorubicin, ampicillin, vancomycin, imipenem, doripenem, gemcitabine, dalbavancin, and azithromycin.
  • antiinflammatory agents e.g., non-steroidal anti-inflammatory drugs (NSAIDs; e.g., detoprofen, diclofenac, diflunisal, etodolac, fenoprofen, flurbiprofen, ibuprofen, indomethacin, ketoprofen, meclofenameate, mefenamic acid, meloxicam, nabumeone, naproxen sodium, oxaprozin, piroxicam, sulindac, tolmetin, celecoxib, rofecoxib, aspirin, choline salicylate, salsalte, and sodium and magnesium salicylate) and steroids (e.g., cortisone, dexamethasone, hydrocortisone, methylpredmsolone, prednisolone, prednisone, triamcinolone)), antibacterial agents (e.g., azithrovasive agents (e.g., antibacterial
  • the AAC of the invention is administered in combination with standard of care (SOC) for S. aureus (including methicillin-resistant and methicillin-sensitive strains).
  • SOC standard of care
  • MSSA is usually typically treated with nafcillin or oxacillin and MRSA is typically treated with vancomycin or cefazolin.
  • additional agents may be administered within 14 days, 7 days, 1 day, 12 hours, or 1 hour of administration of an AAC, or simultaneously therewith.
  • the additional therapeutic agents may be present in the same or different pharmaceutical compositions as an AAC.
  • different routes of administration may be used. For example, an AAC may be administered intravenous or subcutaneously, while a second agent may be administered orally.
  • compositions containing the WTA-AACs and to methods of treating a bacterial infection using the pharmaceutical compositions containing AAC.
  • Such compositions may further comprise suitable excipients, such as pharmaceutically acceptable excipients (carriers) including buffers, acids, bases, sugars, diluents, glidants, preservatives and the like, which are well known in the art and are described herein.
  • suitable excipients such as pharmaceutically acceptable excipients (carriers) including buffers, acids, bases, sugars, diluents, glidants, preservatives and the like, which are well known in the art and are described herein.
  • carriers including buffers, acids, bases, sugars, diluents, glidants, preservatives and the like, which are well known in the art and are described herein.
  • the present methods and compositions may be used alone or in combinations with other conventions methods and/or agents for treating infectious diseases.
  • a pharmaceutical formulation comprises 1)
  • pharmaceutical formulation comprises 1) an AAC of the invention and optionally, 2) at least one additional therapeutic agent.
  • compositions comprising an AAC of the invention are prepared for storage by mixing the AAC having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers ⁇ Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)) in the form of aqueous solutions or lyophilized or other dried formulations.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, histidine and other organic acids; antioxidants including ascorbic acid and methionine;
  • preservatives such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride); phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3- pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol
  • administration are generally sterile, readily accomplished by filtration through sterile filtration membranes.
  • Active ingredients may also be entrapped in microcapsule prepared, for example, by co-acervation techniques or by interfacial polymerization, for example,
  • microcapsule respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in
  • sustained-release preparations may be prepared.
  • suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody or AAC of the invention, which matrices are in the form of shaped articles, e.g., films, or microcapsule.
  • sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or
  • poly(vinylalcohol) poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid- glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3- hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
  • encapsulated antibodies or AAC When encapsulated antibodies or AAC remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37 °C, resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S-S bond formation through thio- disulf de interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
  • An AAC may be formulated in any suitable form for delivery to a target cell/tissue.
  • AACs may be formulated as liposomes, a small vesicle composed of various types of lipids, phospholipids and/or surfactant which is useful for delivery of a drug to a mammal.
  • the components of the liposome are commonly arranged in a bilayer formation, similar to the lipid arrangement of biological membranes.
  • Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., (1985) Proc. Natl. Acad. Sci. USA 82:3688; Hwang et al., (1980) Proc. Natl Acad. Sci. USA 77:4030; US 4485045; US 4544545; WO 97/38731; US 5013556.
  • Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG- derivatized phosphatidylethanolamme (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • a lipid composition comprising phosphatidylcholine, cholesterol and PEG- derivatized phosphatidylethanolamme (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
  • the MIC for extracellular bacteria was determined by preparing serial 2-fold dilutions of the antibiotic in Tryptic Soy Broth. Dilutions of the antibiotic were made in quadruplicate in 96 well culture dishes. MRSA (NRS384 strain of USA300) was taken from an
  • the bacteria was cultured in the presence of antibiotic for 18-24 hours with shaking at 37°C and bacterial growth was determined by reading the Optical Density (OD) at 630 nM. The MIC was determined to be the dose of antibiotic that inhibited bacterial growth by >90%.
  • Intracellular MIC was determined on bacteria that were sequestered inside mouse peritoneal macrophages (see below for generation of murine peritoneal macrophages).
  • Macrophages were plated in 24 well culture dishes at a density of 4xl0 5 cells/mL and infected with MRSA at a ratio of 10-20 bacteria per macrophage. Macrophage cultures were maintained in growth media supplemented with 50 ug/mL of gentamycin (an antibiotic that is active only on extracellular bacteria) to inhibit the growth of extracellular bacteria and test antibiotics were added to the growth media 1 day after infection. The survival of intracellular bacteria was assessed 24 hours after addition of the antibiotics.
  • gentamycin an antibiotic that is active only on extracellular bacteria
  • Macrophages were lysed with Hanks Buffered Saline Solution supplemented with .1% Bovine Serum Albumin and .1% Triton-X, and serial dilutions of the lysate were made in Phosphate Buffered Saline solution containing .05% Tween-20. The number of surviving intracellular bacteria was determined by plating on Tryptic Soy Agar plates with 5% defibrinated sheep blood.
  • Peritoneal macrophages were isolated from the peritoneum of 6-8 week old Balb/c mice (Charles River Laboratories, Hollister, CA). To increase the yield of macrophages, mice were pre-treated by intraperitoneal injection with 1 mL of thioglycolate media (Becton Dickinson). The thioglycolate media was prepared at a concentration of 4% in water, sterilized by autoclaving, and aged for 20 days to 6 months prior to use. Peritoneal macrophages were harvested 4 days post treatment with thioglycolate by washing the peritoneal cavity with cold phosphate buffered saline. Macrophages were plated in
  • DMEM Dulbecco's Modified Eagle Medium
  • Fetal Calf Serum fetal calf serum
  • 10 mM HEPES Dulbecco's Modified Eagle Medium
  • MG63 CRL-1427
  • A549 CCL185
  • HUVEC cells were obtained from Lonza and maintained in EGM Endothelial Cell Complete Media (Lonza, Walkersville, MD).
  • the USA300 strain of MRSA was obtained from the NARSA repository (Chantilly, Virginia). Some experiments utilized the Newman strain of S. aureus
  • Macrophages were pre-washed with serum free DMEM media immediately before infection, and infected by incubation at 37 °C in a humidified tissue culture incubator with 5% C0 2 to permit phagocytosis of the bacteria. After 2 hours, the infection mix was removed and replaced with normal growth media (DMEM supplemented with 10% Fetal Calf Serum, 10 mM HEPES and gentamycin was added at 50 ⁇ g/ml to prevent growth of extracellular bacteria. At the end of the incubation period, the macrophages were washed with serum free media, and the cells were lysed in HB supplemented with 0.1% triton-X (lyses the macrophages without damaging the intracellular bacteria).
  • viability of the macrophages was assessed at the end of the culture period by detecting release of cytoplasmic lactate dehydrogenase (LDH) into the culture supernatant using an LDH Cytotoxicity Detection Kit (Product 11644793001, Roche Diagnostics Corp, Indianapolis, IN). Supematants were collected and analyzed immediately according to the manufacturer's instructions. Serial dilutions of the lysate were made in phosphate buffered saline solution supplemented with 0.05% Tween-20 (to disrupt aggregates of bacteria) and the total number of surviving intracellular bacteria was determined by plating on Tryptic Soy Agar with 5% defibrinated sheep blood.
  • LDH cytoplasmic lactate dehydrogenase
  • mice 6-8 week old female A/J mice (JAXTM Mice, Jackson Laboratories) were infected with lxlO 8 CFU of the NRS384 strain of USA300 by peritoneal injection.
  • the peritoneal wash was harvested 1 day post infection, and the infected peritoneal cells were treated with 50 ⁇ g/mL of lysostaphin diluted in Hepes Buffer supplemented with 0.1% BSA (HB buffer) for 30 minutes at 37 °C. Peritoneal cells were then washed 2x in ice cold HB buffer.
  • the peritoneal cells were diluted to lxlO 6 cells/mL in RPMI 1640 tissue culture media supplemented with 10 mM Hepes and 10 % Fetal Calf Serum, and 5 ⁇ g/mL vancomycin. Free MRSA from the primary infection was stored overnight at 4 °C in Phosphate Buffered Saline Solution as a control for extracellular bacteria that were not subject to neutrophil killing. Transfer of infection from peritoneal cells to osteoblasts:
  • MG63 osteoblast cell line was obtained from ATCC (CRL-1427) and maintained in RPMI 1640 tissue culture media supplemented with 10 mM Hepes and 10 % Fetal Calf Serum (RPMI-10). Osteoblasts were plated in 24 well tissue culture plates and cultured to obtain a confluent layer. On the day of the experiment, the osteoblasts were washed once in RPMI (without supplements). MRSA or infected peritoneal cells were diluted in complete RPMI-10 and vancomycin was added at 5 ⁇ immediately prior to infection. Peritoneal cells were added to the osteoblasts at lxl 0 6 peritoneal cells/mL.
  • a sample of the cells was lysed with 0.1% triton-x to determine the actual concentration of live intracellular bacteria at the time of infection.
  • the actual titer for all infections was determined by plating serial dilutions of the bacteria on Tryptic Soy Agar with 5% defibrinated sheep blood.
  • MG63 osteoblasts were plated in 4 well glass chamber slides and cultured in RPMI 1640 tissue culture media supplemented with 10 mM Hepes and 10 % Fetal Calf Serum (RPMI-10) until they formed confluent layers.
  • RPMI-1640 tissue culture media supplemented with 10 mM Hepes and 10 % Fetal Calf Serum (RPMI-10) until they formed confluent layers.
  • the wells were washed with serum free media and infected with a suspension of infected peritoneal cells, or with the USA300 strain of MRSA diluted in complete RPMI-10 supplemented with 5 ⁇ g/mL of vancomycin.
  • the cells were washed with phosphate buffered saline (PBS) and fixed for 30 minutes at room temperature in PBS with 2% paraformaldehyde.
  • Wells were washed 3X in PBS and permeabilized with PBS with 0.1% saponin for 30 minutes at room temperature.
  • PBS phosphate
  • Peritoneal washes were centrifuged for 5 minutes at 1,000 rpm at 4° C in a table top centrifuge. The cell pellet containing peritoneal cells was collected and cells were treated with 50 ug/mL of lysostaphin (Cell Sciences Inc. Canton MA, CRL 309C) for 20 minutes at 37° C to kill contaminating extracellular bacteria. Peritoneal cells were washed 3x in ice cold PBS to remove the lysostaphin. Peritoneal cells from donor mice were pooled, and recipient mice were injected with cells derived from 5 donors per each recipient by intravenous injection into the tail vein.
  • lysostaphin Cell Sciences Inc. Canton MA, CRL 309C
  • HB Hanks Balanced Salt Solution supplemented with 10 mM HEPES and .1% Bovine Serum Albumin
  • serial dilutions of the lysate were made in PBS with .05% tween-20.
  • Free Bacteria Infections A/J mice were infected with various doses of free bacteria using a fresh aliquot of the glycerol stocks utilized for the peritoneal injections. Actual infection doses were confirmed by CFU plating.
  • MRS A infected peritoneal cells 6-8 week old female A J mice (Jackson Lab) were infected with lxlO 8 CFU of the NRS384 strain of USA300 by peritoneal injection. The peritoneal wash was harvested 1 day post infection, and the infected peritoneal cells were treated with 50 ug/mL of lysostaphin diluted in Hepes Buffer supplemented with .1 % BSA (HB buffer) for 30 minutes at 37° C. Peritoneal cells were then washed 2x in ice cold HB buffer.
  • the peritoneal cells were diluted to lxlO 6 cells/mL in RPMI 1640 tissue culture media supplemented with 10 mM Hepes and 10 % Fetal Calf Serum, and 5 ug/mL vancomycin. Free MRSA from the primary infection was stored overnight at 4°C in
  • Phosphate Buffered Saline Solution as a control for extracellular bacteria that were not subject to neutrophil killing.
  • MG63 cell line was obtained from ATCC (CRL-1427) and maintained in RPMI 1640 tissue culture media supplemented with 10 mM Hepes and 10 % Fetal Calf Serum (RPMI- 10).
  • HBMEC cells Catalog #1000
  • ECM media catalog# 1001 were obtained from SciencCell Research Labs (Carlsbad, CA). Cells were plated in 24 well tissue culture plates and cultured to obtain a confluent layer. On the day of the experiment, the cells were washed once in RPMI (without supplements). MRSA or infected peritoneal cells were diluted in complete RPMI- 10 and vancomycin was added at 5 ug/mL immediately prior to infection.
  • Peritoneal cells were added to the osteoblasts at lxlO 6 peritoneal cells/mL. A sample of the cells was lysed with .1 % triton-x to determine the actual concentration of live intracellular bacteria at the time of infection. The actual titer for all infections was determined by plating serial dilutions of the bacteria on Tryptic Soy Agar with 5% defibrinated sheep blood.
  • the human IgG antibodies against anti-beta-GlcNAc WTA mAb were cloned from peripheral B cells from patients post S. aureus infection using a monoclonal antibody discovery technology which conserves the cognate pairing of antibody heavy and light chains 38 .
  • Antibodies were subsequently produced in 200-ml transient transfections and purified with Protein A chromatography (MabSelect SuRe, GE Life Sciences, Piscataway, NJ) for further testing. Isolation and usage of these antibodies were approved by the regional ethical review board.
  • THIOMAB variant of Anti-WTA antibody was done as follows. A cysteine residue was engineered at the Val 205 position of Anti-WTA Ab light chain to produce its THIOMABTM cysteine-engineered antibody variant. This thio Anti-WTA was conjugated to PML Linker-antibiotic intermediates from Table 2. The antibody was reduced in the presence of fifty-fold molar excess DTT overnight. The reducing agent and the cysteine and glutathione blocks were purified away using HiTrap SP-HP column (GE Healthcare). The antibody was reoxidized in the presence of fifteen-fold molar excess dehydroascorbic acid (MP Biomedical) for 2.5 hours. The formation of interchain disulfide bonds was monitored by LC/MS.
  • a three-fold molar excess of the PML linker antibiotic intermediate over protein was incubated with the THIOMAB for one hour.
  • the antibody drug conjugate was purified by filtration through a 0.2 um SFCA filter (Millipore). Excess free linker drug was removed by filtration.
  • the conjugate was buffer exchanged into 20 mM histidine acetate pH 5.5 / 240 mM sucrose by dialysis.
  • the number of conjugated rifamycin-type antibiotics per mAb was quantified by LC/MS analysis as the antibiotic/antibody ratio (AAR). Purity was also assessed by size exclusion chromatography.
  • LC/MS analysis was performed on a 6530 Accurate-Mass Quadrupole Time-of-Flight (Q-TOF) LC/MS (Agilent Technologies). Samples were chromatographed on a PRLP-S column, 1000 A, 8 ⁇ (50 mm x2.1 mm, Agilent Technologies) heated to 80 °C. A linear gradient from 30-60% B in 4.3 minutes (solvent A, 0.05% TFA in water; solvent B, 0.04% TFA in acetonitrile) was used and the eluent was directly ionized using the electrospray source. Data was collected and deconvoluted using the Agilent Mass Hunter qualitative analysis software.
  • antibody drug conjugate was treated with lysyl endopeptidase (Wako) for 30 minutes at 1 :100 w/w enzyme to antibody ratio, pH 8.0, and 37 °C to produce the Fab and the Fc portion for ease of analysis.
  • the antibiotic to antibody ration (AAR) (used interchangeably herein with drug to antibody ratio (DAR)) was calculated using the abundance of Fab and Fab+1 calculated by the MassHunter software.
  • AAR lysyl endopeptidase
  • DAR drug to antibody ratio
  • Kidneys were homogenized using a GentleMACS dissociator in 5 mL volume per 2 kidneys using M-Tubes and the program RNA01.01 (Miltenyi Biotec, Auburn, CA). Homogenization buffer was: PBS + 0.1% Triton-XlOO, 10 ug/mL DNAase (Bovine pancreas grade II, Roche) and protease inhibitors (Complete protease inhibitor cocktail, Roche 11-836-153001). After homogenization, the samples were incubated at room temperature for 10 minutes and then diluted with ice cold PBS and filtered through a 40 uM cell strainer.
  • Homogenization buffer was: PBS + 0.1% Triton-XlOO, 10 ug/mL DNAase (Bovine pancreas grade II, Roche) and protease inhibitors (Complete protease inhibitor cocktail, Roche 11-836-153001). After homogenization, the samples were incubated at room temperature for 10 minutes and then diluted with
  • Tissue homogenates were washed 2x in ice cold PBS and then suspended in a volume of 0.5 mL per 2 kidneys in HB buffer (Hanks Balanced Salt Solution supplemented with 10 mM HEPES and .1% Bovine Serum Albumin). The cell suspension was filtered again and 25 uL of the bacterial suspension was taken for each staining reaction.
  • HB buffer Horbon Buffer
  • Test antibodies (anti-pWTA:4497, anti- aWTA:7578 or isotype control:gD) were conjugated with Alexa-488 using amine reactive reagents (Invitrogen, succinimidyl-ester of Alexa Fluor 488, NHS-A488). Antibodies in 50 mM sodium phosphate were reacted with a 5-10 fold molar excess of NHS-A488 in the dark for 2-3 hrs at room temperature. The labeling mixture was applied to a GE Sepharose S200 column equilibrated in PBS to remove excess reactants from the conjugated antibody. The number of A488 molecules/antibody was determined using the UV method as described by the manufacturer.
  • S. aureus (USA300) was taken from an overnight stationary phase culture, washed once in Phosphate Buffered Saline (PBS) and suspended at lxlO 7 CFU/mL in PBS with no antibiotic or with lxlO "6 M antibiotic in a 10 mL volume in 50 mL polypropylene centrifuge tubes. The bacteria were incubated at 37°C overnight with shaking. At each time point, three 1 mL samples were removed from each culture and centrifuged to collect the bacteria. Bacteria were washed once with PBS to remove the antibiotic and the total number of surviving bacteria was determined by plating serial dilutions of the bacteria on agar plates.
  • PBS Phosphate Buffered Saline
  • S. aureus (US A300) was taken from an overnight stationary phase culture, washed once in Tryptic Soy Broth (TSB) and then adjusted to a final concentration of lxlO 7 CFU/ml in a total volume of 10 mL of either TSB or TSB with ciprofloxicin (0.05 mM). Cultures were incubated with shaking at 37°C for 6 hours and then the second antibiotic, either rifampicin (1 ug/ml) or another rifamycin-type antibiotic (1 ug/ml) was added. At the indicated times, samples were removed from each culture, washed once with PBS to remove the antibiotic and re-suspended in PBS. The total number of surviving bacteria was determined by plating serial dilutions of the bacteria on agar plates. At the final time point the remainder of each culture was collected and plated.
  • Cathepsin release assay for AAC To quantify the amount of active antibiotic released from AACs following treatment with cathepsin B, AACs were diluted to 200 ug/mL in cathepsin buffer (20 mM Sodium Acetate, 1 mM EDTA, 5 mM L-Cysteine pH 5).
  • Cathepsin B (from bovine spleen, SIGMA C7800) was added at 10 ug/mL and the samples were incubated for 1 hour at 37° C.
  • AACs were incubated in buffer alone.
  • the reaction was stopped by addition of 9 volumes of bacterial growth media, Tryptic Soy Broth pH 7.4 (TSB).
  • TBS Tryptic Soy Broth pH 7.4
  • serial dilutions of the reaction mixture were made in quadruplicate in TSB in 96 well plates and MRSA (USA300) was added to each well at a final density of 2x10 CFU/mL. The cultures were incubated over night at 37° C with shaking and bacterial growth was measured by reading absorbance at 630 nM using a plate reader.
  • a maleimide FRET peptide was synthesized and conjugated to the S4497 cysteine- engineered, THIOMABTM antibody.
  • the FRET pair employed tetramethylrhodamine (TAMRA) and fluorescein (Fischer, R., et al (2010) Bioconjug Chem 21, 64-73).
  • TAMRA tetramethylrhodamine
  • fluorescein Fischer, R., et al (2010) Bioconjug Chem 21, 64-73.
  • the maleimide FRET peptide was synthesized by standard Fmoc solid-phase chemistry using a PS3 peptide synthesizer (Protein Technologies, Inc). Briefly, 0.1 mmol of Rink amide resin was used to generate C-terminal carboxamide.
  • Fmoc-Lys(Mtt)-OH at the N- and C-terminal residues was utilized in order to remove the Mtt (monomethoxytrityl) group on the resin and carry out additional side-chain chemistry to attach TAMRA and fluorescein.
  • the CBDK-cit peptidomimetic unit was added between the FRET pair as a cathepsin-cleavable spacer.
  • the crude maleimide FRET peptide or maleimidocaproyl- (TAMRA)-G- CBDK-cit - K(Fluorescein) cleaved off from the resin was subjected to further purification by reverse- phase HPLC with a Jupiter 5 ⁇ C4 column (5 ⁇ , 10 mm x 250 mm, Phenomenex).
  • Our FRET probe allows monitoring not only the intracelluar trafficking of the antibody conjugate, but also the processing of the linker in the phagolysosome.
  • the intact antibody conjugate fluoresces only in red due to the fluorescence resonance energy transfer from the donor. However, upon the substrate cleavage of the FRET peptide in the phagolysosome, the green fluorescence from the donor is expected to appear.
  • Murine peritoneal macrophages were plated on chamber slides (Ibidi, Verona, WI. catalog 80826) in complete media as described for the macrphage intracellular killing assay. USA300 was labeled with Cell Tracker Viole (Invitrogen C10094) at lOOug/ml, in PBS .1% BSA by incubation for 30 minutes at 37 C. The labeled bacteria were opsonized with the 4497-FRET probe by incubation for 1 hour in HB buffer. Macrophages were washed once immediately prior to addition of the opsonized bacteria, and bacteria were added to cells at IxlO 7 Bacteria/mL.
  • Cell Tracker Viole Invitrogen C10094
  • the macrophages were pre-treated with 60 n Latruneulin A (Calbiochem) for 30 minutes prior to and during phagocytosis.
  • the slides were placed on the micrscope immediately after addition of bacteria to the cells and movies were acquired with a Leica SP5 confocal microscope equipped with an environmental chamber with C0 2 and Temperature controllers from Ludin.
  • the images were captured every minute for a total time of 30 minutes using a Plan APO CS 40X, N..A: 1.25, oil immersion lens, and the 488nm and 543nm laser lines to excite respectively alexa 488 and TAMRA. Phase images were also recorded using the 543 run laser line.
  • Murine peritoneal macrophages were infected in 24 well tissue culture dishes as described below for the intracellular killing assay with MRSA opsonized with AAC at 100 ug/mL in HB. After phagocytosis was complete, the cells were washed and 250uL of complete media + gentamycin was added to wells and the cells were incubated for 1 hour or 3 hours. At each time point the supernatant and cellular fractions were collected and acetonitrile (ACN) was added to 75% final concentration and incubated for 30 minutes.
  • ACN acetonitrile
  • Cell and supernatant extracts were lyophilized by evaporation under N2 (TurboVap) and reconstituted in 100 uL of 50% ACN, filtered and analyzed on Ab Sciex QTRAP 6500 LC/MS/MS system.
  • Non-phagocytic cell types MG63 (CRL-1427) and A549 (CCL185) cell lines were obtained from ATCC and maintained in RPMI 1640 tissue culture media supplemented with 10 mM Hepes and 10 % Fetal Calf Serum (RPMI- 10).
  • HUVEC cells were obtained from Lonza and maintained in EGM Endothelial Cell Complete Media (Lonza, Walkersville, MD).
  • HBMEC cells (Catalog #1000) and ECM media catalog# 1001) were obtained from
  • Murine Macrophages Peritoneal macrophages were isolated from the peritoneum of 6-8 week old Balb/c mice (Charles River Laboratories, Hollister, CA). To increase the yield of macrophages, mice were pre-treated by intraperitoneal injection with 1 mL of
  • thioglycolate media (Becton Dickinson). The thioglycolate media was prepared at a concentration of 4% in water, sterilized by autoclaving, and aged for 20 days to 6 months prior to use. Peritoneal macrophages were harvested 4 days post treatment with thioglycolate by washing the peritoneal cavity with cold phosphate buffered saline. Macrophages were plated in Dulbecco's Modified Eagle Medium (DMEM) supplemented with 10% Fetal Calf Serum, and 10 mM HEPES, without antibiotics, at a density of 4xl0 5 cells/well in 24 well culture dishes. Macrophages were cultured over night to permit adherence to the plate.
  • DMEM Dulbecco's Modified Eagle Medium
  • CD14 + Monocytes were purified from normal human blood using a Monocyte Isolation Kit II (Miltenyi, Cat 130-091-153) and plated at 1.5xl0 5 cells/cm 2 on tissue culture dishes pre-coated with Fetal Calf Serum (FCS) and cultured in RPMI 1640 media with 20% FCS + 100 ng/mL rhM-CSF. Media was refreshed on day 1 and on day 7, the media was changed to 5% serum + 20 ng/mL IL-4. Macrophages were used 18 hours later.
  • Assay protocol In all experiments bacteria were cultured in Tryptic Soy Broth. To assess intracellular killing with Antibody Antibiotic Conjugates (AACs), USA300 was taken from an exponentially growing culture and washed in HB (Hanks Balanced Salt Solution supplemented with 10 mM HEPES and .1% Bovine Serum Albumin). AACs or antibodies were diluted in HB and incubated with the bacteria for 1 hour to permit antibody binding to the bacteria (opsonization), and the opsonized bacteria were used to infect macrophages at a ratio of 10-20 bacteria per macrophage (4xl0 6 bacteria in 250 uL of HB per well.
  • AACs or antibodies were diluted in HB and incubated with the bacteria for 1 hour to permit antibody binding to the bacteria (opsonization), and the opsonized bacteria were used to infect macrophages at a ratio of 10-20 bacteria per macrophage (4xl0 6 bacteria in 250 uL of HB per well.
  • Macrophages were pre-washed with serum free DMEM media immediately before infection, and infected by incubation at 37 C in a humidified tissue culture incubator with 5% C0 2 to permit phagocytosis of the bacteria. After 2 hours, the infection mix was removed and replaced with normal growth media (DMEM supplemented with 10% Fetal Calf Serum, 10 mM HEPES and gentamycin was added at 50ug/ml to prevent growth of extracellular bacteria. At the end of the incubation period, the macrophages were washed with serum free media, and the cells were lysed in HB supplemented with .1% triton-X (lyses the
  • MRSA For extracellular bacteria, MRSA was cultured overnight in Tryptic Soy Broth, and the MIC was determined to be the minimum antibiotic dose that prevented growth.
  • murine peritoneal macrophages were infected with MRSA and cultured in the presence of gentamycin to kill extracellular bacteria. Test antibiotics were added to the culture medium one day post infection, and the total number of surviving intracellular bacteria was determined 24 hours later. The expected serum concentrations for clinically relevant antibiotics was reported in Antimicrobial Agents, Andre Bryskier. ASM Press, Washington DC (2005).
  • Table 4 Minimum inhibitory concentrations (MIC) for several antibiotics on extracellular bacteria grown in liquid culture vs. intracellular bacteria sequestered inside murine macrophages.
  • MG63 osteoblasts were infected with either planktonic MRSA or intracellular MRSA, in the presence of vancomycin. Infection of osteoblasts or HBMEC.
  • MG63 cell line was obtained from ATCC (CRL- 1427) and maintained in RPMI 1640 tissue culture media supplemented with 10 mM Hepes and 10 % Fetal Calf Serum (RPMI- 10).
  • HBMEC cells Catalog #1000
  • ECM media catalog# 1001 were obtained from SciencCell Research Labs (Carlsbad, CA). Cells were plated in 24 well tissue culture plates and cultured to obtain a confluent layer.
  • MRSA or infected peritoneal cells were diluted in complete RPMI- 10 and vancomycin was added at 5 ug/mL immediately prior to infection.
  • Peritoneal cells were added to the osteoblasts at lxlO 6 peritoneal cells/mL.
  • a sample of the cells was lysed with .1 % triton-x to determine the actual concentration of live intracellular bacteria at the time of infection. The actual titer for all infections was determined by plating serial dilutions of the bacteria on Tryptic Soy Agar with 5% defibrinated sheep blood.
  • MRSA free bacteria
  • media media + vancomycin, or media + vancomycin
  • Fig. IE monolayer of MG63 osteoblasts
  • HBMEC Human Brain Microvascular Endothelial Cells
  • Planktonic bacteria exposed to vancomycin alone were efficiently killed. Surviving bacteria were not recoverd after one day in culture (Fig. ID). When a similar number of planktonic bacteria were plated on MG63 osteoblasts, a small number of surviving bacteria (approximately 0.06% of input) associated with the MG63 cells one day after infection, which had been protected from vancomycin by invasion of the osteoblasts, was recovered.
  • MRSA that were sequestered inside peritoneal cells showed a dramatic increase in both survival and efficiency of infection in the presence of vancomycin.
  • Intracellular bacteria also were better able to infect the monolayer of MG63 osteoblasts in the presence of vancomycin, resulting in a doubling of the bacteria recovered one day after exposure to vancomycin (Fig. 1 D).
  • intracellular S. aureus were able to increase by almost 10-fold over a 24 hour period in MG63 cells (Fig. IE), primary human brain endothelial cells (Fig. IF), and A549 bronchial epithelial cells (not shown) under constant exposure to a concentration of vancomycin that killed free living bacteria. Although protected from antibiotic killing, bacterial growth did not occur in cultures of infected peritoneal macrophages and neutrophils (not shown). Together these data support that intracellular reservoirs of MRS A in myeloid cells can promote dissemination of infection to new sites, even in the presence of active antibiotic treatment, and intracellular growth can occur in endothelial and epithelial cells, even under conditions of constant antibiotic therapy.
  • anti-WTAP anti-wall-teichoic acid beta
  • the amount of antibiotic delivered by an AAC is limited by the number of antibody binding sites on the surface of the bacterium. Thus, it was essential to select an antibody that binds to a highly abundant antigen that is stably expressed on MRSA during all phases of an in vivo infection.
  • a panel of greater than 40 anti-S. aureus antibodies were cloned and purified from B cells derived from peripheral blood of patients recovering from various S. aureus infections and screened for binding to MRSA isolated directly from the kidneys of infected mice.
  • MRSA methicillin-resistant S. aureus
  • MSSA methicillin-sensitive S. aureus
  • VISA vancomycin intermediate-resistant S. aureus
  • LTA lecomycin intermediate-resistant S. aureus
  • LTA lecomycin intermediate-resistant S. aureus
  • LTA lecomycin intermediate-resistant S. aureus
  • LTA lecomycin intermediate-resistant S. aureus
  • LTA lecomycin intermediate-resistant S. aureus
  • LTA levomycin intermediate-resistant S. aureus
  • LTA levomycin intermediate-resistant S. aureus
  • LTA levomycin intermediate-resistant S. aureus
  • LTA leptic soy broth
  • CWP cell wall preparation
  • a library of mAbs showing positive ELISA binding to cell wall preparations from USA300 or Wood46 strain S. aureus strains was generated. Antibodies were subsequently produced in 200-ml transient transfections and purified with Protein A chromatography (MabSelect SuRe, GE Life Sciences, Piscataway, NJ) for further testing. For larger scale antibody production, antibodies were produced in CHO cells. Vectors coding for VL and VH were transfected into CHO cells and IgG was purified from cell culture media by protein A affinity chromatography. Table 5 : List of antigens used to isolate the Abs
  • Each mAb within this library was queried for three selection criteria: (1) relative intensity of mAb binding to the MRSA surface, as an indication of high expression of the corresponding cognate antigen which would favor high antibiotic delivery; (2) consistency of mAb binding to MRSA isolated from a diverse variety of infected tissues, as an indication of the stable expression of the cognate antigen at the MRSA surface in vivo during infections; and (3) mAb binding capacity to a panel of clinical S. aureus strains, as an indication of conservation of expression of the cognate surface antigen.
  • flow cytometry was used to test all of these pre-selected culture supernatants of mAbs in the library for reactivity with S. aureus from a variety of infected tissues and from different S. aureus strains.
  • All mAbs in the library were analyzed for their capacity to bind MRSA from infected kidneys, spleens, livers, and lungs from mice which were infected with MRSA USA300; and within hearts or kidneys from rabbits which were infected with USA300 COL in a rabbit endocarditis model.
  • the capacity of an antibody to recognize S. aureus from a variety of infected tissues raises the probability of the therapeutic antibody being active in a wide variety of different clinical infections with S. aureus.
  • Bacteria were analyzed immediately upon harvest of the organs, i.e. without subculture, to prevent phenotypic changes caused by in vitro culture conditions.
  • aureus surface antigens while being expressed during in vitro culture, lost expression in infected tissues. Antibodies directed against such antigens would be unlikely to be useful to treat infections.
  • this mAb library was confirmed for a significant number of antibodies, which showed significant binding to S. aureus bacteria from culture, but absence of binding to bacteria from all of the tested infected tissues. Some antibodies bound to bacteria from some but not all tested infected tissues. Therefore, antibodies were selected that were able to recognize bacteria from all infection conditions tested.
  • Parameters that were assessed were (1) relative fluorescence intensity, as a measure for antigen abundance; (2) number of organs that stained positive, as a measure for stability of antigen expression; and (3) mAb binding capacity to a panel of clinical S. aureus strains as an indication of conservation of expression of the cognate surface antigen. Fluorescence intensity of the test antibodies was determined as relative to an isotype control antibody that was directed against a non-relevant antigen, for example, IgGl mAb anti-herpes virus gD:5237 (referenced below). mAbs against WTA-beta not only showed the highest antigen abundance, but also showed very consistent binding to MRSA from all infected tissues tested and specified above.
  • Cell wall preparations from a S. aureus wild-type (WT) strain and a S. aureus mutant strain lacking WTA (ATagO; WTA-null strain) were generated by incubating 40 mg of pelleted S. aureus strains with 1 mL of 10 mM Tris-HCl (pH 7.4) supplemented with 30% raffmose, 100 ⁇ g/ml of lysostaphin (Cell Sciences, Canton, MA), and EDTA-free protease inhibitor cocktail (Roche, Pleasanton, CA), for 30 min at 37°C. The lysates were centrifuged at 11 ,600 x g for 5 min, and the supernatants containing cell wall components were collected.
  • ATagO WTA-null strain
  • proteins were separated on a 4-12% Tris-glycine gel, and transferred to a nitrocellulose membrane (Invitrogen, Carlsbad, CA), followed by blotting with indicated test antibodies against WTA, or with control antibodies against PGN and LTA.
  • Immunoblotting shows that the antibodies against WTA bind to WT cell wall preparations from WT S. aureus but not to cell wall preparations from the ATagO strain lacking WTA.
  • the control antibodies against peptidoglycan (anti-PGN) and lipoteichoic acid (anti-LTA) bind well to both cell wall preparations. These data indicate the specificity of the test antibodies against WTA.
  • Rabbits were injected intravenously with 5xl 0 7 CFU of stationary-phase grown MRSA strain COL, and heart vegetations were harvested eighteen hours later. Treatment with 30 mg/kg of vancomycin was given intravenously b.i.d. 18 h after infection with 7xl0 7 CFU stationary-phase
  • tissues were homogenized in M tubes (Miltenyi, Auburn, CA) using a gentleMACS cell dissociator (Miltenyi), followed by incubation for 10 min at RT in PBS containing 0.1 % Triton-Xl OO (Thermo), 10 ⁇ g/mL of DNAsel (Roche) and Complete Mini protease inhibitor cocktail (Roche).
  • the suspensions were passed through a 40 micron filter (BD), and washed with HBSS without phenol red supplemented with 0.1% IgG free BSA (Sigma) and 10 mM Hepes, pH 7.4 (HB buffer).
  • the bacterial suspensions were next incubated with 300 ⁇ g/mL of rabbit IgG (Sigma) in HB buffer for 1 h at room temperature (RT) to block nonspecific IgG binding.
  • Bacteria were stained with 2 ⁇ g/mL of primary antibodies, including rFl or isotype control IgGl mAb anti-herpes virus gD:5237 (Nakamura GR et al., J Virol 67: 6179-6191 (1993)), and next with fluorescent anti-human IgG secondary antibodies (Jackson Immunoresearch, West Grove, PA).
  • a double staining was performed using 20 ⁇ 3 ⁇ 4 ⁇ mouse mAb 702 anti-iS*. aureus peptidoglycan (Abeam,
  • Table 6 shows equilibrium binding analysis of MRSA antibodies binding to Newman-ASPA strain, and the antigen density on the bacterium.
  • the K D and antigen density were derived using a radioligand cell binding assay under the following assay conditions: DMEM + 2.5% mouse serum binding buffer; solution binding for 2hrs at room temperature (RT); and using 400,000 bacteria/well.
  • Ab 6263 is 6078-like in that the sequences are very similar. Except for the second residue (R versus G) in CDR H3, all the other L and H chain CDR sequences are identical.
  • each of the anti-WTA beta Abs were cloned out and linked to human H chain gammal constant region and the VL linked to kappa constant region to express the Abs as IgGl. Wild-type sequences were altered at certain positions to improve the antibody stability while maintaining antigen binding as described below. Cysteine engineered Abs (ThioMabs, also referred to as THIOMABTM) were then generated.
  • VH regions of the WTA beta Abs identified from the human antibody library above were linked to human ⁇ constant regions to make full length IgGl Abs.
  • the L chains were kap a L chains.
  • met-2 the second amino acid in the VH, met (met-2), is prone to oxidation. Therefore met-2 was mutated to He or Val, to avoid oxidation of the residue. Since the alteration of met-2 may affect binding affinity, the mutants were tested for binding to Staph CWP by ELISA.
  • CDR H3 "DG” or "DD” motifs were found to be prone to transform to iso-aspartic acid.
  • Ab 4497 contains DG in CDR H3 positions 96 and 97 (see Figure 16) and was altered for stability.
  • CDR H3 is generally critical for antigen binding so several mutants were tested for antigen binding and chemical stability.
  • Mutant D96E (v8) retains binding to antigen, similar to wild-type Ab 4497 ( Figure 16), and is stable and does not form iso-aspartic acid.
  • Staph CWP ELISA For analysis of 6078 antibody mutants, a lysostaphin-treated USA300 ASPA S. aureus cell well preparation (WT) consisting of 1X10 9 bugs/ml was diluted 1/100 in 0.05 Sodium Carbonate pH 9.6 and coated onto 384-well ELISA plates (Nunc; Neptune, NJ) during an overnight incubation at 4°C. Plates were washed with PBS plus 0.05% Tween-20 and blocked during a 2-hour incubation with PBS plus 0.5% bovine serum albumin (BSA). This and all subsequent incubations were performed at room temperature with gentle agitation.
  • WT ASPA S. aureus cell well preparation
  • Antibody samples were diluted in sample/standard dilution buffer (PBS, 0.5% BSA, 0.05% Tween 20, 0.25% CHAPS, 5 mM EDTA, 0.35M NaCl, 15 ppm Proclin , (pH 7.4)), added to washed plates, and incubated for 1.5 - 2 hours. Plate-bound anti-S. aureus antibodies were detected during a 1-hour incubation with a peroxidase-conjugated goat anti-human IgG(Fc ) F(ab')2 fragment (Jackson ImmunoResearch; West Grove, PA) diluted to 40 ng/mL in assay buffer (PBS, 0.5% BSA, 15 ppm Proclin, 0.05% Tween 20).
  • sample/standard dilution buffer PBS, 0.5% BSA, 0.05% Tween 20, 0.25% CHAPS, 5 mM EDTA, 0.35M NaCl, 15 ppm Proclin , (pH 7.4)
  • Cysteine amino acids may be engineered at reactive sites in the heavy chain (HC) or light chain (LC) of an antibody and which do not form intrachain or intermolecular disulfide linkages (Junutula, et al, 2008b Nature Biotech., 26(8):925-932; Dornan et al (2009) Blood
  • H and L chains are then cloned into separate plasmids and the H and L encoding plasmids co-transfected into 293 cells where they are expressed and assembled into intact Abs. Both H and L chains can also be cloned into the same expression plasmid.
  • Figures 13A and 13B shows the 6078 WT and mutant Abs with the combination of HC Cys and LC Cys.
  • the 6078 mutants were also tested for their ability to bind protein A deficient USA300 Staph A from overnight culture. From the results of FACS analysis (data not shown), the mutant Abs bound USA300 similarly to the 6078 WT (unaltered) antibody; the amino acid alterations in the mutants did not impair binding to Staph A. gD was used as a non-specific negative control antibody.
  • Example 6 Selection of Antibiotic
  • Rifamycin-type antibiotics were selected for high potency, unaltered bactericidal activity in low phagolysosomal pH, ability to withstand intracellular insults and the ease with which they can be coupled to a protease-cleavable, non-peptide (PML) linker reagent suitable for conjugation to an anti-WTA antibody. Since the intra-phagocytic bacteria were at most slowly replicating, optimization of the antibiotic also required that it be able to kill non- replicating MRS A when released from the AAC.
  • PML protease-cleavable, non-peptide
  • MRSA was collected from a stationary phase culture and suspended in phosphate buffered saline containing no antibiotic or lxl0 ⁇ 6 M of rifampin or the rifamycin-derivative (Rifalog) and incubated at 37°C. At the indicated times, a sample of the culture was collected and centrifuged to remove the antibiotic and the total number of surviving bacteria was determined by plating.
  • rifamycin-type (rifalog) antibiotic but not rifampicin resulted in a more than 1 ,000-fold decrease in the number of viable, but non- replicating, bacteria after overnight incubation in minimal phosphate-saline buffer (PBS) (see FIG. 8).
  • PBS minimal phosphate-saline buffer
  • the rifamycin-type antibiotic was for the ability to kill classically defined persister cells, bacteria that presumably enter a dormant state to survive antibiotic treatment (e.g., ciprofloxacin) of growing cultures (data not shown).
  • the addition of rifampicin had no effect on their viability, in agreement with previous observations (Conlon, B.P., et al.
  • Anti-wall teichoic acid antibody-antibiotic conjugates (AAC) Table 3 were prepared by conjugating an anti-WTA antibody to a PML Linker- Antibiotic intermediate, including those from Table 2. Prior to conjugation, the anti-WTA antibodies were partially reduced with TCEP using standard methods in accordance with the methodology described in WO 2004/010957, the teachings of which are incorporated by reference for this purpose. The partially reduced antibodies were conjugated to the linker-antibiotic intermediate using standard methods in accordance with the methodology described, e.g., in Doronina et al. (2003) Nat. Biotechnol. 21 :778-784 and US 2005/0238649 Al .
  • the partially reduced antibodies were combined with the linker-antibiotic intermediate to allow conjugation of the linker-antibiotic intermediate to reduced cysteine residues of the antibody.
  • the conjugation reactions were quenched, and the AAC were purified.
  • the antibiotic load average number of antibiotic moieties per antibody
  • Methods 332:41-52) expressed in CHO cells were reduced with about a 20-40 fold excess of TCEP (tris(2-carboxyethyl)phosphine hydrochloride or DTT (dithiothreitol) in 50 mM Tris pH 7.5 with 2 mM EDTA for 3 hrs at 37 °C or overnight at room temperature.
  • TCEP tris(2-carboxyethyl)phosphine hydrochloride or DTT (dithiothreitol) in 50 mM Tris pH 7.5 with 2 mM EDTA for 3 hrs at 37 °C or overnight at room temperature.
  • ThioMab was diluted and loaded onto a HiTrap S column in 10 mM sodium acetate, pH 5, and eluted with PBS containing 0.3M sodium chloride.
  • the antibody was acidified by addition of 1/20* volume of 10 % acetic acid, diluted with 10 mM succinate pH 5, loaded onto the column and then washed with 10 column volumes of succinate buffer. The column was eluted with 50 mM Tris pH7.5, 2 mM EDTA.
  • the AAC were formulated into 20 mM His/acetate, pH 5, with 240 mM sucrose using gel filtration columns.
  • AAC were characterized by UV spectroscopy to determine protein concentration, analytical SEC (size-exclusion chromatography) for aggregation analysis and LC-MS before and after treatment with Lysine C endopeptidase.
  • Size exclusion chromatography was performed using a Shodex KW802.5 column in 0.2M potassium phosphate pH 6.2 with 0.25 mM potassium chloride and 15% IPA at a flow rate of 0.75 ml/min. Aggregation state of AAC was determined by integration of eluted peak area absorbance at 280 nm.
  • LC-MS analysis was performed using an Agilent QTOF 6520 ESI instrument.
  • an AAC generated using this chemistry was treated with 1 :500 w/w Endoproteinase Lys C (Promega) in Tris, pH 7.5, for 30 min at 37 °C.
  • the resulting cleavage fragments were loaded onto a 1000A, 8 um PLRP-S column heated to 80°C and eluted with a gradient of 30% B to 40% B in 5 minutes.
  • Mobile phase A H 2 0 with 0.05% TFA.
  • Mobile phase B acetonitrile with 0.04% TFA.
  • Flow rate 0.5ml/min. Protein elution was monitored by UV absorbance detection at 280 nm prior to electrospray ionization and MS analysis.
  • the rifamycin-type antibiotics were tested for the ability to directly kill extracellular bacteria when linked to the anti- ⁇ WTA mAb in the AAC format.
  • AAC was incubated in buffer alone or treated with cathepsin B. Serial dilutions of the resulting reaction were added to wells containing MRSA in Tryptic Soy Broth and cultured over night to identify wells containing sufficient active antibiotic to prevent growth.
  • MRS A is opsonized with the FRET conjugate and added to macrophage cultures. Uptake of the bacteria and cleavage of the probe is monitored by video microscopy. The linker is cleaved within minutes after uptake of the bacteria by macrophages as visualized by the release of the A488 probe, analogous to the release of rifamycin-type antibiotic on the AACs. On the other hand, the linker remained intact when the bacteria are not internalized due to treatment of the macrophages with latrunculin A, an inhibitor of phagocytosis. Mass spectrometry analysis can also be used to confirm that the free antibiotic is indeed released inside macrophages after uptake of MRSA coated with the actual AACs.
  • Anti-WTAp-CBDK AAC effectively kills S. aureus when internalized by primary human and mouse macrophages and several human cell lines in vitro.
  • S. aureus USA300 NRS384 strain
  • various doses 100 u/mL, 10 ug/mL, 1 ug/mL or 0.1 ug/mL
  • the resulting opsonized bacteria were fed to murine macrophages and incubated at 37 °C to permit phagocytosis.
  • the infection mix was removed and replaced with normal growth media supplemented with 50 ug/mL of gentamycin to kill any remaining extracellular bacteria.
  • the total number of surviving intracellular bacteria were determined 2 days later by plating serial dilutions of the macrophage lysates on Tryptic Soy Agar plates.
  • the WTA-PML AACs were tested in a mouse intravenous infection model. This example demonstrates that the WTA-PML AACs were effective in greatly reducing or eradicating intracellular S. aureus infections, in the murine intravenous infection model.
  • Peritonitis Model 7 week old female A/J mice (Jackson Laboratories) are infected by peritoneal injection with 5xl0 7 CFU of USA300. Mice are sacrificed 2 days post infection and the peritoneum is flushed with 5 mL of cold phosphate buffered saline solution (PBS). Kidneys are homogenized in 5 mL of PBS as described below for the intravenous infection model. Peritoneal washes are centrifuged for 5 minutes at 1,000 rpm at 4°C in a table top centrifuge. The supernatant is collected as the extracellular bacteria and the cell pellet containing peritoneal cells is collected as the intracellular fraction. The cells are treated with 50 ⁇ g mL of lysostaphin for 20 minutes at 37°C to kill contaminating extracellular bacteria.
  • PBS cold phosphate buffered saline solution
  • Peritoneal cells are washed 3x in ice cold PBS to remove the lysostaphin prior to analysis. To count the number of intracellular CFUs, peritoneal cells are lysed in HB (Hanks Balanced Salt Solution supplemented with 10 mM HEPES and .1% Bovine Serum Albumin) with 0.1% Triton-X, and serial dilutions of the lysate are made in PBS with 0.05% tween-20.
  • HB Horbal Stas Balanced Salt Solution supplemented with 10 mM HEPES and .1% Bovine Serum Albumin
  • an AAC would need to be able to eliminate already established intracellular infection. To assess this, treatment was delayed until 24h after initiation of bacteremia, a time at which vancomycin treatment is minimally effective.
  • Intracellular infection in neutrophils is established rapidly; in at least one model of bacteremia, 95% of the bacteria in the blood are inside neutrophils within 15 minutes 7 , presumably accounting for the decreased efficacy of vancomycin. Under these conditions, treatment with a single dose of AAC was efficacious and proved superior to treatment with an equivalent dose of the free rifamycin-type antibiotic.
  • S. aureus is a common colonizer of human skin and mucosal surfaces.
  • Mouse serum has no appreciable levels of anti-S aureus antibody.
  • endogenous anti-WTA antibodies found in normal human serum might compete for binding with the AAC, CB17.SCID mice (Charles River
  • Globulin (ASD Healthcare, Brooks KY) using a dosing regimen optimized to achieve constant serum levels of at least 10 mg/mL of human IgG in serum.
  • IGIV was administered with an initial intravenous dose of 30 mg per mouse followed by a second dose of 15 mg/mouse by intraperitoneal (i.p.) injection after 6 hours, and subsequent daily dosings of 15 mg per mouse by intraperitoneal injection for 3 consecutive days. These mice were equally susceptible to infection with MRSA compared to untreated controls.
  • Figure 10 shows treatment with AAC (DAR2) reduced bacterial load in the kidneys by approximately 7,000-fold.
  • Figure IOC shows that treatment with AAC (DAR2) from Table 3 reduced bacterial burdens in the heart by approximately 500-fold.
  • FIG. 17 shows that pre-treatment with 50 mg/kg of free antibodies is not efficacious in an intravenous infection model.
  • Balb/c mice were given a single dose of vehicle control (PBS) or 50 mg/Kg of antibodies by intravenous injection 30 minutes prior to infection with 2xl0 7 CFU of USA300.
  • Treatment groups included an isotype control antibody that does not bind to S. aureus (gD), an antibody directed against the beta modification of wall teichoic acid (4497) or an antibody directed against the alpha modification of wall teichoic acid (7578).
  • Control mice were given twice daily treatments with 110 mg/Kg of vancomycin by intraperitoneal injection (Vanco).
  • xample 11 Piperidyl benzoxazino rifamycin (pipBOR) 5
  • 6-aminohexanoic acid (201 g, 1.53 mol) in HOAc (1000 mL). After the mixture was stirred at r.t. for 2 h, it was heated at reflux for 8 h. The organic solvents were removed under reduced pressure and the residue was extracted with EtOAc (500 mL x 3), washed with 13 ⁇ 40. The combined organic layers was dried over Na2SC>4 and concentrated to give the crude product. It was washed with petroleum ether to give 6-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l- yl)hexanoic acid as white solid (250 g, 77.4 %).
  • Step 2 Preparation of (S)- 1 -( 1 -(4-(hydroxymethyl)phenyl amino)- 1 -oxo-5 - ureidopentan-2-ylcarbamoyl)cyclobutanecarboxylic acid 10b
  • a coupling reagent such as TBTU (0-(Benzotriazol-l-yl)-NN,N',N'- tetramethyluronium tetrafluoroborate, also called: NN,N',N'-Tetramethyl-0-(benzotriazol-l- yl)uronium tetrafluoroborate, CAS No. 125700-67-6, Sigma-Aldrich B-2903), and N- hydroxysuccinimide to the NHS ester, l-(2,5-dioxopyrrolidin-l-yl) 1-ethyl cyclobutane-1 , 1- dicarboxylate.
  • TBTU Bis(Benzotriazol-l-yl)-NN,N',N'- tetramethyluronium tetrafluoroborate
  • Step 3 Preparation of S)-N-(5-(2,5-dioxo-2,5-dihydro-lH-pyrrol-l-yl)pentyl)-

Landscapes

  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Communicable Diseases (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
PCT/US2015/063510 2014-12-03 2015-12-02 Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof Ceased WO2016090038A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
KR1020177014576A KR20170086536A (ko) 2014-12-03 2015-12-02 항-스타필로코커스 아우레우스 항체 리파마이신 접합체 및 이의 용도
CN201580075298.5A CN107206102A (zh) 2014-12-03 2015-12-02 抗金黄色葡萄球菌抗体利福霉素缀合物及其用途
MX2017007055A MX2017007055A (es) 2014-12-03 2015-12-02 Conjugados de anticuerpo rifamicina anti-staphylococcus aureus y usos de estos.
BR112017011325-2A BR112017011325A2 (pt) 2014-12-03 2015-12-02 ?composto de conjugado anticorpo?antibiótico, composição, método de tratamento de uma infecção, método para matar staph aureus, processo para produzir o conjugado, kit para o tratamento de uma infecção, intermediários antibiótico-ligante e ligante-droga?
CA2965540A CA2965540A1 (en) 2014-12-03 2015-12-02 Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof
HK18103430.2A HK1243931A1 (zh) 2014-12-03 2015-12-02 抗金黄色葡萄球菌抗体利福霉素缀合物及其用途
JP2017528894A JP6742314B2 (ja) 2014-12-03 2015-12-02 抗黄色ブドウ球菌抗体リファマイシン複合体及びその使用
RU2017118793A RU2731055C2 (ru) 2014-12-03 2015-12-02 Конъюгаты антитела к staphylococcus aureus с рифамицином и их применение
EP15820347.1A EP3226911A1 (en) 2014-12-03 2015-12-02 Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof
US15/611,985 US20180021450A1 (en) 2014-12-03 2017-06-02 Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462087184P 2014-12-03 2014-12-03
US62/087,184 2014-12-03

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/611,985 Continuation US20180021450A1 (en) 2014-12-03 2017-06-02 Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof

Publications (1)

Publication Number Publication Date
WO2016090038A1 true WO2016090038A1 (en) 2016-06-09

Family

ID=55070136

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/063510 Ceased WO2016090038A1 (en) 2014-12-03 2015-12-02 Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof

Country Status (11)

Country Link
US (1) US20180021450A1 (https=)
EP (1) EP3226911A1 (https=)
JP (1) JP6742314B2 (https=)
KR (1) KR20170086536A (https=)
CN (1) CN107206102A (https=)
BR (1) BR112017011325A2 (https=)
CA (1) CA2965540A1 (https=)
HK (1) HK1243931A1 (https=)
MX (1) MX2017007055A (https=)
RU (1) RU2731055C2 (https=)
WO (1) WO2016090038A1 (https=)

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10017577B2 (en) 2015-06-15 2018-07-10 Genentech, Inc. Antibodies and immunoconjugates
US10124069B2 (en) 2013-12-16 2018-11-13 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2019094395A3 (en) * 2017-11-07 2019-08-22 Regeneron Pharmaceuticals, Inc. Hydrophilic linkers for antibody drug conjugates
US10533058B2 (en) 2013-12-16 2020-01-14 Genentech Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2020132483A1 (en) 2018-12-21 2020-06-25 Regeneron Pharmaceuticals, Inc. Rifamycin analogs and antibody-drug conjugates thereof
US11229708B2 (en) 2015-12-04 2022-01-25 Seagen Inc. Conjugates of quaternized tubulysin compounds
US11377502B2 (en) 2018-05-09 2022-07-05 Regeneron Pharmaceuticals, Inc. Anti-MSR1 antibodies and methods of use thereof
US11491237B2 (en) 2017-05-18 2022-11-08 Regeneron Pharmaceuticals, Inc. Cyclodextrin protein drug conjugates
WO2022255425A1 (ja) 2021-06-01 2022-12-08 味の素株式会社 抗体および機能性物質のコンジュゲートまたはその塩、ならびにその製造に用いられる化合物またはその塩
US11760775B2 (en) 2016-11-08 2023-09-19 Regeneron Pharmaceuticals, Inc. Steroids and protein-conjugates thereof
US11793880B2 (en) 2015-12-04 2023-10-24 Seagen Inc. Conjugates of quaternized tubulysin compounds
US12070506B2 (en) 2018-01-08 2024-08-27 Regeneron Pharmaceuticals, Inc. Steroids and antibody-conjugates thereof

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102204805B1 (ko) * 2016-03-04 2021-01-20 제넨테크, 인크. 항체-리파마이신 접합체의 제조 방법
TW201944989A (zh) 2018-01-24 2019-12-01 洛克斐勒大學 抗菌化合物、其組成物及使用其之方法
CN110174363A (zh) * 2019-01-09 2019-08-27 北京九强生物技术股份有限公司 6-磷酸葡萄糖脱氢酶突变体及其在制备检测试剂中的用途
WO2021016433A1 (en) 2019-07-23 2021-01-28 The Rockefeller University Antibacterial compounds, compositions thereof, and methods using same
WO2021242849A1 (en) * 2020-05-28 2021-12-02 The Rockefeller University Antibacterial compounds, compositions thereof, and methods using same
CN117659042B (zh) * 2023-12-05 2024-12-27 北京大学第三医院(北京大学第三临床医学院) 利福霉素衍生物及其制备方法和用途
CN118598380B (zh) * 2024-08-08 2024-10-22 生态环境部南京环境科学研究所 一种长效修复石油化工企业地下水石油烃污染的方法
CN119701000A (zh) * 2024-12-25 2025-03-28 中国人民解放军空军军医大学 一类多肽偶联药物及其制备方法和应用

Citations (74)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3150046A (en) 1958-08-12 1964-09-22 Lepetit Spa Antibiotic rifamycin b and method of production
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
EP0183070A2 (en) 1984-10-30 1986-06-04 Phillips Petroleum Company Transformation of yeasts of the genus pichia
US4610919A (en) 1985-06-14 1986-09-09 Fiber Bond Corporation Binder for fibrous padding
EP0244234A2 (en) 1986-04-30 1987-11-04 Alko Group Ltd. Transformation of trichoderma
DD266710A3 (de) 1983-06-06 1989-04-12 Ve Forschungszentrum Biotechnologie Verfahren zur biotechnischen Herstellung van alkalischer Phosphatase
US4859661A (en) 1986-07-14 1989-08-22 Kanegafuchi Kagaku Kogyo Kabushiki Kaisha Alkyl-substituted benzoxazinorifamycin derivative, process for preparing the same and antibacterial agent containing the same
EP0402226A1 (en) 1989-06-06 1990-12-12 Institut National De La Recherche Agronomique Transformation vectors for yeast yarrowia
US4983602A (en) 1988-11-01 1991-01-08 Kanegafuchi Kagaku Kogyo Kabushiki Kaisha 3'-hydroxybenzoxazinorifamycin derivative, process for preparing the same and antibacterial agent containing the same
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
US5362852A (en) 1991-09-27 1994-11-08 Pfizer Inc. Modified peptide derivatives conjugated at 2-hydroxyethylamine moieties
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5545721A (en) 1992-12-21 1996-08-13 Ophidian Pharmaceuticals, Inc. Conjugates for the prevention and treatment of sepsis
WO1997038731A1 (en) 1996-04-18 1997-10-23 The Regents Of The University Of California Immunoliposomes that optimize internalization into target cells
US5786349A (en) 1995-12-08 1998-07-28 Kaneka Corporation Method for treating chlamydia infectious diseases by rifamycin derivative
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US5981522A (en) 1995-09-01 1999-11-09 Kaneka Corporation Treatment of disease caused by infection of Helicobacter
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
WO2000071585A1 (en) 1999-05-03 2000-11-30 Medarex, Inc. Human antibodies to staphylococcus aureus
US6214345B1 (en) 1993-05-14 2001-04-10 Bristol-Myers Squibb Co. Lysosomal enzyme-cleavable antitumor drug conjugates
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
WO2002088172A2 (en) 2001-04-30 2002-11-07 Seattle Genetics, Inc. Pentapeptide compounds and uses related thereto
WO2003020885A2 (en) * 2001-08-15 2003-03-13 The Regents Of The University Of California Identification of sortase gene
WO2003026577A2 (en) 2001-09-24 2003-04-03 Seattle Genetics, Inc. P-amidobenzylethers in drug delivery agents
US20030096743A1 (en) 2001-09-24 2003-05-22 Seattle Genetics, Inc. p-Amidobenzylethers in drug delivery agents
WO2003043583A2 (en) 2001-11-20 2003-05-30 Seattle Genetics, Inc. Treatment of immunological disorders using anti-cd30 antibodies
WO2003045319A2 (en) * 2001-11-21 2003-06-05 Activbiotics, Inc. Targeted therapeutics and uses thereof
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
US6660267B1 (en) 1992-12-21 2003-12-09 Promega Corporation Prevention and treatment of sepsis
WO2004010957A2 (en) 2002-07-31 2004-02-05 Seattle Genetics, Inc. Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
WO2004032828A2 (en) 2002-07-31 2004-04-22 Seattle Genetics, Inc. Anti-cd20 antibody-drug conjugates for the treatment of cancer and immune disorders
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
WO2004042072A2 (en) 2002-11-01 2004-05-21 The Regents Of The University Of Colorado, A Body Corporate Quantitative analysis of protein isoforms using matrix-assisted laser desorption/ionization time of flight mass spectrometry
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
WO2004092219A2 (en) 2003-04-10 2004-10-28 Protein Design Labs, Inc Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
WO2005035778A1 (ja) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法
WO2005035586A1 (ja) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. 融合蛋白質組成物
WO2005053742A1 (ja) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. 抗体組成物を含有する医薬
WO2005082023A2 (en) * 2004-02-23 2005-09-09 Genentech, Inc. Heterocyclic self-immolative linkers and conjugates
WO2005081711A2 (en) * 2003-11-06 2005-09-09 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2007096703A2 (en) * 2005-08-11 2007-08-30 Targanta Therapeutics Inc. Phosphonated rifamycins and uses thereof for the prevention and treatment of bone and joint infections
US7271165B2 (en) 2003-12-23 2007-09-18 Activbiotics, Inc. Rifamycin analogs and uses thereof
WO2007141278A2 (en) * 2006-06-06 2007-12-13 Crucell Holland B.V. Human binding molecules having killing activity against enterococci and staphylococcus aureus and uses thereof
US7342011B2 (en) 2003-08-22 2008-03-11 Activbiotics, Inc. Rifamycin analogs and uses thereof
WO2008141044A2 (en) * 2007-05-08 2008-11-20 Genentech, Inc. Cysteine engineered anti-muc16 antibodies and antibody drug conjugates
US20090018086A1 (en) 2005-07-07 2009-01-15 Seattle Genetics, Inc. Monomethylvaline Compounds Having Phenylalanine Side-Chain Replacements at the C-Terminus
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
WO2009052249A1 (en) 2007-10-19 2009-04-23 Genentech, Inc. Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates
US20090111756A1 (en) 2005-07-07 2009-04-30 Seattle Genectics, Inc. Monomethylvaline Compounds Having Phenylalanine Carboxy Modifications at the C-Terminus
US7547692B2 (en) 2005-12-14 2009-06-16 Activbiotics Pharma, Llc Rifamycin analogs and uses thereof
US7569677B2 (en) 1998-08-20 2009-08-04 Strox Biopharmaceuticals, Llc Antibiotic-conjugated antibodies
WO2011008092A2 (en) * 2009-07-15 2011-01-20 Aimm Therapeutics B.V. Gram-positive bacteria specific binding compounds
US20110059085A1 (en) 2008-05-12 2011-03-10 Strox Biopharmaceuticals, Llc Staphylococcus aureus-specific antibody preparations
US20110178001A1 (en) 2008-08-13 2011-07-21 Targanta Therapeutics Corp. Phosphonated rifamycins and uses thereof for the prevention and treatment of bone and joint infections
US20110262477A1 (en) 2008-10-06 2011-10-27 University Of Chicago Compositions and Methods Related to Bacterial EAP, EMP, and/or ADSA Proteins
US20110301334A1 (en) 2010-06-08 2011-12-08 Sunil Bhakta Cysteine engineered antibodies and conjugates
WO2012113847A1 (en) 2011-02-25 2012-08-30 Lonza Ltd Branched linker for protein drug conjugates
US8283294B2 (en) 2007-03-01 2012-10-09 Symphogen A/S Method for cloning cognate antibodies
WO2014080251A1 (en) * 2012-11-24 2014-05-30 Hangzhou Dac Biotech Co., Ltd. Hydrophilic linkers and their uses for conjugation of drugs to cell binding molecules
WO2014194247A1 (en) 2013-05-31 2014-12-04 Genentech, Inc. Anti-wall teichoic antibodies and conjugates
US20140356375A1 (en) * 2013-05-31 2014-12-04 Genentech, Inc. Anti-wall teichoic antibodies and conjugates
WO2014193722A1 (en) * 2013-05-31 2014-12-04 Genentech, Inc. Anti-wall teichoic antibodies and conjugates
US20140356376A1 (en) * 2013-05-31 2014-12-04 Genentech, Inc. Anti-wall teichoic antibodies and conjugates

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4867973A (en) * 1984-08-31 1989-09-19 Cytogen Corporation Antibody-therapeutic agent conjugates
US7017718B2 (en) * 2001-06-28 2006-03-28 Freni Brembo S.P.A Composite disc for a disc brake having a splittable braking band
AU2003298770A1 (en) * 2002-12-02 2004-06-23 Biosynexus Inc Wall teichoic acid as a target for anti-staphylococcal therapies and vaccines
CA2649288C (en) * 2006-04-19 2015-11-24 Novartis Ag 6-o-substituted benzoxazole and benzothiazole compounds and methods of inhibiting csf-1r signaling

Patent Citations (82)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3150046A (en) 1958-08-12 1964-09-22 Lepetit Spa Antibiotic rifamycin b and method of production
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
DD266710A3 (de) 1983-06-06 1989-04-12 Ve Forschungszentrum Biotechnologie Verfahren zur biotechnischen Herstellung van alkalischer Phosphatase
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
EP0183070A2 (en) 1984-10-30 1986-06-04 Phillips Petroleum Company Transformation of yeasts of the genus pichia
US4610919A (en) 1985-06-14 1986-09-09 Fiber Bond Corporation Binder for fibrous padding
EP0244234A2 (en) 1986-04-30 1987-11-04 Alko Group Ltd. Transformation of trichoderma
US4859661A (en) 1986-07-14 1989-08-22 Kanegafuchi Kagaku Kogyo Kabushiki Kaisha Alkyl-substituted benzoxazinorifamycin derivative, process for preparing the same and antibacterial agent containing the same
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US4983602A (en) 1988-11-01 1991-01-08 Kanegafuchi Kagaku Kogyo Kabushiki Kaisha 3'-hydroxybenzoxazinorifamycin derivative, process for preparing the same and antibacterial agent containing the same
EP0402226A1 (en) 1989-06-06 1990-12-12 Institut National De La Recherche Agronomique Transformation vectors for yeast yarrowia
US5013556A (en) 1989-10-20 1991-05-07 Liposome Technology, Inc. Liposomes with enhanced circulation time
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
US5362852A (en) 1991-09-27 1994-11-08 Pfizer Inc. Modified peptide derivatives conjugated at 2-hydroxyethylamine moieties
US5545721A (en) 1992-12-21 1996-08-13 Ophidian Pharmaceuticals, Inc. Conjugates for the prevention and treatment of sepsis
US6660267B1 (en) 1992-12-21 2003-12-09 Promega Corporation Prevention and treatment of sepsis
US6214345B1 (en) 1993-05-14 2001-04-10 Bristol-Myers Squibb Co. Lysosomal enzyme-cleavable antitumor drug conjugates
US5981522A (en) 1995-09-01 1999-11-09 Kaneka Corporation Treatment of disease caused by infection of Helicobacter
US5786349A (en) 1995-12-08 1998-07-28 Kaneka Corporation Method for treating chlamydia infectious diseases by rifamycin derivative
WO1997038731A1 (en) 1996-04-18 1997-10-23 The Regents Of The University Of California Immunoliposomes that optimize internalization into target cells
US7569677B2 (en) 1998-08-20 2009-08-04 Strox Biopharmaceuticals, Llc Antibiotic-conjugated antibodies
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
WO2000071585A1 (en) 1999-05-03 2000-11-30 Medarex, Inc. Human antibodies to staphylococcus aureus
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
WO2002088172A2 (en) 2001-04-30 2002-11-07 Seattle Genetics, Inc. Pentapeptide compounds and uses related thereto
WO2003020885A2 (en) * 2001-08-15 2003-03-13 The Regents Of The University Of California Identification of sortase gene
WO2003026577A2 (en) 2001-09-24 2003-04-03 Seattle Genetics, Inc. P-amidobenzylethers in drug delivery agents
US20030096743A1 (en) 2001-09-24 2003-05-22 Seattle Genetics, Inc. p-Amidobenzylethers in drug delivery agents
US20030130189A1 (en) 2001-09-24 2003-07-10 Senter Peter D. P-amidobenzylethers in drug delivery agents
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
WO2003043583A2 (en) 2001-11-20 2003-05-30 Seattle Genetics, Inc. Treatment of immunological disorders using anti-cd30 antibodies
WO2003045319A2 (en) * 2001-11-21 2003-06-05 Activbiotics, Inc. Targeted therapeutics and uses thereof
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040110704A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells of which genome is modified
WO2004032828A2 (en) 2002-07-31 2004-04-22 Seattle Genetics, Inc. Anti-cd20 antibody-drug conjugates for the treatment of cancer and immune disorders
US7659241B2 (en) 2002-07-31 2010-02-09 Seattle Genetics, Inc. Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
WO2004010957A2 (en) 2002-07-31 2004-02-05 Seattle Genetics, Inc. Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
WO2004042072A2 (en) 2002-11-01 2004-05-21 The Regents Of The University Of Colorado, A Body Corporate Quantitative analysis of protein isoforms using matrix-assisted laser desorption/ionization time of flight mass spectrometry
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
WO2004092219A2 (en) 2003-04-10 2004-10-28 Protein Design Labs, Inc Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
US7342011B2 (en) 2003-08-22 2008-03-11 Activbiotics, Inc. Rifamycin analogs and uses thereof
WO2005035586A1 (ja) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. 融合蛋白質組成物
WO2005035778A1 (ja) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. α1,6-フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2005081711A2 (en) * 2003-11-06 2005-09-09 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
US20050238649A1 (en) 2003-11-06 2005-10-27 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2005053742A1 (ja) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. 抗体組成物を含有する医薬
US7271165B2 (en) 2003-12-23 2007-09-18 Activbiotics, Inc. Rifamycin analogs and uses thereof
US7375078B2 (en) 2004-02-23 2008-05-20 Genentech, Inc. Heterocyclic self-immolative linkers and conjugates
WO2005082023A2 (en) * 2004-02-23 2005-09-09 Genentech, Inc. Heterocyclic self-immolative linkers and conjugates
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US20090018086A1 (en) 2005-07-07 2009-01-15 Seattle Genetics, Inc. Monomethylvaline Compounds Having Phenylalanine Side-Chain Replacements at the C-Terminus
US20090111756A1 (en) 2005-07-07 2009-04-30 Seattle Genectics, Inc. Monomethylvaline Compounds Having Phenylalanine Carboxy Modifications at the C-Terminus
WO2007096703A2 (en) * 2005-08-11 2007-08-30 Targanta Therapeutics Inc. Phosphonated rifamycins and uses thereof for the prevention and treatment of bone and joint infections
US7547692B2 (en) 2005-12-14 2009-06-16 Activbiotics Pharma, Llc Rifamycin analogs and uses thereof
WO2007141278A2 (en) * 2006-06-06 2007-12-13 Crucell Holland B.V. Human binding molecules having killing activity against enterococci and staphylococcus aureus and uses thereof
US8283294B2 (en) 2007-03-01 2012-10-09 Symphogen A/S Method for cloning cognate antibodies
WO2008141044A2 (en) * 2007-05-08 2008-11-20 Genentech, Inc. Cysteine engineered anti-muc16 antibodies and antibody drug conjugates
US7723485B2 (en) 2007-05-08 2010-05-25 Genentech, Inc. Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates
WO2009052249A1 (en) 2007-10-19 2009-04-23 Genentech, Inc. Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates
US20110059085A1 (en) 2008-05-12 2011-03-10 Strox Biopharmaceuticals, Llc Staphylococcus aureus-specific antibody preparations
US20110178001A1 (en) 2008-08-13 2011-07-21 Targanta Therapeutics Corp. Phosphonated rifamycins and uses thereof for the prevention and treatment of bone and joint infections
US20110262477A1 (en) 2008-10-06 2011-10-27 University Of Chicago Compositions and Methods Related to Bacterial EAP, EMP, and/or ADSA Proteins
WO2011008092A2 (en) * 2009-07-15 2011-01-20 Aimm Therapeutics B.V. Gram-positive bacteria specific binding compounds
US20110301334A1 (en) 2010-06-08 2011-12-08 Sunil Bhakta Cysteine engineered antibodies and conjugates
WO2011156328A1 (en) 2010-06-08 2011-12-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2012113847A1 (en) 2011-02-25 2012-08-30 Lonza Ltd Branched linker for protein drug conjugates
WO2014080251A1 (en) * 2012-11-24 2014-05-30 Hangzhou Dac Biotech Co., Ltd. Hydrophilic linkers and their uses for conjugation of drugs to cell binding molecules
WO2014194247A1 (en) 2013-05-31 2014-12-04 Genentech, Inc. Anti-wall teichoic antibodies and conjugates
US20140356375A1 (en) * 2013-05-31 2014-12-04 Genentech, Inc. Anti-wall teichoic antibodies and conjugates
WO2014193722A1 (en) * 2013-05-31 2014-12-04 Genentech, Inc. Anti-wall teichoic antibodies and conjugates
US20140356376A1 (en) * 2013-05-31 2014-12-04 Genentech, Inc. Anti-wall teichoic antibodies and conjugates

Non-Patent Citations (147)

* Cited by examiner, † Cited by third party
Title
"Short Protocols in Molecular Biology", 1999, WILEY AND SONS
"The Chemistry of Heterocyclic Compounds, A series of Monographs", 1950, JOHN WILEY & SONS, article "Volumes 13, 14, 16, 19, and 28"
.: "Methods in Enzymology", ACADEMIC PRESS, INC.
.: "Methods in Molecular Biology", HUMANA PRESS
A. DOYLE, J.B. GRIFFITHS, AND D.G. NEWELL,: "Cell and Tissue Culture: Laboratory Procedures", August 1993, J. WILEY AND SONS
ALLEY, S.C. ET AL.: "Controlling the location of drug attachment in antibody-drug conjugates", AMERICAN ASSOCIATION FOR CANCER RESEARCH, 2004 ANNUAL MEETING, vol. 45, 27 March 2004 (2004-03-27)
AMSBERRY ET AL., J. ORG. CHEM., vol. 55, 1990, pages 5867
ANDRE BRYSKIER: "Antimicrobial Agents", 2005, ASM PRESS
ANWAR, S. ET AL.: "The rise and rise of Staphylococcus aureus: laughing in the face of granulocytes", CLIN EXP IMMUNOL, vol. 157, 2009, pages 216 - 224
BIGGER JW: "Treatment of staphylococcal infections with penicillin by intermittent sterilization", LANCET, vol. 244, no. 6320, 14 October 1944 (1944-10-14), pages 497 - 500
BOUCHER, H.; MILLER, L.G.; RAZONABLE, R.R.: "Serious infections caused by methicillin-resistant Staphylococcus aureus", CLIN INFECT DIS, vol. 51, no. 2, 2010, pages 183 - 197
BOUCHER, H.W. ET AL.: "Bad bugs, no drugs: no ESKAPE! An update from the Infectious Diseases Society of America", CLIN INFECT DIS, vol. 48, 2009, pages 1 - 12
C.A. JANEWAY; P. TRAVERS, IMMUNOBIOLOGY, 1997
CARTER, P.J.; SENTER P.D., THE CANCER J., vol. 14, no. 3, 2008, pages 154 - 169
CHARI, R.V., ACC. CHEM. RES., vol. 41, 2008, pages 98 - 107
CHEM. PHARM. BULL., vol. 41, 1993, pages 148
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CLARKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLYNES ET AL., PNAS USA, vol. 95, 1998, pages 652 - 656
CONLON, B.P. ET AL., NATURE, vol. 503, 2013, pages 365 - 370
D. CATTY.,: "Antibodies: A Practical Approach", 1988, IRL PRESS
D. UNDERHILL; A OZINSKY: "Phagocytosis of Microbes: complexity in Action", ANNUAL REVIEW OF IMMUNOLOGY, vol. 20, 2002, pages 825
D.M. WEIR AND C.C. BLACKWELL,: "Handbook of Experimental Immunology", .
DORNAN ET AL., BLOOD, vol. 114, no. 13, 2009, pages 2721 - 2729
DORONINA ET AL., NAT. BIOTECHNOL., vol. 21, 2003, pages 778 - 784
DUBOWCHIK ET AL., BIOCONJ. CHEM., vol. 13, 2002, pages 855 - 869
DUBOWCHIK ET AL., BIOCONJUGATE CHEM., vol. 13, no. 4, 2002, pages 855 - 869
DUBOWCHIK ET AL., TETRAHEDRON LETTERS, vol. 38, 1997, pages 5257 - 60
E. HARLOW; D. LANE: "Using Antibodies: A Laboratory Manual", 1999, COLD SPRING HARBOR LABORATORY PRESS
ELIEL, E.; WILEN, S.: "Stereochemistry of Organic Compounds", 1994, JOHN WILEY & SONS, INC.
EPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688
F.M. AUSUBEL, ET AL.: "Current Protocols in Molecular Biology", 2003
FEKLISTOV ET AL., PROC NATL ACAD SCI USA, vol. 105, no. 39, 2008, pages 14820 - 5
FISCHER, R. ET AL., BIOCONJUG CHEM, vol. 21, 2010, pages 64 - 73
FLATMAN ET AL., J. CHROMATOGR. B, vol. 848, 2007, pages 79 - 87
FOWLER ET AL., ARCH. INTERN. MED., vol. 163, 2003, pages 2066 - 2072
FOWLER, V.G., JR. ET AL.: "Daptomycin versus standard therapy for bacteremia and endocarditis caused by Staphylococcus aureus", THE NEW ENGLAND JOURNAL OF MEDICINE, vol. 355, 2006, pages 653 - 665
FRAUNHOLZ, M.; SINHA, B.: "Intracellular Staphylococcus aureus: live-in and let die", FRONT CELL INFECT MICROBIOL, vol. 2, 2012, pages 43
FRISCH ET AL., BIOCONJUGATE CHEM., vol. 7, 1996, pages 180 - 186
FUJII ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 38, 1994, pages 1118 - 1122
FUJII ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 39, 1995, pages 1489 - 1492
GARZONI, C.; KELLEY, W.L.: "Return of the Trojan horse: intracellular phenotype switching and immune evasion by Staphylococcus aureus", EMBO MOL MED, vol. 3, 2011, pages 115 - 117
GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163
GEOGHEGAN; STROH, BIOCONJUGATE CHEM., vol. 3, 1992, pages 138 - 146
GETZ ET AL., ANAL. BIOCHEM., vol. 273, 1999, pages 73 - 80
GHETIE ET AL., NATURE BIOTECHNOLOGY, vol. 15, no. 7, 1997, pages 637 - 40
GHETIE; WARD, IMMUNOL. TODAY, vol. 18, no. 12, 1997, pages 592 - 8
GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59
GRESHAM, H.D. ET AL.: "Survival of Staphylococcus aureus inside neutrophils contributes to infection", J IMMUNOL, vol. 164, 2000, pages 3713 - 3722
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587
HAMANN ET AL., EXPERT OPIN. THER. PATENTS, vol. 15, 2005, pages 1087 - 1103
HAMBLETT ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 7063 - 7070
HAMBLETT, K.J. ET AL.: "Effect of drug loading on the pharmacology, pharmacokinetics, and toxicity of an anti-CD30 antibody-drug conjugate", AMERICAN ASSOCIATION FOR CANCER RESEARCH, 2004 ANNUAL MEETING, vol. 45, 27 March 2004 (2004-03-27)
HAMERS-CASTERMAN ET AL., NATURE, vol. 363, 1993, pages 446 - 448
HARLOW AND LANE,: "Antibodies, A Laboratory Manual, and Animal Cell Culture", 1988
HAY ET AL., BIOORG. MED. CHEM. LETT., vol. 9, 1999, pages 2237
HAZENBOS, W.L. ET AL.: "Novel staphylococcal glycosyltransferases SdgA and SdgB mediate immunogenicity and protection of virulence-associated cell wall proteins", PLOS PATHOG, vol. 9, 2013, pages L003653
HINTON ET AL., J. BIOL. CHEM., vol. 279, no. 8, 2004, pages 6213 - 6
HWANG ET AL., PROC. NATL ACAD. SCI. USA, vol. 77, 1980, pages 4030
J. AM. CHEM. SOC., vol. 82, 1960, pages 5566
J.E. CELLIS,: "Cell Biology: A Laboratory Notebook", 1998, ACADEMIC PRESS
J.E. COLIGAN ET AL.,: "Current Protocols in Immunology", 1991
J.M. MILLER AND M.P. CALOS,: "Gene Transfer Vectors for Mammalian Cells", 1987
J.P. MATHER; P.E. ROBERTS: "Introduction to Cell and Tissue Culture", 1998, PLENUM PRESS
JANEWAY, C.; TRAVERS, P.; WALPORT, M.; SHLOMCHIK: "Immunobiology, 5th Ed.", 2001, GARLAND PUBLISHING
JOHNSON; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, pages: 1 - 25
JONES, A., ADV. DRUG DELIVERY REV., vol. 10, 1993, pages 29 - 90
JUNUTULA ET AL., JOUR OF IMMUN. METHODS, vol. 332, 2008, pages 41 - 52
JUNUTULA ET AL., NATURE BIOTECH., vol. 26, no. 8, 2008, pages 925 - 932
KABAT ET AL.: "Sequences of Proteins of Immunological Interest 5th Ed.", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest Fifth Edition,", vol. 1-3, 1991, NIH PUBLICATION 91-3242
KANDA, Y. ET AL., BIOTECHNOL. BIOENG., vol. 94, no. 4, 2006, pages 680 - 688
KAPRAL, F.A.; SHAYEGANI, M.G.: "Intracellular survival of staphylococci", JEXP MED, vol. 110, 1959, pages 123 - 138
KHATIB ET AL., SCAND. J. INFECT. DIS., vol. 38, 2006, pages 7 - 14
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KINDT ET AL.: "Kuby Immunology, 6th ed.,", 2007, W.H. FREEMAN AND CO., pages: 91
KINGSBURY ET AL., J. MED. CHEM., vol. 27, 1984, pages 1447
KLUSSMAN ET AL., BIOCONJUGATE CHEMISTRY, vol. 15, no. 4, 2004, pages 765 - 773
KULLAR, R.; DAVIS, S.L.; LEVINE, D.P.; RYBAK, M.J.: "Impact of vancomycin exposure on outcomes in patients with methicillin-resistant Staphylococcus aureus bacteremia: support for consensus guidelines suggested targets", CLINICAL INFECTIOUS DISEASES : AN OFFICIAL PUBLICATION OF THE INFECTIOUS DISEASES SOCIETY OF AMERICA, vol. 52, 2011, pages 975 - 981
KUNKEL, T.A.: "Rapid and efficient site-specific mutagenesis without phenotypic selection", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES USA, vol. 82, no. 2, 1985, pages 488 - 492
LANTTO J ET AL., J VIROL., vol. 85, no. 4, 2011, pages 1820 - 33
LANTTO J ET AL., J VIROL., vol. 85, no. 4, February 2011 (2011-02-01), pages 1820 - 33
LEWIS K: "Persister cells, dormancy and infectious disease", NATURE REVIEWS MICROBIOLOGY, vol. 5, no. 1, 2007, pages 48 - 56
LOWY, F.D.: "Staphylococcus aureus infections", N ENGL J MED, vol. 339, 1998, pages 520 - 532
LYON, R. ET AL., METHODS IN ENZYM., vol. 502, 2012, pages 123 - 138
M. ZANETTI AND J. D. CAPRA,: "The Antibodies", 1995, HARWOOD ACADEMIC PUBLISHERS
M.J. GAIT,: "Oligonucleotide Synthesis", 1984
M.J. MACPHERSON, B.D. HAMES AND G.R. TAYLOR: "PCR 2: A Practical Approach", 1995
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745
MATHER ET AL.,, ANNALS N. Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68
MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251
MCDONAGH ET AL., PROT. ENGR. DESIGN & SELECTION, vol. 19, no. 7, 2006, pages 299 - 307
MEIJER PJ ET AL., J MOL BIOL., vol. 358, no. 3, 2006, pages 764 - 72
MEIJER PJ ET AL., JOURNAL OF MOLECULAR BIOLOGY, vol. 358, 2006, pages 764 - 772
MEIJER PJ ET AL., METHODS IN MOLECULAR BIOLOGY, vol. 525, 2009, pages 261 - 277,XIV
MEIJER, P.J. ET AL.: "Isolation of human antibody repertoires with preservation of the natural heavy and light chain pairing", JOURNAL OF MOLECULAR BIOLOGY, vol. 358, 2006, pages 764 - 772
MEIJER, P.J.; NIELSEN, L.S.; LANTTO, J.; JENSEN, A.: "Human antibody repertoires", METHODS MOL BIOL, vol. 525, 2009, pages 261 - 277
MILLER ET AL., J. OF IMMUNOLOGY, vol. 170, 2003, pages 4854 - 4861
MULLIS ET AL.,: "PCR: The Polymerase Chain Reaction", 1994
NAKAMURA GR ET AL., J VIROL, vol. 67, 1993, pages 6179 - 6191
NANNINI, E.; MURRAY, B.E.; ARIAS, C.A.: "Resistance or decreased susceptibility to glycopeptides, daptomycin, and linezolid in methicillin-resistant Staphylococcus aureus", CURR OPIN PHARMACOL, vol. 10, 2010, pages 516 - 521
OKAZAKI ET AL., J. MOL. BIOL., vol. 336, 2004, pages 1239 - 1249
OSOL, A.: "Remington's Pharmaceutical Sciences 16th edition", 1980
P. FINCH, ANTIBODIES, 1997
P. SHEPHERD AND C. DEAN,: "Monoclonal Antibodies: A Practical Approach", 2000, OXFORD UNIVERSITY PRESS
PAQUETTE, LEO A.: "Principles of Modern Heterocyclic Chemistry", 1968, W.A. BENJAMIN, article "Chapters 1, 3, 4, 6, 7, and 9"
POLAKIS P., CURR. OPIN. PHARMACOL., vol. 5, 2005, pages 382 - 387
PORTOLANO ET AL., J. IMMUNOL., vol. 150, 1993, pages 880 - 887
PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599
R.I. FRESHNEY: "Animal Cell Culture", 1987
RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 92
RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545
RODRIGUES ET AL., CHEMISTRY BIOLOGY, vol. 2, 1995, pages 223
ROGERS, D.E.: "Studies on Bacterimia: Mechanisms Relating to the Persistence of Bacteremia in Rabbits Following the Intravanous Injection of Staphylococci", JEM, vol. 103, 1956, pages 713
ROGERS, D.E.; TOMPSETT, R.: "The survival of staphylococci within human leukocytes", J. EXP. MED, vol. 95, 1952, pages 209 - 230
ROTHSTEIN ET AL., EXPERT OPIN. INVESTIG. DRUGS, vol. 12, no. 2, 2003, pages 255 - 271
ROTHSTEIN, D.M. ET AL., EXPERT OPIN. INVEST. DRUGS, vol. 12, no. 2, 2003, pages 255 - 271
S. P. PARKER,: "McGraw-Hill Dictionary of Chemical Terms", 1984, MCGRAW-HILL BOOK COMPANY
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual, 3rd edition", 2001, COLD SPRING HARBOR LABORATORY PRESS
SANDBERG, A.; HESSLER, J.H.; SKOV, R.L.; BLOM, J.; FRIMODT-MOLLER, N.: "Intracellular activity of antibiotics against Staphylococcus aureus in a mouse peritonitis model", ANTIMICROB AGENTS CHEMOTHER, vol. 53, 2009, pages 1874 - 1883
SELIGSON ET AL., ANTI-CANCER DRUGS, vol. 12, 2001, pages 305 - 13
SHAW, K.; BARBACHYN, M., ANN. N.Y. ACAD. SCI., vol. 1241, 2011, pages 48 - 70
SHEN ET AL., NATURE BIOTECH., vol. 30, no. 2, 2012, pages 184 - 191
SHERIFF ET AL., NATURE STRUCT. BIOL., vol. 3, 1996, pages 733 - 736
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604
SINGLETON ET AL.: "Dictionary of Microbiology and Molecular Biology, 2nd Ed.,", 1994, J. WILEY & SONS
STORM ET AL., J. AMER. CHEM. SOC., vol. 94, 1972, pages 5815
SUN ET AL., BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, vol. 12, 2002, pages 2213 - 2215
SUN ET AL., BIOORGANIC & MEDICINAL CHEMISTRY, vol. 11, 2003, pages 1761 - 1768
SUTCLIFFE, J., ANN. N.Y. ACAD. SCI., vol. 1241, 2011, pages 122 - 152
T. W. GREENE: "Protective Groups in Organic Synthesis", 1991, JOHN WILEY & SONS
TATTEVIN P. ET AL., ANTIMICROBIAL AGENTS AND CHEMOTHERAPY, vol. 54, 2010, pages 610 - 613
TEICHER, B.A., CURR. CANCER DRUG TARGETS, vol. 9, 2009, pages 982 - 1004
THWAITES, G.E.; GANT, V.: "Are bloodstream leukocytes Trojan Horses for the metastasis of Staphylococcus aureus?", NAT REV MICROBIOL, vol. 9, 2011, pages 215 - 222
TOKI ET AL., J. ORG. CHEM., vol. 67, 2002, pages 1866 - 1872
TOMIOKA ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 37, 1993, pages 67
V.T. DEVITA ET AL.,: "Cancer: Principles and Practice of Oncology", 1993, J.B. LIPPINCOTT COMPANY
VANDENBROEK, P.V.: "Antimicrobial Drugs, Microorganisms, and Phagocytes", REVIEWS OF INFECTIOUS DISEASES, vol. 11, 1989, pages 213 - 245
VINCENT LEE: "Peptide and Protein Drug Delivery", 1991, MARCEL DEKKER, INC., pages: 247 - 301
WALKER, M.A., J. ORG. CHEM., vol. 60, 1995, pages 5352 - 5355
WICHELHAUS ET AL., J. ANTIMICROB. CHEMOTHER., vol. 47, 2001, pages 153 - 156
WRIGHT ET AL., TIBTECH, vol. 15, 1997, pages 26 - 32
XU ET AL., IMMUNITY, vol. 13, 2000, pages 37 - 45
YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, 2004, pages 614
YAZAKI; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268
YOON, Y.K.; KIM, J.Y.; PARK, D.W.; SOHN, J.W.; KIM, M.J.: "Predictors of persistent methicillin-resistant Staphylococcus aureus bacteraemia in patients treated with vancomycin", THE JOURNAL OF ANTIMICROBIAL CHEMOTHERAPY, vol. 65, 2010, pages 1015 - 1018

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11692043B2 (en) 2013-12-16 2023-07-04 Medimmune Limited Peptidomimetic compounds and antibody-drug conjugates thereof
US10124069B2 (en) 2013-12-16 2018-11-13 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
US10533058B2 (en) 2013-12-16 2020-01-14 Genentech Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
US10632210B2 (en) 2013-12-16 2020-04-28 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
US10017577B2 (en) 2015-06-15 2018-07-10 Genentech, Inc. Antibodies and immunoconjugates
US11793880B2 (en) 2015-12-04 2023-10-24 Seagen Inc. Conjugates of quaternized tubulysin compounds
US11229708B2 (en) 2015-12-04 2022-01-25 Seagen Inc. Conjugates of quaternized tubulysin compounds
US11760775B2 (en) 2016-11-08 2023-09-19 Regeneron Pharmaceuticals, Inc. Steroids and protein-conjugates thereof
US12377159B2 (en) 2016-11-08 2025-08-05 Regeneron Pharmaceuticals, Inc. Steroids and protein-conjugates thereof
US12589101B2 (en) 2017-05-18 2026-03-31 Regeneron Pharmaceuticals, Inc. Cyclodextrin protein drug conjugates
US11491237B2 (en) 2017-05-18 2022-11-08 Regeneron Pharmaceuticals, Inc. Cyclodextrin protein drug conjugates
US12134631B2 (en) 2017-11-07 2024-11-05 Regeneron Pharmaceuticals, Inc. Hydrophilic linkers for antibody drug conjugates
WO2019094395A3 (en) * 2017-11-07 2019-08-22 Regeneron Pharmaceuticals, Inc. Hydrophilic linkers for antibody drug conjugates
US12070506B2 (en) 2018-01-08 2024-08-27 Regeneron Pharmaceuticals, Inc. Steroids and antibody-conjugates thereof
US12497460B2 (en) 2018-05-09 2025-12-16 Regeneron Pharmaceuticals, Inc. Anti-MSR1 antibodies and methods of use thereof
US11377502B2 (en) 2018-05-09 2022-07-05 Regeneron Pharmaceuticals, Inc. Anti-MSR1 antibodies and methods of use thereof
WO2020132483A1 (en) 2018-12-21 2020-06-25 Regeneron Pharmaceuticals, Inc. Rifamycin analogs and antibody-drug conjugates thereof
KR20240016287A (ko) 2021-06-01 2024-02-06 아지노모토 가부시키가이샤 항체 및 기능성 물질의 콘쥬게이트 또는 이의 염, 및 이의 제조에 사용되는 화합물 또는 이의 염
WO2022255425A1 (ja) 2021-06-01 2022-12-08 味の素株式会社 抗体および機能性物質のコンジュゲートまたはその塩、ならびにその製造に用いられる化合物またはその塩

Also Published As

Publication number Publication date
JP6742314B2 (ja) 2020-08-19
MX2017007055A (es) 2017-11-08
RU2017118793A3 (https=) 2019-01-09
JP2018503603A (ja) 2018-02-08
CA2965540A1 (en) 2016-06-09
CN107206102A (zh) 2017-09-26
HK1243931A1 (zh) 2018-07-27
EP3226911A1 (en) 2017-10-11
US20180021450A1 (en) 2018-01-25
BR112017011325A2 (pt) 2020-07-21
KR20170086536A (ko) 2017-07-26
RU2017118793A (ru) 2019-01-09
RU2731055C2 (ru) 2020-08-28

Similar Documents

Publication Publication Date Title
US20180021450A1 (en) Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof
EP3004162B1 (en) Anti-wall teichoic antibodies and conjugates
US9895450B2 (en) Anti-wall teichoic antibodies and conjugates
US20180125995A1 (en) Anti-staphylococcus aureus antibody rifamycin conjugates and uses thereof
US10570192B2 (en) Anti-wall teichoic antibodies and conjugates
US20140356375A1 (en) Anti-wall teichoic antibodies and conjugates
HK1261352A1 (en) Anti-wall teichoic antibodies and conjugates

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15820347

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2965540

Country of ref document: CA

REEP Request for entry into the european phase

Ref document number: 2015820347

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20177014576

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017528894

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2017/007055

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017118793

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017011325

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112017011325

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170530