WO2016054654A1 - Hiv vaccines comprising one or more population episensus antigens - Google Patents

Hiv vaccines comprising one or more population episensus antigens Download PDF

Info

Publication number
WO2016054654A1
WO2016054654A1 PCT/US2015/054067 US2015054067W WO2016054654A1 WO 2016054654 A1 WO2016054654 A1 WO 2016054654A1 US 2015054067 W US2015054067 W US 2015054067W WO 2016054654 A1 WO2016054654 A1 WO 2016054654A1
Authority
WO
WIPO (PCT)
Prior art keywords
vaccine
seq
antigen
epitopes
gag
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/054067
Other languages
English (en)
French (fr)
Inventor
Eric E. Bruening
Klaus Frueh
Louis Picker
Bette T. Korber
James Theiler
Emily MARSHALL
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2017538177A priority Critical patent/JP2017531693A/ja
Priority to EP15847978.2A priority patent/EP3200878B1/en
Priority to KR1020177012171A priority patent/KR102633096B1/ko
Priority to MX2017004275A priority patent/MX391149B/es
Priority to CA2963573A priority patent/CA2963573C/en
Priority to CN201580063643.3A priority patent/CN108064181A/zh
Priority to US15/516,491 priority patent/US10894078B2/en
Priority to UAA201704021A priority patent/UA126890C2/uk
Priority to NZ731173A priority patent/NZ731173B2/en
Priority to BR112017006865-6A priority patent/BR112017006865B1/pt
Priority to SG11201702729YA priority patent/SG11201702729YA/en
Application filed by Individual filed Critical Individual
Priority to AU2015327797A priority patent/AU2015327797A1/en
Priority to HK18113892.2A priority patent/HK1254806A1/zh
Priority to IL251469A priority patent/IL251469B2/en
Priority to EA201790680A priority patent/EA201790680A1/ru
Publication of WO2016054654A1 publication Critical patent/WO2016054654A1/en
Anticipated expiration legal-status Critical
Priority to US17/008,335 priority patent/US11554168B2/en
Priority to US17/008,289 priority patent/US11628215B2/en
Priority to AU2021218141A priority patent/AU2021218141B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/21Retroviridae, e.g. equine infectious anemia virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • C12N15/867Retroviral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16111Cytomegalovirus, e.g. human herpesvirus 5
    • C12N2710/16141Use of virus, viral particle or viral elements as a vector
    • C12N2710/16143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16211Human Immunodeficiency Virus, HIV concerning HIV gagpol
    • C12N2740/16222New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16211Human Immunodeficiency Virus, HIV concerning HIV gagpol
    • C12N2740/16234Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16311Human Immunodeficiency Virus, HIV concerning HIV regulatory proteins
    • C12N2740/16322New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16311Human Immunodeficiency Virus, HIV concerning HIV regulatory proteins
    • C12N2740/16334Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the present subject matter relates, in general, to HIV and, in particular, to HIV vaccines.
  • HIV human immunodeficiency virus
  • AIDS acquired immune deficiency syndrome
  • HDAC histone-deacetylase
  • HIV/SIV polypeptides comprising one or more EpiGraph antigen sequences comprising amino acid sequences corresponding to HIV/SIV Gag, Nef, Pol, Env, including full-length sequences, portions thereof, or any combination thereof. Also provided herein are HIV/SIV polypeptides comprising one or more population episensus antigen sequences comprising amino acid sequences corresponding to HIV/SIV Gag, Nef, Pol, Env, or a combination thereof. Also provided herein are one or more carriers comprising HIV/SIV polypeptides comprising one or more population episensus antigen sequences.
  • HIV/SIV polypeptides comprising one or more tailored antigen sequences comprising amino acid sequences corresponding to HIV/SIV Gag, Nef, Pol, Env, or a combination thereof.
  • the HIV/SIV polypeptides of the present disclosure can comprise one or more HIV-1 tailored antigens, wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 692-696 and SEQ ID NOs: 754-789.
  • one or more carriers comprising HIV/SIV polypeptides comprising one or more tailored antigen sequences. EpiGraph antigen sequences having SEQ ID NOs: 691-789 are provided herein.
  • HIV-1 vaccines comprising one or more carriers and one or more population episensus antigens. Also provided herein are HIV-1 vaccines comprising a vector capable of expressing a population episensus antigen and one or more tailored antigens.
  • the HIV-1 population episensus antigen comprises epitopes from Gag, Pol, Nef, Env, Tat, Rev, Vpr, Vif, or Vpu.
  • the HIV-1 population episensus antigen is a fusion antigen comprising two or more HIV-1 population episensus antigens.
  • the HIV-1 population episensus antigen is central to the HIV-1 B clade epidemic in the United States.
  • the HIV-1 population episensus antigen is central to the HIV-1 C clade epidemic in South Africa.
  • the HIV-1 population episensus antigen is central to the HIV-12-clade regional epidemic in Thailand.
  • the HIV-1 population episensus antigen is central to the HIV-1 M-group global set.
  • the HIV-1 population episensus antigen comprises epitopes from Gag. In some embodiments, the HIV-1 population episensus antigen comprises epitopes from a conserved region of HIV-1. In some embodiments, the HIV-1 population episensus antigen comprises epitopes from a conserved region of Gag, Pol, or Nef. In some embodiments, the epitopes from the conserved region of Gag are epitopes from the p24 capsid protein of Gag.
  • the HIV-1 tailored antigen comprises epitopes from Gag, Pol, Nef, Env, Tat, Rev, Vpr, Vif, or Vpu. In some embodiments, the HIV-1 tailored antigen is central to the HIV-1 M-group global set. In some embodiments, the HIV-1 tailored antigen is central to the HIV-1 C clade epidemic in South Africa. In some embodiments, the HIV-1 tailored antigen is central to the HIV-1 B clade epidemic in the United States.
  • kits comprising administering an effective amount of the described HIV-1 vaccines to the subject in need thereof.
  • methods of designing and producing an HIV-1 vaccine for a subject comprising sequencing HIV-1 viruses in an individual, selecting vaccine antigens designed to optimally cover the diversity within a geographic area, and inserting the vaccine antigens into a vector.
  • methods of treating an HIV-1 infection in a subject comprising administering an effective amount of the disclosed vaccines to the subject in need thereof.
  • HIV-1 vaccines comprising one or more carriers and a population episensus antigen determined using the EpiGraph approach. Further provided herein are methods of designing vaccine antigens to optimally cover the diversity within a geographic area using a vaccine antigen amino acid sequence generated using the
  • EpiGraph method of antigen amino acid sequence selection and producing said designed vaccine antigen Further provided herein are methods of designing and producing an HIV-1 vaccine for a subject comprising determining the amino acid sequence of HIV-1 viruses in an individual by sequencing, selecting vaccine antigens designed to optimally cover the diversity within a geographic area using a vaccine antigen amino acid sequence generated using the EpiGraph method of antigen amino acid sequence selection, and inserting the vaccine antigens into a vector.
  • Also provided herein are methods of inducing an effector memory T cell response comprising determining one or more EpiGraph amino acid sequences, generating a vaccine comprising the one or more EpiGraph antigen amino acid sequences and one or more carriers, and administering the vaccine to a subject in need thereof. Further provided are methods of treating HIV-1 in a subject comprising administering an effective amount of the described HIV-1 vaccines to the subject in need thereof. Also provided herein are methods of protecting from an HIV-1 infection in a subject comprising administering an effective amount of the described HIV-1 vaccines to the subject in need thereof. BRIEF DESCRIPTION OF THE DRAWINGS
  • Figure 1A shows a full graph for the CRF01-AE clade of the Nef protein. The rectangle is an inset shown in Figure 1B.
  • Figure 1B represents the inset from Figure 1A.
  • the solid black line is the optimal path, and corresponds to the sequence TSSNMNNADSVWLRAQEEE [SEQ ID NO: 792]while the dashed line corresponds to TSSNMNNADCVWLRAQEEE [SEQ ID NO: 793].
  • the dashed line achieves higher f(e) values on 4 nodes, but the solid line has higher f(e) for 5 nodes, and ⁇ f(e) is higher. Note there is no path that includes the highest- valued nodes for all values of x.
  • Figure 2 shows nodes of an epitope graph showing the epitope k-character string, and the frequency (f) that the epitope is observed at that position in the aligned sequence set, and the cumulative best score S of consistent paths that end in that node.
  • the nodes are arranged in columns with each column corresponding to the position t associated with the epitope.
  • the lines connecting these nodes correspond to adjacent epitopes that are consistent. The aim is to find a consistent path through this graph that maximizes the sum of the frequency values in each node.
  • the thicker lines show one path that leads to an optimal total score.
  • q2 DEFGKLM [SEQ ID NO: 795].
  • the thicker lines show one path that leads to an optimal total score.
  • Figures 4A-B show the epitope graph associated with a set of 690 US B-clade Gag protein sequences [SEQ ID NOs.1-690], each aligned to 556 positions.
  • the horizontal axis is the position t, and the columns of nodes indicate the different epitopes at each position.
  • the nodes are arranged so that the most frequent at each position are at the bottom of each column.
  • the full graph is shown in Fig.4A; a close-up inset of the same graph is shown in Fig.4B.
  • Figures 6A-B show two-antigen vaccine coverage. Comparisons illustrating the average epitope coverage per sequence of the contemporary B clade sequences isolated in the United States, which was considered as a hypothetical target population for a therapeutic vaccine. To illustrate potential T-cell epitope (PTE) coverage using a pair of natural within-clade sequences as vaccine antigens, 5000 randomly selected pairs of natural B clade sequences (gray) were evaluated as potential vaccines, and the
  • Fig.6A shows the comparison for the full Gag protein.
  • Fig.6B shows comparisons for only the conserved p24 region.
  • Figure 7 shows mapping potential epitope coverage spanning the HIV proteome.
  • Figure 8 shows the average potential Gag epitope coverage of the HIV-1 B clade U.S. sequences by different vaccine antigens.
  • Fig.8A shows the average Gag epitope coverage by single vaccine antigens
  • Fig.8B shows the average Gag epitope coverage by pairs of vaccine antigens.
  • FIG. 9A-C show that EpiGraph designed synthetic HIV antigens are expressed as full-length proteins.
  • HeLa cells were transfected with expression plasmids encoding: fusion proteins of gag and nef for HIV or SIV (HIV M group EpiGraph 1 [SEQ ID NO: 705] and HIV M group EpiGraph 2 [SEQ ID NO: 707], SIVmac239 full length proteins, SIV variants hybrid proteins [SEQ ID NO: 713], and SIV conserved portions of gag and nef [SEQ ID NO: 714]), as represented in Fig.9A; polymerase proteins of HIV or SIV (SIVmac239 full-length (FL), SIV variants hybrid proteins [SEQ ID NO: 715], (HIV M group EpiGraph 1[SEQ ID NO: 709] and HIV M group EpiGraph 2 [SEQ ID NO: 711], and SIV conserved portions of pol [SEQ ID NO: 716]), as represented in Fig.9B;
  • gag and nef constructs include a carboxy-terminal V5 tag (Fig.9A), and all pol constructs include a carboxy-terminal HA tag (Figs.9B and 9C). For Fig.9B, 1 and 2 indicate multiple clones of each construct. Lysates were harvested at 48 hours post-transfection and
  • FIG. 10A-B show that EpiGraph designed synthetic antigens are expressed by CMV vectors.
  • RhCMV strain 68-1 expressing SIVmac 239 polymerase full-length (FL) a hybrid of SIV polymerases from different SIV variants [SEQ ID NO: 715]
  • a synthetic polymerase gene based on global M group HIV EpiGraph 1 [SEQ ID NO: 709] or global M group HIV EpiGraph 2 [SEQ ID NO: 711] were constructed by BAC mutagenesis and reconstituted in telomerized Rhesus fibroblasts.
  • RhCMV strain 68-1 expressing SIVmac239 conserved regions of the polymerase constructs [SEQ ID NO: 716] were also constructed by BAC mutagenesis and reconstituted in telomerized Rhesus fibroblasts. In all vectors, antigen expression is driven by the endogenous viral Rh107 promoter. Cell pellets were harvested at full CPE and immunoblotted for the HA tag expressed at the carboxy-terminus of each protein. For pol conserved, two independent clones (2.1 and 2.2) are shown in Fig.10B.
  • Figures 11A-C shows conserved regions within: Nef (Fig.11A), Gag (Fig.11B), and Pol (Fig.11C). defined based on the potential for potential T-cell epitope (PTE) coverage by a bivalent (i.e., 2 antigen) vaccine.
  • PTE potential T-cell epitope
  • Figure 12 illustrates the average Epigraph coverage of each of the conserved
  • the term“effective amount” refers to an amount effective, at dosages, and for periods of time necessary, to achieve the desired result with respect to the treatment of the relevant disorder, condition, or side effect. It will be appreciated that the effective amount of components of the present invention will vary from patient to patient not only with the particular vaccine, component or composition selected, the route of administration, and the ability of the components to elicit a desired result in the individual, but also with factors such as the disease state or severity of the condition to be alleviated, hormone levels, age, sex, weight of the individual, the state of being of the patient, and the severity of the pathological condition being treated, concurrent medication or special diets then being followed by the particular patient, and other factors which those skilled in the art will recognize, with the appropriate dosage being at the discretion of the attending physician. Dosage regimes may be adjusted to provide the improved therapeutic response. An effective amount is also one in which any toxic or detrimental effects of the components are outweighed by the therapeutically beneficial effects.
  • administering means either directly administering a compound or composition of the present invention, or administering a prodrug, derivative or analog which will form an equivalent amount of the active compound or substance within the body.
  • the terms“subject,”“individual,” and“patient” are used interchangeably herein, and refer to an animal, for example a human, to whom treatment, including prophylactic treatment, with the pharmaceutical composition according to the present invention, is provided.
  • the term“subject” as used herein refers to human and non-human animals.
  • the terms“non-human animals” and“non-human mammals” are used interchangeably herein and include all vertebrates, e.g., mammals, such as non-human primates,
  • cocktail refers to a set of antigens intended to be delivered in
  • epitope based consensus sequence refers to an epitope based consensus sequence. It is a
  • epitopes match, as closely as possible, the epitopes in a reference set of natural sequences.
  • epitope and“potential epitope” refer to a sequence of k characters (typically k is in the range of 8-12), often in the context of a k-character subsequence of a much longer natural or vaccine antigen sequence. T cells can recognize such peptides in an immune response.
  • EpiGraph refers to a new computational strategy developed to create sequences that provide an optimal episensus sequence, or set of sequences that combined provide optimal coverage of a population of diverse viral sequences.
  • the term“population episensus antigen” refers to a sequence derived with the EpiGraph algorithm, which are“central” to a population of HIV sequences.
  • the population could be a specific HIV clade, cluster of sequences derived using our Tailored epitope based clustering algorithm, or the global epidemic.“Central” is defined in terms of sharing potential epitopes, so it is a computationally-derived sequence that provides the maximal average epitope coverage of the population.
  • EpiGraph sequences can be used as a solution for a prophylactic, preventive
  • the term “tailored vaccine set” refers to a set of vaccine antigen sequences designed for manufacture, from which a subset antigens could be selected to best match a patient’s virus for delivery as a therapeutic vaccine.
  • tailored antigen or“tailored episensus antigen” refers to one or more amino acid sequences from the“tailored vaccine set” that would be specifically selected based on a best match to a patient’s infecting HIV-1 strain. for delivery to that patient as a therapeutic vaccine.
  • treatment or“therapy” (as well as different forms thereof, including curative or palliative) refer to treatment of an infected person.
  • treating includes alleviating or reducing at least one adverse or negative effect or symptom of a condition, disease or disorder. This condition, disease or disorder can be HIV infection.
  • prevention or“prophylaxis” refer to preventing a subject from becoming infected with, or reducing the risk of a subject from becoming infected with, or halting transmission of, or the reducing the risk of transmission of, for example, HIV, SIV, or a related virus.
  • “Pharmaceutically acceptable” refers to those compounds, materials,
  • compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem complications commensurate with a reasonable benefit/risk ratio.
  • Vectors that can be used include, but are not limited to, plasmids, bacterial
  • Viral vectors include cytomegalovirus (CMV) vectors.
  • CMV cytomegalovirus
  • An advantage of these CMV vectors for use in therapeutic vaccine delivery is that they create a new CD8+ T cell epitope paradigm and induce more potent and enduring responses. It has been shown in animal models that vaccines based on these viral vectors can clear viral infections (Hansen, S. G.2013. Science 340:1237874), and so these approaches have promise for a therapeutic vaccine, a setting in which tailored vaccines can be useful.
  • viral vectors can include poxvirus (vaccinia), including vaccinia Ankara and canarypox; adenoviruses, including adenovirus type 5 (Ad5); rubella; sendai virus;
  • EpiGraph vaccine antigens could be delivered as DNA, RNA or protein components of a vaccine. As this is an antigen design strategy, EpiGraph-designed vaccine antigens would be compatible with essentially any mode of vaccine antigen delivery.
  • vaccines designed using EpiGraph amino acid sequences have a single antigen. In certain embodiments, vaccines designed using EpiGraph amino acid sequences have sets of antigens.
  • the EpiGraph antigen sequences can be used in a
  • the EpiGraph strategy can be used to make sequences that fully optimize epitope coverage for a prophylactic vaccine. This could be one sequence, or several sequences designed to complement each other as a preventative vaccine. EpiGraph vaccines could be used in any vector , including, but not limited to, plasmids, bacterial vectors, and viral vectors.
  • the natural sequences are characterized by a large graph of nodes, each node corresponding to an epitope that appears in the natural sequences.
  • a path through this graph of nodes and edges corresponds to a single string that contains k-mer substrings corresponding to each of the nodes in the graph. Each node is weighted according to how many sequences in the reference set exhibit a substring corresponding to that node.
  • the EpiGraph algorithm uses a dynamic programming scheme to find the path through this full graph that maximizes the sum of these weights, and therefore provides the greatest coverage.
  • Certain embodiments provided include an HIV-1 vaccine comprising a vector and a population episensus antigen, or combination of optimized EpiGraph antigens designed to be used as a set.
  • vectors that could be used for the vaccine.
  • one type of vector that can be used is a viral vector.
  • viral vectors can include a human cytomegalovirus (HCMV), a poxvirus, adenoviruses, rubella, sendai virus, rhabdovirus, alphavirus or adeno-associated virus.
  • HCMV human cytomegalovirus
  • the vaccine could also be delivered as a gene encoding the EpiGraph protein, either using DNA, RNA, or included as an expressed protein or part of a protein.
  • EpiGraph antigen of the disclosed vaccines can be any organic compound [0053] in certain embodiments.
  • the HIV-1 Gag protein has been inactivated by eliminating a myristoylation sequence in the N-terminus of the HIV-1 Gag protein.
  • the EpiGraph antigen can be derived from the HIV- 1 Pol or Nef protein, or indeed any other HIV protein, including Env, Tat, Rev, Vif, or Vpu.
  • the population episensus antigen can be determined using the EpiGraph approach. This population episensus antigen could then be used to create a vaccine. Alternatively, EpiGraphs could be designed as a combination of sequences designed to be used as a set. HIV-1 can be split into clades based on geographic location. In one embodiment, the population episensus antigen is central to the HIV-1 B clade epidemic in the United States in the disclosed vaccines. In another embodiment, the population episensus antigen is central to the HIV-1 C clade epidemic in South Africa in the disclosed vaccines. In another embodiment, the population episensus antigen is central to the HIV-12-clade regional epidemic in Thailand in the disclosed vaccines. In another embodiment, the population episensus antigen is central to the HIV-1 M-group global set in the disclosed vaccines.
  • the HIV-1 population episensus antigen comprises epitopes from Gag, Pol, Nef, Env, Tat, Rev, Vpr, Vif, or Vpu.
  • the HIV-1 population episensus antigen comprises epitopes from Gag and comprises the amino acid sequence of SEQ ID NO: 691, SEQ ID NO: 697, SEQ ID NO: 698, SEQ ID NO: 699, or SEQ ID NO: 700.
  • the HIV-1 population episensus antigen comprises epitopes from a conserved region of HIV-1.
  • the HIV-1 population episensus antigen comprises epitopes from a conserved region of Gag, Pol, or Nef.
  • the epitopes from the conserved region of Gag are epitopes from the p24 capsid protein of Gag.
  • the HIV-1 population episensus antigen is a fusion antigen comprising two or more HIV-1 population episensus antigens.
  • the fusion antigen comprises a HIV-1 population episensus antigen comprising Gag epitopes and a HIV-1 population episensus antigen comprising Nef epitopes.
  • the fusion antigen comprises a HIV-1 population episensus antigen comprising epitopes from a conserved region of Gag and a HIV-1 population episensus antigen comprising epitopes from a conserved region of Nef.
  • the epitopes of the fusion antigen from the conserved region of Gag are epitopes from the p24 capsid protein of Gag.
  • the HIV-1 population episensus antigen is central to the HIV-1 B clade epidemic in the United States.
  • the HIV-1 B clade population episensus antigen comprises Gag epitopes and comprises the amino acid sequence of SEQ ID NO: 730, SEQ ID NO: 732, or SEQ ID NO: 778.
  • the HIV-1 B clade population episensus antigen comprises epitopes from the p24 capsid protein of Gag and comprises the amino acid sequence of SEQ ID NO: 731, SEQ ID NO: 733, or SEQ ID NO: 779.
  • the HIV-1 B clade population episensus antigen comprises Nef epitopes and comprises the amino acid sequence of SEQ ID NO: 734 or SEQ ID NO: 736. In some embodiments, the HIV-1 B clade population episensus antigen comprises epitopes from a conserved region of Nef and comprises the amino acid sequence of SEQ ID NO: 735 or SEQ ID NO: 737. In some embodiments, the HIV-1 B clade population episensus antigen comprises Pol epitopes and comprises the amino acid sequence of SEQ ID NO: 703, SEQ ID NO: 704, SEQ ID NO: 738, or SEQ ID NO: 740.
  • the HIV-1 B clade population episensus antigen comprises epitopes from a conserved region of Pol and comprises the amino acid sequence of SEQ ID NO: 739 or SEQ ID NO: 741.
  • the HIV-1 B clade population episensus antigen is a fusion antigen comprising (1) a HIV-1 B clade population episensus antigen comprising Gag epitopes and (2) a HIV-1 B clade population episensus antigen comprising Nef epitopes, wherein the fusion antigen comprises the amino acid sequence of SEQ ID NO: 701 or SEQ ID NO: 702.
  • the HIV-1 B clade population episensus antigen is a fusion antigen comprising (1) a HIV-1 B clade population episensus antigen comprising epitopes from the p24 capsid protein of Gag and (2) a HIV-1 B clade population episensus antigen comprising epitopes from a conserved region of Nef.
  • the HIV-1 population episensus antigen is central to the HIV-1 C clade epidemic in South Africa.
  • the HIV-1 C clade population episensus antigen comprises Gag epitopes and comprises the amino acid sequence of SEQ ID NO: 742, SEQ ID NO: 744, or SEQ ID NO: 766.
  • the HIV-1 C clade population episensus antigen comprises epitopes from the p24 capsid protein of Gag and comprises the amino acid sequence of SEQ ID NO: 743, SEQ ID NO: 745, or SEQ ID NO: 767.
  • the HIV-1 C clade population episensus antigen comprises Nef epitopes and comprises the amino acid sequence of SEQ ID NO: 746 or SEQ ID NO: 748. In some embodiments, the HIV-1 C clade population episensus antigen comprises epitopes from a conserved region of Nef and comprises the amino acid sequence of SEQ ID NO: 747 or SEQ ID NO: 749. In some embodiments, the HIV-1 C clade population episensus antigen comprises Pol epitopes and comprises the amino acid sequence of SEQ ID NO: 750 or SEQ ID NO: 752.
  • the HIV-1 C clade population episensus antigen comprises epitopes from a conserved region of Pol and comprises the amino acid sequence of SEQ ID NO: 751 or SEQ ID NO: 753.
  • the HIV-1 C clade population episensus antigen is a fusion antigen comprising (1) a HIV-1 C clade population episensus antigen comprising Gag epitopes and (2) a HIV-1 C clade population episensus antigen comprising Nef epitopes.
  • the HIV-1 C clade population episensus antigen is a fusion antigen comprising (1) a HIV-1 C clade population episensus antigen comprising epitopes from the p24 capsid protein of Gag and (2) a HIV-1 C clade population episensus antigen comprising epitopes from a conserved region of Nef.
  • the HIV-1 population episensus antigen is central to the HIV-12-clade regional epidemic in Thailand.
  • the HIV-12-clade population episensus antigen comprises Gag epitopes.
  • the HIV-1 2-clade population episensus antigen comprises epitopes from the p24 capsid protein of Gag.
  • the HIV-12-clade population episensus antigen comprises Nef epitopes.
  • the HIV-12-clade population episensus antigen comprises epitopes from a conserved region of Nef.
  • the HIV-12- clade population episensus antigen comprises Pol epitopes.
  • the HIV-12-clade population episensus antigen comprises epitopes from a conserved region of Pol. In some embodiments, the HIV-12-clade population episensus antigen is a fusion antigen comprising (1) a HIV-12-clade population episensus antigen comprising Gag epitopes and (2) a HIV-12-clade population episensus antigen comprising Nef epitopes.
  • the HIV-12-clade population episensus antigen is a fusion antigen comprising (1) a HIV-12-clade population episensus antigen comprising epitopes from the p24 capsid protein of Gag and (2) a HIV-12-clade population episensus antigen comprising epitopes from a conserved region of Nef.
  • the HIV-1 population episensus antigen is central to the HIV-1 M-group global set.
  • the HIV-1 M-group population episensus antigen comprises Gag epitopes and comprises the amino acid sequence of SEQ ID NO: 718, SEQ ID NO: 720, or SEQ ID NO: 754.
  • the HIV-1 M- group population episensus antigen comprises epitopes from the p24 capsid protein of Gag and comprises the amino acid sequence of SEQ ID NO: 719, SEQ ID NO: 721, or SEQ ID NO: 755.
  • the HIV-1 M-group population episensus antigen comprises Nef epitopes and comprises the amino acid sequence of SEQ ID NO: 722 or SEQ ID NO: 724. In some embodiments, the HIV-1 M-group population episensus antigen comprises epitopes from a conserved region of Nef and comprises the amino acid sequence of SEQ ID NO: 723 or SEQ ID NO: 725.
  • the HIV-1 M- group population episensus antigen is a fusion antigen comprising (1) a HIV-1 M-group population episensus antigen comprising Gag epitopes and (2) a HIV-1 M-group population episensus antigen comprising Nef epitopes, wherein the fusion antigen comprises the amino acid sequence of SEQ ID NO: 705 or SEQ ID NO: 707.
  • the HIV-1 M-group population episensus antigen is a fusion antigen comprising (1) a HIV-1 M-group population episensus antigen comprising epitopes from the p24 capsid protein of Gag and (2) a HIV-1 M-group population episensus antigen comprising epitopes from a conserved region of Nef, wherein the fusion antigen comprises the amino acid sequence of SEQ ID NO: 706 or SEQ ID NO: 708.
  • the HIV-1 M-group population episensus antigen comprises Pol epitopes and comprises the amino acid sequence of SEQ ID NO: 709, SEQ ID NO: 711, SEQ ID NO: 726, or SEQ ID NO: 728.
  • the HIV-1 M-group population episensus antigen comprises epitopes from a conserved region of Pol and comprises the amino acid sequence of SEQ ID NO: 710, SEQ ID NO: 712, SEQ ID NO: 727, or SEQ ID NO: 729.
  • the disclosed vaccines can further comprise a HCMV vector comprising a HCMV backbone and a tailored antigen selected to be a best match natural HIV-1 strain.
  • the disclosed vaccines can further comprise a HCMV vector comprising a HCMV backbone and a tailored antigen selected to be a best match different HIV-1 strain.
  • the HIV-1 tailored antigen comprises epitopes from Gag, Pol, Nef, Env, Tat, Rev, Vpr, Vif, or Vpu.
  • the tailored antigen comprises a sequence selected from: SEQ ID NOs.692-696; SEQ ID NOs.756-765; SEQ ID NOs.769-777; or SEQ ID NOs.780-789.
  • the HIV-1 tailored antigen comprises epitopes from Gag and comprises the amino acid sequence of SEQ ID NO: 692, SEQ ID NO: 693, SEQ ID NO: 694, SEQ ID NO: 695, or SEQ ID NO: 696.
  • the HIV-1 tailored antigen is central to the HIV-1 M-group global set.
  • the HIV-1 M-group tailored antigen comprises Gag epitopes and comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 756-765.
  • the HIV-1 M-group tailored antigen comprises epitopes from the p24 capsid protein of Gag and comprises the amino acid sequence of SEQ ID NO: 757, SEQ ID NO: 759, SEQ ID NO: 761, SEQ ID NO: 763, or SEQ ID NO: 765.
  • the HIV-1 tailored antigen is central to the HIV-1 C clade epidemic in South Africa.
  • the HIV-1 C clade tailored antigen comprises Gag epitopes and comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 768-777.
  • the HIV-1 C clade tailored antigen comprises epitopes from the p24 capsid protein of Gag and comprises the amino acid sequence of SEQ ID NO: 769, SEQ ID NO: 771, SEQ ID NO: 773, SEQ ID NO: 775, or SEQ ID NO: 777.
  • the HIV-1 tailored antigen is central to the HIV-1 B clade epidemic in the United States.
  • the HIV-1 B clade tailored antigen comprises Gag epitopes and comprises an amino acid sequence selected from the group consisting of: SEQ ID NOs: 780-789.
  • the HIV-1 B clade tailored antigen comprises epitopes from the p24 capsid protein of Gag and comprises the amino acid sequence of SEQ ID NO: 781, SEQ ID NO: 783, SEQ ID NO: 785, SEQ ID NO: 787, or SEQ ID NO: 789.
  • methods of treating HIV-1 in a subject comprising administering an effective amount of one of the disclosed vaccines to the subject in need thereof is provided.
  • the selecting vaccine antigens to optimally cover the diversity within a geographical area uses a vaccine antigen sequence generated using the EpiGraph method of antigen sequence selection.
  • Embodiments of the present invention include methods of treating an HIV-1 infection in a subject comprising administering an effective amount of any of these disclosed vaccines to the subject in need thereof.
  • Embodiments of the present invention also include methods of inducing an
  • effector memory T cell response comprising determining one or more EpiGraph sequences, generating a vaccine comprising the one or more EpiGraph amino sequences and a vector; and, administering the vaccine to a subject in need thereof.
  • methods are provided of inducing an effector memory T cell response wherein the one or more EpiGraph amino sequences comprises SEQ ID NO: 697, SEQ ID NO: 698, SEQ ID NO: 699, or SEQ ID NO: 700.
  • This vaccine can be a prophylactic or therapeutic vaccine.
  • TEM effector memory T cell
  • TCM central memory T cells
  • TEM are persistently maintained in lymphoid tissues and extralymphoid effector sites and are immediately ready to mediate anti-viral effector function, thus providing a constant immune shield at the portals of viral entry and sites of viral reactivation.
  • the most qualified vector system to induce and indefinitely maintain TEM is derived from CMV. Presumably due to continuous, low-level reactivation and/or gene expression in persistently infected cells, CMV maintains just the right amount of persistent, low level immune stimulation required for TEM maintenance without triggering T cell exhaustion.
  • the tailored antigen cocktail can be used in a therapeutic vaccine setting.
  • the tailored vaccine can use a k-means clustering strategy to a defined set of 6-10 sequences that provide very good coverage of epitopes in a population of people that are infected with a highly variable pathogen, such as HIV.
  • the virus infecting a subject can be sequenced and 2 or 3 tailored vaccines will be delivered that best cover the infecting virus. Epitope coverage will be optimized while epitope mismatches will be will be minimized between the vaccine and the infecting strain.
  • HIV-1 vaccine comprising a HCMV backbone vector, which lacks certain CMV gene regions, and a population episensus antigen.
  • the HCMV backbone can lack the UL131A-128 gene region.
  • Certain embodiments can also include deletion of the tegument protein pp71 (UL82) gene. (U.S. Patent Application Publication Nos.2014-0141038; 2008-0199493; 2013-0142823: and International Application Publication No. WO/2014/138209).
  • the present disclosure provides vaccines which can
  • the vaccines can comprise a second, a third, or more tailored antigen sequences.
  • the episensus antigen can comprise the amino acid sequence of SEQ ID NO: 691.
  • the tailored antigen can comprise the amino acid sequence of SEQ ID NO: 692, SEQ ID NO: 693, SEQ ID NO: 694, SEQ ID NO: 695 or SEQ ID NO: 696.
  • the first tailored antigen sequence and the second tailored antigen sequence comprise two of the amino acid sequences of SEQ ID NO: 692, SEQ ID NO: 693, SEQ ID NO: 694, SEQ ID NO: 695 and SEQ ID NO: 696.
  • the first tailored antigen sequence, the second tailored antigen sequence and the third tailored antigen sequence comprises three of the amino acid sequences of SEQ ID NO: 692, SEQ ID NO: 693, SEQ ID NO: 694, SEQ ID NO: 695 and SEQ ID NO: 696.
  • tailored antigen sequences that can comprise SEQ ID NO: 692, SEQ ID NO: 693, SEQ ID NO: 694, SEQ ID NO: 695 or SEQ ID NO: 696.
  • the disclosed vaccines can further comprise a HCMV vector comprising a HCMV backbone and a tailored antigen selected to be a best match natural HIV-1 strain.
  • the disclosed vaccines can further comprise a HCMV vector comprising a HCMV backbone and a tailored antigen selected to be a best match different (and distant) HIV-1 strain.
  • the disclosed vaccines can be derived from the HIV-1 Gag protein.
  • the HIV-1 Gag protein has been inactivated by eliminating a myristoylation sequence in the N-terminus of the HIV-1 Gag protein.
  • the episensus antigen and the tailored antigen can be derived from the HIV-1 Pol or Nef protein.
  • methods of treating HIV-1 in a subject comprising
  • methods of designing and producing an HIV-1 vaccine for a subject comprising sequencing HIV-1 viruses in an individual, selecting vaccine antigens designed to optimally cover the diversity within a geographic area, and, inserting the vaccine antigens into a vector are provided.
  • Certain embodiments include methods of treating an HIV-1 infection in a subject comprising administering an effective amount of any of this disclosed vaccines to the subject in need thereof.
  • Example 1 Graphical model for optimal epitope coverage of aligned sequences.
  • a frequency f (e) can be associated which counts the fraction of sequences in S for which the epitope appears.
  • I is the indicator function: it is one if its argument is true, and is zero otherwise.
  • the set E Q can also be partitioned according to position in sequences q.
  • Figure 2 shows nodes of an epitope graph, where each node includes the epitope k-character string, and the frequency (f) that the epitope is observed at that position in the aligned sequence set, and the cumulative best score S of consistent paths that end on that node.
  • the nodes were arranged in columns with each column corresponding to the position t associated with the epitope.
  • the lines connecting these nodes correspond to adjacent epitopes that were consistent.
  • the aim is to and a consistent path through this graph that maximized the sum of the frequency values in each node.
  • T ⁇ k+1 argmax e S(T ⁇ k + 1, e)
  • T -k defined the highest-scoring consistent sequence of epitopes.
  • the argmax operator may not have a unique value; if it does not, then there will be multiple solutions to the episensus problem, all of which are optimal in the sense of coverage.
  • ARCCDEGH [SEQ ID NO: 806] and ARCDEFGH [SEQ ID NO: 807] were better aligned as ARCCDE-GH [SEQ ID NO: 808] and ARC-DEFGH [SEQ ID NO: 809]. Placeholder epitopes were developed to deal with these gaps in the EpiGraph algorithm.
  • a“substrate” sequence that is generally taken to be the consensus sequence was used. Then, all the epitopes at all the positions were taken and sorted according to how often they appear. Starting from the least frequent epitope, each epitope was dropped onto the substrate by replacing the characters in the substrate at the positions [t : t + k ⁇ 1] with the characters in the epitope. When the most frequently occurring epitope was dropped onto the substrate, a string was used as the episensus solution q. Since the most frequent epitopes overwrite the rarer epitopes, higher epitope coverage was achieved. And since a single sequence q is always updated, the final solution will be composed of consistent epitopes.
  • the algorithm may not be fully deterministic because some epitopes might have identical frequencies, and if their positions are overlapping, then the final result may depend on what order they are dropped. On implementation, the order that the sort algorithm gives is taken, but there is an opportunity to randomize those orders and to make multiple runs of the algorithm, with some runs possibly giving higher scores.
  • each epitope was“dropped” onto the substrate by replacing the characters in the substrate at the positions [t : t + k ⁇ 1] with the characters in the epitope.
  • episensus solution q Since the most frequent epitopes overwrite the rarer epitopes, a high epitope coverage was achieved. Since a single sequence q was always being updated, the final solution was composed of consistent epitopes.
  • the algorithm may not be fully deterministic because some epitopes might have identical frequencies, and if their positions are overlapping, the n the final result may depend on what order they are dropped. In implementation, the order that the sort algorithm gives is taken, but there is an opportunity to randomize those orders and to make multiple runs of the algorithm, with some runs possibly giving higher scores. The utility of this randomized multiple-run approach has not been investigated.
  • Figure 4 illustrates what the graph looks like for such a large dataset.
  • Figure 4 shows a graph associated with a dataset of 690 US B-clade Gag protein sequences (SEQ ID NOs.1-690), each aligned to 556 positions. Results are shown in Table 2. Horizontal axis is the position t, and the columns of nodes indicate the different epitopes at each position. The nodes were arranged so that the most frequent are at the bottom. The nodes and edges (indicating consistency of adjacent nodes) are shown. The full graph is shown in (a); a close-up inset of the same graph is shown in (b).
  • a set S ⁇ s 1 , s 2 , ... , s N ⁇ of N unaligned protein sequences is taken to
  • the monovalent problem is to design a single artificial sequence q that resembles a natural protein but optimally covers the potential epitopes in the population S. Writing E(q) as the set of epitopes that appear in q, our measure of coverage is
  • the numerator is the sum of the frequencies of epitopes that appear in q, and the denominator normalizes by the sum over all epitopes that appear in any of the sequences in S.
  • This formulation can be expressed as a directed graph. Each node in the graph corresponds to a distinct epitope e, and a directed edge connects two length-k epitopes (ea; eb) if those epitopes overlap by k-1 characters.
  • this directed graph has no cycles, then EpiGraph finds a path through the graph that rigorously maximizes coverage, providing the optimal solution. Furthermore, this optimization is done with computational effort that scales only linearly with the size (as measured in nodes and edges) of the graph. In practice the directed graph created from S may not be acyclic, though it is often very nearly so, especially for larger values of k. For this case, the graph was“de-cycled,” by iteratively identifying cycles and then removing low-value edges until no cycles remain.
  • a polyvalent“cocktail” of m > 1 antigens can be created by running EpiGraph sequentially, and optimizing complementary epitope coverage. This is achieved by treating the epitopes e that were included in the first antigens as if their frequencies were zero, and then running Epigraph on these modified frequencies. If any of the epitopes in the first antigens are required to complete a path (and generate a complete protein), they will still be available, but they will be disfavored, since they no longer contribute to the coverage score. This sequential solution can be improved using iterative refinement.
  • Example 3 Tailored therapeutic vaccines.
  • the infecting virus sequence can be obtained and matched.
  • Optimality was defined in terms of k-mer coverage. This is defined by replacing each sequence with a“bag of epitopes,” i.e., an unordered list of all the k-mers that appear in the sequence.
  • a bag of epitopes can be defined for a set of sequences by making a list of all k-mers that appear in any of the sequences in the set.
  • the coverage of a given sequence S by a set of sequences is given by the fraction of epitopes in S’s bag that are also in the collective bag of the Q sequences, where Q might be a polyvalent combination in a vaccine cocktail. It is this coverage that was optimized.
  • Another quantity of interest was the fraction of epitopes in the Q-bag that are not in the S- bag. Although it is not (currently) used directly in the optimization, a smaller fraction of these extraneous epitopes is preferred, and these numbers are calculated for comparisons and experimental design.
  • Consensus The consensus was a common standard, obtained by concatenating the most common amino acid in an alignment.
  • the EpiGraph solution was very close to a consensus, and was also very close to the single best mosaic, with only one amino acid difference from the other two centroids.
  • the episensus is first defined for the population, and this is q 1 .
  • all k-mers that are already covered by q 1 are excluded, and the approach solves for the second sequence in the series by the same drop-in-place process, to yield q 2 .
  • all k-mers already covered by q 1 and q 2 are excluded, and the approach solves for q 3 and so on until it has been solved for a set of N sequences, each including ever rarer versions of the potential epitopes.
  • Mosaic refers to the genetic algorithm termed Mosaic and/or antigen sequences produced by the GA.
  • a set of mosaics of size N are solved for all at once, or the best single mosaic can be solved for, fixed, and solved for a complementary set of 5 to make a total of 6 vaccine option sequences. This strategy was employed to enable direct comparisons with clustering strategies described below.
  • the natural strain in a set is identified that is most“epitope centric”, i.e. it has the most common k-mers.
  • a frequency can be assigned to that specific form based on its frequency in the population, and then sum the frequencies as a measure of how well the natural strain covers the population.
  • the natural strain with the highest score is the best single strain, Nat.1.
  • the k-mers that are covered by Nat.1 can be eliminated from the scoring scheme, and the best complement to Nat.2 can be picked by finding the best natural strain for epitope coverage excluding those epitopes already covered by Nat.1.
  • Nat.1 is the best single strain
  • Nat.2 the best complement to Nat.1
  • Nat.3 the best complement to (Nat.1+Nat.2).
  • Vaccine options have been explored that are designed according to the following general strategies, comparing new ideas to specifically address therapeutic vaccine population sequences that have been designed in the past to optimize for population coverage.
  • Consensus Find a single universal sequence that best covers the population.
  • Candidates for this 1-universal sequence included: a population consensus, the best single GA mosaic, the episensus, and the most“epi-centric” natural strain.
  • EpiGraph Find either 2 or 3 population-based sequences and give them to
  • each individual would get only the vaccine sequences that best matched his or her infection: Manufacture, for example, 6 vaccine antigen sequences, and pick the best one, or the best combination of 2 or 3 from among those 6 for delivery to the patient; i.e., choose those that provide the best coverage of a patient’s infecting strain, with the fewest mismatched epitopes.
  • Manufacture for example, 6 vaccine antigen sequences, and pick the best one, or the best combination of 2 or 3 from among those 6 for delivery to the patient; i.e., choose those that provide the best coverage of a patient’s infecting strain, with the fewest mismatched epitopes.
  • the 6 clusters were seeded with most complementary 6 natural (Nat6) strains as these are very distinctive, and then reassigned the center based on the clusters as the episensus, and iteratively re-clustered, and re-centered.
  • This strategy was compared to starting with the 6 best natural strains and using a consensus as the cluster centroid instead of the episensus, and the episensus gave slightly better coverage. Enforcing a minimum cluster size also gave slightly better coverage (1, 5 and 20 as minimum cluster sizes were tried), so a minimum cluster size was incorporated as a constraint. A minimum size of 20 was better than 1 or 5.
  • the members of this“too-small cluster” are each reassigned to best centroid from the other five clusters.
  • the cluster that has the greatest average distances to its centroid was split by taking two random natural sequences from within the cluster as centroids and reforming two clusters about them, recalculating the centroids, and going on to the next step with these new six clusters.
  • the centroids of these clusters were very close to the center of the tree. It was determined from the sequences that this is due to replication of the consensus repeatedly within the clusters dominating the signal.
  • Episensus + (5 cluster centers).
  • the central sequence was first defined for the whole population using the EpiGraph algorithm (the population episensus), fixed for inclusion as a vaccine reagent. Any epitopes that match the population episensus were excluded from clustering considerations. Sequences are clustered as before, with a minimum size but this time 5 clusters based on all potential epitopes except those found in the episensus, so the clusters complement the population episensus, were targeted. This was determined to be the best solution for Gag.
  • T/A Tailored/Alternatives, T is the number of tailored pills (out of A alternatives) that are given to each individual, possibly in combination with some common pills.
  • P Per-subject total (T+C), the number of pills given to each individual.
  • C6-epi is the best of class if 6 vaccines were going to be made, and give one of the six to a subject based on their sequence.
  • Hybrid best three– fix the population center, and 2 of 5 centroids to best complement a fixed sequence so cover the test sequence.
  • HIV diversity at the population level begins with rapid evolution within each
  • prophylactic vaccines are to rapidly eliminate the infecting strain or prevent it from infecting in the first place. Since it is not known which strain will be transmitted, prophylactic vaccines have to elicit immune responses that would be active against any variant that might be encountered. In contrast, an immunotherapy can be directed against a known viral population present within a given host.
  • the implementation of a tailored vaccine design strategy requires manufacturing a manageable number of vaccine reagents that maximally capture the epitope diversity of the target population, sequencing HIV from the infected vaccine recipient, and then selecting from among the vaccine reagent pool the subset of antigen inserts that best matches the subject.
  • the tailored vaccine strategy is thus conceptually distinct from mosaic vaccine design.
  • the episensus seeks the most common epitope (e.g., 12-mer) starting in each position of the alignment.
  • epitope e.g., 12-mer
  • the goal is to deal with those conflicts in a way that leads to maximal epitope coverage of a population by a vaccine.
  • a new centroid sequence is computed, based on the episensus of the sequences in that cluster. All of the sequences are then re-assigned according to which of the new centroids is closest. This process converges to a k-means-like optimization for the design of the 6 vaccine antigens, which are taken to be the episensus centroids of the individual clusters, and these antigens could be used as a manufactured set, from which to select those that provide the best-match for a given vaccine.
  • a hybrid approach was found to substantially improve epitope coverage, while minimizing increases in potential vaccine-specific responses.
  • the central sequence was computed for the whole population (the population episensus), and subsequent clustering was based exclusively on epitopes that were not found in the central sequence.
  • the cluster episensus sequences complement the population episensus.
  • the 6-sequence reagent pool consists of the one population episensus and five complementary-cluster centroid sequences, and subjects would be given a two- antigen tailored vaccine, the population episensus paired with the best complementary sequence.
  • This strategy yielded more diverse sequences in the reference set, and improved potential coverage of natural Gag sequences in the test population as seen in Table 4.
  • Table 4 Average per-strain coverage of potential epitopes in US clade B Gag by different vaccines.
  • a tailored vaccine, 2- or 3-antigen design was made for each of the 690 variants, selected from the population episensus and the 5 cluster derived complementary sequences. This was compared to the potential epitope coverage of population-based vaccine strategies where every vaccinee would be given the same vaccine, either mosaic or best-natural combinations.“Delivered” indicates the number of antigens that would be included in a vaccine cocktail.“Manufactured” indicates the size of the reference pool of vaccine antigens that would need to be synthesized to choose among for the tailored approach to be used.
  • The“% matched” indicates the average number of potential epitopes perfectly matched between each of the natural Gag variants and the vaccine; the higher this value, the more likely vaccine responses will be cross-reactive with natural variants.
  • The“% non-matched” represents the fraction of potential epitopes in the vaccine that are not found in a given natural Gag sequence, calculated for each of the 690 sequences separately then averaged. The higher this value, the greater the potential the vaccine to elicit vaccine-specific responses that may detract from cross-reactive responses.
  • the improvement factor indicates the increase in coverage using the proposed new vaccine design options, over using a single best natural strain.
  • the tailored vaccine approach theoretically does very well if 1 out of 12 mis-matches are tolerated in potential epitopes, rather than requiring identity (Table 5); given this more lenient, and perhaps biologically more realistic, measure, approximately 90% of vaccine responses to tailored vaccines may be cross-reactive with epitopes in matched natural Gags.
  • the tailored vaccine approach was superior to population mosaics, consensus sequences, and the best natural strains in terms of both maximizing epitope coverage of Gag sequences, and minimizing potentially deleterious vaccine- specific epitopes (Figure 8).
  • the code can also be applied to tailoring vaccines using multiple sequences rather than use one representative each from infected individuals, and applying the tailored vaccine design strategy to different populations (the C clade epidemic in Southern Africa, the 2-clade regional epidemic in Thailand, and global M group set) are explored.
  • Tailored vaccine antigens can provide better coverage (compared to population- based antigens) of natural sequences when the infecting strain is known.
  • Example 5 Dual expression vectors
  • dual expression vectors are generated, with each expressing a complete Gag antigen and a second HIV antigen.
  • the second HIV antigen can be, for example, a fusion protein of reverse transcriptase (RT) and the central part of Nef. Integrase is not included, as it is a rather poor stimulator of T cell responses.
  • CMV vectors e.g., RhCMV or HCMV vectors
  • sequences based on the EpiGraph algorithm developed are generated (one vector expressing a Gag population episensus antigen and five vectors that each express a complementary cluster-based Gag antigen), and panels of antigens covering RT and the central region of Nef are also designed.
  • One vector expressing a Gag population episensus antigen plus two vectors each expressing a different Gag antigen can be selected from among the five complementary cluster-based antigens are provided.
  • These vectors can also contain one of two complementary HIV-1 EpiGraph RT/nef
  • HCMV-based vaccine vectors that can enter vaccine production is generated by sequencing the resulting vectors and characterizing them for antigen expression and growth in vitro.
  • Inserts were ligated to linearized vector at approximately 3:1 insert to vector ratio for 15 minutes at room temperature using a rapid ligation kit (Roche, Indianapolis, IN), transformed into chemically competent E. coli (DH5-alpha), and plated on antibiotic selection plates. DNA from resulting colonies was screened by restriction digestion for inserts.
  • Clones containing each of the correct inserts in the appropriate orientation relative to vector promoter and poly(A) sequences were grown in liquid culture for plasmid DNA purification. Actively growing sub-confluent Hela cells in 12 well tissue culture plates received 500ul of fresh media (DMEM 10% FBS) while liposomes were prepared. To generate liposomes containing plasmid DNA, 250ul of serum free media was mixed with 500ng of plasmid DNA, and 250ul of serum free media was mixed with 2ul of lipid (Lipofectamine 2000, Invitrogen). After 5 minutes incubation at room temperature these solutions were combined, mixed, and incubated for 20 minutes.
  • DMEM 10% FBS fresh media
  • 250ul of serum free media was mixed with 500ng of plasmid DNA
  • 250ul of serum free media was mixed with 2ul of lipid (Lipofectamine 2000, Invitrogen). After 5 minutes incubation at room temperature these solutions were combined, mixed, and incubated for 20 minutes.
  • the DNA containing liposomes (500ul) formed during this process were added dropwise to the culture and allowed to incubate 12-16 hours after which time the transfection mixture was replaced with fresh media. After an additional day of incubation cultures were harvested by scraping and centrifugation. Supernatants were removed by aspiration and cell pellets lysed by resuspension in 100ul gel loading dye containing 5% SDS and 10% 2- mercaptoethanol and centrifugation through QiaShred column (Qiagen, Valencia, CA).
  • HA (Sigma) or V5 (Santa Cruz) antibodies were diluted in 5% milk solution and incubated with membranes for 1 hour followed by 3 washes with PBS-T prior to addition of 1:2000 dilution of horseradish peroxidase conjugated goat anti-mouse (Santa Cruz) secondary antibody for 1 hour. Subsequently blots are washed three times in PBS-T and developed with enzyme linked chemi- luminescence (ECL kit (Thermo-Pierce) and visualized with X-ray film.
  • ECL kit enzyme linked chemi- luminescence
  • EpiGraph antigens were designed to maximize the coverage of T-cell epitopes representative of the spectrum of viral sequences and clades of HIV from which they were generated. To utilize these antigens most effectively they have been engineered into CMV vectors which have demonstrated three times the CD8 + T cell spectrum of competing platforms. Broad antigen presentation and lifelong expression profiles of CMV vectors have demonstrated the capacity to protect and cure rhesus monkeys infected with SIV. The EpiGraph antigen design algorithm in combination with CMV vectors may provide even greater coverage of HIV within and across clades when applied to broadly prophylactic vaccines or tailored focused vaccines.
  • Recombination is a sequential two-step process consisting of insertion of the antigen sequence with an antibiotic resistance gene (kanamycin) into the target region followed by removal of the kanamycin cassette.
  • the insertion fragments are amplified by PCR from template DNA containing the antigen of interest plus kanamycin using primers with long (50+ bp) homology arms.
  • Purified insert 500 ng was combined with 100 ul competent E. coli on ice, moved to a 0.2 cm cuvette (Fisher), and electroporated using the Bio-rad MicroPulser apparatus. Following electroporation, the bacteria were diluted by addition of 900 ul LB culture media and allowed to recover at 30°C for 2 hours prior to plating on chloramphenicol/kanamycin plates. Plates were incubated at 30°C for two days and colonies were screened by restriction digest and PCR for recombination events.
  • BAC constructs positive for recombination proceeded to the second step where the kanamycin cassette was excised by arabinose induction of the Flip recombinase mediated by flanking FRT sites.
  • Five ml cultures were grown overnight in LB + chloramphenicol and diluted 1:10 the following morning. After three hours of growth the bacteria were treated with L-arabinose (Arcos, 0.1% final concentration) and induced for 1.5 hours at 30°C. Following induction the bacteria were streaked on chloramphenicol plates and incubated for two days at 30°C. Colonies were then replica plated on chloramphenicol/kanamycin and chloramphenicol plates to screen for clones that had lost kanamycin resistance. These clones were further screened by restriction digest and PCR to confirm the construct.
  • Viral Reconstitution To regenerate virus, the BAC DNA was transferred into mammalian host cells permissive for viral growth. BAC DNA purified from 10 ml of an overnight culture was electroporated into approximately 1/5 of a confluent flask of telomerized fibroblasts ( ⁇ 200,000 cells). In brief, cells were pelleted (1,500 rpm, 5 minutes) and resuspended in 700 ul Opti-Mem. This cell mixture was then added to 50 ul of BAC DNA and mixed gently before transfer to a 4mm cuvette. Electroporation was done using the Bio-rad GenePulser II at 0.25 kV and 0.95 uF.
  • cells were plated into 100 mm dishes containing DMEM + 10% FBS and media was changed the next day to remove cell debris. Cells were observed daily for the formation of plaques and harvested at full CPE. The remaining attached cells were harvested by cell scraper and pelleted by centrifugation (1,500 rpm, 5 minutes), and the supernatant containing reconstituted virus vector was retained for passage of the recombinant virus. Cell pellets were lysed by resuspension in 100ul gel loading dye containing 5% SDS and 10% 2-mercaptoethanol and centrifugation through QiaShred column (Qiagen, Valencia, CA).
  • 10% polyacrylamide gels were prepared and loaded with 10ul (10% of each sample) and electrophoresed at 110– 120 volts for 90 minutes.
  • the resolved proteins were transferred to PVDF membranes by semi-dry blotting at 20 volts for 45– 50 minutes.
  • Non-specific binding was blocked with a solution of 10% nonfat dry milk in phosphate buffered saline with 0.1% tween-20 (PBS-T) for 60 minutes.
  • HA (Sigma) or V5 (Santa Cruz) antibodies were diluted in 5% milk solution and incubated with membranes for 1 hour followed by 3 washes with PBS-T prior to addition of 1:2000 dilution of horseradish peroxidase conjugated goat anti-mouse (Santa Cruz) secondary antibody for 1 hour. Subsequently blots were washed three times in PBS-T and developed with enzyme linked chemi-luminescence (ECL kit (Thermo-Pierce) and visualized with X-ray film.
  • ECL kit enzyme linked chemi-luminescence
  • M group (global) was considered, as well as B and C clade (geographically
  • Gag, Pol and Nef Epigraph vaccine antigens were generated -. B and M group are expressed.
  • Epigraphs have an additional tangible benefit relative to Mosaic antigens, in that the benefit of excluding ever-more rare epitopes in the constructs can be balanced by tolerating minimal PTE coverage costs. These Epigraphs were designed with that in mind, allowing a slight coverage cost (0.005) to ensure that even the rarest epitopes represented in the Epigraph antigens were observed in many of the population sequences (the precise number depends on the input data set).
  • Paired Epigraph antigen sets for a bivalent vaccine were sequentially solved using the Epigraph algorithm for unaligned sequences.
  • the sequential solution was used, which allows the use of first Epigraph as a monovalent vaccine in isolation. This means that they are designed so that the best single Epigraph antigen, an“episensus”, is solved first to provide the optimal PTE coverage of a population, and then it is fixed for inclusion in the bivalent design. The complement is then solved to give best population PTE coverage by a bivalent pair of antigens that contain the first Epigraph, the episensus. The coverage costs were minimal relative to a simultaneous antigen solution.
  • the basic Epigraph antigens were designed as full proteins, and these -were - expressed in CMV vectors and tested as either Gag/Nef fusion proteins, or Pol with deletions made for safety, or as the most conserved regions of Gag and Nef fused, or the most conserved regions of Pol fused. Lists of each of the full protein form for expression in the CMV vector are included below with examples for the M group and the B clade.
  • Tailored antigens either Gag or the most conserved part of Gag, p24 were used.
  • the full M group 2015 alignments of 4596 sequences were used, to provide a global solution.
  • An alignment of 189 contemporary B clade sequences were isolated in the US, or an alignment of 199 contemporary C clade sequences from
  • These therapeutic vaccine antigens are designed for used in treatment scenarios where they could be matched, or“tailored”, to the sequenced infecting virus of the person who would receive the vaccine. 6 vaccine antigens would be manufactured, the best matched 2 or 3 from that set to the individuals infecting virus would be given to an individual to maximize matches between the vaccine and their infecting strain.
  • Tailored antigen solution with p24 as bold face. Either Gag or the more conserved p24 could be used in a tailored vaccine.
  • Matched PTE scores and mismatched scores for delivery of the n best matched antigens out of a pool of m, for Gag proteins or the interior p24 region, where the n are selected to best cover each individual sequence in the target population.
  • the target populations are the contemporary C clade infected population sampled in Southern Africa, or the contemporary B clade population sampled in the USA.
  • the vaccine arms for initial testing in CMV include: 1) A single population
  • episensus Gag antigen central to the U.S. B clade epidemic; 2) The population episensus plus a tailored Gag protein selected to be a best match natural HIV-1 strain; 3) The population episensus plus a tailored Gag protein selected to be a best match different (and distant) natural HIV-1 strain; 4) The population episensus plus both Gag proteins from cohort 2 and 3.
  • the resulting immune responses are analyzed using overlapping 15-mer peptides (4 amino acid overlap) corresponding to the vaccine antigen (to determine the total vaccine-elicited Gag-specific responses) and then to both the“target” HIV-1 strain and selected non-target HIV strains (see below) to measure the strain-specific responses and the level of epitope matching (comparing target vs. non-target HIV Gag sequences). It is determined whether computationally designed inserts and vector combinations provide higher magnitude and broader T cell responses to the target strain, while minimizing non-target strain matched responses. The results of this analysis allow for experimentally testing the predictions for epitope matching generated in Example 1.
  • RM Rhesus Macaques
  • 10 6 PFU of HCMV vectors receives a single vector containing the clade B episensus sequence
  • cohort 2 receives the episensus vector plus a single tailored vaccine vector
  • cohort 3 receives the episensus plus a different tailored vaccine vector
  • cohort 4 receives the episensus plus both tailored vaccine vectors.
  • the vaccines are“tailored” towards 2 representative transmitted/founder HIV strains selected from a small set of 9 B clade U.S. HIV infections that were extensively sequenced longitudinally; this panel represents a spectrum of natural infection comparable to what might be encountered in a human clinical trial.
  • Rhesus monkeys are inoculated subcutaneously at day 0 and week 12 and followed longitudinally for one year. Since vaccination by HCMV-vectors is not affected by pre-existing anti-RhCMV immunity, animals naturally infected with RhCMV are used for these experiments.
  • Flow cytometric intracellular cytokine analysis is used to determine the CD4+ and CD8+ T cell response to individual consecutive 15mer peptides comprising the vaccine sequences within the vaccine inserts administered to each animal (which will comprise the total vaccine-elicited responses). It is then determined whether these epitope-specific T cells recognize epitope variants in both the target strain and the other 8 non-target strains.
  • the magnitude, functional avidity, and functional characteristics (IFN- ⁇ , TNF- ⁇ , IL-2 and MIP-1 ⁇ production and CD107 externalization) of these responses to the“parent” (vaccine insert sequences) peptide variants are compared to determine the degree of functional cross-reactivity.
  • truncation analysis is used to identify the core epitope for similar comparative analysis.
  • the tailored 2 antigen cocktail could likely generate T cell responses with at least 25% higher frequency of cross-reactive responses to its matched natural strain compared to episensus alone (Table 5). Testing is also done to determine whether inclusion of 3 complementary tailored antigens in a cocktail induces more cross-reactivity, or if antigen dilution or the presence of greater numbers of vaccine- specific epitopes necessitated by adding 3 instead of 2 antigens actually diminishes the magnitude or breadth of the cross reactive response to the natural protein.
  • CMV-based T cell responses are expected to be much broader and therefore cover a much higher percentage of sequences than reported previously for other vectors. Thus, even with a relatively small number of animals there should be sufficient epitope responses to evaluate the impact of sequence variation on the cross-reactive potential of the responses.
  • the number and magnitude of all responses to the vaccines is determined by using vaccine-matched sets of peptides. Once the targeted peptides are determined, using just those peptides that are positive in each animal, the impact of natural variation on each vaccine-responsive peptide is determined.
  • the natural variants that are tested are based on the variation found in a reference panel, including both tailored and poorly matched Gags.
  • Nonparametric and computational re-sampling statistical methods are used as the primary tools to evaluate the impact of epitope variation on diminishing magnitude or abrogation of recognition. These analyses are complemented, however, by using generalized linear models as needed to explore the impact of more complex interactions on T cell response cross-reactivity.
  • Tailored vaccine antigen episensus sequence Tailored vaccine antigen episensus sequence.
  • Tailored vaccine antigen 1 sequence
  • Tailored vaccine antigen 2 sequence
  • Tailored vaccine antigen 3 sequence
  • Tailored vaccine antigen 4 sequence is
  • Tailored vaccine antigen 5 sequence MGARASVLSGGKLDKWEKIRLRPGGKKQYKLKHLVWASRELERFAVNPGLLETAEGCRQILGQLQPALQTGS EELKSLFNTVATLYCVHQRIDVKDTKEALEKIEEEQNKSKKKAQQ-------AAADTGNNS--------- QVSQNYPIVQNIQGQMVHQALSPRTLNAWVKVIEEKAFSPEVIPMFSALAEGATPQDLNTMLNTVGGHQAAMQILKET INEEAAEWDRLHPVQAGPVAPGQMREPRGSDIAGTTSNLQEQIAWMTHNPPIPVGEIYKRWIIMGLNKIVRMYSPVSI LDIRQGPKEPFRDYVDRFYKTLRAEQASQDVKNWMTETLLVQNSNPDCKTILKALGPGATLEEMMTACQGVGGPSHKA RVLAEAMSQATN--PATIMMQRGNFKNQRKIVKCFNCGKEGHIAKNCRAPRKKGCWK
  • HIV B pol Epigraph 1 HIV B pol Epigraph 1
  • HIV M pol Epigraph 1 HIV M pol Epigraph 1
  • HIV B pol Epigraph2 HIV B pol Epigraph2
  • HIV M gag episensus EG-0 conserveed, Tailored
  • HIV C gag episensus EG-0 conserveed, Tailored
  • HIV C gag CEN-2 conserveed, Tailored
  • HIV B gag episensus EG-0 Tailored
  • HIV B gag episensus EG-0 conserveed, Tailored
  • HIV B gag CEN-1 conserveed, Tailored
  • HIV B gag CEN-2 conserveed, Tailored
  • HIV B gag CEN-3 conserveed, Tailored
  • HIV B gag CEN-4 conserveed, Tailored
  • HIV B gag CEN-5 conserveed, Tailored
  • ARCGSLM SEQ ID NO: 800 ARCGSPM SEQ ID NO: 801 ARYGSLM SEQ ID NO: 802 AYCHSLM SEQ ID NO: 803 YRCHSLM SEQ ID NO: 804 DEFGSLM SEQ ID NO: 805 DEFGKLM SEQ ID NO: 806 ARCCDEGH SEQ ID NO: 807 ARCDEFGH SEQ ID NO: 808 ARCCDE-GH SEQ ID NO: 809 ARC-DEFGH SEQ ID NO: 810 DECHJLM SEQ ID NO: 811 DEFGJLM

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Virology (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Communicable Diseases (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • AIDS & HIV (AREA)
  • Oncology (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Biochemistry (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2015/054067 2014-10-03 2015-10-05 Hiv vaccines comprising one or more population episensus antigens Ceased WO2016054654A1 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
SG11201702729YA SG11201702729YA (en) 2014-10-03 2015-10-05 Hiv vaccines comprising one or more population episensus antigens
KR1020177012171A KR102633096B1 (ko) 2014-10-03 2015-10-05 하나 이상의 집단 에피센서스 항원을 포함하는 hiv 백신 조성물
MX2017004275A MX391149B (es) 2014-10-03 2015-10-05 Vacunas contra el virus de inmunodeficiencia humana (vih) que comprenden uno o mas antigenos episensus de poblacion.
CA2963573A CA2963573C (en) 2014-10-03 2015-10-05 Hiv vaccines comprising one or more population episensus antigens
CN201580063643.3A CN108064181A (zh) 2014-10-03 2015-10-05 包含一种或多种群体表位基共序列抗原的hiv疫苗
US15/516,491 US10894078B2 (en) 2014-10-03 2015-10-05 HIV vaccines comprising one or more population episensus antigens
UAA201704021A UA126890C2 (uk) 2014-10-03 2015-10-05 Вакцина проти вірусу імунодефіциту людини (віл), що містить один або більше епісенсусних (episensus) для популяції антигенів
NZ731173A NZ731173B2 (en) 2015-10-05 Hiv vaccines comprising one or more population episensus antigens
AU2015327797A AU2015327797A1 (en) 2014-10-03 2015-10-05 HIV vaccines comprising one or more population episensus antigens
JP2017538177A JP2017531693A (ja) 2014-10-03 2015-10-05 1種類または複数種類の集団エピセンサス抗原を含むhivワクチン
EP15847978.2A EP3200878B1 (en) 2014-10-03 2015-10-05 Hiv vaccines comprising one or more population episensus antigens
BR112017006865-6A BR112017006865B1 (pt) 2014-10-03 2015-10-05 Vacina contra hiv-1 compreendendo um ou mais antígenos epissenso de população, uso da mesma para proteger um indivíduo de uma infecção por hiv-1 ou para tratar hiv-1 e polipeptídeo
HK18113892.2A HK1254806A1 (zh) 2014-10-03 2015-10-05 包含一种或多种群体表位基共序列抗原的hiv疫苗
IL251469A IL251469B2 (en) 2014-10-03 2015-10-05 Vaccines for the AIDS virus containing antigens of one or more of the Apisenses population
EA201790680A EA201790680A1 (ru) 2014-10-03 2015-10-05 Вакцины против вируса иммунодефицита человека (вич), содержащие один или более эписенсусных (episensus) для популяции антигенов
US17/008,335 US11554168B2 (en) 2014-10-03 2020-08-31 HIV vaccines comprising one or more population episensus antigens
US17/008,289 US11628215B2 (en) 2014-10-03 2020-08-31 HIV vaccines comprising one or more population episensus antigens
AU2021218141A AU2021218141B2 (en) 2014-10-03 2021-08-19 HIV vaccines comprising one or more population episensus antigens

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201462059497P 2014-10-03 2014-10-03
US201462059506P 2014-10-03 2014-10-03
US62/059,506 2014-10-03
US62/059,497 2014-10-03

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US15/516,491 A-371-Of-International US10894078B2 (en) 2014-10-03 2015-10-05 HIV vaccines comprising one or more population episensus antigens
US17/008,289 Division US11628215B2 (en) 2014-10-03 2020-08-31 HIV vaccines comprising one or more population episensus antigens
US17/008,335 Division US11554168B2 (en) 2014-10-03 2020-08-31 HIV vaccines comprising one or more population episensus antigens

Publications (1)

Publication Number Publication Date
WO2016054654A1 true WO2016054654A1 (en) 2016-04-07

Family

ID=55631703

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/054067 Ceased WO2016054654A1 (en) 2014-10-03 2015-10-05 Hiv vaccines comprising one or more population episensus antigens

Country Status (16)

Country Link
US (3) US10894078B2 (https=)
EP (1) EP3200878B1 (https=)
JP (3) JP2017531693A (https=)
KR (1) KR102633096B1 (https=)
CN (1) CN108064181A (https=)
AU (2) AU2015327797A1 (https=)
CA (1) CA2963573C (https=)
EA (1) EA201790680A1 (https=)
HK (1) HK1254806A1 (https=)
IL (1) IL251469B2 (https=)
MA (1) MA40783A (https=)
MX (3) MX391149B (https=)
SG (1) SG11201702729YA (https=)
UA (1) UA126890C2 (https=)
WO (1) WO2016054654A1 (https=)
ZA (1) ZA202206809B (https=)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2019527055A (ja) * 2016-07-08 2019-09-26 アメリカン ジーン テクノロジーズ インターナショナル インコーポレイテッド Hiv予備免疫化および免疫療法
WO2020243485A1 (en) * 2019-05-29 2020-12-03 Massachusetts Institute Of Technology Hiv-1 specific immunogen compositions and methods of use
WO2021045969A1 (en) 2019-08-29 2021-03-11 Vir Biotechnology, Inc. Hepatitis b virus vaccines
WO2022155258A1 (en) * 2021-01-14 2022-07-21 Gilead Sciences, Inc. Hiv vaccines and methods of using
WO2023034801A1 (en) 2021-08-31 2023-03-09 Vir Biotechnology, Inc. Recombinant hcmv vectors and uses thereof
CN116524994A (zh) * 2023-02-20 2023-08-01 中国科学院天津工业生物技术研究所 一种基于贪婪算法的菌株构建排程设计方法
US11795210B2 (en) 2019-07-16 2023-10-24 Gilead Sciences, Inc. HIV vaccines and methods of making and using
US11980663B2 (en) 2015-07-08 2024-05-14 American Gene Technologies International Inc. HIV pre-immunization and immunotherapy
US12090200B2 (en) 2016-02-08 2024-09-17 American Gene Technologies International Inc. Methods of producing cells resistant to HIV infection

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MA40783A (fr) 2014-10-03 2017-08-08 Los Alamos Nat Security Llc Vaccins contre le vih comprenant un ou plusieurs antigènes episensus de population
TW202436326A (zh) * 2023-02-13 2024-09-16 長怡 王 包含hiv th/ctl 抗原決定位胜肽的疫苗用於預防及治療hiv感染及aids患者

Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003025003A2 (en) 2001-09-20 2003-03-27 Glaxo Group Limited Hiv-gag codon-optimised dna vaccines
WO2003035097A1 (en) 2001-10-23 2003-05-01 Epipop Pty Ltd A method for identification and development of therapeutic agents
WO2005035779A2 (en) 2003-10-10 2005-04-21 Powderject Vaccines, Inc Method
US20080199493A1 (en) 2004-05-25 2008-08-21 Picker Louis J Siv and Hiv Vaccination Using Rhcmv- and Hcmv-Based Vaccine Vectors
US20100183651A1 (en) 2007-03-30 2010-07-22 Finnefrock Adam C Broadly Representative Antigen Sequences and Method for Selection
US20110123485A1 (en) * 2007-03-27 2011-05-26 President And Fellows Of Harvard College Viral vectors for delivering vaccines for hiv and other infectious diseases
US20130142823A1 (en) 2010-03-25 2013-06-06 Oregon Health And Science University Cmv glycoproteins and recombinant vectors
US20140073525A1 (en) * 2011-05-13 2014-03-13 The Board Of Trustees Of The Leland Stanford Junior University Diagnostic, prognostic and therapeutic uses of long non-coding rnas for cancer and regenerative medicine
US20140141038A1 (en) 2011-06-10 2014-05-22 Oregon Health & Science University Cmv glycoproteins and recombinant vectors
US20140186384A1 (en) 2006-07-28 2014-07-03 The Trustees Of The University Of Pennsylvania Vaccines and methods for using the same
WO2014107744A1 (en) 2013-01-07 2014-07-10 Beth Israel Deaconess Medical Center, Inc. Stabilized human immunodeficiency virus (hiv) envelope (env) trimer vaccines and methods of using the same
WO2014138209A1 (en) 2013-03-05 2014-09-12 Oregon Health & Science University Cytomegalovirus vectors enabling control of t cell targeting

Family Cites Families (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FI116851B (fi) * 2001-05-03 2006-03-15 Fit Biotech Oyj Plc Ilmentämisvektori, sen käyttöjä ja menetelmä sen valmistamiseksi sekä sitä sisältäviä tuotteita
US20030190308A1 (en) * 2002-03-19 2003-10-09 Braun Ralph P. Adjuvant
GB0225788D0 (en) * 2002-11-05 2002-12-11 Glaxo Group Ltd Vaccine
US20070054262A1 (en) * 2003-03-28 2007-03-08 Baker Denise M Methods of identifying optimal variants of peptide epitopes
AU2011203095A1 (en) 2003-09-17 2011-07-21 Duke University Consensus/Ancestral Immunogens
BRPI0414443A (pt) * 2003-09-17 2006-11-21 Univ Duke imunógenos consensuais/ancestrais
CN101969996A (zh) * 2005-08-23 2011-02-09 加利福尼亚大学董事会 多价疫苗
NZ602504A (en) 2008-11-18 2014-01-31 Beth Israel Hospital Antiviral vaccines with improved cellular immunogenicity
AU2010305030A1 (en) * 2009-10-08 2012-05-10 Bavarian Nordic A/S Generation of a broad T-cell response in humans against HIV
TR201802741T4 (tr) * 2010-05-14 2018-03-21 Univ Oregon Health & Science Rekombinant hcmv ve rhcmv vektörleri ve bunların kullanımları.
EP2620446A1 (en) 2012-01-27 2013-07-31 Laboratorios Del Dr. Esteve, S.A. Immunogens for HIV vaccination
EP2820035B1 (en) 2012-03-02 2019-01-09 The Government of the United States of America as represented by The Secretary of the Department of Health and Human Services Method of altering the immundominance hierarchy of hiv gag by dna vaccine expressing conserved regions
CA2941116A1 (en) 2014-02-28 2015-09-03 Janssen Vaccines & Prevention B.V. Replicating recombinant adenovirus vectors, compositions, and methods of use thereof
CN113528466B (zh) 2014-07-16 2024-12-24 俄勒冈健康与科学大学 包含外源抗原的人巨细胞病毒
CN106999571B (zh) 2014-09-26 2020-10-02 贝斯以色列护理医疗中心有限公司 诱导针对人免疫缺陷病毒感染的保护性免疫性的方法和组合物
MA40783A (fr) 2014-10-03 2017-08-08 Los Alamos Nat Security Llc Vaccins contre le vih comprenant un ou plusieurs antigènes episensus de population
DK3584252T3 (da) 2015-12-15 2021-11-15 Janssen Vaccines & Prevention Bv Human immundefektvirus-antigener, -vektorer, -sammensætninger og fremgangsmåder til anvendelse deraf

Patent Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003025003A2 (en) 2001-09-20 2003-03-27 Glaxo Group Limited Hiv-gag codon-optimised dna vaccines
WO2003035097A1 (en) 2001-10-23 2003-05-01 Epipop Pty Ltd A method for identification and development of therapeutic agents
WO2005035779A2 (en) 2003-10-10 2005-04-21 Powderject Vaccines, Inc Method
US20080199493A1 (en) 2004-05-25 2008-08-21 Picker Louis J Siv and Hiv Vaccination Using Rhcmv- and Hcmv-Based Vaccine Vectors
US20140186384A1 (en) 2006-07-28 2014-07-03 The Trustees Of The University Of Pennsylvania Vaccines and methods for using the same
US20110123485A1 (en) * 2007-03-27 2011-05-26 President And Fellows Of Harvard College Viral vectors for delivering vaccines for hiv and other infectious diseases
US20100183651A1 (en) 2007-03-30 2010-07-22 Finnefrock Adam C Broadly Representative Antigen Sequences and Method for Selection
US20130142823A1 (en) 2010-03-25 2013-06-06 Oregon Health And Science University Cmv glycoproteins and recombinant vectors
US20140073525A1 (en) * 2011-05-13 2014-03-13 The Board Of Trustees Of The Leland Stanford Junior University Diagnostic, prognostic and therapeutic uses of long non-coding rnas for cancer and regenerative medicine
US20140141038A1 (en) 2011-06-10 2014-05-22 Oregon Health & Science University Cmv glycoproteins and recombinant vectors
WO2014107744A1 (en) 2013-01-07 2014-07-10 Beth Israel Deaconess Medical Center, Inc. Stabilized human immunodeficiency virus (hiv) envelope (env) trimer vaccines and methods of using the same
WO2014138209A1 (en) 2013-03-05 2014-09-12 Oregon Health & Science University Cytomegalovirus vectors enabling control of t cell targeting

Non-Patent Citations (15)

* Cited by examiner, † Cited by third party
Title
BAR, K. J., PLOS PATHOG, vol. 8, 2012, pages e1002721
BAROUCH ET AL., NAT. MED., vol. 16, no. 3, 2010, pages 319 - 23
BOCK ET AL., GENOME BIOL, vol. 10, no. 2, 2009, pages R14
BORST ET AL., J VIROL., vol. 73, no. 10, October 1999 (1999-10-01), pages 8320 - 9
ERIKSSON, S, PLOS PATHOG, vol. 9, 2013, pages e1003174
FISCHER, W, PLOS ONE, vol. 5, 2010, pages e12303
FISHER, NAT MED, vol. 13, no. 1, January 2007 (2007-01-01), pages 100 - 6
HANSEN, S. G., SCIENCE, vol. 340, 2013, pages 1237874
KIROVSKI, D ET AL.: "Combinatorics of The Vaccine Design Problem: Definition and An Algorithm", MICROSOFT RESEARCH, November 2007 (2007-11-01), XP055426515, Retrieved from the Internet <URL:http://research.microsoft.com/pubs/70508/tr-2007-148.pdf> [retrieved on 20151209] *
KORBER, B ET AL.: "LANL/New Mexico Consortium HIV Vaccine Design and Analysis. Los Alamos National Laboratory.", PRESENTATION, 7 July 2014 (2014-07-07), XP055426513, Retrieved from the Internet <URL:http://permalink.lanl.gov/object/tr?what=info:lanl-repo/lareport/LA-UR-14-25023> [retrieved on 20160225] *
KULKARNI ET AL., VACCINE, 2011
LIU, M. K., J. CLIN. INVEST., vol. 123, 2013, pages 380 - 93
MESSERLE ET AL., PROC NATL ACAD SCI USA., vol. 94, no. 26, 23 December 1997 (1997-12-23), pages 14759 - 63
SANTRA ET AL., VIROLOGY, vol. 428, no. 2, May 2012 (2012-05-01), pages 121 - 7
See also references of EP3200878A4

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11980663B2 (en) 2015-07-08 2024-05-14 American Gene Technologies International Inc. HIV pre-immunization and immunotherapy
US12090200B2 (en) 2016-02-08 2024-09-17 American Gene Technologies International Inc. Methods of producing cells resistant to HIV infection
US11911458B2 (en) 2016-07-08 2024-02-27 American Gene Technologies International Inc. HIV pre-immunization and immunotherapy
US12370253B2 (en) 2016-07-08 2025-07-29 American Gene Technologies International Inc. Pre-immunization and immunotherapy
JP2019527055A (ja) * 2016-07-08 2019-09-26 アメリカン ジーン テクノロジーズ インターナショナル インコーポレイテッド Hiv予備免疫化および免疫療法
US20210317192A9 (en) * 2019-05-29 2021-10-14 Massachusetts Institute Of Technology Hiv-1 specific immunogen compositions and methods of use
WO2020243485A1 (en) * 2019-05-29 2020-12-03 Massachusetts Institute Of Technology Hiv-1 specific immunogen compositions and methods of use
US11795210B2 (en) 2019-07-16 2023-10-24 Gilead Sciences, Inc. HIV vaccines and methods of making and using
WO2021045969A1 (en) 2019-08-29 2021-03-11 Vir Biotechnology, Inc. Hepatitis b virus vaccines
US12485168B2 (en) 2019-08-29 2025-12-02 Vir Biotechnlogy, Inc. Hepatitis B virus vaccines
WO2022155258A1 (en) * 2021-01-14 2022-07-21 Gilead Sciences, Inc. Hiv vaccines and methods of using
US12053517B2 (en) 2021-01-14 2024-08-06 Gilead Sciences, Inc. HIV vaccines and methods of using
WO2023034801A1 (en) 2021-08-31 2023-03-09 Vir Biotechnology, Inc. Recombinant hcmv vectors and uses thereof
CN116524994A (zh) * 2023-02-20 2023-08-01 中国科学院天津工业生物技术研究所 一种基于贪婪算法的菌株构建排程设计方法
CN116524994B (zh) * 2023-02-20 2026-01-30 中国科学院天津工业生物技术研究所 一种基于贪婪算法的菌株构建排程设计方法

Also Published As

Publication number Publication date
AU2021218141B2 (en) 2024-06-06
CA2963573A1 (en) 2016-04-07
KR102633096B1 (ko) 2024-02-02
ZA202206809B (en) 2023-11-29
JP2021035946A (ja) 2021-03-04
UA126890C2 (uk) 2023-02-22
IL251469B2 (en) 2023-05-01
CN108064181A (zh) 2018-05-22
NZ731173A (en) 2024-04-26
IL251469A0 (en) 2017-05-29
EP3200878A4 (en) 2018-05-30
US20170319679A1 (en) 2017-11-09
EA201790680A1 (ru) 2017-11-30
EP3200878A1 (en) 2017-08-09
JP7441340B2 (ja) 2024-03-06
CA2963573C (en) 2024-02-06
US20210046174A1 (en) 2021-02-18
US11554168B2 (en) 2023-01-17
JP2023059272A (ja) 2023-04-26
SG11201702729YA (en) 2017-04-27
MX391149B (es) 2025-03-21
US10894078B2 (en) 2021-01-19
AU2021218141A1 (en) 2021-09-09
IL251469B1 (en) 2023-01-01
MX2022003663A (es) 2022-04-25
EP3200878B1 (en) 2025-06-04
MX2017004275A (es) 2018-01-17
MX2022003664A (es) 2022-04-25
US11628215B2 (en) 2023-04-18
HK1254806A1 (zh) 2019-07-26
AU2015327797A1 (en) 2017-05-11
MA40783A (fr) 2017-08-08
KR20170122711A (ko) 2017-11-06
JP7212020B2 (ja) 2023-01-24
JP2017531693A (ja) 2017-10-26
BR112017006865A2 (pt) 2017-12-12
US20210046175A1 (en) 2021-02-18

Similar Documents

Publication Publication Date Title
US11554168B2 (en) HIV vaccines comprising one or more population episensus antigens
Doria-Rose et al. Human immunodeficiency virus type 1 subtype B ancestral envelope protein is functional and elicits neutralizing antibodies in rabbits similar to those elicited by a circulating subtype B envelope
Kulkarni et al. HIV-1 p24gag derived conserved element DNA vaccine increases the breadth of immune response in mice
Rolland et al. Reconstruction and function of ancestral center-of-tree human immunodeficiency virus type 1 proteins
Maman et al. Immune-induced evolutionary selection focused on a single reading frame in overlapping hepatitis B virus proteins
Lu et al. Humoral and cellular immune responses induced by 3a DNA vaccines against severe acute respiratory syndrome (SARS) or SARS-like coronavirus in mice
JP7635208B2 (ja) B型肝炎ウイルスワクチン
HK1241309A1 (en) Hiv vaccines comprising one or more population episensus antigens
HK1241309B (en) Hiv vaccines comprising one or more population episensus antigens
Li et al. Comparative immunogenicity of monovalent and bivalent adenovirus vaccines carrying spikes of early and late SARS-CoV-2 variants
EA040402B1 (ru) Вакцины против вируса иммунодефицита человека (вич), содержащие один или более эписенсусных (episensus) антигенов для популяции
BR122021016789B1 (pt) Vacinas contra hiv-1 compreendendo um ou mais antígenos epissenso de população, usos das mesmas para proteger um indivíduo de uma infecção por hiv-1, tratar hiv-1 e induzir uma resposta de células t de memória efetoras, bem como polipeptídeo e método para projetar e produzir as ditas vacinas
Kadam et al. Molecular and structural insights into COVID-19 pandemic
BR112017006865B1 (pt) Vacina contra hiv-1 compreendendo um ou mais antígenos epissenso de população, uso da mesma para proteger um indivíduo de uma infecção por hiv-1 ou para tratar hiv-1 e polipeptídeo
HK40074198A (en) Hepatitis b virus vaccines
Darton et al. Efficacy of ChAdOx1 nCoV-19 (AZD1222) vaccine against SARS-CoV-2 VOC 202012/01 (B. 1.1. 7)
CN102321653A (zh) 人鼠嵌合型cd4质粒及其多抗在抑制hiv感染中的应用

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15847978

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 251469

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2017538177

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2017/004275

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2963573

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 122021016789

Country of ref document: BR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112017006865

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 201790680

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: A201704021

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 20177012171

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015847978

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2015327797

Country of ref document: AU

Date of ref document: 20151005

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112017006865

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20170403

WWG Wipo information: grant in national office

Ref document number: 2015847978

Country of ref document: EP