WO2016018920A1 - Il-15 and il-15ralpha heterodimer dose escalation regimens for treating conditions - Google Patents

Il-15 and il-15ralpha heterodimer dose escalation regimens for treating conditions Download PDF

Info

Publication number
WO2016018920A1
WO2016018920A1 PCT/US2015/042489 US2015042489W WO2016018920A1 WO 2016018920 A1 WO2016018920 A1 WO 2016018920A1 US 2015042489 W US2015042489 W US 2015042489W WO 2016018920 A1 WO2016018920 A1 WO 2016018920A1
Authority
WO
WIPO (PCT)
Prior art keywords
dose
complex
subject
human
approximately
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/042489
Other languages
English (en)
French (fr)
Other versions
WO2016018920A8 (en
Inventor
Barbara K. Felber
Sergio Finkielsztein
George N. Pavlakis
John N. Vournakis
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis Institutes for Biomedical Research Inc
US Department of Health and Human Services
Original Assignee
Admune Therapeutics LLC
US Department of Health and Human Services
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Admune Therapeutics LLC, US Department of Health and Human Services filed Critical Admune Therapeutics LLC
Priority to JP2017504713A priority Critical patent/JP6655061B2/ja
Priority to US15/328,882 priority patent/US10335460B2/en
Priority to EP15828027.1A priority patent/EP3174974B1/en
Priority to ES15828027T priority patent/ES2811974T3/es
Publication of WO2016018920A1 publication Critical patent/WO2016018920A1/en
Publication of WO2016018920A8 publication Critical patent/WO2016018920A8/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19—Cytokines; Lymphokines; Interferons
    • A61K38/20—Interleukins [IL]
    • A61K38/2086—IL-13 to IL-16
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1793—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19—Cytokines; Lymphokines; Interferons
    • A61K38/20—Interleukins [IL]
    • A61K38/2046—IL-7
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A61P31/06—Antibacterial agents for tuberculosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/18—Antivirals for RNA viruses for HIV
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/04—Antineoplastic agents specific for metastasis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/04—Immunostimulants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/16011—Human Immunodeficiency Virus, HIV

Definitions

  • IL-15 interleukin-15
  • IL-15Ra IL-15 receptor alpha
  • IL-15Ra IL-15 receptor alpha
  • the dose escalation regimens are useful in the prevention, treatment, and/or management of disorders in which enhancing IL-15 -mediated function is beneficial, such as cancer, infectious diseases, immunodeficiencies and lymphopenia.
  • the dose escalation regimens are useful for eradicating or reducing HIV in HIV-infected patients.
  • the IL-15 receptor consists of two polypeptides, the IL-2/IL-15 receptor beta (" ⁇ ") (or CD 122), and the gamma chain (“ ⁇ ”) (or CD 132) that is shared by multiple cytokine receptors.
  • IL-15 signaling has been shown to occur through the heterodimeric complex of IL- 15RP and IL-15R ⁇ .
  • IL-15Ra is a receptor for IL- 15
  • an alternative interpretation of the existing data is that IL-15Ra is not a receptor for the IL-15 polypeptide chain.
  • IL-15Ra has evolved very high affinity for IL-15 and is always co- expressed with IL-15 in the same cell. The two molecules form heterodimeric complexes in the Endoplasmic Reticulum and are transported to the plasma membrane. See, e.g.,
  • IL-15 specifically binds to the IL-15Ra with high affinity via the "sushi domain" in exon 2 of the extracellular domain of the receptor.
  • Endogenous heterodimeric IL-15 is found in two forms, as a membrane -bound form that is expressed by antigen presenting and stroma cells in various tissues; and as a soluble extracellular complex of IL-15 to the soluble IL-15Ra, which is produced by cleavage of the membrane-anchored IL-15Ra by cellular proteases.
  • IL-15 mRNA has been reported in cells of both hematopoietic and non- hematopoietic lineage, T cells do not produce IL-15. Instead, IL-15 heterodimers released from the cell surface after cleavage of the membrane bound heterodimers binds to the IL-15 ⁇ Receptor on lymphocytes.
  • IL-15 can enhance the immune function of patients infected with human immunodeficiency virus (HIV).
  • HIV human immunodeficiency virus
  • IL-15Ra soluble form of the IL-15Ra
  • sIL-15Ra soluble form of the IL-15Ra
  • the sIL-15Ra has been explored for treating autoimmune inflammatory diseases. Nevertheless, recent reports suggest that IL-15, when complexed with the sIL- 15Ra, or the sushi domain, maintains its immune enhancing function.
  • provided herein are methods for enhancing IL- 15 -mediated immune function, comprising administering to subjects agents that induce IL-15 signal transduction and enhance IL-15 -mediated immune function in a dose escalation regimen. More specifically, provided herein are methods for enhancing IL-15 -mediated immune function, comprising administering to subjects in a dose escalation regimen complexes that bind to the ⁇ subunits of the IL-15 receptor, induce IL-15 signal transduction and enhance IL-15- mediated immune function, wherein the complexes comprise IL-15 covalently or
  • IL-15Ra Interleukin-15 receptor alpha
  • IL- 15/IL-15Ra complexes Interleukin-15 receptor alpha
  • Therapeutic Agents Since enhancing IL-15 -mediated immune function is beneficial for the prevention, treatment and/or management of certain disorders, such as lymphopenia, cancer, and infectious diseases, provided herein are methods for the prevention, treatment and/or management of such disorders comprising administering to a subject in need thereof IL-15/IL-15Ra complexes in a dose escalation regimen. Further, provided herein are methods for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering to a subject in need thereof IL-15/IL-15Ra complexes in a dose escalation regimen.
  • the methods described herein are based, in part, on the discovery that the amount of IL-15/IL-15Ra complex administered to a subject needs to be escalated over time in order to achieve an effective ratio of IL-15 to lymphocyte cell number so that lymphocytes remain activated or do not undergo cell death.
  • the administration of IL-15/IL-15Ra complex to a subject causes lymphocytes to increase and in order for further proliferation and survival of lymphocytes, the amount of IL-15/IL-15Ra complex administered to the subject needs to be increased.
  • the methods provided herein achieve an effective ratio of IL-15 to lymphocyte cell number while avoiding the toxicity associated with the administration of the high doses of IL-15.
  • the methods provided herein involve a dose escalation regimen that achieves a systemic effect (not just a local effect) with minimal side effects.
  • the dose escalation regimens decrease the side effects associated with the administration of a high dose of an IL-15/IL-15Ra complex to a subject, such as a decrease in blood pressure or an increase in body temperature.
  • the dose escalation regimens do not alter blood pressure or body temperature.
  • the methods described herein are also based, in part, on the discovery that a high dose of an IL-15/IL-15Ra complex activates lymphocytes including lymphocytes infected with HIV or the simian counterpart, Simian Immunodeficiency Virus (SIV), and such lymphocytes can become targets for elimination if they are activated, without a systemic increase in viral load.
  • SIV Simian Immunodeficiency Virus
  • the administration of an IL- 15/IL-15Ra complex did not lead to a systemic increase in the virus. See, e.g., Example 3, infra.
  • a method for preventing, treating and/or managing disorders in a subject wherein enhancement of IL- 15 -mediated immune function is beneficial for the prevention, treatment and/or management of such disorders, the method comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to a subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject to achieve an effective ratio of IL-15 to lymphocyte cell number.
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject to achieve an effective ratio of IL-15 to lymphocyte cell number.
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject to achieve an effective ratio of IL-15 to lymphocyte cell number.
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject achieve an effective ratio of IL-15 to lymphocyte cell number.
  • the subject is a human subject.
  • the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is between 0.1 ⁇ g/kg and 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15. In certain embodiments, the initial low dose is administered 1, 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times. In some embodiment,
  • the initial low dose is administered 1, 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each successively higher dose is 1.2, 1.25, 1.3, 1.35, 1.4, 1.45, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, or 6 times higher than the previous dose, or 1.2 to 2, 2 to 3, 2 to 4, 2 to 6, 3 to 4, 3 to 6, or 4 to 6 times higher than the previous dose.
  • each successively higher dose is 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 105%, 1 10%, 1 15%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195%, or 200% higher than the previous dose.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • the subject is monitored for signs of an enlarged lymph node(s) and/or an enlarged spleen.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises (c) administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 of approximately 1 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing disorders in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL- 15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL- 15/IL-15Ra complex) is within normal levels or less than normal levels.
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex) is within normal levels or less than normal levels.
  • a sample e.g., a plasma sample
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex) is within normal levels or less than normal levels.
  • a sample e.g., a plasma sample
  • the subject is a human subject.
  • the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is between 0.1 ⁇ g/kg and 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15. In certain embodiments, the initial low dose is administered 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each successively higher dose is 1.2, 1.25, 1.3, 1.35, 1.4, 1.45, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, or 6 times higher than the previous dose, or 1.2 to 2, 2 to 3, 2 to 4, 2 to 6, 3 to 4, 3 to 6, or 4 to 6 times higher than the previous dose.
  • each successively higher dose is 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 105%, 1 10%, 1 15%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195%, or 200% higher than the previous dose.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • the subject is monitored for signs of an enlarged lymph node(s) and/or an enlarged spleen.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises (c) administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 of approximately 1 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing disorders in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL- 15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL- 15/IL-15Ra complex) is approximately 1 pg/ml to 50 pg/ml.
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before
  • administration of another dose of the IL-15/IL-15Ra complex e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex.
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b)
  • the concentration of free IL-15 in a sample e.g., a plasma sample
  • a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex
  • the subject is a human subject.
  • the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is between 0.1 ⁇ g/kg and 0.5 ⁇ g/kg as determined based on the mass of single chain IL- 15. In another embodiment, the initial low dose is 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15. In certain embodiments, the initial low dose is administered 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each successively higher dose is 1.2, 1.25, 1.3, 1.35, 1.4, 1.45, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, or 6 times higher than the previous dose, or 1.2 to 2, 2 to 3, 2 to 4, 2 to 6, 3 to 4, 3 to 6, or 4 to 6 times higher than the previous dose.
  • each successively higher dose is 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 105%, 1 10%, 1 15%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195%, or 200% higher than the previous dose.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • the subject is monitored for signs of an enlarged lymph node(s) and/or an enlarged spleen.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises (c) administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 of approximately 1 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing disorders in a subject comprising (a) administering at least one initial low dose of IL-15/IL-15Ra complex to the subject, wherein the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL- 15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising (a) administering at least one initial low dose of IL-15/IL-15Ra complex to the subject, wherein the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex) is within normal levels or less than normal levels as
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising (a) administering at least one initial low dose of IL-15/IL-15Ra complex to the subject, wherein the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex) is within normal levels or less than normal levels as determined based on the
  • the subject is a human.
  • the initial low dose is 0.5 ⁇ /13 ⁇ 4 as determined based on the mass of single chain IL-15.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • the subject is monitored for signs of an enlarged lymph node(s) and/or an enlarged spleen.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises (c) administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 of approximately 1 pg/ml to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing disorders in a subject comprising (a) administering at least one initial low dose of IL-15/IL-15Ra complex to the human subject, wherein the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the human subject, if the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL- 15/IL-15Ra complex is approximately 1 pg/ml to 50 pg/ml, wherein each successively higher dose is from two to three times higher than the previous dose.
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising (a) administering at least one initial low dose of IL-15/IL-15Ra complex to the human subject, wherein the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the human subject, if the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex is approximately 1 pg/ml to 50 pg/ml, wherein each successively higher dose is from two to three times higher than the previous dose.
  • a method for treating comprising (a) administering at least one initial low dose of IL-15/IL-15Ra complex to the human subject, wherein the initial low dose
  • lymphocytopenia, cancer or an infectious disease in a human subject or a method for eradicating or reducing HIV in HIV-infected cells in a human subject, comprising: (a) administering at least one initial low dose of IL-15/IL-15Ra complex to the human subject, wherein the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15; and (b) administering successively higher doses of the IL-15/IL- 15Ra complex to the human subject, if the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL- 15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex is approximately 1 pg/ml to 50 pg/ml, wherein each successively higher dose is from two to three times higher than the previous dose.
  • the subject is a human.
  • the initial low dose is 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • the initial low dose is administered 1, 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times.
  • the initial low dose is administered 1, 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least 1, 2, 3, 4, 5, 6 or more times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • the subject is monitored for signs of an enlarged lymph node(s) and/or an enlarged spleen.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises (c) administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 of approximately 1 pg/ml to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing disorders in a subject comprising administering an IL-15/IL-15Ra complex to the human subject in an escalating dose regimen beginning with an initial low dose of between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose two to three times over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising administering an IL-15/IL-15Ra complex to the human subject in an escalating dose regimen beginning with an initial low dose of between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose two to three times over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL- 15/IL-15Ra complex) is monitored before elevating the dose to
  • a sample e.g
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen beginning with an initial low dose of between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose two to three times over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL- 15/IL-15Ra complex) is monitored before elevating the dose to the next level.
  • a sample e.g.
  • the subject is a human subject.
  • the initial low dose is 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • the initial low dose is administered 1 , 2, 3, 4, 5, or 6 times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, or 4 to 6 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least 1 , 2, 3, 4, 5, or 6 or more times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • the subject is monitored for signs of an enlarged lymph node(s) and/or an enlarged spleen.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 5 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • the method further comprises administering a maintenance dose of the IL- 15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 of approximately 1 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • a method for preventing, treating and/or managing disorders in a subject wherein enhancement of IL-15 -mediated immune function is beneficial for the prevention, treatment and/or management of such disorders, the method comprising administering an IL-15/IL-15Ra complex to the human subject in an escalating dose regimen beginning with an initial low dose of between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, or 1.9 fold over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of
  • a sample e.g.,
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen beginning with an initial low dose of between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, or 1.9 fold over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL- 15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex) is monitored before elevating the dose to the next level.
  • a sample e.g., a plasma sample
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen beginning with an initial low dose of between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, or 1.9 fold over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL- 15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL
  • a sample e.g.
  • the subject is a human subject.
  • the initial low dose is 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • the initial low dose is administered 1 , 2, 3, 4, 5, or 6 times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, or 4 to 6 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least 1 , 2, 3, 4, 5, or 6 or more times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • the subject is monitored for signs of an enlarged lymph node(s) and/or an enlarged spleen.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 5 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 of approximately 1 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • a method for preventing, treating and/or managing disorders in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.5 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; (v) 8 ⁇ g /kg; and (vi) 16 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.5 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; (v) 8 ⁇ g /kg; and (vi) 16 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a
  • a sample e.g
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.5 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; (v) 8 ⁇ g /kg; and (vi) 16 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a sample sample) obtained from the subject a certain period of time after the administration of a dose of the IL- 15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours after the administration of a dose of the
  • the initial low dose is administered 1 , 2, 3, 4, 5, or 6 times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, or 4 to 6 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least 1 , 2, 3, 4, 5, or 6 or more times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • the subject is monitored for signs of an enlarged lymph node(s) and/or an enlarged spleen.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 1 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject.
  • the method further comprises further comprising administering a maintenance dose of 0.1 ⁇ g/kg to 10 ⁇ g/kg, 0.1 ⁇ g/kg to 20 ⁇ g/kg, 0.1 to 25 ⁇ g/kg, or 0.1 ⁇ g/kg to 30 ⁇ g/kg of IL-15/IL-15Ra complex to the subject, wherein the dose is determined based on the mass of single chain IL-15.
  • the methods described herein are not cylical in nature.
  • the methods described herein do not include a cyclical administration regimen, wherein the cycle comprises administering a dose of the IL- 15/IL-15Ra complex for a certain period of time (e.g., 1 to 4 weeks) followed by another period of time when the subject is not administered a dose of the IL-15/IL-15Ra complex (e.g., 1 week to 2 months) and this cycle is repeated any number of times (e.g, the cycle is repeated 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times).
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen beginning with an initial low dose of an IL-15/IL-15Ra complex to the human subject one to five times, and sequentially escalating the dose by at least 25%, 50%>, 75%, 100%, 150%, or 200%) over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex is monitored before elevating the dose to the next level.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen beginning with an initial low dose in the range of 0.1 ⁇ g/kg and 10 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose by at least 25%, 50%>, 75%), 100%), 150%), or 200%) over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex is monitored before elevating the dose to the next level.
  • an initial low dose is in the range of 0.5 ⁇ g/kg and 10 ⁇ g/kg as determined based on the mass of single chain IL-15. In specific embodiments of the methods provided herein, an initial low dose is in the range of 0.2 ⁇ g/kg and 10 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen at the following sequential doses: (i) 2 ⁇ g /kg; (ii) 4 ⁇ g /kg; (iv) 8 ⁇ g /kg; (v) 16 ⁇ g /kg; (v) 32 ⁇ g /kg; and (vi) 64 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL- 15Ra complex is monitored before elevating the dose to the next level.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen at the following sequential doses: (i) 5 ⁇ g /kg; (ii) 10 ⁇ g /kg; (iv) 20 ⁇ g /kg; (v) 40 ⁇ g /kg; (v) 80 ⁇ g /kg; and (vi) 120 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL- 15Ra complex is monitored before elevating the dose to the next level.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen at the following sequential doses: (i) 0.5 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; (v) 8 ⁇ g /kg; and (vi) 16 ⁇ g/kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level.
  • the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL- 15/IL-15Ra complex is monitored before elevating the dose to the next level.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen beginning with an initial low dose (in, e.g., the range of 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15), and sequentially escalating ⁇ e.g., by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 225%, 250%), 275%) or 300%>) the dose over the previous dose every two days initially for a period of time (e.g., 1 , 2, 3 or 4 weeks) and then escalating the dose gradually everyday over the previous dose for a period of time (e.g., 1 , 2, 3 or 4 weeks).
  • an initial low dose in, e.g., the range of 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15
  • sequentially escalating ⁇ e.
  • the initial low dose is 0.1 ⁇ g/kg, 0.2 ⁇ g/kg , 0.3 ⁇ g/kg , 0.4 ⁇ g/kg , 0.5 ⁇ g/kg , 0.6 ⁇ g/kg , 0.7 ⁇ g/kg , 0.8 ⁇ g/kg, 0.9 ⁇ g/kg , or 1 ⁇ g/kg as determined based on the mass of single chain IL- 15.
  • each dose is administered at least once, twice or thrice before the dose is escalated.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen beginning with an initial low dose as determined based on the mass of single chain IL-15, and sequentially escalating (e.g., by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, or 300%) the dose over the previous dose for a period of time (e.g., 1 , 2, 3, 4, 5, 6 or more weeks) and then administering an IL-15/IL-15Ra complex to the human subject in a maintenance dose for a period of time.
  • a period of time e.g., 1 , 2, 3, 4, 5, 6 or more weeks
  • the initial low dose is 0.1 ⁇ g/kg, 0.2 ⁇ g/kg , 0.3 ⁇ g/kg , 0.4 ⁇ g/kg , 0.5 ⁇ g/kg , 0.6 ⁇ g/kg , 0.7 ⁇ g/kg , 0.8 ⁇ g/kg, 0.9 ⁇ g/kg , or 1 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • each dose is administered at least once, twice or thrice before the dose is escalated. In certain embodiments, the dose is escalated every day, every 2 days, or every 3 days.
  • the maintenance dose is at least 1 ⁇ 2 or 1 ⁇ 4 lower than the highest escalating dose administered. In specific embodiments, in accordance with the methods described herein, the maintenance dose is at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% lower than the highest escalating dose
  • each dose is administered once, three times a week for two weeks. In specific embodiments, in accordance with the methods described herein, each dose is administered once, three times a week for two, three, or four weeks, or more than once, six times per week for two, three, or four weeks. In specific embodiments, in accordance with the methods described herein, each dose is administered once, every other day, for two, three, or four weeks. In specific embodiments, in accordance with the methods described herein, each dose is administered once a day for one, two, three, or four weeks. [0030] In specific embodiments, the methods described herein further comprise administering to the human subject one or more other therapies. In particular embodiments, the one or more other therapies is an antibody (e.g., monoclonal antibody) that
  • the one or more other therapies is an histone deacetylase (HDAC) inhibitor (e.g., panobinstat or vorinostat), TLR7 agonist, an antibody (e.g., monoclonal antibody), or a cytokine (e.g., IL-7).
  • HDAC histone deacetylase
  • TLR7 agonist e.g., panobinstat or vorinostat
  • an antibody e.g., monoclonal antibody
  • a cytokine e.g., IL-7
  • the IL-15/IL-15Ra complex administered to a subject in accordance with the methods described herein may comprise native IL-15 or an IL-15 derivative covalently or noncovalently bound to native IL-15Ra or an IL-15Ra derivative.
  • the IL-15/IL-15Ra complex comprises native IL-15 and native IL-15Ra.
  • the IL-15/IL-15Ra complex comprises an IL-15 derivative and native IL-15Ra. In another embodiment, the IL-15/IL-15Ra complex is in the native heterodimeric form. In another embodiment, the IL-15 is human IL-15 and IL-15Ra is human IL-15Ra. In a specific embodiment, the human IL-15 comprises the amino acid sequence of SEQ ID NO: 1 or amino acid residues 49 to 162 of SEQ ID NO: 1 and the human IL-15Ra comprises the amino acid sequence of SEQ ID NO: 3 or a fragment thereof.
  • the IL-15 comprises the amino acid sequence of SEQ ID NO: l or amino acid residues 49 to 162 of SEQ ID NO: 1 and the IL-15Ra comprises the amino acid sequence of SEQ ID NO:4, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 or 45.
  • the human IL-15 comprises amino acid residues 49 to 162 of the amino acid sequence of SEQ ID NO: 1 and human IL- 15Ra comprises the amino acid sequence of SEQ ID NO: 33.
  • the IL-15Ra is glycosylated such that glycosylation accounts for at least or more than 20%, 30%, 40% or 50% of the mass of the IL-15Ra.
  • the IL-15/IL-15Ra complex comprises native IL-15 and an IL-15Ra derivative.
  • the IL- 15/IL-15Ra complex comprises an IL-15 derivative and an IL-15Ra derivative.
  • the IL-15Ra derivative is a soluble form of the native IL-15Ra.
  • the IL-15Ra derivative comprises mutation that inhibits cleavage by an endogenous protease.
  • the extracellular domain cleavage site of IL- 15Ra is replaced with a cleavage site that is specifically recognized by a heterologous protease.
  • the extracellular domain cleavage site of IL-15Ra is replaced with a heterologous extracellular domain cleavage site (e.g. , heterologous transmembrane domain that is recognized and cleaved by another enzyme unrelated to the endogenous processing enzyme that cleaves the IL-15Ra).
  • a heterologous extracellular domain cleavage site e.g. , heterologous transmembrane domain that is recognized and cleaved by another enzyme unrelated to the endogenous processing enzyme that cleaves the IL-15Ra.
  • the human IL-15Ra is modified either simultaneously or alternatively as follows: O-glycosylated on Thr5 of amino acid sequence
  • NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; O-glycosylated on Ser7 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; N- glycosylated on Ser 8 of amino acid sequence ITCPPPMSVEHADIWVK (SEQ ID NO: 43) in the IL-15Ra; N-glycosylated on Ser 8 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; N- glycosylated on Ser 18 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; N- glycosylated on Ser 20 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; N- glycosylated on Ser 23 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; and/or N- glycosylated on Ser 31 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra.
  • the IL-15Ra is a soluble form of IL-15Ra.
  • the soluble form of IL-15Ra is a soluble form of human IL-15Ra.
  • the human IL-15Ra comprises SEQ ID NO: 3.
  • the last amino acids at the C-terminal end of the soluble form of human IL-15Ra consist of amino acid residues PQGHSDTT (SEQ ID NO: 26), wherein T is at the C-terminal end of the amino acid sequence.
  • the last amino acids at the C-terminal end of the soluble form of human IL-15Ra consist of amino acid residues PQGHSDT (SEQ ID NO: 27), wherein T is at the C-terminal end of the amino acid sequence.
  • the last amino acids at the C-terminal end of the soluble form of human IL-15Ra consist of amino acid residues PQGHSD (SEQ ID NO: 28), wherein D is at the C-terminal end of the amino acid sequence.
  • the last amino acids at the C-terminal end of the soluble form of IL-15Ra consist of amino acid residues PQGHS (SEQ ID NO: 29), wherein S is at the C-terminal end of the amino acid sequence.
  • the last amino acids at the C-terminal end of the soluble form of human IL-15Ra consist of amino acid residues PQGH (SEQ ID NO: 30), wherein H is at the C-terminal end of the amino acid sequence.
  • the last amino acids at the C-terminal end of the soluble form of human IL- 15Ra consist of amino acid residues PQG (SEQ ID NO: 31), wherein G is at the C-terminal end of the amino acid sequence.
  • the IL-15 is human IL-15.
  • the human IL-15 comprises SEQ ID NO: l or amino acid residues 49 to 162 of SEQ ID NO: l .
  • an IL-15/IL-15Ra complex is associated with a cell.
  • the extracellular domain cleavage site of IL-15Ra that is cleaved by an endogenous processing enzyme is replaced with a heterologous domain (e.g., heterologous transmembrane domain) or a synthetic amino acid sequence that does not allow cleavage and generation of soluble IL-15Ra.
  • the extracellular domain cleavage site of IL-15Ra that is cleaved by an endogenous processing enzyme is mutated to inhibit cleavage and generation of soluble IL-15Ra.
  • the IL-15/IL-15Ra complexes may comprise a heterologous molecule.
  • the heterologous molecule may be conjugated to IL-15 and/or IL- 15Ra.
  • the heterologous molecule is conjugated to IL-15 or IL-15Ra in a manner that does not interfere or prevent IL-15 and IL-15Ra from binding to one another and does not interfere or prevent the interaction between the IL-15/IL-15Ra complex and the ⁇ subunits of the IL- 15 receptor.
  • the heterologous molecule is an antigen associated with a disease that one intends to prevent, treat and/or manage.
  • the heterologous molecule is an antibody that specifically binds to an antigen associated with a disease that one intends to prevent, treat and/or manage.
  • the antibody specifically binds to a cellular antigen (e.g., a receptor) expressed by a cell that one desires to target.
  • the heterologous molecule increases protein stability.
  • the heterologous molecule is an Fc domain of an immunoglobulin or a fragment thereof.
  • IL-15Ra is conjugated/fused to the Fc domain of an immunoglobulin (e.g., an IgGl).
  • an immunoglobulin e.g., an IgGl
  • the heterologous molecule is not an Fc domain of an immunoglobulin molecule or a fragment thereof.
  • the IL-15/IL-15Ra complex is administered
  • the IL-15/IL-15Ra complex is administered intravenously or intramusuclarly to a subject in accordance with the methods described herein. In certain embodiments, the IL-15/IL-15Ra complex is administered intratumorally to a subject in accordance with the methods described herein. In some embodiments, the IL-15/IL-15Ra complex is
  • the cancer is melanoma, colon cancer, lung cancer, prostate cancer or renal cell carcinoma.
  • the cancer is metastastic.
  • the infectious disease is chronic.
  • the infectious disease is AIDS, pneumonia or tuberculosis.
  • the terms “disease” and “disorder” are used interchangeably to refer to a condition, in particular, a pathological condition.
  • the terms “disease” and “disorder” are used interchangeably to refer to a disease affected by IL-15 signal transduction.
  • the term “peak level” and “peak concentration” refer to the highest levels of free IL-15 in a sample (e.g., a plasma sample) from a subject over a period of time.
  • the period of time is the entire period of time between the administration of one dose of IL-15/IL-15Ra complex and another dose of the complex. In some embodiments, the period of time is approximately 24 hours, approximately 48 hours or approximately 72 hours after the administration of one dose of IL-15/IL-15Ra complex and before the administration of another dose of the complex.
  • the terms “trough level” and “trough concentration” refer to the lowest levels of free IL-15 in a sample (e.g., a plasma sample) from a subject over a period of time.
  • the period of time is the entire period of time between the administration of one dose of IL-15/IL-15Ra complex and another dose of the complex. In some embodiments, the period of time is approximately 24 hours, approximately 48 hours or approximately 72 hours after the administration of one dose of IL-15/IL-15Ra complex and before the administration of another dose of the complex.
  • normal levels in the context of the concentration of free IL-15 refers to the concentration of free IL-15 found in a sample obtained or derived from a healthy subject. Basal plasma levels of free IL-15 in healthy subjects are
  • mice approximately 1 pg/ml in humans, approximately 8-15 pg/ml in monkeys (such as macaques), and approximately 12 pg/ml in rodents (such as mice). Normal levels depend on the exact method used for measurement and may vary because of this.
  • the phase "an effective ratio of IL-15 to lymphocyte cell number” means that the amount of IL-15 available for lymphocytes keeps pace with the number of lymphocytes so that lymphocytes continue proliferating or survive.
  • a trough concentration of approximately 1 pg/ml to 5 pg/ml, approximately 1 pg/ml to 10 pg/ml, approximately 1 pg/ml to 15 pg/ml, approximately 1 pg/ml to 20 pg/ml, approximately 1 to 25 pg/ml, approximately 1 pg/ml to 30 pg/ml, approximately 1 pg/ml to 40 pg/ml, or approximately 1 pg/ml to 50 pg/ml of free IL-15 in a plasma sample from a subject is indicative of "an effective ratio of IL-15 to lymphocyte cell number."
  • a trough concentration 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml of free IL-15 in a plasma sample from a subject is indicative that the ratio of IL-15 to lymphocyte cell number is excessive.
  • Any method known to one skilled in the art for measuring free IL-15 concentration in a sample from a subject may be used, such as, e.g., an immunoassay.
  • an ELISA is used to measure the free IL-15 concentration in a sample from a subject.
  • the terms “specifically binds,” “specifically recognizes” and analogous terms in the context of a receptor ⁇ e.g., native IL-15Ra or IL-15 receptor ⁇ ) and a ligand ⁇ e.g., native IL-15) interaction refer to the specific binding or association between the ligand and receptor.
  • the ligand has higher affinity for the receptor than for other molecules.
  • the ligand is native IL-15 and the native receptor is IL- 15Ra.
  • the ligand is the native IL-15/IL-15Ra complex and the native receptor is the ⁇ receptor complex.
  • the IL-15/IL-15Ra complex binds to the ⁇ receptor complex and activates IL-15 mediated signal transduction.
  • Ligands that specifically bind a receptor can be identified, for example, by immunoassays, BIAcore, or other techniques known to those of skill in the art.
  • the terms "native IL-15” and “native interleukin-15” in the context of proteins or polypeptides refer to any naturally occurring mammalian interleukin-15 amino acid sequences, including immature or precursor and mature forms. Non-limiting examples of GeneBank Accession Nos.
  • NP 000576 human, immature form
  • CAA62616 human, immature form
  • NP 001009207 Felis catus, immature form
  • AAB94536 rattus, immature form
  • AAB41697 rattus, immature form
  • NP 032383 Mus musculus, immature form
  • AAR19080 canine
  • AAB60398 macaca mulatta, immature form
  • AAI00964 human, immature form
  • AAH23698 mus musculus, immature form
  • AAH18149 human.
  • the amino acid sequence of the immature/precursor form of native human IL-15 which comprises the long signal peptide (underlined) and the mature human native IL-15 (italicized) is provided:
  • native IL-15 is the immature or precursor form of a naturally occurring mammalian IL-15.
  • native IL-15 is the mature form of a naturally occurring mammalian IL-15.
  • native IL-15 is the precursor form of naturally occurring human IL-15.
  • native IL-15 is the mature form of naturally occurring human IL-15.
  • the native IL-15 protein/polypeptide is isolated or purified.
  • nucleic acids refer to any naturally occurring nucleic acid sequences encoding mammalian interleukin-15, including the immature or precursor and mature forms.
  • Non- limiting examples of GeneBank Accession Nos. for the nucleotide sequence of various species of native mammalian IL-15 include NM_000585 (human), NM_008357 (Mus musculus), and RNU69272 (rattus norvegicus).
  • the nucleotide sequence encoding the immature/precursor form of native human IL-15 which comprises the nucleotide sequence encoding the long signal peptide (underlined) and the nucleotide sequence encoding the mature human native IL-15 (italicized), is provided: atgagaat ttcgaaacca catttgagaa gtatttccat ccagtgctac ttgtgttttac ttctaaacag tcattttcta actgaagctg gcattcatgt cttcattttg ggctgtttca gtgcagggct tcctaaaaca gaagccaact gggtgaatgt aataagtgat ttgaaaaaaaagatct tcaatct atgcatattg atg
  • nucleic acid is an isolated or purified nucleic acid.
  • nucleic acids encode the immature or precursor form of a naturally occurring mammalian IL-15.
  • nucleic acids encode the mature form of a naturally occurring mammalian IL-15.
  • nucleic acids encoding native IL-15 encode the precursor form of naturally occurring human IL-15.
  • nucleic acids encoding native IL-15 encode the mature form of naturally occurring human IL-15.
  • IL-15 derivative and "interleukin-15 derivative” in the context of proteins or polypeptides refer to: (a) a polypeptide that is at least 40%, 45%, 50%>, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to a native mammalian IL-15 polypeptide; (b) a polypeptide encoded by a nucleic acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical a nucleic acid sequence encoding a native mammalian IL-15 polypeptide; (c) a polypeptide that contains 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acid mutations ⁇ i.e., additions, deletions and/or substitutions) relative to a native mammalian IL-15 polypeptide
  • IL-15 derivatives also include a polypeptide that comprises the amino acid sequence of a naturally occurring mature form of a mammalian IL-15 polypeptide and a heterologous signal peptide amino acid sequence.
  • an IL-15 derivative is a derivative of a native human IL-15 polypeptide.
  • an IL-15 derivative is a derivative of an immature or precursor form of naturally occurring human IL-15 polypeptide.
  • an IL-15 derivative is a derivative of a mature form of naturally occurring human IL-15 polypeptide.
  • an IL- 15 derivative is the IL-15N72D described in, e.g., Zhu et al, 2009, J. Immunol.
  • an IL-15 derivative is one of the IL-15 variants described in U.S. Patent No. 8,163,879.
  • an IL-15 derivative is isolated or purified.
  • IL-15 derivatives retain at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% of the function of native mammalian IL-15 polypeptide to bind IL-15Ra polypeptide, as measured by assays well known in the art, e.g., ELISA, Biacore, co-immunoprecipitation.
  • IL-15 derivatives retain at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% of the function of native mammalian IL-15 polypeptide to induce IL-15 -mediated signal transduction, as measured by assays well-known in the art, e.g. , electromobility shift assays, western blots, phosphoprotein analysis, ELISAs and other immunoassays.
  • IL-15 derivatives bind to IL-15Ra and/or IL-15RPy as assessed by, e.g., ligand/receptor binding assays well-known in the art.
  • Percent identity can be determined using any method known to one of skill in the art. In a specific embodiment, the percent identity is determined using the "Best Fit” or "Gap” program of the Sequence Analysis Software Package (Version 10; Genetics Computer Group, Inc., University of Wisconsin Biotechnology Center, Madison, Wisconsin).
  • IL-15 derivative and "interleukin-15 derivative” in the context of nucleic acids refer to: (a) a nucleic acid sequence that is at least 40%>, 45%, 50%>, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to the naturally occurring nucleic acid sequence encoding a mammalian IL-15 polypeptide; (b) a nucleic acid sequence encoding a polypeptide that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical the amino acid sequence of a native mammalian IL-15 polypeptide; (c) a nucleic acid sequence that contains 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more nucleic acid base mutations (i.e., additions, deletions and/or substitutions) relative to the naturally occurring
  • an IL-15 derivative in the context of nucleic acids is a derivative of a naturally occurring nucleic acid sequence encoding a human IL-15 polypeptide.
  • an IL- 15 derivative in the context of nucleic acids is a derivative of a naturally occurring nucleic acid sequence encoding an immature or precursor form of a human IL-15 polypeptide.
  • an IL-15 derivative in the context of nucleic acids is a derivative of a naturally occurring nucleic acid sequence encoding a mature form of a human IL-15 polypeptide.
  • an IL-15 derivative in the context of nucleic acids is the nucleic acid sequence encoding the IL-15N72D described in, e.g., Zhu et al, 2009, J. Immunol. 183: 3598 or U.S. Patent No. 8,163,879.
  • an IL-15 derivative in the context of nucleic acids is the nucleic acid sequence encoding one of the IL- 15 variants described in U.S. Patent No. 8,163,879.
  • IL-15 derivative nucleic acid sequences include codon-optimized/RNA-optimized nucleic acid sequences that encode native mammalian IL-15 polypeptide, including mature and immature forms of IL-15 polypeptide.
  • IL-15 derivative nucleic acids include nucleic acids that encode mammalian IL-15 RNA transcripts containing mutations that eliminate potential splice sites and instability elements ⁇ e.g. , A/T or A/U rich elements) without affecting the amino acid sequence to increase the stability of the mammalian IL-15 RNA transcripts.
  • the IL-15 derivative nucleic acid sequence is the codon-optimized sequence in SEQ ID NO: 9 (the amino acid sequence encoded by such a nucleic acid sequence is provided in SEQ ID NO: 10).
  • IL-15 derivative nucleic acid sequences encode proteins or polypeptides that retain at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% of the function of a native mammalian IL-15 polypeptide to bind IL- 15Ra, as measured by assays well known in the art, e.g., ELISA, Biacore, co- immunoprecipitation or gel electrophoresis.
  • IL-15 derivative nucleic acid sequences encode proteins or polypeptides that retain at least 50%>, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% of the function of a native mammalian IL-15 polypeptide to induce IL-15 -mediated signal transduction, as measured by assays well-known in the art, e.g., electromobility shift assays, ELISAs and other
  • IL-15 derivative nucleic acid sequences encode proteins or polypeptides that bind to IL-15Ra and/or IL-15RPy as assessed by, e.g., ligand/receptor assays well-known in the art.
  • IL-15 and interleukin-15 refer to a native IL-15, an IL-15 derivative, or a native IL-15 and an IL-15 derivative.
  • IL-15Ra and “native interleukin-15 receptor alpha” in the context of proteins or polypeptides refer to any naturally occurring mammalian interleukin-15 receptor alpha ("IL-15Ra") amino acid sequence, including immature or precursor and mature forms and naturally occurring isoforms.
  • IL-15Ra mammalian interleukin-15 receptor alpha
  • Non-limiting examples of GeneBank Accession Nos. for the amino acid sequence of various native mammalian IL- 15Ra include NP_002180 (human), ABK41438 (Macaca mulatta), NP_032384 (Mus musculus), Q60819 (Mus musculus), CAM 1082 (human).
  • the amino acid sequence of the immature form of the native full length human IL-15Ra which comprises the signal peptide (underlined) and the mature human native IL-15Ra (italicized), is provided: MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQG HSDTTVAIST STVLLCGLSA VSLLACYLKS RQTPPLASVE MEAMEALPVT WGTSSRDEDL ENCSHHL (SEQ ID NO: 3; FIG.
  • the amino acid sequence of the immature form of the native soluble human IL-15Ra which comprises the signal peptide (underlined) and the mature human native soluble IL-15Ra (italicized), is provided: MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQG (SEQ ID NO: 32, FIG. 3D).
  • native IL-15Ra is the immature form of a naturally occurring mammalian IL-15Ra polypeptide.
  • native IL- 15Ra is the mature form of a naturally occurring mammalian IL-15Ra polypeptide.
  • native IL-15Ra is the naturally occurring soluble form of mammalian IL-15Ra polypeptide.
  • native IL-15Ra is the full-length form of a naturally occurring mammalian IL-15Ra polypeptide.
  • native IL- 15Ra is the immature form of a naturally occurring human IL-15Ra polypeptide.
  • native IL-15Ra is the mature form of a naturally occurring human IL-15Ra polypeptide.
  • native IL-15Ra is the naturally occurring soluble form of human IL-15Ra polypeptide.
  • native IL-15Ra is the full-length form of a naturally occurring human IL-15Ra polypeptide.
  • a native IL- 15Ra protein or polypeptide is isolated or purified.
  • nucleic acids refer to any naturally occurring nucleic acid sequences encoding mammalian interleukin-15 receptor alpha, including the immature or precursor and mature forms.
  • Non-limiting examples of GeneBank Accession Nos. for the nucleotide sequence of various species of native mammalian IL-15Ra include NM 002189 (human), EF033114 (Macaca mulatta), and NM 008358 (Mus musculus).
  • the nucleotide sequence encoding the immature form of native human IL-15Ra which comprises the nucleotide sequence encoding the signal peptide (underlined) and the nucleotide sequence encoding the mature human native IL-15Ra (italicized), is provided: atggcccc gcggcgggcg cgcggctgcc ggaccctcgg tctcccggcg ctgctactgc tgctgctgctgct ct cccg gcgacgcggg zcatcacgtg ccctcccccccc atgtccgtgg aacacgcaga catctgggtc aagagctaca gcttgtactc cagggagcgg tacatttgta actctggttt caagcgtaaa gccggca
  • nucleotide sequence encoding the immature form of native soluble human IL-15Ra protein or polypeptide which comprises the nucleotide sequence encoding the signal peptide (underlined) and the nucleotide sequence encoding the mature human soluble native IL-15Ra (italicized), is provided: atggcccc gcggcgggcg cgcggctgcc ggaccctcgg tctcccggcg ctgctactgc tgctgctgct ct ccccg gcgacgcggg gcatcacgtg ccctcccccccc atgtccgtgg aacacgcaga catctgggtc aagagctaca gcttgtactc cagggagcgg tacatttgta actctggttt caagcgta
  • the nucleic acid is an isolated or purified nucleic acid.
  • naturally occurring nucleic acids encode the immature form of a naturally occurring mammalian IL-15Ra polypeptide.
  • naturally occurring nucleic acids encode the mature form of a naturally occurring mammalian IL-15Ra polypeptide.
  • naturally occurring nucleic acids encode the soluble form of a naturally occurring mammalian IL-15Ra polypeptide.
  • naturally occurring nucleic acids encode the full-length form of a naturally occurring mammalian IL-15Ra polypeptide.
  • naturally occurring nucleic acids encode the precursor form of naturally occurring human IL-15 polypeptide.
  • naturally occurring nucleic acids encode the mature of naturally occurring human IL-15 polypeptide. In certain embodiments, naturally occurring nucleic acids encode the soluble form of a naturally occurring human IL-15Ra polypeptide. In other embodiments, naturally occurring nucleic acids encode the full-length form of a naturally occurring human IL-15Ra polypeptide.
  • IL-15Ra derivative and "interleukin-15 receptor alpha derivative” in the context of a protein or polypeptide refer to: (a) a polypeptide that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to a native mammalian IL-15 polypeptide; (b) a polypeptide encoded by a nucleic acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical a nucleic acid sequence encoding a native mammalian IL-15Ra polypeptide; (c) a polypeptide that contains 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acid mutations (i.e.
  • IL-15Ra derivative a polypeptide encoded by a nucleic acid sequence that can hybridize under high, moderate or typical stringency hybridization conditions to a nucleic acid sequence encoding a native mammalian IL-15Ra polypeptide;
  • IL-15Ra derivative a nucleic acid sequence that can hybridize under high, moderate or typical stringency hybridization conditions to a nucleic acid
  • an IL-15Ra derivative is a derivative of a native human IL-15Ra polypeptide.
  • an IL-15Ra derivative is a derivative of an immature form of naturally occurring human IL-15 polypeptide.
  • an IL-15Ra derivative is a derivative of a mature form of naturally occurring human IL-15 polypeptide.
  • an IL-15Ra derivative is a soluble form of a native mammalian IL-15Ra polypeptide.
  • an IL-15Ra derivative includes soluble forms of native mammalian IL-15Ra, wherein those soluble forms are not naturally occurring.
  • An example of an amino acid sequence of a truncated, soluble form of an immature form of the native human IL-15Ra comprises the following signal peptide
  • IL-15Ra derivatives include the truncated, soluble forms of native human IL- 15Ra described in Section 5.1, infra or the sushi domain, which is the binding site to IL-15.
  • an IL-15Ra derivative is purified or isolated.
  • IL-15Ra derivatives retain at least 50%, 55%, 60%>, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% of the function of a native mammalian IL-15Ra polypeptide to bind an IL-15 polypeptide, as measured by assays well known in the art, e.g., ELISA, Biacore, co-immunoprecipitation.
  • IL- 15Ra derivatives retain at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% of the function of a native mammalian IL-15Ra polypeptide to induce IL-15- mediated signal transduction, as measured by assays well-known in the art, e.g.,
  • IL- 15Ra derivatives bind to IL-15 as assessed by methods well-known in the art, such as, e.g., ELISAs.
  • IL-15Ra derivative and "interleukin-15 receptor alpha derivative” in the context of nucleic acids refer to: (a) a nucleic acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to the naturally occurring nucleic acid sequence encoding a mammalian IL-15Ra
  • nucleic acid sequence encoding a polypeptide that is at least 40%>, 45%>, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical the amino acid sequence of a native mammalian IL-15Ra polypeptide;
  • an IL-15Ra derivative in the context of nucleic acids is a derivative of a naturally occurring nucleic acid sequence encoding a human IL- 15Ra polypeptide.
  • an IL-15Ra derivative in the context of nucleic acids is a derivative of a naturally occurring nucleic acid sequence encoding an immature form of a human IL-15Ra polypeptide.
  • an IL-15Ra derivative in the context of nucleic acids is a derivative of a naturally occurring nucleic acid sequence encoding a mature form of a human IL-15Ra polypeptide.
  • an IL-15Ra derivative in the context of nucleic acids refers to a nucleic acid sequence encoding a derivative of mammalian IL-15Ra polypeptide that is soluble.
  • an IL-15Ra derivative in context of nucleic acids refers to a nucleic acid sequence encoding a soluble form of native mammalian IL-15Ra, wherein the soluble form is not naturally occurring.
  • an IL-15Ra derivative in the context of nucleic acids refers to a nucleic acid sequence encoding a derivative of human IL-15Ra, wherein the derivative of the human IL-15Ra is a soluble form of IL-15Ra that is not naturally occurring.
  • an IL-15Ra derivative nucleic acid sequence is the nucleotide sequence encoding the truncated, soluble, immature form of a native human IL-15Ra protein or polypeptide that comprises the following nucleotide sequence encoding the signal peptide (underlined) and the following nucleotide sequence encoding a truncated form of the mature human native IL- 15 Ra (italicized) : atggcccc gcggcgggcg cgcggctgcc ggaccctcgg tctcccggcg ctgctactgc tgctgctgctgct ct cccg gcgacgcggg Qcatcacgtg ccctcccccccc atgtccgtgg aacacgcaga catctgggtc aagagctaca gcttgtact
  • IL-15Ra derivative nucleic acid sequences include RNA or codon-optimized nucleic acid sequences that encode native IL-15Ra polypeptide, including mature and immature forms of IL-15Ra polypeptide.
  • IL-15Ra derivative nucleic acids include nucleic acids that encode IL-15Ra RNA transcripts containing mutations that eliminate potential splice sites and instability elements ⁇ e.g. , A/T or A/U rich elements) without affecting the amino acid sequence to increase the stability of the IL-15Ra RNA transcripts.
  • the IL-15Ra derivative nucleic acid sequence is the RNA or codon-optimized sequence in SEQ ID NO: 11, 13, 15 or 17 (the amino acid sequences encoded by such a nucleic acid sequences are provided in SEQ ID NO: 12, 14, 16 and 18, respectively).
  • IL-15Ra derivative nucleic acid sequences encode proteins or polypeptides that retain at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% of the function of a native mammalian IL-15Ra polypeptide to bind IL-15, as measured by assays well known in the art, e.g., ELISA, Biacore, co- immunoprecipitation.
  • IL-15Ra derivative nucleic acid sequnces encode proteins or polypeptides that retain at least 50%>, 55%>, 60%>, 65%>, 70%>, 75%, 80%, 85%, 90%, 95%, 98% or 99% of the function of a native mammalian IL-15Ra to induce IL-15 -mediated signal transduction, as measured by assays well-known in the art, e.g., electromobility shift assays, ELISAs and other immunoassays.
  • IL- 15Ra derivative nucleic acid sequences encode proteins or polypeptides that bind to IL-15 as assessed by methods well-known in the art, such as, e.g., ELISAs.
  • IL-15Ra and "interleukin-15 receptor alpha” refer to a native IL-15Ra, an IL-15Ra derivative, or a native IL-15Ra and an IL-15Ra derivative.
  • IL-15/IL-15Ra complex refers to a complex comprising IL-15 and IL-15Ra covalently or noncovalently bound to each other.
  • the IL-15Ra has a relatively high affinity for IL-15, e.g., IQ of 10 to 50 pM as measured by a technique known in the art, e.g., KinEx A assay, plasma surface resonance ⁇ e.g., BIAcore assay).
  • the IL-15/IL-15Ra complex induces IL-15 -mediated signal transduction, as measured by assays well-known in the art, e.g., electromobility shift assays, ELISAs and other immunoassays.
  • the IL-15/IL-15Ra complex retains the ability to specifically bind to the ⁇ chain.
  • the IL-15/IL-15Ra complex is isolated from a cell.
  • the terms "subject” and “patient” are used interchangeably and refer to a mammal such as a non-primate (e.g., cows, pigs, horses, cats, dogs, rats etc.) and a primate (e.g., monkey and human), most preferably a human.
  • a non-primate e.g., cows, pigs, horses, cats, dogs, rats etc.
  • a primate e.g., monkey and human
  • the terms “purified” and “isolated” in the context of a compound or agent (including, e.g. , proteinaceous agents) that is chemically synthesized refers to a compound or agent that is substantially free of chemical precursors or other chemicals when chemically synthesized.
  • the compound or agent is 60%, 65%, 75%, 80%, 85%, 90%, 95%, or 99% free (by dry weight) of other, different compounds or agents.
  • purified and “isolated” when used in the context of a compound or agent (including proteinaceous agents such as polypeptides) that can be obtained from a natural source, e.g., cells, refers to a compound or agent which is
  • contaminating materials from the natural source e.g., soil particles, minerals, chemicals from the environment, and/or cellular materials from the natural source, such as but not limited to cell debris, cell wall materials, membranes, organelles, the bulk of the nucleic acids, carbohydrates, proteins, and/or lipids present in cells.
  • contaminating materials from the natural source e.g., soil particles, minerals, chemicals from the environment, and/or cellular materials from the natural source, such as but not limited to cell debris, cell wall materials, membranes, organelles, the bulk of the nucleic acids, carbohydrates, proteins, and/or lipids present in cells.
  • substantially free of natural source materials refers to preparations of a compound or agent that has been separated from the material (e.g., cellular components of the cells) from which it is isolated.
  • a compound or agent that is isolated includes preparations of a compound or agent having less than about 30%>, 20%>, 10%>, 5%, 2%, or 1% (by dry weight) of cellular materials and/or contaminating materials.
  • nucleic acid sequence or nucleotide sequence is one which is separated from other nucleic acid molecules which are present in a natural source of the nucleic acid sequence or nucleotide sequence.
  • an "isolated" nucleic acid sequence or nucleotide sequence, such as a cDNA molecule can be substantially free of other cellular material or culture medium when produced by recombinant techniques, or substantially free of chemical precursors when chemically synthesized.
  • an "isolated" nucleic acid sequence or nucleotide sequence is a nucleic acid sequence or nucleotide sequence that is recombinantly expressed in a heterologous cell.
  • nucleic acid In some embodiments, the terms "nucleic acid”, “nucleotide” and
  • polynucleotide refer to deoxyribonucleotides, deoxyribonucleic acids, ribonucleotides, and ribonucleic acids, and polymeric forms thereof, and include either single- or double-stranded forms.
  • such terms include known analogues of natural nucleotides, for example, peptide nucleic acids ("PNA"s), that have similar binding properties as the reference nucleic acid.
  • PNA peptide nucleic acids
  • such terms refer to deoxyribonucleic acids (e.g., cDNA or DNA).
  • ribonucleic acid e.g., mRNA or RNA).
  • the terms “therapies” and “therapy” can refer to any protocol(s), method(s), compositions, formulations, and/or agent(s) that can be used in the prevention, treatment, management, or amelioration of a disease, e.g., cancer, infectious disease, lymphopenia, and immunodeficiencies, or a symptom associated therewith.
  • a disease e.g., cancer, infectious disease, lymphopenia, and immunodeficiencies, or a symptom associated therewith.
  • the terms “therapies” and “therapy” refer to biological therapy, supportive therapy, and/or other therapies useful in treatment, management, prevention, or amelioration of a disease or a symptom associated therewith known to one of skill in the art.
  • a therapy includes a Therapeutic Agent.
  • a therapy is not a Therapeutic Agent.
  • protein(s) and “polypeptide(s)” interchangeably to refer to a chain of amino acids linked together by peptide bonds.
  • protein(s) and “polypeptide(s)” refer to a macromolecule which comprises amino acids that are linked together by peptide bonds.
  • fragment in the context of a nucleotide sequence refers to a nucleotide sequence comprising an nucleic acid sequence of at least 5 contiguous nucleic acid bases, at least 10 contiguous nucleic acid bases, at least 15 contiguous nucleic acid bases, at least 20 contiguous nucleic acid bases, at least 25 contiguous nucleic acid bases, at least 40 contiguous nucleic acid bases, at least 50 contiguous nucleic acid bases, at least 60 contiguous nucleic acid bases, at least 70 contiguous nucleic acid bases, at least 80 contiguous nucleic acid bases, at least 90 contiguous nucleic acid bases, at least 100 contiguous nucleic acid bases, at least 125 contiguous nucleic acid bases, at least 150 contiguous nucleic acid bases, at least 175 contiguous nucleic acid bases, at least 200 contiguous nucleic acid bases, or at least 250 contiguous nucleic acid bases of the
  • fragment is the context of a fragment of a
  • proteinaceous agent refers to a fragment that is composed of 8 or more contiguous amino acids, 10 or more contiguous amino acids, 15 or more contiguous amino acids, 20 or more contiguous amino acids, 25 or more contiguous amino acids, 50 or more contiguous amino acids, 75 or more contiguous amino acids, 100 or more contiguous amino acids, 150 or more contiguous amino acids, 200 or more contiguous amino acids, 10 to 150 contiguous amino acids, 10 to 200 contiguous amino acids, 10 to 250 contiguous amino acids, 10 to 300 contiguous amino acids, 50 to 100 contiguous amino acids, 50 to 150 contiguous amino acids, 50 to 200 contiguous amino acids, 50 to 250 contiguous amino acids or 50 to 300 contiguous amino acids of a proteinaceous agent, e.g., IL-15 and IL-15Ra polypeptides.
  • a proteinaceous agent e.g., IL-15 and IL-15Ra polypeptides.
  • the term "in combination” refers to the use of more than one therapies ⁇ e.g., one or more prophylactic and/or therapeutic agents).
  • the use of the term “in combination” does not restrict the order in which therapies are administered to a subject with a disease or disorder.
  • a first therapy ⁇ e.g., a prophylactic or therapeutic agent
  • a prophylactic or therapeutic agent can be administered prior to ⁇ e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to ⁇ e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapy ⁇ e.g., a second therapy ⁇ e.g., a
  • prophylactic or therapeutic agent to a subject with a disease or disorder or a symptom thereof.
  • the term "host cell” refers to any type of cell, e.g., a primary cell or a cell from a cell line.
  • the term “host cell” refers a cell transfected with a nucleic acid molecule and the progeny or potential progeny of such a cell. Progeny of such a cell may not be identical to the parent cell transfected with the nucleic acid molecule due to mutations or environmental influences that may occur in succeeding generations or integration of the nucleic acid molecule into the host cell genome.
  • premature human infant refers to a human infant born at less than 37 weeks of gestational age.
  • human infant refers to a newborn to 1 year old human.
  • human child refers to a human that is 1 year to 18 years old.
  • human adult refers to a human that is 18 years or older.
  • the term “elderly human” refers to a human 65 years or older.
  • the terms “treat”, “treating” and “treatment” in the context of the administration of a therapy to a subject refer to the beneficial effects that a subject derives from a therapy.
  • Non-limiting examples of such benefits include the reduction or inhibition of the progression, spread and/or duration of a disease or disorder, the reduction or amelioration of the severity of a disease or disorder, amelioration of one or more symptoms of a disease or disorder, and/or the reduction in the duration of one or more symptom of a disease or disorder resulting from the administration of one or more therapies.
  • the terms "prevent,” “preventing” and “prevention” in the context of the administration of a therapy to a subject refer to the inhibition of the onset or recurrence of a disease or disorder in a subject.
  • a subject is administered one or more therapies to "manage" a disease or disorder so as to prevent the progression or worsening of symptoms associated with a disease or disorder.
  • immunospecifically binds and “specifically binds” in the context of antibodies refer to molecules that specifically bind to an antigen (e.g., an epitope or an immune complex) and do not specifically bind to another molecule.
  • a molecule that specifically binds to an antigen may bind to other antigens with a lower affinity as determined by, e.g. , immunoassays, BIAcore or other assays known in the art.
  • molecules that bind to an antigen do not cross-react with other antigens.
  • the dose is according to the mass of the single-chain IL-15.
  • the single-chain IL-15 equivalent is calculated from (i) the mass of an IL-15/IL-15Ra complex by amino acid analysis and (ii) the ratio of IL-15 to IL-15Ra (e.g., soluble IL-15Ra) in the specific preparation as determined experimentally by RP-HPLC or by amino acid analysis.
  • Figures. 1A-B Nucleic acid and amino acid sequences of native human IL-15.
  • the nucleic acid sequence (FIG. 1A) (SEQ ID NO: 2) and amino acid sequence (FIG. IB) (SEQ ID NO: 1) are shown.
  • the amino acid sequence and nucleic acid sequence of the long signal peptide (underlined) and mature form (italicized) are indicated.
  • Figures 2A-B Nucleic acid and amino acid sequences of full length native human IL-15Ra.
  • the nucleic acid sequence (FIG. 2A) (SEQ ID NO: 5) and amino acid sequence (FIG. 2B) (SEQ ID NO: 3) are shown.
  • the amino acid sequence and nucleic acid sequence of the signal peptide (underlined) and mature form (italicized) are indicated.
  • Figures 3A-D Nucleic acid and amino acid sequences of soluble forms of human IL-15Ra.
  • the nucleic acid sequence (FIG. 3 A) (SEQ ID NO: 6) and amino acid sequence (FIG. 3B) (SEQ ID NO: 4) for a truncated soluble human IL-15Ra in cell clone 2.66 are shown in Fig. 3A-B.
  • the nucleic acid sequence (FIG. 3C) (SEQ ID NO: 46) and amino acid sequence (FIG. 3D) (SEQ ID NO: 32) for a native soluble human IL-15Ra are shown in FIGS. 3C-D.
  • the amino acid sequences and nucleic acid sequences of the signal peptide (underlined) and mature form (italicized) are indicated.
  • FIG. 4 Plasma IL-15 levels in 6 macaques injected with IL-15 heterodimer at escalated doses of 1 ⁇ g/kg, 20 ⁇ g/kg, and 50 ⁇ g/kg. The 6 macaques received 6 s.c.
  • IL-15/IL-15Ra injections of IL-15/IL-15Ra at the dose of 1 ⁇ g/Kg, 20 ⁇ g/Kg, or 50 ⁇ g/Kg (on day 0, 2, 4, 7, 9 and 11.
  • Group 1 50 ⁇ g/kg IL-15/sIL-15Ra
  • Group 2 20 ⁇ g/kg IL-15/sIL-15Ra
  • Group 3 ⁇ g/kg IL-15/sIL-15Ra.
  • Figure 5 The fold over baseline increase of NK cells and CD8 T cells in peripheral blood in 6 macaques injected with IL-15 heterodimer at escalated doses of 1 ⁇ g/kg, 20 ⁇ g/kg, and 50 ⁇ g/kg.
  • Group 1 50 ⁇ g/kg IL-15/sIL-15Ra
  • Group 2 20 ⁇ g/kg IL- 15/sIL-15Ra
  • Group 3 ⁇ g/kg IL-15/sIL-15Ra.
  • Figure 6 Dose-dependent proliferation of lymphocytes in different tissues, including lymph nodes, liver, PBMC, spleen, upon IL-15 heterodimer s.c. administration. Squares: 50 ⁇ g/kg; triangles: 20 ⁇ g/kg; circles: 1 ⁇ g/kg.
  • FIG. 7 Lymphocytes profiles (T cells, CD4+, CD8+) by flow cytometry in the lymph node upon IL-15 heterodimer (hetIL-15) s.c. administration. hetIL-15 treatment increases the frequency of CD8 T cells in lymph nodes. hetIL-15 preferentially increases lymphocytes with memory phenotype, including effector CD8+ T cells (CD28 " CD95 + ).
  • Figure 8 T lymphocyte proliferation and PD1 expression within the lymph nodes upon IL-15 heterodimer s.c. administration.
  • Figure 9 Serum albumin profile during IL-15 heterodimer s.c. administration. Circles: T138 (2-64 ⁇ g/kg); squares: P934 (5-80 ⁇ g/kg); triangles: P941 (5-120 ⁇ g/kg).
  • Figure 10. Serum albumin/globulin (Alb/Glob) Ratio profile during IL-15 heterodimer s.c. administration. Circles: T138 (2-64 ⁇ g/kg); squares: P934 (5-80 ⁇ g/kg); triangles: P941 (5-120 ⁇ ).
  • FIG. 11 Lymphocyte infiltration within a macaque tumor and PD 1 expression upon IL-15 heterodimer s.c. administration.
  • PBMC left: Analysis of blood lymphocytes by flow cytometry.
  • TILs right: Tumor Infiltrating Lymphocytes before (Pre, top) and after (hetIL-15, bottom) heterodimer s.c. administration.
  • IL-15Ra Described herein is the naturally occurring soluble form of human IL-15Ra. Also described herein are specific IL-15Ra derivatives that are truncated, soluble forms of human IL-15Ra. These specific IL-15Ra derivatives and the naturally occurring soluble form of human IL-15Ra are based, in part, on the identification of the proteolytic cleavage site of human IL-15Ra. Further described herein are soluble forms of IL-15Ra that are
  • IL-15Ra characterized based upon glycosylation of the IL-15Ra.
  • proteolytic cleavage of human IL-15Ra takes place between the residues (i.e., Glyl70 and His 171) which are shown in bold and underlined in the provided amino acid sequence of the immature form of the native full length human IL- 15Ra: MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA K WELTASAS HQPPGVYPQG HSDTTVAIST STVLLCGLSA VSLLACYLKS RQTPPLASVE MEAMEALPVT WGTSSRDEDL ENCSHHL (SEQ ID NO: 3; FIG. 2B).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • the amino acid sequence of the soluble form of human IL-15Ra terminates at the site of the proteolytic cleavage of the native membrane-bound human IL-15Ra.
  • a soluble form of human IL-15Ra e.g. , a purified soluble form of human IL-15Ra
  • the amino acid sequence of the soluble form of human IL-15Ra terminates with PQG (SEQ ID NO: 31), wherein G is Glyl70.
  • a soluble form of human IL-15Ra (e.g. , a purified soluble form of human IL-15Ra) which has the following amino acid sequence: MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQG (SEQ ID NO: 32).
  • an IL-15Ra derivative e.g. , a purified and/or soluble form of IL-15Ra derivative
  • IL-15Ra derivative which is a polypeptide that: (i) is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 32; and (ii) terminates with the amino acid sequence PQG (SEQ ID NO: 31).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • an IL-15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • a polypeptide that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 33, and, optionally, wherein the amino acid sequence of the soluble form of the IL-15Ra derivative terminates with PQG (SEQ ID NO: 31).
  • IL-15Ra derivatives that are truncated, soluble forms of naturally occurring human IL-15Ra.
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • PQGH SEQ ID NO: 30
  • H Hisl71 of SEQ ID NO:45.
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • an IL-15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • an IL-15Ra derivative which is a polypeptide that: (i) is at least 40%>, 45%, 50%>, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 34; and (ii) terminates with the amino acid sequence PQGH (SEQ ID NO: 30).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra which has the following amino acid sequence:
  • IL-15Ra derivative e.g.
  • a purified and/or soluble form of an IL-15Ra derivative which is a polypeptide that: (i) is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 35; and (ii) has the amino acid sequence of the soluble form of the IL-15Ra derivative terminates with PQGH (SEQ ID NO: 30).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • the amino acid sequence of the soluble form of human IL-15Ra terminates with PQGHS (SEQ ID NO: 29), wherein S is Serl72 of SEQ ID NO:45.
  • a soluble form of human IL-15Ra (e.g., a purified soluble form of human IL-15Ra) which has the following amino acid sequence: MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQGHS (SEQ ID NO: 36).
  • an IL-15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • a polypeptide that: (i) is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 36; and (ii) terminates with the amino acid sequence PQGHS (SEQ ID NO: 29).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra which has the following amino acid sequence: ITCPPPMSVE HADIWVKSYS LYSRERYICN
  • an IL-15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • a polypeptide that: (i) is at least 40%>, 45%, 50%>, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 37; and (ii) terminates with the amino acid sequence PQGHS (SEQ ID NO: 29).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • the amino acid sequence of the soluble form of human IL-15Ra terminates with PQGHSD (SEQ ID NO: 28), wherein D is Asp 173 of SEQ ID NO:45.
  • a soluble form of human IL-15Ra (e.g., a purified soluble form of human IL-15Ra) which has the following amino acid sequence: MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQGHSD (SEQ ID NO: 38).
  • an IL- 15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • a polypeptide that: (i) is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 38; and (ii) terminates with the amino acid sequence PQGHSD (SEQ ID NO: 28).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra which has the following amino acid sequence: ITCPPPMSVE HADIWVKSYS LYSRERYICN
  • an IL-15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • a polypeptide that: (i) is at least 40%>, 45%, 50%>, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 39; and(ii) terminates with the amino acid sequence PQGHSD (SEQ ID NO: 28).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • the amino acid sequence of the soluble form of human IL-15Ra terminates with PQGHSDT (SEQ ID NO: 27), wherein T is Thrl74 of SEQ ID NO:45.
  • a soluble form of human IL-15Ra (e.g., a purified soluble form of human IL-15Ra) which has the following amino acid sequence: MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQGHSDT (SEQ ID NO: 40).
  • an IL- 15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • a polypeptide that: (i) is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 40; and (ii) terminates with the amino acid sequence PQGHSDT (SEQ ID NO: 27).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • IL-15Ra which has the following amino acid sequence: ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQGHSDT (SEQ ID NO: 41).
  • an IL-15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • a polypeptide that: (i) is at least 40%>, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 41; and (ii) terminates with the amino acid sequence PQGHSDT (SEQ ID NO: 27).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • the amino acid sequence of the soluble form of human IL-15Ra terminates with PQGHSDTT (SEQ ID NO: 26), wherein T is Thrl75 of SEQ ID NO:45.
  • a soluble form of human IL-15Ra (e.g., a purified soluble form of human IL-15Ra) which has the following amino acid sequence: MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQGHSDTT (SEQ ID NO: 4).
  • an IL- 15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • a polypeptide that: (i) is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 4; and (ii) terminates with the amino acid sequence PQGHSDTT (SEQ ID NO: 26).
  • a soluble form of human IL-15Ra e.g., a purified soluble form of human IL-15Ra
  • IL-15Ra which has the following amino acid sequence: ITCPPPMSVE HADIWVKSYS LYSRERYICN SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA KNWELTASAS HQPPGVYPQGHSDTT (SEQ ID NO: 45).
  • an IL-15Ra derivative e.g., a purified and/or soluble form of an IL-15Ra derivative
  • a polypeptide that: (i) is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 45; and (ii) terminates with the amino acid sequence PQGHSDTT (SEQ ID NO: 26).
  • an IL-15Ra derivative of naturally occurring human IL-15Ra wherein the IL-15Ra derivative is soluble and: (a) the last amino acids at the C-terminal end of the IL-15Ra derivative consist of amino acid residues
  • PQGHSDTT (SEQ ID NO: 26), wherein T is at the C-terminal end of the amino acid sequence; (b) the last amino acids at the C-terminal end of the IL-15Ra derivative consist of amino acid residues PQGHSDT (SEQ ID NO: 27), wherein T is at the C-terminal end of the amino acid sequence; (c) the last amino acids at the C-terminal end of the IL-15Ra derivative consist of amino acid residues PQGHSD (SEQ ID NO: 28), wherein D is at the C-terminal end of the amino acid sequence; (d) the last amino acids at the C-terminal end of the IL-15Ra derivative consist of amino acid residues PQGHS (SEQ ID NO: 29), wherein S is at the C- terminal end of the amino acid sequence; or (e) the last amino acids at the C-terminal end of the IL-15Ra derivative consist of amino acid residues PQGH (SEQ ID NO: 30), wherein H is at the C-terminal end of the
  • amino acid sequences of these IL-15Ra derivatives are at least 75%, at least 85%, at least 90%>, at least 95%), at least 96%>, at least 97%, at least 98%, or at least 99% identical to the amino acid sequence of SEQ ID NO: 45.
  • an IL-15Ra derivative of a naturally occurring human IL-15Ra wherein the IL-15Ra derivative: (i) is soluble; (ii) comprises an amino acid sequence that is at least 75%, at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, or at least 98% identical to the amino acid sequence of SEQ ID NO:45; and (iii) terminates with the amino acid sequence PQG (SEQ ID NO: 31), wherein G is at the C-terminal end of the amino acid sequence of the IL-15Ra derivative.
  • these IL-15Ra derivatives are purified.
  • IL-15Ra derivatives in which the cleavage site for an endogenous protease that cleaves native IL-15Ra has been mutated.
  • IL-15Ra derivatives comprising one, two, three, four, five, six, seven or eight mutations (e.g., additions, deletions or substitutions; such as deletions or substitutions of one, two, three, four, five, six, seven or eight amino acid residues) in the extracellular domain cleavage site of IL-15Ra such that cleavage of the IL-15Ra by an endogenous protease that cleaves native IL-15Ra is inhibited.
  • these amino acid residues or surrounding amino acid residues are mutated such that cleavage of IL-15Ra by an endogenous protease that cleaves native IL-15Ra is inhibited.
  • the amino acid sequence PQGHSDTT (SEQ ID NO: 26) is mutated such that cleavage by an endogenous protease that cleaves native human IL-15Ra is inhibited.
  • one, two, three, four, five, six, seven, or eight amino acid substitutions and/or deletions are introduced into the amino acid sequence PQGHSDTT (SEQ ID NO: 26) of human IL-15Ra such that cleavage by an endogenous proteases that cleaves native human IL-15Ra is inhibited.
  • the amino acid sequence PQGHSDTT (SEQ ID NO: 26) is replaced with a cleavage site that is recognized and cleaved by a heterologous protease.
  • Non-limiting examples of such heterologous protease cleavage sites include Arg-X-X-Arg (SEQ ID NO: 7), which is recognized and cleaved by furin protease; and A-B-Pro-Arg-X-Y (SEQ ID NO: 8) (A and B are hydrophobic amino acids and X and Y are nonacidic amino acids) and Gly-Arg-Gly, which are recognized and cleaved by the thrombin protease.
  • IL-15Ra derivatives wherein the IL-15Ra derivatives: (i) comprises a mutated extracellular cleavage site that inhibits cleavage by an endogenous protease that cleaves native IL-15Ra, and (ii) lack all or a fragment of the transmembrane domain of native IL-15Ra.
  • IL- 15Ra derivatives wherein the IL-15Ra derivatives comprise: (i) one, two, three, four, five, six, seven or eight mutations (e.g., substitutions and/or deletions) in the extracellular cleavage site of IL-15Ra such that cleavage of IL-15Ra by an endogenous protease that cleaves native IL-15Ra is inhibited, and (ii) all or a fragment of a transmembrane domain of a heterologous molecule in place of all or a fragment of the transmembrane domain of native IL-15Ra.
  • mutations e.g., substitutions and/or deletions
  • IL-15Ra derivatives wherein the IL-15Ra derivatives comprise: (i) one, two, three, four, five, six, seven or eight mutations (e.g., substitutions and/or deletions) in the amino acid sequence PQGHSDTT (SEQ ID NO: 26) such that cleavage of IL-15Ra by an endogenous protease that cleaves native IL-15Ra is inhibited, and (ii) all or a fragment of a transmembrane domain of a heterologous molecule in place of all or a fragment of the transmembrane domain of native IL-15Ra.
  • mutations e.g., substitutions and/or deletions
  • the IL-15Ra derivatives may or may not comprise all or a fragment of the cytoplasmic tail of native IL-15Ra.
  • the heterologous molecule is CD4, CD8, or major histocompatability complex (MHC).
  • glycosylated forms of IL-15Ra e.g., purified glycosylated forms of IL-15Ra
  • the glycosylation of the IL-15Ra accounts for at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, or 20% to 25%, 20% to 30%, 25% to 30%, 25% to 35%, 30% to 35%, 30% to 40%, 35% to 40%, 35% to 45%, 40% to 50%, 45% to 50%, 20% to 40%, or 25% to 50% of the mass (molecular weight) of the IL-15Ra as assessed by techniques known to one of skill in the art.
  • the percentage of the mass (molecular weight) of IL-15Ra (e.g., purified IL-15Ra) that glycosylation of IL-15Ra accounts for can be determined using, for example and without limitation, gel electrophoresis and quantitative densitometry of the gels, and comparison of the average mass (molecular weight) of a glycosylated form of IL-15Ra (e.g., a purified glycosylated form of IL-15Ra) to the non-glycosylated form of IL-15Ra (e.g., a purified non- glycosylated form of IL-15Ra).
  • a glycosylated form of IL-15Ra e.g., a purified glycosylated form of IL-15Ra
  • non-glycosylated form of IL-15Ra e.g., a purified non- glycosylated form of IL-15Ra
  • the average mass (molecular weight) of IL-15Ra (e.g., purified IL-15Ra) can be determined using MALDI-TOF MS spectrum on Voyager De-Pro equipped with CovalX HM-1 high mass detector using sinapic acid as matrix, and the mass of a glycosylated form of IL-15Ra (e.g., purified glycosylated form of IL-15Ra) can be compared to the mass of the non-glycosylated form of IL-15Ra (e.g., purified non-glycosylated form of IL-15Ra) to determine the percentage of the mass that glycosylation accounts for.
  • a glycosylated form of IL-15Ra e.g., purified glycosylated form of IL-15Ra
  • a glycosylated IL-15Ra e.g., human IL-15Ra
  • the glycosylation accounts for at least 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more of the mass (molecular weight) of the IL-15Ra.
  • a glycosylated IL-15Ra e.g.
  • human IL-15Ra wherein the glycosylation accounts for 20%> to 25%, 20%> to 30%>, 25% to 30%, 25% to 35%, 30% to 35%, 30% to 40%, 35% to 40%, 35% to 45%, 40% to 50%, 45% to 50%, 20% to 40%, 25% to 50%, 50% to 75%, 75% to 95%, or 75% to 100% of the mass (molecular weight) of the IL-15Ra.
  • a glycosylated IL-15Ra e.g., human IL-15Ra
  • the glycosylation accounts for about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the mass (molecular weight) of the IL-15Ra.
  • the glycosylated IL-15Ra is a native IL-15Ra (e.g., a native human IL-15Ra).
  • the glycosylated IL-15Ra is an IL-15Ra derivative (e.g.
  • an IL-15Ra derivative of naturally occurring human IL-15Ra is a native soluble human IL-15Ra, such as SEQ ID NO: 32 or 33.
  • the glycosylated IL-15Ra is an IL-15Ra derivative that is a soluble form of human IL-15Ra.
  • the glycosylated IL-15Ra has the amino acid sequence of SEQ ID NO: 4, 34, 35, 36, 37, 38, 39, 40, 41 , or 45.
  • the glycosylated IL-15Ra has an amino acid sequence that is at least 40%, 45%, 50%>, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 3, 4,: 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , or 45.
  • the glycosylated IL-15Ra is glycosylated at one, two, three, four, five, six, seven, or all, of the following glycosylation sites: (i) O-glycosylation on Thr5 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; (ii) O-glycosylation on Ser7 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; (iii) N-glycosylation on Ser 8 of amino acid sequence ITCPPPMSVEHADIWVK (SEQ ID NO: 43) in the IL-15Ra, or Ser 8 of amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (iv) N-glycosylation on Ser 18 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (v) N- glycosylation on Ser 20 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (vi) N- glycosylation on Ser 23 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; and/or (vii) N-glycosylated on Ser 31 of amino acid sequence
  • the glycosylated IL-15Ra is purified or isolated.
  • composition comprising IL-15 and glycosylated IL-15Ra (e.g., human IL-15Ra), wherein the glycosylation of the IL-15Ra accounts for at least 20%>, at least 25%>, at least 30%>, at least 35%>, at least 40%>, at least 45%>, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% of the mass (molecular weight) of the IL-15Ra as assessed by techniques known to one of skill in the art.
  • IL-15Ra glycosylated IL-15Ra
  • the glycosylation of the IL-15Ra accounts for at least 20%>, at least 25%>, at least 30%>, at least 35%>, at least 40%>, at least 45%>, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%
  • a composition comprising IL-15 and glycosylated IL-15Ra (e.g., human IL-15Ra), wherein the glycosylation of the IL-15Ra accounts for 20% to 25%, 20% to 30%, 25% to 30%, 25% to 35%, 30% to 35%, 30% to 40%, 35% to 40%, 35% to 45%, 40% to 50%, 45% to 50%, 20% to 40%, 25% to 50%, 50% to 75%, or 75% to 95% of the mass (molecular weight) of the IL-15Ra as assessed by techniques known to one of skill in the art.
  • IL-15Ra glycosylated IL-15Ra
  • the glycosylation of the IL-15Ra accounts for 20% to 25%, 20% to 30%, 25% to 30%, 25% to 35%, 30% to 35%, 30% to 40%, 35% to 40%, 35% to 45%, 40% to 50%, 45% to 50%, 20% to 40%, 25% to 50%, 50% to 75%, or 75% to 95% of the mass (molecular weight) of the IL-15
  • a composition comprising IL-15 and glycosylated IL-15Ra (e.g., human IL-15Ra), wherein the glycosylation of the IL-15Ra accounts for about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the mass (molecular weight) of the IL-15Ra as assessed by techniques known to one of skill in the art.
  • the IL-15 is glycosylated.
  • the glycosylated IL-15Ra is a native IL-15Ra (e.g. , a native human IL-15Ra). In other specific embodiments, the glycosylated IL-15Ra is an IL-15Ra derivative (e.g., an IL-15Ra derivative of naturally occurring human IL-15Ra). In some embodiments, the glycosylated IL-15Ra is a native soluble human IL-15Ra, such as SEQ ID NO: 32 or 33. In other embodiments, the glycosylated IL-15Ra is an IL-15Ra derivative that is a soluble form of human IL-15Ra.
  • a native IL-15Ra e.g. , a native human IL-15Ra
  • the glycosylated IL-15Ra is an IL-15Ra derivative (e.g., an IL-15Ra derivative of naturally occurring human IL-15Ra).
  • the glycosylated IL-15Ra is a native soluble human
  • the glycosylated IL-15Ra has the amino acid sequence of SEQ ID NO: 4, 34, 35, 36, 37, 38, 39, 40, 41 , or 45.
  • the glycosylated IL-15Ra has an amino acid sequence that is at least 40%>, 45%, 50%>, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 3, 4,: 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , or 45.
  • the glycosylated IL-15Ra is glycosylated at one, two, three, four, five, six, seven, or all, of the following glycosylation sites: (i) O-glycosylation on Thr5 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; (ii) O-glycosylation on Ser7 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; (iii) N-glycosylation on Ser 8 of amino acid sequence ITCPPPMSVEHADIWVK (SEQ ID NO: 43) in the IL-15Ra, or Ser 8 of amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (iv) N-glycosylation on Ser 18 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (v) N- glycosylation on Ser 20 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (vi) N- glycosylation on Ser 23 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; and/or (vii) N-glycosylated on Ser 31 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra.
  • an IL-15/IL-15Ra complex comprising glycosylated IL-15Ra (e.g., human IL-15Ra), wherein the glycosylation of the IL-15Ra accounts for at least 20%>, at least 25%>, at least 30%>, at least 35%>, at least 40%>, at least 45%>, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% of the mass (molecular weight) of the IL-15Ra as assessed by techniques known to one of skill in the art.
  • glycosylated IL-15Ra e.g., human IL-15Ra
  • the glycosylation of the IL-15Ra accounts for at least 20%>, at least 25%>, at least 30%>, at least 35%>, at least 40%>, at least 45%>, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least
  • an IL-15/IL-15Ra complex comprising glycosylated IL-15Ra (e.g. , human IL- 15Ra), wherein the glycosylation of the IL-15Ra accounts for 20%> to 25%>, 20%> to 30%>, 25% to 30%, 25% to 35%, 30% to 35%, 30% to 40%, 35% to 40%, 35% to 45%, 40% to 50%, 45% to 50%, 20% to 40%, 25% to 50%, 50% to 75%, or 75% to 95% of the mass (molecular weight) of the IL-15Ra as assessed by techniques known to one of skill in the art.
  • an IL-15/IL-15Ra complex comprising
  • glycosylated IL-15Ra e.g., human IL-15Ra
  • the glycosylation of the IL-15Ra accounts for about 20%>, about 25%, about 30%>, about 35%, about 40%>, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, aboutt 80%, about 85%, about 90%), or about 95% of the mass (molecular weight) of the IL-15Ra as assessed by techniques known to one of skill in the art.
  • the glycosylated IL- 15Ra is a native IL-15Ra (e.g., a native human IL-15Ra).
  • the glycosylated IL-15Ra is an IL-15Ra derivative (e.g. , an IL-15Ra derivative of naturally occurring human IL-15Ra).
  • the glycosylated IL-15Ra is a native soluble human IL-15Ra, such as SEQ ID NO: 32 or 33.
  • the glycosylated IL-15Ra is an IL-15Ra derivative that is a soluble form of human IL-15Ra.
  • the glycosylated IL-15Ra has the amino acid sequence of SEQ ID NO: 4, 34, 35, 36, 37, 38, 39, 40, 41 , or 45.
  • the glycosylated IL- 15Ra has an amino acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 3, 4, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , or 45.
  • the glycosylated IL-15Ra is glycosylated at one, two, three, four, five, six, seven, or all, of the following glycosylation sites: (i) O- glycosylation on Thr5 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; (ii) O-glycosylation on Ser7 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (v) N- glycosylation on Ser 20 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (vi) N- glycosylation on Ser 23 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; and/or (vii) N-glycosylated on Ser 31 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra.
  • the IL-15/IL-15Ra complex is purified or isolated.
  • glycosylated forms of IL-15Ra wherein the IL-15Ra is glycosylated (N- or O-glycosylated) at certain amino acid residues.
  • a human IL-15Ra which is glycosylated at one, two, three, four, five, six, seven, or all, of the following glycosylation sites: (i) O-glycosylation on Thr5 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; (ii) O-glycosylation on Ser7 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; (iii) N-glycosylation on Ser 8 of amino acid sequence
  • ITCPPPMSVEHADIWVK (SEQ ID NO: 43) in the IL-15Ra, or Ser 8 of amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (iv) N-glycosylation on Ser 18 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (v) N- glycosylation on Ser 20 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (vi) N- glycosylation on Ser 23 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; and/or (vii) N-glycosylated on Ser 31 of amino acid sequence
  • the glycosylated IL-15Ra is a native human IL-15Ra.
  • the glycosylated IL-15Ra is an IL-15Ra derivative of naturally occurring human IL-15Ra.
  • the glycosylated IL-15Ra is a native soluble human IL-15Ra, such as SEQ ID NO: 32 or 33.
  • the glycosylated IL-15Ra is an IL-15Ra derivative that is a soluble form of human IL-15Ra.
  • the glycosylated IL-15Ra has the amino acid sequence of SEQ ID NO: 4, 34, 35, 36, 37, 38, 39, 40, 41, or 45.
  • the glycosylated IL- 15Ra has an amino acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 3, 4, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, or 45.
  • the glycosylated IL-15Ra is purified or isolated.
  • composition comprising IL-15 and human IL-15Ra, wherein the human IL-15Ra is glycosylated at one, two, three, four, five, six, seven, or all, of the following glycosylation sites: (i) O-glycosylation on Thr5 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15R ⁇ x; (ii) O- glycosylation on Ser7 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; (iii) N-glycosylation on Ser 8 of amino acid sequence ITCPPPMSVEHADIWVK (SEQ ID NO: 43) in the IL-15Ra, or Ser 8 of amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (iv) N-glycosy
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (v) N- glycosylation on Ser 20 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (vi) N- glycosylation on Ser 23 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; and/or (vii) N-glycosylated on Ser 31 of amino acid sequence
  • the glycosylated IL-15Ra is a native human IL-15Ra.
  • the glycosylated IL-15Ra is an IL-15Ra derivative of naturally occurring human IL-15Ra.
  • the glycosylated IL-15Ra is a native soluble human IL-15Ra, such as SEQ ID NO: 32 or 33.
  • the glycosylated IL-15Ra is an IL-15Ra derivative that is a soluble form of human IL-15Ra.
  • the glycosylated IL-15Ra has the amino acid sequence of SEQ ID NO: 4, 34, 35, 36, 37, 38, 39, 40, 41, or 45.
  • the glycosylated IL- 15Ra has an amino acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 3, 4, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, or 45.
  • the glycosylated IL-15Ra is purified or isolated.
  • an IL-15/IL-15Ra complex comprising human IL-15Ra which is glycosylated at one, two, three, four, five, six, seven, or all, of the following glycosylation sites: (i) O-glycosylation on Thr5 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (iv) N- glycosylation on Ser 18 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (v) N- glycosylation on Ser 20 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (vi) N- glycosylation on Ser 23 of amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; and/or (vii) N-glycosylated on Ser 31 of amino acid sequence
  • the glycosylated IL-15Ra is a native human IL-15Ra.
  • the glycosylated IL-15Ra is an IL-15Ra derivative of naturally occurring human IL-15Ra.
  • the glycosylated IL-15Ra is a native soluble human IL-15Ra, such as SEQ ID NO: 32 or 33.
  • the glycosylated IL-15Ra is an IL-15Ra derivative that is a soluble form of human IL-15Ra.
  • the glycosylated IL-15Ra has the amino acid sequence of SEQ ID NO: 4, 34, 35, 36, 37, 38, 39, 40, 41 , or 45.
  • the glycosylated IL- 15Ra has an amino acid sequence that is at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% identical to SEQ ID NO: 3, 4, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , or 45.
  • the IL-15/IL-15Ra complex is purified or isolated.
  • a glycosylated form of IL- 15Ra e.g. , human IL-15Ra
  • the glycosylation accounts for at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, or 20% to 25%, 20% to 30%, 25% to 30%, 25% to 35%, 30% to 35%, 30% to 40%, 35% to 40%, 35% to 45%, 40% to 50%, 45% to 50%, 20% to 40%, or 25% to 50% of the mass (molecular weight) of the IL- 15Ra, and which is glycosylated on at least one, at least two, at least three, at least four, at least five, at least six, or at least seven of the following sites: (i) Thr5 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra (e.g., O-glycosylated); (ii) Ser7 of amino acid sequence NWELTASASHQPPGVYPQ
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra (e.g., N- glycosylated); (vi) Ser 23 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra (e.g., N- glycosylated); (vii) Ser 31 of amino acid sequence
  • the glycosylated human IL-15Ra comprises amino acid sequence of SEQ ID NO: 3, 4, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 or 45.
  • the glycosylated human IL-15Ra is: (i)soluble; and (ii) (a) the last amino acids at the C-terminal end of the soluble form of human IL-15Ra consist of amino acid residues PQGHSDTT (SEQ ID NO: 26), wherein T is at the C-terminal end of the amino acid sequence; (b) the last amino acids at the C-terminal end of the soluble form of human IL-15Ra consist of amino acid residues PQGHSDT (SEQ ID NO: 27), wherein T is at the C- terminal end of the amino acid sequence; (c) the last amino acids at the C-terminal end of the soluble form of human IL-15Ra consist of amino acid residues PQGHSD (SEQ ID NO: 28), wherein D is at the C-terminal end of the amino acid sequence; (d) the last amino acids at the C-terminal end of the soluble form of IL-15Ra consist of amino acid residues PQGHS (SEQ ID NO: 29),
  • complexes that bind to the ⁇ subunits of the IL-15 receptor, induce IL-15 signal transduction (e.g., Jak/Stat signal transduction) and enhance IL-15- mediated immune function, wherein the complexes comprise IL-15 covalently or
  • IL-15Ra interleukin-15 receptor alpha
  • IL-15/IL-15Ra complexes or "Therapeutic Agents”
  • the IL-15/IL-15Ra complex is able to bind to the ⁇ receptor complex.
  • the IL-15/IL-15Ra complexes may be composed of native IL-15 or an IL-15 derivative and native IL-15Ra or an IL-15Ra derivative.
  • an IL- 15/IL-15Ra complex comprises native IL-15 or an IL-15 derivative and an IL-15Ra described in Section 5.1, supra.
  • an IL-15/IL-15Ra complex comprises native IL-15 or an IL-15 derivative and IL-15Ra with the amino acid sequence of SEQ ID NO: 33, 35, 37, 39, 41 or 45.
  • an IL-15/IL-15Ra complex comprises native IL-15 or an IL-15 derivative and a glycosylated form of IL-15Ra described in Section 5.1, supra.
  • an IL-15/IL-15Ra complex comprises native IL-15 or an IL-15Ra derivative and native soluble IL-15Ra (e.g., native soluble human IL-15Ra).
  • an IL-15/IL-15Ra complex comprises native IL-15 and native soluble IL-15Ra.
  • an IL-15/IL-15Ra complex is composed of an IL-15 derivative and an IL-15Ra derivative.
  • an IL-15/IL-15Ra complex is composed of native IL-15 and an IL-15Ra derivative.
  • the IL- 15Ra derivative is a soluble form of IL-15Ra.
  • soluble forms of IL- 15Ra are described in Section 5.1, supra.
  • the soluble form of IL- 15Ra lacks the transmembrane domain of native IL-15Ra, and optionally, the intracellular domain of native IL-15Ra.
  • the IL-15Ra derivative is the
  • the IL-15Ra derivative is a fragment of the extracellular domain comprising the sushi domain or exon 2 of native IL-15Ra. In some embodiments, the IL-15Ra derivative comprises a fragment of the extracellular domain comprising the sushi domain or exon 2 of native IL- 15Ra and at least one amino acid that is encoded by exon 3. In certain embodiments, the IL- 15Ra derivative comprises a fragment of the extracellular domain comprising the sushi domain or exon 2 of native IL-15Ra and an IL-15Ra hinge region or a fragment thereof. In certain embodiments, the IL-15Ra comprises the amino acid sequence of SEQ ID NO: 19 or 20. In some embodiments, the IL-15Ra comprises the amino acid sequence of SEQ ID NO: 33, 35, 37, 39, 41 or 45. In certain embodiments, the IL-15Ra is the native soluble human IL-15Ra.
  • the IL-15Ra derivative comprises a mutation in the extracellular domain cleavage site that inhibits cleavage by an endogenous protease that cleaves native IL-15Ra.
  • an endogenous protease that cleaves native IL-15Ra.
  • the extracellular cleavage site of native IL-15Ra has been identified.
  • the extracellular domain cleavage site of IL-15Ra is replaced with a cleavage site that is recognized and cleaved by a heterologous known protease.
  • Non-limiting examples of such heterologous protease cleavage sites include Arg-X-X-Arg (SEQ ID NO: 7), which is recognized and cleaved by furin protease; and A-B-Pro-Arg-X-Y (SEQ ID NO: 8) (A and B are hydrophobic amino acids and X and Y are nonacidic amino acids) and Gly-Arg-Gly, which are recognized and cleaved by thrombin protease.
  • the IL-15Ra is encoded by a nucleic acid sequence optimized to enhance expression of IL-15Ra, e.g., using methods as described in U.S.
  • the IL-15 is encoded by a nucleic acid sequence optimized to enhance expression of IL-15, e.g., using methods as described in U.S. Provisional Application Nos. 60/812,566, filed on June 9, 2006 and 60/758,819, filed on January 13, 2006, and International Patent Application Publication Nos.
  • the IL-15/IL-15Ra complexes may comprise a heterologous molecule.
  • the heterologous molecule is an antigen associated with a disease that one intends to prevent, treat and/or manage ⁇ e.g., a viral antigen, bacterial antigen, parasitic antigen, or cancer antigen).
  • Non- limiting examples of such antigens include antigens of the flavivirus, West Nile Virus (WNV) including structural proteins, e.g., C, M, and E, and non-structural proteins, e.g., NSl, NS2A, NS2B, NS3, NS4A, NS4B and NS5; human immunodeficiency virus (HIV) antigens gp41, gpl20, gpl60, Nef, Gag, and Rev, Tat, Vif, Vpu, Vpr, or vpx; influenza virus hemagglutinin; human respiratory syncytial virus G glycoprotein; core protein, matrix protein or other protein of Dengue virus; measles virus hemagglutinin; herpes simplex virus type 2 glycoprotein gB; poliovirus I VP1 (Emini et ah, 1983, Nature 304:699); an envelope glycoprotein of HIV I; hepatitis B surface antigen
  • infectious bovine rhinotracheitis virus glycoprotein E or glycoprotein G infectious bovine rhinotracheitis virus glycoprotein E or glycoprotein G
  • antigens of infectious laryngotracheitis virus ⁇ e.g. , infectious laryngotracheitis virus glycoprotein G or glycoprotein I a glycoprotein of La Crosse virus
  • antigens of neonatal calf diarrhea virus Venezuelan equine encephalomyelitis virus; punta toro virus
  • murine leukemia virus mouse mammary tumor virus
  • hepatitis B virus core protein and/or hepatitis B virus surface antigen or a fragment or derivative thereof see, e.g., U.K. Patent Publication No. GB 2034323 A published June 4, 1980; Ganem and Varmus, 1987, Ann. Rev. Biochem.
  • antigen of equine influenza virus or equine herpesvirus ⁇ e.g., equine influenza virus type AJ Alaska 91 neuraminidase, equine influenza virus type A/Miami 63 neuraminidase; equine influenza virus type A/Kentucky 81 neuraminidase; equine herpes virus type 1 glycoprotein B; equine herpes virus type 1 glycoprotein D);
  • bovine respiratory syncytial virus or bovine parainfluenza virus ⁇ e.g., bovine respiratory syncytial virus attachment protein (BRSV G); bovine respiratory syncytial virus fusion protein (BRSV F); bovine respiratory syncytial virus nucleocapsid protein (BRSV N); bovine parainfluenza virus type 3 fusion protein; the bovine parainfluenza virus type 3 hemagglutinin neuraminidase); bovine viral diarrhea virus glycoprotein 48 or glycoprotein 53.
  • BRSV G bovine respiratory syncytial virus attachment protein
  • BRSV F bovine respiratory syncytial virus fusion protein
  • BRSV N bovine respiratory syncytial virus nucleocapsid protein
  • bovine parainfluenza virus type 3 fusion protein the bovine parainfluenza virus type 3 hemagglutinin neuraminidase
  • bovine viral diarrhea virus glycoprotein 48 or glycoprotein 53 e.g., bovine respiratory
  • antigens include KS 1/4 pan-carcinoma antigen, ovarian carcinoma antigen (CA125), prostatic acid phosphate, prostate specific antigen, melanoma-associated antigen p97, melanoma antigen gp75, high molecular weight melanoma antigen (HMW-MAA), prostate specific membrane antigen, carcinoembryonic antigen (CEA), polymorphic epithelial mucin antigen, human milk fat globule antigen, Colorectal tumor-associated antigens such as: CEA, TAG-72, C017-1A; GICA 19-9, CTA-1 and LEA, Burkitt's lymphoma antigen-38.13, CD19, human B-lymphoma antigen-CD20, CD33, melanoma specific antigens such as ganglioside GD2, ganglioside GD3, ganglioside GM2, ganglioside GM3, tumor-specific transplantation
  • neoglycoprotein neoglycoprotein, sphingolipids, breast cancer antigen such as EGFR (Epidermal growth factor receptor), HER2 antigen (pl85HER2), EphA2 receptor, polymorphic epithelial mucin (PEM), malignant human lymphocyte antigen-APO-1, differentiation antigen such as I antigen found in fetal erthrocytes and primary endoderm, I(Ma) found in gastric cancer antigen such as EGFR (Epidermal growth factor receptor), HER2 antigen (pl85HER2), EphA2 receptor, polymorphic epithelial mucin (PEM), malignant human lymphocyte antigen-APO-1, differentiation antigen such as I antigen found in fetal erthrocytes and primary endoderm, I(Ma) found in gastric cancer antigen such as EGFR (Epidermal growth factor receptor), HER2 antigen (pl85HER2), EphA2 receptor, polymorphic epi
  • adenocarcinomas M18 and M39 found in breast epithelium, SSEA-1 found in myeloid cells, VEP8, VEP9, Myl, VIM-D5, and D156-22 found in colorectal cancer, TRA-1-85 (blood group H), C14 found in colonic adenocarcinoma, F3 found in lung adenocarcinoma, AH6 found in gastric cancer, Y hapten, Ley found in embryonal carcinoma cells, TL5 (blood group A), EGF receptor, El series (blood group B) found in pancreatic cancer, FC10.2 found in embryonal carcinoma cells, gastric adenocarcinoma, CO-514 (blood group Lea) found in adenocarcinoma, NS-10 found in adenocarcinomas, CO-43 (blood group Leb), G49, 19.9 found in colon cancer, gastric cancer mucins, T5A7 found in myeloid cells, R24 found in melanoma, 4.2,
  • the heterologous molecule is an antibody that specifically binds to an antigen associated with a disease that one intends to prevent, treat and/or manage (e.g. , an antibody that specifically binds to a viral antigen, bacterial antigen, parasitic antigen, or cancer antigen).
  • Non-limiting examples of such antibodies include anti-CD34 antibody, anti-CD56 antibody, anti-CD 8 antibody, anti-CD22 antibody, anti-CD20 antibody, anti-CD 19 antibody, anti-CD3 antibody, anti-EGFR antibody, anti-HER2 antibody, anti-CD34 antibody, anti-ckit antibody, anti-flt3 antibody, anti-hemagglutinin antibody, anti-gp41 antibody, anti- gpl20 antibody, and anti-HSV-II glycoprotein gB antibody.
  • the antibody immunospecifically binds to one of the antigens listed above.
  • the antibody specifically binds to a cellular antigen (e.g., a receptor or cell surface antigen) expressed by a cell that one desires to target.
  • a cellular antigen e.g., a receptor or cell surface antigen
  • the IL-15/IL- 15Ra complex can be targeted to CD34+ progenitor cells with an anti-CD34 antibody to induce development of such cells into CD56 + NK cells.
  • the IL-15/IL-15Ra complex can be targeted to CD56+ NK cells with an anti-CD56 antibody to induce proliferation of such cells.
  • the heterologous molecule increases protein stability.
  • Non-limiting examples of such molecules include polyethylene glycol (PEG), Fc domain of an IgG immunoglobulin or a fragment thereof, or albumin that increase the half-life of IL-15 or IL-15Ra in vivo.
  • IL-15Ra is conjugated/fused to the Fc domain of an immunoglobulin (e.g., an IgGl) or a fragment thereof.
  • the IL-15RaFc fusion protein comprises the amino acid sequence of SEQ ID NO: 21 or 22.
  • the IL-15RaFc fusion protein is the IL-15Ra/Fc fusion protein described in Han et al, 20011, Cytokine 56: 804-810, U.S. Patent No. 8,507,222 or U.S. Patent No. 8,124,084.
  • the heterologous molecules is not an Fc domain of an immunoglobulin molecule or a fragment thereof.
  • the heterologous molecule may be conjugated to IL-15 and/or IL-15Ra.
  • the heterologous molecule is conjugated to IL-15Ra.
  • the heterologous molecule is conjugated to IL-15.
  • IL-15/IL-15Ra complex may be directly fused, using either non-covalent bonds or covalent bonds (e.g., by combining amino acid sequences via peptide bonds), and/or may be combined using one or more linkers.
  • IL-15 and IL-15Ra are directly fused to each other using either non-covalent bonds or covalent bonds (e.g. , by combining amino acid sequences via peptide bonds), and/or may be combined using one or more linkers.
  • a polypeptide comprising IL-15 and IL- 15Ra directly fused to each other using either non-covalent bonds or covalent bonds is functional (e.g., capable of specifically binding to the IL-15R ⁇ complex and inducing IL- 15-mediated signal transduction and/or IL-15 -mediated immune function).
  • Linkers suitable for preparing the IL-15/IL-15Ra complexes comprise peptides, alkyl groups, chemically substituted alkyl groups, polymers, or any other covalently-bonded or non-covalently bonded chemical substance capable of binding together two or more components.
  • Polymer linkers comprise any polymers known in the art, including polyethylene glycol ("PEG").
  • the linker is a peptide that is 1 , 2, 3, 4, 5,6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids long. In a specific embodiment, the linker is long enough to preserve the ability of IL-15 to bind to the IL-15Ra. In other embodiments, the linker is long enough to preserve the ability of the IL-15/IL-15Ra complex to bind to the ⁇ receptor complex and to act as an agonist to mediate IL-15 signal transduction. In a specific embodiment, the IL-15/IL-15Ra complex is a fusion protein, such as RLI and ILR, disclosed in U.S. Patent Application Publication No. 2009/0238791 and Mortier et al, 2006, J. Biol. Chem. 281(3): 1612-9.
  • IL-15/IL-15Ra complexes are pre-coupled prior to use in the methods described herein (e.g. , prior to contacting cells with the IL-15/IL-15Ra complexes or prior to administering the IL-15/IL-15Ra complexes to a subject). In other embodiments, the IL-15/IL-15Ra complexes are not pre-coupled prior to use in the methods described herein.
  • the IL-15/IL-15Ra complex is administered in combination with a vaccine composition to enhance the immune response elicited by the administration of the vaccine composition to a subject. In a specific embodiment, a
  • Therapeutic Agent comprising IL-15 and IL-15Ra directly fused to each other is
  • a vaccine composition administered in combination with a vaccine composition to enhance an immune response elicited by administration of the vaccine composition to a subject.
  • a Therapeutic Agent enhances or induces immune function in a subject by at least 99%, at least 95%>, at least 90%>, at least 85%>, at least 80%>, at least 75%, at least 70%, at least 60%, at least 50%, at least 45%, at least 40%, at least 45%, at least 35%, at least 30%, at least 25%, at least 20%, or at least 10% relative to the immune function in a subject not administered the Therapeutic Agent using assays well known in the art, e.g., ELISPOT, ELISA, and cell proliferation assays.
  • the immune function is cytokine release (e.g., interferon-gamma, IL-2, IL-5, IL-10, IL-12, or transforming growth factor (TGF)-beta).
  • the IL-15 mediated immune function is NK cell proliferation, which can be assayed, e.g., by flow cytometry to detect the number of cells expressing markers of NK cells (e.g., CD56).
  • the IL-15 mediated immune function is antibody production, which can be assayed, e.g., by ELISA.
  • the IL-15 mediated immune function is effector function, which can be assayed, e.g. , by a cytotoxicity assay or other assays well known in the art.
  • Therapeutic Agent include the proliferation/expansion of lymphocytes (e.g., increase in the number of lymphocytes), inhibition of apoptosis of lymphocytes, activation of dendritic cells (or antigen presenting cells), and antigen presentation.
  • an immune function enhanced by the Therapeutic Agent is proliferation/expansion in the number of or activation of CD4 + T cells (e.g., Thl and Th2 helper T cells), CD8 + T cells (e.g., cytotoxic T lymphocytes, alpha/beta T cells, and gamma/delta T cells), B cells (e.g., plasma cells), memory T cells, memory B cells, dendritic cells (immature or mature), antigen presenting cells, macrophages, mast cells, natural killer T cells (NKT cells), tumor-resident T cells, CD122 + T cells, or natural killer cells (NK cells).
  • CD4 + T cells e.g., Thl and Th2 helper T cells
  • CD8 + T cells e.g
  • the Therapeutic Agent enhances the proliferation/expansion or number of lymphocyte progenitors.
  • a Therapeutic Agent increases the number of CD4 + T cells (e.g., Thl and Th2 helper T cells), CD8 + T cells (e.g., cytotoxic T lymphocytes, alpha/beta T cells, and gamma/delta T cells), B cells (e.g., plasma cells), memory T cells, memory B cells, dendritic cells (immature or mature), antigen presenting cells, macrophages, mast cells, natural killer T cells (NKT cells), tumor-resident T cells, CD122 + T cells, or natural killer cells (NK cells) by approximately 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 20 fold, or more relative a negative control (e.g., number of the respective cells not treated, cultured, or contacted with a Therapeutic Agent).
  • CD4 + T cells e.g., Thl and Th2 helper
  • nucleic acids that encode IL-15 and IL-15Ra.
  • the nucleic acids encode IL-15 and IL-15Ra that are capable of covalently or noncovalently binding to each other to form the IL-15/IL-15Ra complexes described in Section 5.2, supra.
  • Such IL- 15/IL-15Ra complexes can bind to the ⁇ receptor complex, and induce IL- 15 -mediated signal transduction.
  • nucleic acid sequences encoding native IL-15 are well known in the art and have been described, for a review, see, Fehniger and Caligiuri, Blood, 2001, 97: 14-32, which is incorporated by reference herein in its entirety.
  • the nucleic acid sequences encoding native IL-15 can be readily found in publicly available publications and databases, e.g., National Center for Biotechnology Information website at ncbi.nlm.nih.gov.
  • Nucleic acid sequences encoding native IL-15Ra have been described, e.g., see International
  • nucleic acids that encode the IL-15 and IL-15Ra polypeptides described herein are nucleic acids that encode the IL-15 and IL-15Ra polypeptides described herein.
  • nucleic acids that encode an IL-15Ra polypeptide described in Section 5.1 or 5.2, supra are nucleic acids that encode an IL-15Ra polypeptide comprising the amino acid sequence of SEQ ID NO:3, 4, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 or 45.
  • nucleic acid sequence that encodes an IL- 15Ra polypeptide, wherein the nucleic acid sequence comprises SEQ ID NO: 5 or 6.
  • nucleic acid sequence that encodes an IL-15 polypeptide comprising the amino acid sequence of SEQ ID NO: 1 or amino acid residues 49 to 162 of SEQ ID NO: 1.
  • nucleic acid sequence comprises SEQ ID NO:2.
  • nucleic acids that encode IL-15 and/or IL- 15Ra that are optimized e.g., by codon/RNA optimization, replacement with heterologous signal sequences, and elimination of mRNA instability elements.
  • Methods to generate optimized nucleic acids encoding IL-15 and IL-15Ra for expression by introducing codon changes and/or eliminating inhibitory regions in the mRNA can be carried out by adapting the optimization methods described in, e.g., U.S. Patent Nos. 5,965,726; 6,174,666; 6,291,664; 6,414,132; and 6,794,498, for IL-15 and IL-15Ra. The contents of each of these references are incorporated by reference herein in its entirety.
  • splice sites and instability elements within the RNA of IL-15 and IL-15Ra can be mutated without altering the amino acids encoded by the nucleic acid sequences to increase stability of the RNA for expression.
  • the alterations utilize the degeneracy of the genetic code, e.g., using an alternative codon for an identical amino acid.
  • a conservative mutation e.g. , a similar amino acid with similar chemical structure and properties and/or function as the original amino acid.
  • Such methods can increase expression of IL-15 and/or IL-15Ra proteins by at least 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 10 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, or 100 fold or more relative to the expression of IL-15 and/or IL-15Ra proteins encoded by native nucleic acid sequences.
  • the native signal peptide sequence of IL-15 and/or IL-15Ra can be replaced with a heterologous signal peptide, e.g., a signal peptide of human GM-CSF, tissue plasminogen activator (tPA), preprolactin, growth hormone or an immunoglobulin protein (e.g., IgE).
  • a heterologous signal peptide e.g., a signal peptide of human GM-CSF, tissue plasminogen activator (tPA), preprolactin, growth hormone or an immunoglobulin protein (e.g., IgE).
  • the signal peptide of IL-15 is replaced with the signal sequence of tPA.
  • the signal peptide of IL-15 is replaced with the signal peptide of human GM-CSF.
  • Such alternations can increase expression of IL-15 and/or IL-15Ra proteins/polypeptides by at least 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 10 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, or 100 fold or more relative to the expression of IL-15 and/or IL-15Ra proteins with the respective native signal peptide, as measured/detected by a technique known to one of skill in the art, e.g., ELISA.
  • an optimized nucleotide sequence encoding IL-15 or IL- 15Ra hybridizes to the nucleotide sequence encoding native IL-15 or IL-15Ra, respectively.
  • an optimized nucleotide sequence encoding IL-15 or IL-15Ra hybridizes under high stringency conditions to a nucleotide sequence encoding native IL-15 or IL-15Ra, respectively, or a fragment thereof.
  • an optimized nucleotide sequence encoding IL-15 or IL-15Ra hybridizes under high stringency, intermediate or lower stringency hybridization conditions to a nucleotide sequence encoding native IL-15 or IL-15Ra, respectively, or a fragment thereof.
  • Information regarding hybridization conditions have been described, see, e.g., U.S. Patent Application Publication No. US 2005/0048549 (e.g., paragraphs 72-73).
  • nucleic acids encoding IL-15, IL-15Ra, and a heterologous molecule in a form that allows IL-15 to covalently or noncovalently bind to the IL-15Ra to form IL-15/IL-15Ra complexes.
  • the heterologous molecule is an antigen associated with a disease that one intends to prevent, treat and/or manage. Non-limiting examples of such antigens include those listed above in Section 5.2.
  • the heterologous molecule is an antibody that specifically binds to an antigen associated with a disease that one intends to prevent, treat and/or manage. Non- limiting examples of such antibodies include those listed above in Section 5.2 and those known in the art.
  • the antibody specifically binds to a cellular surface antigen (e.g. , a receptor) expressed by a cell that one desires to target.
  • a cellular surface antigen e.g. , a receptor
  • the heterologous molecule increases protein stability.
  • Non-limiting examples of such molecules include polyethylene glycol (PEG), Fc domain of an IgG immunoglobulin or a fragment thereof, or albumin that increase the half-life of IL-15 or IL-15Ra in vivo.
  • the heterologous molecules is not an Fc domain of an immunoglobulin molecule or a fragment thereof.
  • the heterologous molecule may be conjugated to IL-15 and/or IL-15Ra.
  • the heterologous molecule is conjugated to IL-15Ra.
  • the heterologous molecule is conjugated to IL-15.
  • IL-15 and IL-15Ra are encoded by one nucleic acid construct (e.g., bicistronic construct). In some embodiments, IL-15 and IL-15Ra are encoded by one nucleic acid construct comprising a single open reading frame (ORF) of IL-15 and IL- 15Ra. In some embodiments, IL-15 or IL-15Ra encoded by a nucleic acid construct may be conjugated to a nucleic acid encoding a heterologous molecule, such as an antigen or an antibody of interest.
  • a nucleic acid construct e.g., bicistronic construct
  • IL-15 and IL-15Ra are encoded by one nucleic acid construct comprising a single open reading frame (ORF) of IL-15 and IL- 15Ra.
  • ORF open reading frame
  • IL-15 or IL-15Ra encoded by a nucleic acid construct may be conjugated to a nucleic acid encoding a heterologous molecule, such
  • IL-15 and IL-15Ra are encoded by two nucleic acid constructs, wherein a first nucleic acid construct encodes IL-15 and a second nucleic acid construct encodes IL-15Ra.
  • the IL-15 encoded by the first nucleic acid construct may be conjugated to a nucleic acid encoding a heterologous molecule, such as an antigen or an antibody of interest.
  • the IL-15Ra encoded by the second nucleic acid construct may be conjugated to a nucleic acid encoding a heterologous molecule, such as an antigen or an antibody of interest. 5.3.2 Constructs & Cells
  • the nucleic acids encoding IL-15 and/or IL-15Ra can be inserted into nucleic acid constructs for expression in mammalian cells, bacteria, yeast, and viruses.
  • IL-15 and IL- 15Ra can be recombinantly expressed from the same nucleic acid construct (e.g., using a bicistronic nucleic acid construct) or from different nucleic acid constructs (e.g. , using monocistronic nucleic acid constructs).
  • IL-15 and IL-15Ra can be recombinantly expressed from a single nucleic acid construct comprising a single open reading frame (ORF) of IL-15 and IL-15Ra.
  • a construct described herein comprises nucleic acid sequences encoding IL-15 and IL-15Ra.
  • a construct described herein comprises nucleic acid sequences encoding IL-15Ra.
  • the nucleic acid constructs may comprise one or more transcriptional regulatory element(s) operably linked to the coding sequence of IL-15 and/or IL-15Ra.
  • transcriptional regulatory elements are typically 5' to the coding sequence and direct the transcription of the nucleic acids encoding IL-15 and/or IL-15Ra.
  • one or more of the transcriptional regulatory elements that are found in nature to regulate the transcription of the native IL-15 and/or native IL-15Ra gene are used to control transcription.
  • one or more transcriptional regulatory elements that are heterologous to the native IL-15 and/or native IL-15Ra gene are used to control transcription. Any transcriptional regulatory element(s) known to one of skill in the art may be used.
  • Non- limiting examples of the types of transcriptional regulatory element(s) include a constitutive promoter, a tissue-specific promoter, and an inducible promoter.
  • transcription is controlled, at least in part, by a mammalian (in some embodiments, human) transcriptional regulatory element(s). In a specific embodiment, transcription is controlled, at least in part, by a strong promoter, e.g., CMV.
  • promoters which may be used to control transcription include, but are not limited to, the SV40 early promoter region (Bernoist & Chambon, 1981, Nature 290:304-310), the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto et al, 1980, Cell 22:787-797), the herpes thymidine kinase promoter (Wagner et al, 1981, Proc. Natl. Acad. Sci. U.S.A.
  • telomeres the regulatory sequences of the metallothionein gene (Brinster et al, 1982, Nature 296:39-42); adenovirus (ADV), cytomegalovirus (CMV), bovine papilloma virus (BPV), parovirus B19p6 promoter, prokaryotic expression vectors such as the .beta. -lactamase promoter (Villa-Kamaroff et al, 1978, Proc. Natl. Acad. Sci. U.S.A. 75:3727-3731), or the tac promoter (DeBoer et al, 1983, Proc. Natl. Acad. Sci. U.S.A.
  • promoter of the photosynthetic enzyme ribulose biphosphate carboxylase (Herrera-Estrella et al., 1984, Nature 310: 115-120); promoter elements from yeast or other fungi such as the Gal 4 promoter, the ADC (alcohol dehydrogenase) promoter, PGK
  • elastase I gene control region which is active in pancreatic acinar cells (Swift et al, 1984, Cell 38:639-646; Ornitz et al, 1986, Cold Spring Harbor Symp. Quant. Biol. 50:399-409; MacDonald, 1987, Hepatology 7:425-515); insulin gene control region which is active in pancreatic beta cells (Hanahan, 1985, Nature 315: 115-122),
  • immunoglobulin gene control region which is active in lymphoid cells (Grosschedl et al, 1984, Cell 38:647-658; Adames et al, 1985, Nature 318:533-538; Alexander et al, 1987, Mol. Cell. Biol. 7: 1436-1444), mouse mammary tumor virus control region which is active in testicular, breast, lymphoid and mast cells (Leder et al, 1986, Cell 45:485-495), albumin gene control region which is active in liver (Pinkert et al, 1987, Genes and Devel. 1 :268- 276), alpha- fetoprotein gene control region which is active in liver (Krumlauf et al, 1985, Mol. Cell. Biol.
  • the nucleic acid constructs also may comprise one or more post-transcriptional regulatory element(s) operably linked to the coding sequence of IL-15 and/or IL-15Ra.
  • the post-transcriptional regulatory elements can be 5' and/or 3' to the coding sequence and direct the post-transcriptional regulation of the translation of RNA transcripts encoding IL-15 and/or IL-15Ra.
  • the nucleic acid construct can be a gene targeting vector that replaces a gene's existing regulatory region with a regulatory sequence isolated from a different gene or a novel regulatory sequence as described, e.g., in International Publication Nos.
  • a host cell can be engineered to increase production of endogenous IL-15 and/or IL-15Ra by, e.g., altering the regulatory region of the endogenous IL-15 and/or IL-15Ra genes.
  • the nucleic acid construct chosen will depend upon a variety of factors, including, without limitation, the strength of the transcriptional regulatory elements and the host cell to be used to express IL-15 and/or IL-15Ra.
  • the nucleic acid constructs can be a plasmid, phagemid, cosmid, viral vector, phage, artificial chromosome, and the like.
  • the vectors can be episomal or non-homologously integrating vectors, which can be introduced into the appropriate host cells by any suitable means (transformation, transfection, conjugation, protoplast fusion, electroporation, calcium phosphate-precipitation, direct microinjection, etc.) to transform them.
  • the nucleic acid constructs can be a plasmid or a stable integration vector for transient or stable expression of IL-15 and/or IL-15Ra in host cells.
  • the vector can mediate chromosomal integration at a target site or a random chromosomal site.
  • Non- limiting examples of host cell-vector systems that may be used to express IL-15 and/or IL-15Ra include mammalian cell systems infected with virus ⁇ e.g., vaccinia virus, adenovirus, retroviruses, lentiviruses, etc.); insect cell systems infected with virus ⁇ e.g., baculovirus); microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage, DNA, plasmid DNA, or cosmid DNA; and stable cell lines generated by transformation using a selectable marker.
  • the nucleic acid constructs include a selectable marker gene including, but not limited to, neo, gpt, dhfr, ada, pac, hyg, CAD and hisD.
  • the nucleic acid constructs can be monocistronic or multicistronic.
  • multicistronic nucleic acid construct may encode 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, or in the range of 2-5, 5-10 or 10-20 genes/nucleotide sequences.
  • a bicistronic nucleic acid construct may comprise in the following order a promoter, a first gene ⁇ e.g., IL-15), and a second gene and ⁇ e.g., IL-15Ra).
  • the transcription of both genes is driven by the promoter, whereas the translation of the mRNA from the first gene is by a cap-dependent scanning mechanism and the translation of the mRNA from the second gene is by a cap-independent mechanism, e.g., by an IRES.
  • the nucleic acid construct(s) comprising nucleic acids encoding IL-15 and/or IL- 15Ra can be administered in vivo to a mammal or transfected into primary or immortalized cells in culture. Such a nucleic acid construct(s) can be used to enhance IL-15 -mediated function and/or to prevent, treat and/or manage a disease in which enhancement of IL-15- mediated function is beneficial, such as the diseases described in Sections 5.6 to 5.8, infra.
  • the nucleic acid constructs comprising nucleic acids encoding IL-15 and/or IL-15Ra can be used to generate cells that express IL-15 and/or IL-15Ra.
  • the cells are primary cells ⁇ e.g., tumor cells isolated from a patient). In other embodiments, the cells are mammalian cell lines.
  • the host cells chosen for expression of nucleic acids will depend upon the intended use of the cells. Factors such as whether a cell glycosylates similar to cells that endogenously express, e.g., IL-15 and/or IL-15Ra, may be considered in selecting the host cells.
  • Factors such as whether a cell glycosylates similar to cells that endogenously express, e.g., IL-15 and/or IL-15Ra, may be considered in selecting the host cells.
  • Non-limiting examples of hosts cells that can be used to express the protein(s) encoded by the nucleic acid constructs herein include mammalian cells, bacterial cells, yeast cells, primary cells, immortalized cells, plant cells and insect cells.
  • the host cells are a mammalian cell line.
  • mammalian cell lines include, but are not limited to, COS, CHO, HeLa, NIH3T3, HepG2, MCF7, HEK 293, HEK 293T, RD, PC12, hybridomas, pre-B cells, 293, 293H, K562, SkBr3, BT474, A204, M07Sb, ⁇ , Raji, Jurkat, MOLT-4, CTLL-2, MC-IXC, SK-N-MC, SK-N-MC, SK-N-DZ, SH-SY5Y, C127, NO, and BE(2)-C cells.
  • the mammalian cell line used to express the protein(s) encoded by the nucleic acid constructs herein is HEK293 cell line.
  • Other mammalian cell lines available as hosts for expression are known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC).
  • the host cells are immortalized cell lines derived from a subject.
  • the host cells are primary or secondary cells from a subject.
  • the host cells are cancer cells.
  • the host cells are irradiated cells.
  • the host cells are irradiated mammalian cell lines or primary cells from a subject.
  • the host cells are epithelial cells or endothelial cells.
  • the host cells are fetal/embryonic cells. In some embodiments, the host cells are progenitor cells. In some embodiments, the host cells are lymphocytes (e.g., T cells and B cells). In another embodiment, the host cells are stem cells. In yet another embodiment, the host cells engineered to express the nucleic acid constructs described herein are from an adult.
  • isolated cells are utilized herein.
  • isolated cells are utilized herein.
  • the isolated cells are at least 80%, 90%>, 95% or 98%> free of a different cell type as measured by a technique known to one of skill in the art, such as flow cytometry.
  • a technique known to one of skill in the art such as flow cytometry.
  • at least 80%>, 90%>, 95% or 98%> of the isolated cells are of the same cell type.
  • nucleic acid constructs encoding IL-15 or IL-15Ra can be co-transfected or transfected into the same host cells or different host cells.
  • nucleic acid construct comprising nucleic acids encoding a selectable marker gene can also be transfected into the same cells to select for transfected cells. If the nucleic acid constructs comprising nucleic acids encoding IL-15 and IL-15Ra are transfected into different cells, IL-15 and IL-15Ra expressed by the different cells can be isolated and contacted with each other under conditions suitable to form IL-15/IL-15Ra complexes described in Section 5.2, supra.
  • transfect or transducer host cells with nucleic acids including, e.g., transformation, transfection, conjugation, protoplast fusion, electroporation, calcium phosphate-precipitation, direct microinjection, and infection with viruses, including but not limited to adenoviruses, lentiviruses, and retroviruses.
  • stable cell lines can be generated.
  • cell lines can be transformed using the nucleic acid constructs described herein which may contain a selectable marker gene on the same or on a separate nucleic acid construct.
  • the selectable marker gene can be introduced into the same cell by co-transfection. Following the introduction of the vector, cells are allowed to grow for 1-2 days in an enriched media before they are switched to selective media to allow growth and recovery of cells that successfully express the introduced nucleic acids. Resistant clones of stably transformed cells may be proliferated using tissue culture techniques well known in the art that are appropriate to the cell type.
  • the cell line has been adapted to grow in serum- free medium. In one embodiment, the cell line has been adapted to grow in serum- free medium in shaker flasks. In one embodiment, the cell line has been adapted to grow in stir or rotating flasks. In certain embodiments, the cell line is cultured in suspension. In particular embodiments, the cell line is not adherent or has been adapted to grow as nonadherent cells. In certain embodiments, the cell line has been adapted to grow in low calcium conditions. In some embodiments, the cell line is cultured or adapted to grow in low serum medium.
  • a particularly preferred method of high-yield production of a recombinant polypeptide of the present invention is through the use of dihydro folate reductase (DHFR) amplification in DHFR-deficient CHO cells, by the use of successively increasing levels of methotrexate as described in U.S. Patent No. 4,889,803, which is incorporated by reference herein in its entirety.
  • DHFR dihydro folate reductase
  • the polypeptide obtained from such cells may be in a glycosylated form.
  • a host cell recombinantly expressing IL-15 and IL- 15Ra is produced utilizing the techniques described herein.
  • a host cell is stably transfected with a first construct encoding IL-15 (e.g., native IL-15) and IL- 15Ra (e.g. , native IL-15Ra), and a second construct encoding IL-15Ra.
  • the host cell is the HEK293 cell
  • a host cell recombinantly expresses an IL-15Ra polypeptide that is glycosylated (N- or O-glycosylated) at certain amino acid residues.
  • a host cell recombinantly expresses an IL-15Ra polypeptide(e.g., a human IL- 15Ra polypeptide) that is glycosylated, wherein the glycosylation of the IL-15Ra polypeptide accounts for at least 20%, at least 25%, at least 30%>, at least 35%, at least 40%>, at least 45%, at least 50%, or 20% to 25%, 20% to 30%, 25% to 30%, 25% to 35%, 30% to 35%, 30% to 40%, 35% to 40%, 35% to 45%, 40% to 50%, 45% to 50%, 20% to 40%, or 25% to 50% of the mass (molecular weight) of the IL-15Ra polypeptide.
  • a host cell recombinantly expresses a human IL-15Ra polypeptide which is glycosylated at one, two, three, four, five, six, seven, or all, of the following glycosylation sites: (i) O-glycosylation on Thr5 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL- 15Ra; (ii) O-glycosylation on Ser7 of amino acid sequence NWELTASASHQPPGVYPQG (SEQ ID NO: 42) in the IL-15Ra; (iii) N-glycosylation on Ser 8 of amino acid sequence ITCPPPMSVEHADIWVK (SEQ ID NO: 43) in the IL-15Ra, or Ser 8 of amino acid sequence ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (iv) N-glycosylation on Ser 18 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (v) N- glycosylation on Ser 20 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; (vi) N- glycosylation on Ser 23 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra; and/or (vii) N-glycosylated on Ser 31 of amino acid sequence
  • ITCPPPMSVEHADIWVKSYSLYSRERYICNS (SEQ ID NO: 44) in the IL-15Ra.
  • cell lines are engineered to express both IL-15 and soluble IL-15Ra, and the purified stable heterodimer of the IL-15 and soluble IL-15Ra, which can be used in vitro or in vivo, e.g., can be administered to a human.
  • cell lines are engineered to express both native human IL-15 and native human IL-15Ra, and the stable heterodimer of native human IL-15 and native soluble human IL-15Ra which is formed can be purified, and this purified heterodimer can be used be administered to a human.
  • the stability of IL-15 is increased when produced from cell lines recombinantly expressing both IL-15 and IL-15Ra.
  • the host cell recombinant expresses IL-15 and the full length IL-15Ra. In another specific embodiment, the host cell recombinantly expresses IL- 15 and the soluble form of IL-15Ra. In another specific embodiment, the host cell recombinantly expresses IL-15 and a membrane-bound form of IL-15Ra which is not cleaved from the surface of the cell and remains cell associated. In some embodiments, the host cell recombinantly expressing IL-15 and/or IL-15Ra (full-length or soluble form) also
  • recombinantly expresses another polypeptide ⁇ e.g., a cytokine or fragment thereof).
  • a host cell recombinant expresses an IL-15Ra polypeptide described herein ⁇ see, e.g., Section 5.1 and/or Section 5.2, supra).
  • a host cell recombinant expresses an IL-15Ra polypeptide comprising the amino acid sequence of SEQ ID NO: 3, 4, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 or 45.
  • a host cell recombinant expresses a glycosylated IL-15Ra polypeptide described herein ⁇ see, e.g., Section 5.1, supra).
  • such a host cell recombinant expresses an IL-15 polypeptide in addition to an IL-15Ra polypeptide.
  • a host cell recombinantly expresses an IL-15Ra
  • a host cell recombinantly expresses an IL-15Ra polypeptide comprising the amino acid sequence of SEQ ID NO: 3, 4, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 or 45, and IL-15 (e.g., the IL-15 described in Section 3.1, supra).
  • a host cell recombinantly expresses a glycosylated IL-15Ra polypeptide described herein (see, e.g., Section 5.1, supra), and IL-15 (e.g., the IL-15 described in Section 3.1, supra).
  • a host cell recombinantly expresses an IL-15Ra
  • a host cell recombinantly expresses an IL-15Ra derivative comprising one, two, three, four, five, six, seven or eight mutations in the extracellular domain cleavage site of IL-15Ra such that cleavage of the IL-15Ra by an endogenous protease that cleaves native IL-15Ra is inhibited.
  • a host cell recombinantly expresses an IL-15Ra derivative in which the amino acid sequence PQGHSDTT (SEQ ID NO: 26) is mutated such that cleavage by an endogenous protease that cleaves native human IL-15Ra is inhibited.
  • one, two, three, four, five, six, seven, or eight amino acid substitutions and/or deletions are introduced into the amino acid sequence PQGHSDTT (SEQ ID NO: 26) of human IL-15Ra such that cleavage by an endogenous proteases that cleaves native human IL-15Ra is inhibited.
  • a host cell recombinantly expresses an IL-15Ra derivative in which the amino acid sequence PQGHSDTT (SEQ ID NO: 26) is replaced with a cleavage site that is recognized and cleaved by a heterologous protease.
  • Non-limiting examples of such heterologous protease cleavage sites include Arg-X-X-Arg (SEQ ID NO: 7), which is recognized and cleaved by furin protease; and A-B-Pro-Arg-X-Y (SEQ ID NO: 8) (A and B are hydrophobic amino acids and X and Y are nonacidic amino acids) and Gly-Arg-Gly, which are recognized and cleaved by the thrombin protease.
  • a host cell recombinantly expresses an IL-15Ra derivative, wherein the IL-15Ra derivative: (i) comprises a mutated extracellular cleavage site that inhibits cleavage by an endogenous protease that cleaves native IL-15Ra, and (ii) lacks all or a fragment of the transmembrane domain of native IL-15Ra.
  • a host cell recombinantly expresses an IL-15Ra derivative, wherein the IL- 15Ra derivative comprises: (i) one, two, three, four, five, six, seven or eight mutations (e.g., substitutions and/or deletions) in the extracellular cleavage site of IL-15Ra such that cleavage of IL-15Ra by an endogenous protease that cleaves native IL-15Ra is inhibited, and (ii) all or a fragment of a transmembrane domain of a heterologous molecule in place of all or a fragment of the transmembrane domain of native IL-15Ra.
  • mutations e.g., substitutions and/or deletions
  • a host cell recombinantly expresses an IL-15Ra derivative, wherein the IL-15Ra derivative comprises: (i) one, two, three, four, five, six, seven or eight mutations (e.g., substitutions and/or deletions) in the amino acid sequence PQGHSDTT (SEQ ID NO: 26) such that cleavage of IL-15Ra by an endogenous protease that cleaves native IL-15Ra is inhibited, and (ii) all or a fragment of a transmembrane domain of a heterologous molecule in place of all or a fragment of the transmembrane domain of native IL-15Ra.
  • the IL-15Ra derivatives may or may not comprise all or a fragment of the cytoplasmic tail of native IL-15Ra.
  • the heterologous molecule is CD4, CD8, or MHC.
  • the nucleic acids encoding IL-15 and/or IL-15Ra can be used to generate mammalian cells that recombinantly express IL-15 and IL-15Ra in high amounts for the isolation and purification of IL-15 and IL-15Ra, preferably the IL-15 and the IL-15Ra are associated as complexes.
  • high amounts of IL-15/IL-15Ra complexes refer to amounts of IL-15/IL-15Ra complexes expressed by cells that are at least 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 20 fold, or more than 20 fold higher than amounts of IL-15/IL-15Ra complexes expressed endogenously by control cells (e.g., cells that have not been genetically engineered to recombinantly express IL-15, IL- 15Ra, or both IL-15 and IL-15Ra, or cells comprising an empty vector).
  • control cells e.g., cells that have not been genetically engineered to recombinantly express IL-15, IL- 15Ra, or both IL-15 and IL-15Ra, or cells comprising an empty vector.
  • a host cell described herein expresses approximately 0.1 pg to 25 pg, 0.1 pg to 20 pg, 0.1 pg to 15 pg, 0.1 pg to 10 pg, 0.1 pg to 5 pg, 0.1 pg to 2 pg, 2 pg to 10 pg, or 5 to 20 pg of IL-15 as measured by a technique known to one of skill in the art (e.g., an ELISA).
  • a technique known to one of skill in the art e.g., an ELISA
  • a host cell described herein expresses approximately 0.1 to 0.25 pg per day, 0.25 to 0.5 pg per day, 0.5 to 1 pg per day, 1 to 2 pg per day, 2 to 5 pg per day, or 5 to 10 pg per day of IL-15 as measured by a technique known to one of skill in the art (e.g., an ELISA).
  • a population of host cells that recombinantly expresses IL- 15 and IL-15Ra expresses between 200 ng/million cells per day to 20,000 ng/million cells per day, 200 ng/million cells per day to 15,000 ng/million cells per day, 200 ng/ million cells per day to 10,000 ng/million cells per day, 200 ng/million cells per day to 5,000 ng/million cells per day, 200 ng/million cells per day to 2,000 ng/million cells per day, 200 ng/million cells per day to 1 ,000 ng/million cells per day, 200 ng/million cells per day to 600 ng/million cells per day, 200 ng/million cells per day to 500 ng/million cells per day, 300 ng/million cells per day to 600 ng/million cells per day of IL-15.
  • a population of host cells that recombinantly expresses IL-15 and IL-15Ra expresses about 200 ng/million cells per day, about 300 ng/million cells per day, about 400 ng/million cells per day, about 500 ng/million cells per day, about 600 ng/million cells per day, about 700 ng/million cells per day, about 800 ng/million cells per day, about 900 ng/million cells per day, about 1,000 ng/million cells per day, about 1,500 ng/million cells per day, about 2,000 ng/million cells per day, about 5,000 ng/million cells per day, about 10,000 ng/million cells per day, about 15,000 ng/million cells per day, or about 20,000 ng/million cells per day of IL-15.
  • the IL-15Ra is the soluble form of IL-15Ra. In a specific embodiment, the IL-15Ra is the soluble form of IL-15Ra associated with IL-15 in a stable heterodimer, which increases yields and simplifies production and purification of bioactive heterodimer IL-15/soluble IL-15Ra cytokine.
  • Recombinant IL-15 and IL-15Ra can be purified using methods of recombinant protein production and purification are well known in the art, e.g., see International
  • the polypeptide can be produced intracellularly, in the periplasmic space, or directly secreted into the medium.
  • Cell lysate or supernatant comprising the polypeptide can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography.
  • IL-15 and IL-15Ra are synthesized or recombinantly expressed by different cells and subsequently isolated and combined to form an IL-15/IL- 15Ra complex, in vitro, prior to administration to a subject.
  • IL-15 and IL-15Ra are synthesized or recombinantly expressed by different cells and subsequently isolated and simultaneously administered to a subject an IL-15/IL-15Ra complex in situ or in vivo.
  • IL-15 and IL-15Ra are synthesized or expressed together by the same cell, and the IL-15/IL-15Ra complex formed is isolated.
  • compositions comprising an IL-15Ra described herein, e.g., a soluble IL-15Ra, such as described in Section 5.1, supra.
  • compositions comprising the Therapeutic Agents.
  • the compositions include bulk drug compositions useful in the manufacture of pharmaceutical compositions (e.g., impure or non- sterile compositions) and pharmaceutical compositions (i.e., compositions that are suitable for administration to a subject or patient) which can be used in the preparation of unit dosage forms.
  • the compositions e.g., pharmaceutical compositions
  • compositions comprise an effective amount of one or more Therapeutic Agents and a pharmaceutically acceptable carrier.
  • the composition further comprises an additional therapeutic, e.g. , anti-cancer agent, anti-viral agent, antiinflammatory agent, adjuvant.
  • additional therapeutic e.g. , anti-cancer agent, anti-viral agent, antiinflammatory agent, adjuvant.
  • the term "pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
  • carrier refers to a diluent, adjuvant (e.g., Freund's adjuvant (complete and incomplete) or, more preferably, MF59C.1 adjuvant available from Chiron, Emeryville, CA), excipient, or vehicle with which the therapeutic is administered.
  • Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
  • water is a carrier when the pharmaceutical composition is administered intravenously.
  • Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
  • the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
  • compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
  • Pharmaceutical compositions may be formulated in any conventional manner using one or more pharmaceutically acceptable carriers or excipients.
  • a Therapeutic Agent administered to a subject in accordance with the methods described herein is administered as a pharmaceutical composition.
  • the components of the pharmaceutical compositions comprising Therapeutic Agents are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
  • a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
  • the Therapeutic Agent is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline (e.g., PBS).
  • PBS sterile pharmaceutical grade water or saline
  • an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
  • Therapeutic Agents may be formulated for administration by any method known to one of skill in the art, including but not limited to, parenteral (e.g., subcutaneous, intravenous, or intramuscular) and intratumoral administration.
  • parenteral e.g., subcutaneous, intravenous, or intramuscular
  • intratumoral administration e.g., intratumoral administration.
  • the Therapeutic Agents are formulated for local or systemic parenteral administration.
  • the Therapeutic Agents are formulated for subcutaneous or intravenous administration.
  • the Therapeutic Agents are formulated in a pharmaceutically compatible solution.
  • the Therapeutic Agents can be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion.
  • Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative.
  • the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • the active ingredient i.e., Therapeutic Agent
  • methods for enhancing IL- 15 -mediated immune function comprising administering to subjects agents that induce IL-15 signal transduction and enhance IL-15 -mediated immune function in a dose escalation regimen. More specifically, provided herein are methods for enhancing IL-15 -mediated immune function, comprising administering to subjects in a dose escalation regimen complexes that bind to the ⁇ subunits of the IL-15 receptor, induce IL-15 signal transduction and enhance IL-15- mediated immune function, wherein the complexes comprise IL-15 covalently or
  • IL-15Ra interleukin-15 receptor alpha
  • IL-15Ra complexes noncovalently bound to interleukin-15 receptor alpha
  • a method for preventing, treating and/or managing disorders in a subject wherein enhancement of IL-15 -mediated immune function is beneficial for the prevention, treatment and/or management of such disorders, the method comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to a subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject to achieve an effective ratio of IL-15 to lymphocyte cell number.
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject to achieve an effective ratio of IL-15 to lymphocyte cell number.
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject achieve an effective ratio of IL-15 to lymphocyte cell number.
  • the subject is a human subject.
  • the intial low dose is in the range of 2 ⁇ g/kg and 10 ⁇ g/kg as determined based on the mass of single chain IL-15. In a specific embodiment, the intial low dose is in the range of 0.5 ⁇ g/kg and 10 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is in the range of 0.5 ⁇ g/kg and 5 ⁇ g/kg as determined based on the mass of single chain IL-15. In a specific embodiment, the intial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL- 15.
  • the initial low dose is between 0.1 ⁇ g/kg and 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is about 2 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is about 5 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is about 10 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • the initial low dose is 0.1 ⁇ g/kg, 0.2 ⁇ g/kg, 0.3 ⁇ g/kg, 0.4 ⁇ g/kg, 0.5 ⁇ g/kg, 0.6 ⁇ g/kg, 0.7 ⁇ g/kg, 0.8 ⁇ g/kg, 0.9 ⁇ g/kg or 1 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 2 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 2 to 4, 2 to 5, 1 to 5, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each successively higher dose is 1.2, 1.25, 1.3, 1.35, 1.4, 1.45, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, or 6 times higher than the previous dose, or 1.2 to 2, 2 to 3, 2 to 4, 1 to 5, 2 to 6, 3 to 4, 3 to 6, or 4 to 6 times higher than the previous dose.
  • each successively higher dose is 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 105%, 1 10%, 1 15%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195%, or 200% higher than the previous dose.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least once and the subject is administered a dose three times per 7 day week (e.g., Monday, Wednesday and Friday).
  • the subject is monitored for one, two, or more, or all of the following: (i) signs of an enlarged lymph node(s); (ii) signs of an enlarged spleen; (iii) levels of free IL-15 in a sample (e.g., plasma sample) from the subject; (iv) changes (e.g., increases) in body temperature; (v) changes (e.g., decreases) in blood pressure; (vi) changes (e.g., increases) in cytokines, such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject; (vii) elevation of liver enzymes, such as hepatic transaminases (e.g., alanine aminotransferase (ALT) or aspartate aminotransfer
  • WBC White Blood Cell
  • ALC absolute lymphocyte count
  • ANC absolute neutrophil count
  • lymphocytosis lymphocytosis and organ dysfunction (e.g., liver or kidney dysfunction).
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • the dose is not increased and the dose may be remain the same, be stopped or reduced if the subject experiences adverse events, such as grade 3 or 4
  • the dose of the IL-15/IL-15Ra complex administered to the subject may be reduced or remain the same until the adverse events decrease or disappear.
  • the method further comprises (c) administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 of approximately 1 pg/ml to
  • a sample e.g., a plasma sample
  • the maintenance dose is equal to or less than the highest dose received by the subject during the dose escalation phase of the therapeutic regimen which does not result in one, two, or more, or all of the following: (i) adverse events, such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC) > 100,000 mm3), grade 3 or 4 decreases in WBC, absolute lymphocyte count (ALC) and/or absolute neutrophil count (ANC), lymphocytosis, and organ dysfunction (e.g., liver or kidney dysfunction); (ii) a significant decrease in blood pressure not easily corrected clinically by, e.g., fluid injection; and/or (iii) an increase in body temperature, e.g., a body temperature of 104°F or higher.
  • adverse events such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC
  • the maintenance dose reaches trough levels of plasma IL-15 that are close to normal levels (approximately 1 pg/ml plasma).
  • the maintenance dose is 0.1 ⁇ g/kg, 0.5 ⁇ g/kg,l ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 1 1 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg
  • the maintenance dose is between 0.1 ⁇ /kg to 5 ⁇ g/kg, 0.1 ⁇ /kg to 10 ⁇ g/kg, 2 ⁇ g/kg to 5 ⁇ g/kg, 2 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 15 ⁇ g/kg, 10 ⁇ g/kg to 15 ⁇ /kg, 0.1 ⁇ /kg to 20 ⁇ /kg, 15 ⁇ /kg to 20 ⁇ /kg, 15 ⁇ /kg to 25 ⁇ /kg, 20 ⁇ g/kg to 25 ⁇ /kg, 20 ⁇ /kg to 30 ⁇ /kg, 25 ⁇ /kg to 30 ⁇ /kg, 25 ⁇ /kg to 35 ⁇ /kg, 30 ⁇ g/kg to 35 ⁇ /kg, 35 ⁇ /kg to 40 ⁇ /kg, 20 ⁇ /kg to 40 ⁇ /kg, 25 ⁇ /kg, 20
  • the same dose of IL-15/IL- 15Ra complex is administered to the subject continuously for a certain period of time (e.g. , days, weeks, months, or years) as the maintenance dose.
  • the dose of IL-15/IL-15Ra complex administered to the subject as the maintenance dose is slowly decreased so that the elevated lymphocytes (in number and activation) in the subject gradually return to physiological conditions.
  • IL- 15 -mediated immune function is beneficial for the prevention, treatment and/or management of such disorders
  • the method comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g.
  • a plasma sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g.
  • a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL- 15/IL-15Ra complex e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or approximately 48 hours to 60 hours after the administration of a dose of the IL- 15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex
  • a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL- 15/IL-15Ra complex e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or approximately 48 hours to 60 hours after the administration of a dose of the IL- 15/IL-15
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL- 15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or approximately 48 hours to 60 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex) is within normal levels or less than normal levels
  • the subject is a human subject.
  • the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is between 0.1 ⁇ g/kg and 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • the initial low dose is 0.1 ⁇ g/kg, 0.2 ⁇ g/kg, 0.3 ⁇ g/kg, 0.4 ⁇ g/kg, 0.5 ⁇ g/kg, 0.6 ⁇ g/kg, 0.7 ⁇ g/kg, 0.8 ⁇ g/kg, 0.9 ⁇ g/kg or 1 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each successively higher dose is 1.2, 1.25, 1.3, 1.35, 1.4, 1.45, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, or 6 times higher than the previous dose, or 1.2 to 2, 2 to 3, 2 to 4, 1 to 5, 2 to 6, 3 to 4, 3 to 6, or 4 to 6 times higher than the previous dose.
  • each successively higher dose is 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 105%, 1 10%, 1 15%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195%, or 200% higher than the previous dose.
  • each dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least once and the subject is administered a dose three times per 7 day week (e.g., Monday, Wednesday and Friday).
  • the subject is monitored for one, two, or more, or all of the following: (i) signs of an enlarged lymph node(s); (ii) signs of an enlarged spleen; (iii) levels of free IL-15 in a sample (e.g., plasma sample) from the subject; (iv) changes (e.g., increases) in body temperature; (v) changes (e.g., decreases) in blood pressure; (vi) changes (e.g., increases) in cytokines, such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject; (vii) elevation of liver enzymes, such as hepatic transaminases (e.g.
  • ALT alanine aminotransferase
  • AST aspartate aminotransferase
  • adverse events such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC) > 100,000 mm3), grade 3 or 4 decreases in WBC, absolute lymphocyte count (ALC) and/or absolute neutrophil count (ANC), lymphocytosis and organ dysfunction (e.g., liver or kidney dysfunction).
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • the dose is not increased and the dose may be remain the same, be stopped or reduced if the subject experiences adverse events, such as grade 3 or 4
  • the dose of the IL-15/IL-15Ra complex administered to the subject may be reduced or remain the same until the adverse events decrease or disappear.
  • the method further comprises (c) administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 1 pg/ml to approximately 5 pg/ml, approximately 2 pg/ml to approximately 5 pg/ml, approximately 2 pg/ml to approximately 10 pg/ml, approximately 5 pg/ml to approximately 10 pg/ml, approximately 10 pg/ml to approximately 15 pg/ml, approximately 10 pg/ml to
  • the maintenance dose is equal to or less than the highest dose received by the subject during the dose escalation phase of the therapeutic regimen which does not result in one, two, or more, or all of the following: (i) adverse events, such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC) > 100,000 mm3), grade 3 or 4 decreases in WBC, absolute lymphocyte count (ALC) and/or absolute neutrophil count (ANC), lymphocytosis, and organ dysfunction (e.g., liver or kidney dysfunction); (ii) a significant decrease in blood pressure not easily corrected clinically by, e.g., fluid injection; and/or (iii) an increase in body temperature, e.g., a body temperature of 104°F or higher.
  • adverse events such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC
  • the maintenance dose reaches trough levels of plasma IL-15 that are close to normal levels (approximately 1 pg/ml plasma).
  • the maintenance dose is 0.1 ⁇ g/kg, 0.5 ⁇ g/kg,l ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg,
  • the maintenance dose is between 0.1 ⁇ g/kg to 5 ⁇ g/kg, 0.1 ⁇ g/kg to 10 ⁇ g/kg, 2 ⁇ g/kg to 5 ⁇ g/kg, 2 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 15 ⁇ g/kg, 10 ⁇ g/kg to 15 ⁇ g/kg, 0.1 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 35 ⁇ g/kg, 30 ⁇ g/kg to 35 ⁇ g/kg, 35 ⁇ g/kg to 40 ⁇ g/kg, 20 ⁇ g/kg to 40 ⁇ g/kg, 25 ⁇ g/kg, 20
  • the same dose of IL- 15/IL-15Ra complex is administered to the subject continuously for a certain period of time ⁇ e.g., days, weeks, months, or years) as the maintenance dose.
  • the dose of IL-15/IL-15Ra complex administered to the subject as the maintenance dose is slowly decreased so that the elevated lymphocytes (in number and activation) in the subject gradually return to physiological conditions.
  • a method for preventing, treating and/or managing disorders in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL- 15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or approximately 48 hours to 60 hours after the administration of a dose of the IL-15/IL-15Ra complex and
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising (a) administering at least one initial low dose of an IL-15/IL- 15Ra complex to the subject; and (b) administering successively higher doses of the IL- 15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL- 15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or approximately 48 hours to 60 hours after the administration of a dose of the IL- 15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex) is
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising (a) administering at least one initial low dose of an IL-15/IL-15Ra complex to the subject; and (b) administering successively higher doses of the IL-15/IL-15Ra complex to the subject, if the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex and before administration of another dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or approximately 48 hours to 60 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex) is approximately 1 pg/ml to
  • the subject is a human subject.
  • the initial low dose is between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15. In another embodiment, the initial low dose is between 0.1 ⁇ g/kg and 0.5 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • the initial low dose is 0.1 ⁇ g/kg, 0.2 ⁇ g/kg, 0.3 ⁇ g/kg, 0.4 ⁇ g/kg, 0.5 ⁇ g/kg, 0.6 ⁇ g/kg, 0.7 ⁇ g/kg, 0.8 ⁇ g/kg, 0.9 ⁇ g/kg or 1 ⁇ g/kg as determined based on the mass of single chain IL-15.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each successively higher dose is 1.2, 1.25, 1.3, 1.35, 1.4, 1.45, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, or 6 times higher than the previous dose, or 1.2 to 2, 2 to 3, 2 to 4, 1 to 5, 2 to 6, 3 to 4, 3 to 6, or 4 to 6 times higher than the previous dose.
  • each successively higher dose is 25%, 30%>, 35%>, 40%>, 45%>, 50%>, 55%>, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 105%, 1 10%, 1 15%, 120%, 125%, 130%, 135%, 140%, 145%, 150%, 155%, 160%, 165%, 170%, 175%, 180%, 185%, 190%, 195%), or 200%) higher than the previous dose.
  • each dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least once and the subject is administered a dose three times per 7 day week (e.g., Monday, Wednesday and Friday).
  • the subject is monitored for one, two, or more, or all of the following: (i) signs of an enlarged lymph node(s); (ii) signs of an enlarged spleen; (iii) levels of free IL-15 in a sample (e.g., plasma sample) from the subject; (iv) changes (e.g., increases) in body temperature; (v) changes (e.g., decreases) in blood pressure; (vi) changes (e.g., increases) in cytokines, such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject; (vi) elevation of liver enzymes, such as hepatic transaminases (e.g., alanine aminotransferase (ALT) or aspartate aminotransferase (AST)); and/or (vii) adverse events, such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocyto
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • the dose is not increased and the dose may be remain the same, be stopped or reduced if the subject experiences adverse events, such as grade 3 or 4 thrombocytopenia, grade 3 or 4
  • the dose of the IL-15/IL-15Ra complex administered to the subject may be reduced or remain the same until the adverse events decrease or disappear.
  • the method further comprises (c) administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 1 pg/ml to approximately 5 pg/ml, approximately 2 pg/ml to approximately 5 pg/ml, approximately 2 pg/ml to approximately 10 pg/ml, approximately 5 pg/ml to approximately 10 pg/ml, approximately 10 pg/ml to approximately 15 pg/ml, approximately 10 pg/ml to approximately 20 pg/ml, approximately 20 pg/ml to approximately 30 pg/ml, approximately 30 pg/ml to approximately 40 pg/ml, or approximately 40 pg/ml to approximately 50 pg/ml, approximately 1 pg/ml to 50 pg/ml or approximately 5 pg/ml to approximately 50 pg/ml in a blood sample from the
  • the maintenance dose is equal to or less than the highest dose received by the subject during the dose escalation phase of the therapeutic regimen which does not result in one, two, or more, or all of the following: (i) adverse events, such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC) > 100,000 mm3), grade 3 or 4 decreases in WBC, absolute lymphocyte count (ALC) and/or absolute neutrophil count (ANC), lymphocytosis, and organ dysfunction (e.g., liver or kidney dysfunction); (ii) a significant decrease in blood pressure not easily corrected clinically by, e.g., fluid injection; and/or (iii) an increase in body temperature, e.g., a body temperature of 104°F or higher.
  • adverse events such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC
  • the maintenance dose reaches trough levels of plasma IL-15 that are close to normal levels (approximately 1 pg/ml plasma).
  • the maintenance dose is 0.1 ⁇ g/kg, 0.5 ⁇ ,1 ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg, 28
  • the maintenance dose is between 0.1 ⁇ g/kg to 5 ⁇ g/kg, 0.1 ⁇ g/kg to 10 ⁇ g/kg, 2 ⁇ g/kg to 5 ⁇ g/kg, 2 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 15 ⁇ g/kg, 10 ⁇ g/kg to 15 ⁇ g/kg, 0.1 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 35 ⁇ g/kg, 30 ⁇ g/kg to 35 ⁇ g/kg, 35 ⁇ g/kg to 40 ⁇ g/kg, 20 ⁇ g/kg to 40 ⁇ g/kg, 25 ⁇ g/kg, 20
  • the same dose of IL-15/IL-15Ra complex is administered to the subject continuously for a certain period of time (e.g., days, weeks, months, or years) as the maintenance dose.
  • the dose of IL-15/IL-15Ra complex administered to the subject as the maintenance dose is slowly decreased so that the elevated lymphocytes (in number and activation) in the subject gradually return to physiological conditions.
  • a method for preventing, treating and/or managing disorders in a subject wherein enhancement of IL-15 -mediated immune function is beneficial for the prevention, treatment and/or management of such disorders, the method comprising administering an IL-15/IL-15Ra complex to the human subject in an escalating dose regimen beginning with an initial low dose of between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose two to three times over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample ⁇ e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex ⁇ e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising administering an IL-15/IL-15Ra complex to the human subject in an escalating dose regimen beginning with an initial low dose of between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose two to three times over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the
  • concentration of free IL-15 in a sample e.g., a plasma sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen beginning with an initial low dose of between 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose two to three times over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level, and wherein the concentration of free IL- 15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately
  • the initial low dose is 0.1 ⁇ g/kg, 0.2 ⁇ g/kg, 0.3 ⁇ g/kg, 0.4 ⁇ g/kg, 0.5 ⁇ g/kg, 0.6 ⁇ /13 ⁇ 4, 0.7 ⁇ /13 ⁇ 4, 0.8 ⁇ /kg, 0.9 ⁇ /13 ⁇ 4 or 1 ⁇ /kg as determined based on the mass of single chain IL-15.
  • the initial low dose is administered 1, 2, 3, 4,
  • the initial low dose is administered 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 2 to 6, 1 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least 1, 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least once and the subject is administered a dose three times per 7 day week ⁇ e.g., Monday, Wednesday and Friday).
  • the subject is monitored for one, two, or more, or all of the following: (i) signs of an enlarged lymph node(s); (ii) signs of an enlarged spleen; (iii) changes ⁇ e.g., increases) in body temperature; (iv) changes ⁇ e.g., decreases) in blood pressure; (v) changes ⁇ e.g., increases) in cytokines, such as pro-inflammatory cytokines ⁇ e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject; (vi) elevation of liver enzymes, such as hepatic transaminases (e.g., alanine aminotransferase (ALT) or aspartate aminotransferase (AST)); and/or (vii) adverse events, such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC) >
  • WBC
  • the dose of the IL-15/IL-15Ra complex administered to the subject may be reduced or remain the same until the adverse events decrease or disappear.
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of a free IL-15 of approximately 1 pg/ml to approximately 5 pg/ml, approximately 2 pg/ml to approximately 5 pg/ml, approximately 2 pg/ml to approximately 10 pg/ml, approximately 5 pg/ml to approximately 10 pg/ml, approximately 10 pg/ml to approximately 15 pg/ml, approximately 10 pg/ml to approximately 20 pg/ml, approximately 20 pg/ml to approximately 30 pg/ml, approximately 30 pg/ml to approximately 40 pg/ml, or
  • the maintenance dose is equal to or less than the highest dose received by the subject during the dose escalation phase of the therapeutic regimen which does not result in one, two, or more, or all of the following: (i) adverse events, such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC) > 100,000 mm3), grade 3 or 4 decreases in WBC, absolute lymphocyte count (ALC) and/or absolute neutrophil count (ANC), lymphocytosis, and organ dysfunction (e.g., liver or kidney dysfunction); (ii) a significant decrease in blood pressure not easily corrected clinically by, e.g., fluid injection; and/or (iii) an increase in body temperature, e.g., a body temperature of 104°F or higher.
  • adverse events such as grade 3 or 4 thrombocytopenia, grade 3 or 4 granulocytopenia, grade 3 or 4 leukocytosis (White Blood Cell (WBC
  • the maintenance dose reaches trough levels of free IL-15 that are close to normal levels (approximately 1 pg/ml plasma).
  • the maintenance dose is 0.1 ⁇ g/kg, 0.5 ⁇ g/kg,l ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg,
  • the maintenance dose is between 0.1 ⁇ g/kg to 5 ⁇ g/kg, 0.1 ⁇ g/kg to 10 ⁇ g/kg, 2 ⁇ g/kg to 5 ⁇ g/kg, 2 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 15 ⁇ g/kg, 10 ⁇ g/kg to 15 ⁇ g/kg, 0.1 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 35 ⁇ g/kg, 30 ⁇ g/kg to 35 ⁇ g/kg, 35 ⁇ g/kg to 40 ⁇ g/kg, 20 ⁇ g/kg to 40 ⁇ g/kg, 25 ⁇ g/kg, 20
  • the same dose of IL- 15/IL-15Ra complex is administered to the subject continuously for a certain period of time (e.g., days, weeks, months, or years) as the maintenance dose.
  • the dose of IL-15/IL-15Ra complex administered to the subject as the maintenance dose is slowly decreased so that the elevated lymphocytes (in number and activation) in the subject gradually return to physiological conditions.
  • a method for preventing, treating and/or managing disorders in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.5 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; (v) 8 ⁇ g /kg; and (vi) 16 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15
  • a sample e.g., a plasma sample
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.5 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; (v) 8 ⁇ g /kg; and (vi) 16 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.5 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; (v) 8 ⁇ g /kg; and (vi) 16 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a sample sample) obtained from the subject a certain period of time after the administration of a dose of the IL- 15/
  • a sample e.g., a sample sample
  • the subject is a human subject.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 2 to 6, 1 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least once and the subject is administered a dose three times per 7 day week (e.g., Monday, Wednesday and Friday).
  • the subject is monitored for one, two, or more, or all of the following: (i) signs of an enlarged lymph node(s); (ii) signs of an enlarged spleen; (iii) changes (e.g., increases) in body temperature; (iv) changes (e.g.
  • cytokines such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject;
  • cytokines such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject;
  • cytokines such as pro-inflammatory cytokines (e.g., IL-1 and IL-6
  • a sample e.g., blood sample
  • hepatic transaminases e.g., alanine aminotransferase (ALT) or aspartate aminotransferase (AST)
  • adverse events such as grade 3 or 4 thrombocytopenia, grade 3 or 4
  • the dose is not increased and the dose may be remain the same, be stopped or reduced if the subject experiences adverse events, such as grade 3 or 4
  • the dose of the IL-15/IL-15Ra complex administered to the subject may be reduced or remain the same until the adverse events decrease or disappear.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 5 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject. In some embodiments, the maintenance dose reaches trough levels of free IL-15 of approximately 1 pg/ml to the subject.
  • the maintenance dose is equal to or less than the highest dose received by the subject during the dose escalation phase of the therapeutic regimen which does not result in one, two, or more, or all of the following: (i) adverse events, such as grade 3 or 4
  • the maintenance dose reaches trough levels of plasma IL-15 that are close to normal levels (approximately 1 pg/ml plasma).
  • the maintenance dose is 0.1 ⁇ g/kg, 0.5 ⁇ ,1 ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 1 1 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg, 28 ⁇ g/kg, 29 ⁇ g/kg, 30 ⁇ g/kg, 31 ⁇ g/kg, 32 ⁇ g/kg, 33 ⁇ g/kg,
  • the maintenance dose is between 0.1 ⁇ g/kg to 5 ⁇ g/kg, 0.1 ⁇ g/kg to 10 ⁇ g/kg, 2 ⁇ g/kg to 5 ⁇ g/kg, 2 ⁇ /13 ⁇ 4 to 10 ⁇ /13 ⁇ 4, 5 ⁇ /13 ⁇ 4 to 10 ⁇ /13 ⁇ 4, 5 ⁇ /kg to 15 ⁇ /kg, 10 ⁇ /kg to 15 ⁇ /kg, 0.1 ⁇ g/kg to 20 ⁇ /kg, 15 ⁇ /kg to 20 ⁇ /kg, 15 ⁇ /kg to 25 ⁇ /kg, 20 ⁇ /kg to 25 ⁇ /kg, 20 ⁇ g/kg to 30 ⁇ /kg, 25 ⁇ /kg to 30 ⁇ /kg, 25 ⁇ /kg to 35 ⁇ /kg, 30 ⁇ /kg to 35 ⁇ /kg, 35 ⁇ g/kg to 40 ⁇ /kg, 20 ⁇ /kg to 40 ⁇ /kg, 25 ⁇ g/kg
  • the same dose of IL-15/IL-15Ra complex is administered to the subject continuously for a certain period of time (e.g., days, weeks, months, or years) as the maintenance dose.
  • the dose of IL-15/IL-15Ra complex administered to the subject as the maintenance dose is slowly decreased so that the elevated lymphocytes (in number and activation) in the subject gradually return to physiological conditions.
  • a method for preventing, treating and/or managing disorders in a subject wherein enhancement of IL- 15 -mediated immune function is beneficial for the prevention, treatment and/or management of such disorders, the method comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.125 ⁇ g /kg; (ii) 0.25 ⁇ g /kg; (iv) 0.5 ⁇ g /kg; (v) 1 ⁇ g /kg; (v) 2 ⁇ g /kg; and (vi) 4 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15
  • a sample e.g.,
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.125 ⁇ g /kg; (ii) 0.25 ⁇ g /kg; (iv) 0.5 ⁇ g /kg; (v) 1 ⁇ g /kg; (v) 2 ⁇ g /kg; and (vi) 4 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g.
  • a plasma sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or approximately 48 hours to 60 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex) is monitored before elevating the dose to the next level.
  • a dose of the IL-15/IL-15Ra complex e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72 hours, approximately 36 hours to approximately 48 hours, or approximately 48 hours to 60 hours after the administration of a dose of the IL-15/IL-15Ra complex and before the administration of another dose of the IL-15/IL-15Ra complex
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.125 ⁇ g /kg; (ii) 0.25 ⁇ g /kg; (iv) 0.5 ⁇ g /kg; (v) 1 ⁇ g /kg; (v) 2 ⁇ g /kg; and (vi) 4 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours,
  • the subject is a human subject.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 2 to 6, 1 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least once and the subject is administered a dose three times per 7 day week (e.g., Monday, Wednesday and Friday).
  • the subject is monitored for one, two, or more, or all of the following: (i) signs of an enlarged lymph node(s); (ii) signs of an enlarged spleen; (iii) changes (e.g., increases) in body temperature; (iv) changes (e.g.
  • cytokines such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject;
  • cytokines such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject;
  • cytokines such as pro-inflammatory cytokines (e.g., IL-1 and IL-6
  • a sample e.g., blood sample
  • hepatic transaminases e.g., alanine aminotransferase (ALT) or aspartate aminotransferase (AST)
  • adverse events such as grade 3 or 4 thrombocytopenia, grade 3 or 4
  • the dose is not increased and the dose may be remain the same, be stopped or reduced if the subject experiences adverse events, such as grade 3 or 4
  • the dose of the IL-15/IL-15Ra complex administered to the subject may be reduced or remain the same until the adverse events decrease or disappear.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 5 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject. In some embodiments, the maintenance dose reaches trough levels of free IL-15 of approximately 1 pg/ml to the subject.
  • the maintenance dose is equal to or less than the highest dose received by the subject during the dose escalation phase of the therapeutic regimen which does not result in one, two, or more, or all of the following: (i) adverse events, such as grade 3 or 4
  • the maintenance dose reaches trough levels of plasma IL-15 that are close to normal levels (approximately 1 pg/ml plasma).
  • the maintenance dose is 0.1 ⁇ g/kg, 0.5 ⁇ ,1 ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg, 28 ⁇ g/kg, 29 ⁇ g/kg, 30 ⁇ g/kg, 31 ⁇ g/kg, 32 ⁇ g/kg, 33 ⁇ g/kg, 34 ⁇ g/
  • the maintenance dose is between 0.1 ⁇ g/kg to 5 ⁇ g/kg, 0.1 ⁇ g/kg to 10 ⁇ g/kg, 2 ⁇ g/kg to 5 ⁇ g/kg, 2 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 15 ⁇ g/kg, 10 ⁇ g/kg to 15 ⁇ g/kg, 0.1 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 35 ⁇ g/kg, 30 ⁇ g/kg to 35 ⁇ g/kg, 35 ⁇ g/kg to 40 ⁇ g/kg, 20 ⁇ g/kg to 40 ⁇ g/kg, 25 ⁇ g/kg, 20
  • the same dose of IL-15/IL-15Ra complex is administered to the subject continuously for a certain period of time (e.g., days, weeks, months, or years) as the maintenance dose.
  • the dose of IL-15/IL-15Ra complex administered to the subject as the maintenance dose is slowly decreased so that the elevated lymphocytes (in number and activation) in the subject gradually return to physiological conditions.
  • a method for preventing, treating and/or managing disorders in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.25 ⁇ g /kg; (ii) 0.5 ⁇ g /kg; (iii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; and (vi) 8 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample ⁇ e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.25 ⁇ g /kg; (ii) 0.5 ⁇ g /kg; (iii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; and (vi) 8 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a sample (e.g., a
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.25 ⁇ g /kg; (ii) 0.5 ⁇ g /kg; (iii) 1 ⁇ g /kg; (iv) 2 ⁇ g /kg; (v) 4 ⁇ g /kg; and (vi) 8 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours
  • the subject is a human subject.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 2 to 6, 1 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least once and the subject is administered a dose three times per 7 day week (e.g., Monday, Wednesday and Friday).
  • the subject is monitored for one, two, or more, or all of the following: (i) signs of an enlarged lymph node(s); (ii) signs of an enlarged spleen; (iii) changes (e.g., increases) in body temperature; (iv) changes (e.g., decreases) in blood pressure; (v) changes (e.g., increases) in cytokines, such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject; (vi) elevation of liver enzymes, such as hepatic transaminases (e.g., alanine aminotransferase (ALT) or aspartate aminotransferase (AST)); and/or (vii) adverse events, such as grade 3 or 4 thrombocytopenia, grade 3 or 4
  • the dose is not increased and the dose may be remain the same, be stopped or reduced if the subject experiences adverse events, such as grade 3 or 4
  • the dose of the IL-15/IL-15Ra complex administered to the subject may be reduced or remain the same until the adverse events decrease or disappear.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 5 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject. In some embodiments, the maintenance dose reaches trough levels of free IL-15 of approximately 1 pg/ml to the subject.
  • the maintenance dose is equal to or less than the highest dose received by the subject during the dose escalation phase of the therapeutic regimen which does not result in one, two, or more, or all of the following: (i) adverse events, such as grade 3 or 4
  • the maintenance dose reaches trough levels of plasma IL-15 that are close to normal levels (approximately 1 pg/ml plasma).
  • the maintenance dose is 0.1 ⁇ g/kg, 0.5 ⁇ ,1 ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 1 1 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg, 28 ⁇ g/kg, 29 ⁇ g/kg, 30 ⁇ g/kg, 31 ⁇ g/kg, 32 ⁇ g/kg, 33 ⁇ g/kg,
  • the maintenance dose is between 0.1 ⁇ g/kg to 5 ⁇ g/kg, 0.1 ⁇ g/kg to 10 ⁇ g/kg, 2 ⁇ g/kg to 5 ⁇ g/kg, 2 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 15 ⁇ g/kg, 10 ⁇ g/kg to 15 ⁇ g/kg, 0.1 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 35 ⁇ g/kg, 30 ⁇ g/kg to 35 ⁇ g/kg, 35 ⁇ g/kg to 40 ⁇ g/kg, 20 ⁇ g/kg to 40 ⁇ g/kg, 25 ⁇ g/kg, 20
  • the same dose of IL-15/IL-15Ra complex is administered to the subject continuously for a certain period of time (e.g., days, weeks, months, or years) as the maintenance dose.
  • the dose of IL-15/IL-15Ra complex administered to the subject as the maintenance dose is slowly decreased so that the elevated lymphocytes (in number and activation) in the subject gradually return to physiological conditions.
  • a method for preventing, treating and/or managing disorders in a subject wherein enhancement of IL- 15 -mediated immune function is beneficial for the prevention, treatment and/or management of such disorders, the method comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.1 ⁇ g /kg; 0.3 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iii) 3 ⁇ g /kg; and (iv) 9 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.1 ⁇ g /kg; 0.3 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iii) 3 ⁇ g /kg; and (iv) 9 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL- 15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours,
  • a sample e.g
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.1 ⁇ g /kg; 0.3 ⁇ g /kg; (ii) 1 ⁇ g /kg; (iii) 3 ⁇ g /kg; and (iv) 9 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours, approximately 24 hours to approximately 72 hours, approximately 48 hours to approximately 72
  • the subject is a human subject.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 2 to 6, 1 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least once and the subject is administered a dose three times per 7 day week (e.g., Monday, Wednesday and Friday).
  • the subject is monitored for one, two, or more, or all of the following: (i) signs of an enlarged lymph node(s); (ii) signs of an enlarged spleen; (iii) changes (e.g., increases) in body temperature; (iv) changes (e.g., decreases) in blood pressure; (v) changes (e.g., increases) in cytokines, such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject; (vi) elevation of liver enzymes, such as hepatic transaminases (e.g., alanine aminotransferase (ALT) or aspartate aminotransferase (AST)); and/or (vii) adverse events, such as grade 3 or 4 thrombocyto
  • the dose of the IL-15/IL-15Ra complex administered to the subject may be reduced or remain the same until the adverse events decrease or disappear.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 5 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject. In some embodiments, the maintenance dose reaches trough levels of free IL-15 of approximately 1 pg/ml to the subject.
  • the maintenance dose is equal to or less than the highest dose received by the subject during the dose escalation phase of the therapeutic regimen which does not result in one, two, or more, or all of the following: (i) adverse events, such as grade 3 or 4
  • the maintenance dose reaches trough levels of plasma IL-15 that are close to normal levels (approximately 1 pg/ml plasma).
  • the maintenance dose is 0.1 ⁇ g/kg, 0.5 ⁇ ,1 ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg, 28 ⁇ g/kg, 29 ⁇ g/kg, 30 ⁇ g/kg, 31 ⁇ g/kg, 32 ⁇ g/kg, 33 ⁇ g/kg, 34 ⁇ g/
  • the maintenance dose is between 0.1 ⁇ g/kg to 5 ⁇ g/kg, 0.1 ⁇ g/kg to 10 ⁇ g/kg, 2 ⁇ g/kg to 5 ⁇ g/kg, 2 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 15 ⁇ g/kg, 10 ⁇ g/kg to 15 ⁇ g/kg, 0.1 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 35 ⁇ g/kg, 30 ⁇ g/kg to 35 ⁇ g/kg, 35 ⁇ g/kg to 40 ⁇ g/kg, 20 ⁇ g/kg to 40 ⁇ g/kg, 25 ⁇ g/kg, 20
  • the same dose of IL-15/IL-15Ra complex is administered to the subject continuously for a certain period of time (e.g., days, weeks, months, or years) as the maintenance dose.
  • the dose of IL-15/IL-15Ra complex administered to the subject as the maintenance dose is slowly decreased so that the elevated lymphocytes (in number and activation) in the subject gradually return to physiological conditions.
  • a method for preventing, treating and/or managing disorders in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.1 ⁇ g /kg; 0 ⁇ g /kg; (ii) 0.4 ⁇ g /kg; (iii) 0.8 ⁇ g /kg; (iv) 1.6 ⁇ g /kg, and (v) 3.2 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample ⁇ e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL
  • a method for preventing, treating and/or managing lymphocytopenia, cancer or an infectious disease in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.1 ⁇ g /kg; O ⁇ g /kg; (ii) 0.4 ⁇ g /kg; (iii) 0.8 ⁇ g /kg; (iv) 1.6 ⁇ g /kg, and (v) 3.2 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24
  • a method for eradicating or reducing HIV in HIV-infected cells in a subject comprising administering an IL-15/IL-15Ra complex to the subject in an escalating dose regimen at the following sequential doses: (i) 0.1 ⁇ g /kg; 0 ⁇ g /kg; (ii) 0.4 ⁇ g /kg; (iii) 0.8 ⁇ g /kg; (iv) 1.6 ⁇ g /kg, and (v) 3.2 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level, and wherein the concentration of free IL-15 in a sample (e.g., a plasma sample) obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex (e.g., approximately 24 hours to approximately 48 hours, approximately 24 hours to approximately 36 hours
  • the subject is a human subject.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • the initial low dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 2 to 6, 1 to 6, 3 to 6, 4 to 6 or 6 to 8 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times.
  • each dose is administered at least 1 , 2, 3, 4, 5, 6 or more times, or 1 to 3, 1 to 4, 1 to 5, 2 to 4, 2 to 5, 1 to 6, 2 to 6, 1 to 6, 3 to 6, 4 to 6, 6 to 8, 5 to 8, or 5 to 10 times over a 5 to 7 day, 5 to 10 day, 7 to 12 day, 7 to 14 day, 7 to 21 day or 14 to 21 day period of time.
  • each dose is administered at least once and the subject is administered a dose three times per 7 day week (e.g., Monday, Wednesday and Friday).
  • the subject is monitored for one, two, or more, or all of the following: (i) signs of an enlarged lymph node(s); (ii) signs of an enlarged spleen; (iii) changes (e.g., increases) in body temperature; (iv) changes (e.g., decreases) in blood pressure; (v) changes (e.g., increases) in cytokines, such as pro-inflammatory cytokines (e.g., IL-1 and IL-6) in a sample (e.g., blood sample) from the subject; (vi) elevation of liver enzymes, such as hepatic transaminases (e.g., alanine aminotransferase (ALT) or aspartate aminotransferase (AST)); and/or (vii) adverse events, such as grade 3 or 4 thrombocytopenia, grade 3 or 4
  • the dose is not increased and the dose may be remain the same, be stopped or reduced if the subject experiences adverse events, such as grade 3 or 4
  • the dose of the IL-15/IL-15Ra complex administered to the subject may be reduced or remain the same until the adverse events decrease or disappear.
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is above 50 pg/ml, 55 pg/ml, 60 pg/ml, 65 pg/ml, 70 pg/ml, 75 pg/ml, 80 pg/ml, 85 pg/ml, 90 pg/ml, 95 pg/ml, or 100 pg/ml.
  • a sample e.g., plasma sample
  • the dose is not increased if the trough concentration of free IL-15 in a sample (e.g., plasma sample) from the subject is 50 pg/ml to 75 pg/ml, 60 pg/ml to 75 pg/ml, 75 pg/ml to 85 pg/ml, 75 pg/ml to 100 pg/ml, 85 pg/ml to 100 pg/ml or 50 pg/ml to 100 pg/ml.
  • a sample e.g., plasma sample
  • the method further comprises administering a maintenance dose of the IL-15/IL-15Ra complex to the subject, wherein the maintenance dose reaches trough levels of free IL-15 concentration of approximately 5 to 50 pg/ml in a sample (e.g., a plasma sample) from the subject. In some embodiments, the maintenance dose reaches trough levels of free IL-15 of approximately 1 pg/ml to the subject.
  • the maintenance dose is equal to or less than the highest dose received by the subject during the dose escalation phase of the therapeutic regimen which does not result in one, two, or more, or all of the following: (i) adverse events, such as grade 3 or 4
  • the maintenance dose reaches trough levels of plasma IL-15 that are close to normal levels (approximately 1 pg/ml plasma).
  • the maintenance dose is 0.1 ⁇ g/kg, 0.5 ⁇ ,1 ⁇ g/kg, 2 ⁇ g/kg, 3 ⁇ g/kg, 4 ⁇ g/kg, 5 ⁇ g/kg, 6 ⁇ g/kg, 7 ⁇ g/kg, 8 ⁇ g/kg, 9 ⁇ g/kg, 10 ⁇ g/kg, 11 ⁇ g/kg, 12 ⁇ g/kg, 13 ⁇ g/kg, 14 ⁇ g/kg, 15 ⁇ g/kg, 16 ⁇ g/kg, 17 ⁇ g/kg, 18 ⁇ g/kg, 19 ⁇ g/kg, 20 ⁇ g/kg, 21 ⁇ g/kg, 22 ⁇ g/kg, 23 ⁇ g/kg, 24 ⁇ g/kg, 25 ⁇ g/kg, 26 ⁇ g/kg, 27 ⁇ g/kg, 28 ⁇ g/kg, 29 ⁇ g/kg, 30 ⁇ g/kg, 31 ⁇ g/kg, 32 ⁇ g/kg, 33 ⁇ g/kg, 34 ⁇ g/
  • the maintenance dose is between 0.1 ⁇ g/kg to 5 ⁇ g/kg, 0.1 ⁇ g/kg to 10 ⁇ g/kg, 2 ⁇ g/kg to 5 ⁇ g/kg, 2 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 10 ⁇ g/kg, 5 ⁇ g/kg to 15 ⁇ g/kg, 10 ⁇ g/kg to 15 ⁇ g/kg, 0.1 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 20 ⁇ g/kg, 15 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 25 ⁇ g/kg, 20 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 30 ⁇ g/kg, 25 ⁇ g/kg to 35 ⁇ g/kg, 30 ⁇ g/kg to 35 ⁇ g/kg, 35 ⁇ g/kg to 40 ⁇ g/kg, 20 ⁇ g/kg to 40 ⁇ g/kg, 25 ⁇ g/kg, 20
  • the same dose of IL-15/IL-15Ra complex is administered to the subject continuously for a certain period of time (e.g., days, weeks, months, or years) as the maintenance dose.
  • the dose of IL-15/IL-15Ra complex administered to the subject as the maintenance dose is slowly decreased so that the elevated lymphocytes (in number and activation) in the subject gradually return to physiological conditions.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen beginning with an initial low dose of an IL-15/IL-15Ra complex to the human subject one to five times, and sequentially escalating the dose by at least 25%, 50%>, 75%, 100%, 125%), 150%), 175%) 200%), 250%), or 300%> over the previous dose, wherein each dose is
  • the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex is monitored before elevating the dose to the next level.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen beginning with an initial low dose in the range of 2 ⁇ g/kg and 10 ⁇ g/kg as determined based on the mass of single chain IL-15, and sequentially escalating the dose by at least 25%, 50%>, 75%, 100%, 125%, 150%, 175% 200%, 250%, or 300% over the previous dose, wherein each dose is administered at least once, twice, or thrice before elevating the dose to the next level.
  • the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex is monitored before elevating the dose to the next level.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen at the following sequential doses: (i) 2 ⁇ g /kg; (ii) 4 ⁇ g /kg; (iv) 8 ⁇ g /kg; (v) 16 ⁇ g /kg; (v) 32 ⁇ g /kg; and (vi) 64 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level.
  • the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex is monitored before elevating the dose to the next level.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen at the following sequential doses: (i) 5 ⁇ g /kg; (ii) 10 ⁇ g /kg; (iv) 20 ⁇ g /kg; (v) 40 ⁇ g /kg; (v) 80 ⁇ g /kg; and (vi) 120 ⁇ g /kg, wherein the doses are determined based on the mass of single chain IL-15, wherein each dose is administered at least once, twice or thrice before elevating the dose to the next level.
  • the concentration of free IL-15 in a sample obtained from the subject a certain period of time after the administration of a dose of the IL-15/IL-15Ra complex is monitored before elevating the dose to the next level.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen beginning with an initial low dose (in, e.g., the range of 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15), and sequentially escalating (e.g., by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 225%, 250%), 275%) or 300%>) the dose over the previous dose every two days initially for a period of time (e.g., 1, 2, 3 or 4 weeks) and then escalating the dose gradually everyday over the previous dose for a period of time (e.g., 1, 2, 3 or 4 weeks).
  • an initial low dose in, e.g., the range of 0.1 ⁇ g/kg and 1 ⁇ g/kg as determined based on the mass of single chain IL-15
  • sequentially escalating e.g., by about 10%
  • the initial low dose is 0.1 ⁇ g/kg, 0.2 ⁇ g/kg , 0.3 ⁇ g/kg , 0.4 ⁇ g/kg , 0.5 ⁇ g/kg , 0.6 ⁇ g/kg , 0.7 ⁇ g/kg , 0.8 ⁇ g/kg, 0.9 ⁇ g/kg , or 1 ⁇ g/kg as determined based on the mass of single chain IL- 15.
  • each dose is administered at least once, twice or thrice before the dose is escalated.
  • lymphocytopenia cancer or an infectious disease in a human subject
  • a method for eradicating or reducing HIV in HIV-infected cells in a human subject comprising
  • an IL-15/IL-15Ra complex administered to the human subject in an escalating dose regimen beginning with an initial low dose as determined based on the mass of single chain IL-15, and sequentially escalating (e.g., by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, or 300%) the dose over the previous dose for a period of time (e.g., 1, 2, 3, 4, 5, 6 or more weeks) and then administering an IL-15/IL-15Ra complex to the human subject in a maintenance dose for a period of time.
  • a period of time e.g. 1, 2, 3, 4, 5, 6 or more weeks
  • the initial low dose is 0.1 ⁇ g/kg, 0.2 ⁇ g/kg , 0.3 ⁇ g/kg , 0.4 ⁇ g/kg , 0.5 ⁇ g/kg , 0.6 ⁇ /kg , 0.7 ⁇ /kg , 0.8 ⁇ /kg, 0.9 ⁇ /kg , or 1 ⁇ /kg as determined based on the mass of single chain IL-15.
  • each dose is administered at least once, twice or thrice before the dose is escalated. In certain embodiments, the dose is escalated every day, every 2 days, or every 3 days.
  • the maintenance dose is at least 1 ⁇ 2 or 1 ⁇ 4 lower than the highest escalating dose administered. In specific embodiments, in accordance with the methods described herein, the maintenance dose is at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% lower than the highest escalating dose
  • each dose is administered once, three times a week for two weeks. In specific embodiments, in accordance with the methods described herein, each dose is administered once, three times a week for two, three, or four weeks. In specific embodiments, in accordance with the methods described herein, each dose is administered once, six times a week for two, three, or four weeks. In specific embodiments, in accordance with the methods described herein, each dose is administered once, every other day, for two, three, or four weeks. In specific
  • each dose is administered once, everyday, for two, three, or four weeks.
  • the IL-15/IL-15Ra complex is administered
  • the IL-15/IL-15Ra complex is administered intravaneously or intramusclarly to a subject in accordance with the methods described herein. In certain embodiments, the IL-15/IL-15Ra complex is administered intratumorally to a subject in accordance with the methods described herein. In some embodiments, the IL-15/IL-15Ra complex is
  • a site e.g., a site of infection
  • a subject administered locally to a site (e.g., a site of infection) in a subject in accordance with the methods described herein.
  • a sample obtained from a subject in accordance with the methods described herein is a blood sample.
  • the sample is a plasma sample.
  • Basal plasma levels of IL-15 are approximately 1 pg/ml in humans, approximately 8-10 pg/ml in monkeys (such as macaques), and approximately 12 pg/m in rodents (such as mice). Techniques known to one skilled in the art can be used to obtain a sample from a subject.
  • the methods described herein are not cylical in nature.
  • the methods described herein do not include a cyclical administration regimen, wherein the cycle comprises administering a dose of the IL- 15/IL-15Ra complex for a certain period of time (e.g., 1 to 4 weeks) followed by another period of time when the subject is not administered a dose of the IL-15/IL-15Ra complex (e.g., 1 week to 2 months) and this cycle is repeated any number of times (e.g, the cycle is repeated 2, 3, 4, 5, 6, 7, 8, 9, 10 or more times).
  • the Therapeutic Agent may be administered to a subject in a pharmaceutical composition.
  • the Therapeutic Agent is sole/single agent administered to the subject.
  • the Therapeutic Agents is administered in combination with one or more other therapies (e.g., an antibody that immunospecifically binds to Her2, PD-1 or a ligand of PD-1 (e.g., PD-L1)).
  • Combination therapy includes concurrent and successive administration of a Therapeutic Agent and another therapy.
  • the Therapeutic Agent and another therapy are said to be administered concurrently if they are administered to the patient on the same day, for example, simultaneously, or 1 , 2, 3, 4, 5, 6, 7, or 8 hours apart.
  • the Therapeutic Agent and another therapy are said to be administered concurrently if they are administered to the patient on the same day, for example, simultaneously, or 1 , 2, 3, 4, 5, 6, 7, or 8 hours apart.
  • the Therapeutic Agent and another therapy are said to be administered concurrently if they are administered to the patient on the same day, for example, simultaneously, or 1 , 2, 3, 4, 5, 6, 7, or 8 hours apart
  • Therapeutic Agent and the therapy are said to be administered successively if they are administered to the patient on the different days, for example, the Therapeutic Agent and the therapy can be administered at a 1-day, 2-day or 3 -day intervals. In the methods described herein, administration of the Therapeutic Agent can precede or follow administration of the second therapy. When administered simultaneously, the Therapeutic Agent and the other therapy can be in the same pharmaceutical composition or in a different pharmaceutical composition..
  • examples of immune function enhanced by the methods described herein include the proliferation/expansion of lymphocytes (e.g., increase in the number of lymphocytes), inhibition of apoptosis of lymphocytes, activation of dendritic cells (or antigen presenting cells), and antigen presentation.
  • an immune function enhanced by the methods described herein is proliferation/expansion in the number of or activation of CD4 + T cells (e.g., Thl and Th2 helper T cells), CD8 + T cells (e.g., cytotoxic T lymphocytes, alpha/beta T cells, and gamma/delta T cells), B cells (e.g., plasma cells), memory T cells, memory B cells, dendritic cells (immature or mature), antigen presenting cells, macrophages, mast cells, natural killer T cells (NKT cells), tumor-resident T cells, CD122 + T cells, or natural killer cells (NK cells).
  • the methods described herein enhance the proliferation/expansion or number of lymphocyte progenitors.
  • the methods described herein increases the number of CD4 + T cells (e.g., Thl and Th2 helper T cells), CD8 + T cells (e.g., cytotoxic T lymphocytes, alpha/beta T cells, and gamma/delta T cells), B cells (e.g., plasma cells), memory T cells, memory B cells, dendritic cells (immature or mature), antigen presenting cells, macrophages, mast cells, natural killer T cells (NKT cells), tumor-resident T cells, CD122 + T cells, or natural killer cells (NK cells) by approximately 1 fold, 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 20 fold, or more relative a negative control (e.g., number of the respective cells not treated, cultured, or contacted with a Therapeutic Agent).
  • CD4 + T cells e.g., Thl and Th2 helper T cells
  • CD8 + T cells e.g., cytotoxic T lymphocytes
  • the methods described herein enhance or induce immune function in a subject by at least 0.2 fold, 0.5 fold, 0.75 fold, 1 fold, 1.5 fold, 2 fold, 2.5 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold 9 fold, or at least 10 fold relative to the immune function in a subject not administered the Therapeutic Agent using assays well known in the art, e.g., ELISPOT, ELISA, and cell proliferation assays.
  • assays well known in the art, e.g., ELISPOT, ELISA, and cell proliferation assays.
  • the methods described herein enhance or induce immune function in a subject by at least 99%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, at least 50%, at least 45%, at least 40%, at least 45%, at least 35%, at least 30%, at least 25%, at least 20%, or at least 10% relative to the immune function in a subject not administered the Therapeutic Agent using assays well known in the art, e.g., ELISPOT, ELISA, and cell proliferation assays.
  • the immune function is cytokine release (e.g., interferon-gamma, IL-2, IL-5, IL-10, IL-12, or transforming growth factor (TGF) -beta).
  • the IL-15 mediated immune function is NK cell proliferation, which can be assayed, e.g. , by flow cytometry to detect the number of cells expressing markers of NK cells (e.g., CD56).
  • the IL-15 mediated immune function is CD8 + T cell proliferation (see, e.g., Figure 8 and Example 5), which can be assayed, e.g., by flow cytometry or by a method described in the Examples Section below.
  • the IL-15 mediated immune function is antibody production, which can be assayed, e.g., by ELISA.
  • the IL-15 mediated immune function is effector function, which can be assayed, e.g. , by a cytotoxicity assay or other assays well known in the art.
  • Peripheral blood lymphocytes counts in a mammal can be determined by, e.g. , obtaining a sample of peripheral blood from said mammal, separating the lymphocytes from other components of peripheral blood such as plasma using, e.g. , Ficoll- Hypaque (Pharmacia) gradient centrifugation, and counting the lymphocytes using trypan blue.
  • Peripheral blood T-cell counts in mammal can be determined by, e.g., separating the
  • T-cell antigen such as CD3, CD4, and CD8 which is conjugated to FITC or phycoerythrin, and measuring the number of T-cells by FACS.
  • T cells e.g., CD2 + , CD4 + , CD8 + , CD4 + RO + , CD8 + RO + , CD4 + RA + , or CD8 RA
  • NK cells can be determined using standard techniques known to one of skill in the art such as FACS.
  • the plasma levels of IL-15 can be assessed using standard techniques known to one of skill in the art. For example, a plasma can be obtained from a blood sample obtained from a subject and the levels of IL-15 in the plasma can be measured by ELISA.
  • kits for preventing, treating, and/or managing cancer in a dose escalation regimen comprising administering to a subject an effective amount of a Therapeutic Agent or a composition comprising a Therapeutic Agent to a subject in need thereof.
  • the methods described herein do not involve a cyclical administration regimen of the Therapeutic Agent.
  • the effect of a Therapeutic Agent on proliferation of cancer cells can be detected by routine assays, such as by assays that measure the uptake of radiolabeled thymidine.
  • cell viability can be measured by assays that measure lactate dehydrogenase (LDH), a stable cytosolic enzyme that is released upon cell lysis, or by the release of [ 51 Cr] upon cell lysis.
  • LDH lactate dehydrogenase
  • necrosis measured by the ability or inability of a cell to take up a dye such as neutral red, trypan blue, or ALAMARTM blue (Page et ah, 1993, Intl. J. of Oncology 3:473 476).
  • the cells are incubated in media containing the dye, the cells are washed, and the remaining dye, reflecting cellular uptake of the dye, is measured spectrophotometrically.
  • the dye is sulforhodamine B (SRB), whose binding to proteins can be used as a measure of cytotoxicity (Skehan et ah, 1990, J. Nat'l Cancer Inst. 82: 1107 12).
  • SRB sulforhodamine B
  • a tetrazolium salt such as MTT, is used in a quantitative colorimetric assay for mammalian cell survival and proliferation by detecting living, but not dead, cells (see, e.g., Mosmann, 1983, J. Immunol. Methods 65:55 63).
  • apoptotic cells are measured in both the attached and "floating" compartments of the cultures. Both compartments are collected by removing the supernatant, trypsinizing the attached cells, and combining both preparations following a centrifugation wash step (10 minutes, 2000 rpm).
  • the protocol for treating tumor cell cultures with sulindac and related compounds to obtain a significant amount of apoptosis has been described in the literature (see, e.g., Piazza et ah, 1995, Cancer Research 55:3110 16).
  • Features of this method include collecting both floating and attached cells, identification of the optimal treatment times and dose range for observing apoptosis, and identification of optimal cell culture conditions.
  • apoptosis is quantitated by measuring DNA
  • apoptosis can be observed morphologically.
  • Cancer cell lines on which such assays can be performed are well known to those of skill in the art. Apoptosis, necrosis and proliferation assays can also be performed on primary cells, e.g. , a tissue explant.
  • the proliferation or viability of cancer cells contacted with a Therapeutic Agent or a composition comprising a Therapeutic Agent is inhibited or reduced by at least 2 fold, preferably at least 2.5 fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 7 fold, or at least 10 fold relative to the proliferation of the cancer cells when contacted with a negative control as measured using assays well known in the art, e.g. , cell proliferation assays using CSFE, BrdU, and 3 H-Thymidine incorporation.
  • the proliferation of cancer cells contacted with a Therapeutic Agent or a composition comprising a Therapeutic Agent is inhibited or reduced by at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% relative to cancer cells contacted with a negative control as measured using assays well known in the art, e.g., cell proliferation assays using CSFE, BrdU, and 3 H-Thymidine incorporation, or those assays described above.
  • the composition comprising a Therapeutic Agent further comprises cells ⁇ e.g. , NK cells or cytotoxic T cells) that are responsive to IL-15 signaling and that can target and exert cytotoxic effects on the cancer cells.
  • the administration of a Therapeutic Agent to a subject in accordance with the methods described herein achieves one, two, or three or more results: (1) a reduction in the growth of a tumor or neoplasm; (2) a reduction in the formation of a tumor; (3) an eradication, removal, or control of primary, regional and/or metastatic cancer; (4) a reduction in metastatic spread; (5) a reduction in mortality; (6) an increase in survival rate; (7) an increase in length of survival; (8) an increase in the number of patients in remission; (9) a decrease in hospitalization rate; (10) a decrease in hospitalization lengths; and (11) the maintenance in the size of the tumor so that it does not increase by more than 10%, or by more than 8%, or by more than 6%, or by more than 4%; preferably the size of the tumor does not increase by more than 2%.
  • the administration of a Therapeutic Agent, or a composition comprising a Therapeutic Agent to a subject with cancer in accordance with the methods described herein inhibits or reduces the growth of a tumor by at least 2 fold, preferably at least 2.5 fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 7 fold, or at least 10 fold relative to the growth of a tumor in a subject with cancer (in some embodiments, in the same animal model for cancer) administered a negative control as measured using assays well known in the art.
  • the administration of a Therapeutic Agent or an Engineered Cell(s), or a composition comprising a Therapeutic Agent to a subject with cancer in accordance with the methods described herein inhibits or reduces the growth of a tumor by at least 25%, at least 30%>, at least 35%, at least 40%>, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% relative to the growth of a tumor in a subject with cancer (in some embodiments, in the same animal model for cancer)
  • the administration of a Therapeutic Agent,or a composition comprising a Therapeutic Agent to a subject with cancer in some embodiments, an animal model for cancer in accordance with the methods described herein reduces the size of a tumor by at least 2 fold, preferably at least 2.5 fold, at least 3 fold, at least 4 fold, at least 5 fold, at least 7 fold, or at least 10 fold relative to the growth of a tumor in a subject with cancer (in some embodiments, the same animal model for cancer) in accordance with the methods described herein administered a negative control as measured using assays well known in the art.
  • the administration of a Therapeutic Agent, or a composition comprising a Therapeutic Agent to a subject with cancer reduces the size of a tumor by at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% relative to the growth of a tumor in a subject with cancer (in some embodiments, the same animal model for cancer) administered a negative control (e.g., saline or PBS) as measured using assays well known in the art.
  • the cancer is melanoma, renal cancer, colon cancer, or prostate cancer.
  • the cancer is metastatic.
  • a Therapeutic Agent can be administered in combination with one or more other therapies, e.g., anti-cancer agents, cytokines or anti-hormonal agents, to treat and/or manage cancer.
  • therapies e.g., anti-cancer agents, cytokines or anti-hormonal agents.
  • Non-limiting examples anti-cancer agents are described below. See Section 5.9, infra, and in particular, Section 5.9.1, infra.
  • Therapeutic Agent and one or more other therapies provides an additive therapeutic effect relative to the therapeutic effects of the Therapeutic Agent alone or the one or more other therapies alone. In one embodiment, the combination of a Therapeutic Agent and one or more other therapies provides more than an additive therapeutic effect relative to the therapeutic effects of the Therapeutic Agent alone or the one or more other therapies alone. In one embodiment, the combination of a Therapeutic Agent and one or more other therapies provides a synergistic therapeutic effect relative to the therapeutic effects of the Therapeutic Agent alone or the one or more other therapies alone.
  • the one or more therapies include, but are not limited to cytokines/growth factors, e.g., interleukin (IL) 1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL- 10, IL-11, IL-12, 11-15, TNF-a, TNF- ⁇ , TGF- ⁇ , GM-CSF, and interferon- ⁇ .
  • cytokines/growth factors e.g., interleukin (IL) 1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL- 10, IL-11, IL-12, 11-15, TNF-a, TNF- ⁇ , TGF- ⁇ , GM-CSF, and interferon- ⁇ .
  • the one or more therapies include, but are not limited to receptors, antibodies, or other binding agents that bind to cytokines/growth factors, e.g., interleukin (IL) 1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, TNF-a, TNF- ⁇ , TGF- ⁇ , GM-CSF, interferon-a, interferon- ⁇ , and interferon- ⁇ .
  • cytokines/growth factors e.g., interleukin (IL) 1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-10, IL-11, IL-12, TNF-a, TNF- ⁇ , TGF- ⁇ , GM-CSF, interferon-a, interferon- ⁇ , and interferon- ⁇ .
  • the one or more therapies include, but are not limited to, cells recombinantly expressing a therapeutic protein (or polypeptides), e.g., a cytokine, a growth factor, a chemokine, or a fragment or derivative thereof.
  • the one or more therapies include, but are not limited to, cells recombinantly expressing IL-12, IL-6, GM-CSF, interferon-a, interferon- ⁇ , interferon- ⁇ or TNF-a.
  • such therapies are administered prior to, concurrently with, or after administration of a Therapeutic Agent, wherein the Therapeutic Agent is administered in accordance with the methods described herein
  • a Therapeutic Agent can also be administered in combination with radiation therapy comprising, e.g., the use of x-rays, gamma rays and other sources of radiation to destroy the cancer cells.
  • the radiation treatment is administered as external beam radiation or teletherapy wherein the radiation is directed from a remote source.
  • the radiation treatment is administered as internal therapy or brachytherapy wherein a radioactive source is placed inside the body close to cancer cells or a tumor mass.
  • a Therapeutic Agent can be administered in accordance with the methods described herein before, during or after radiation therapy.
  • the Therapeutic Agent can enhance the immune function of cancer patient with a compromised immune system due to anti-cancer therapy.
  • a Therapeutic Agent can also be administered in combination with chemotherapy.
  • a Therapeutic Agent can be administered in accordance with the methods described herein before, during or after radiation therapy or chemotherapy.
  • a Therapeutic Agent can be used before, during or after surgery.
  • methods provided herein include the combination of transplant and a Therapeutic Agent.
  • Non-limiting examples of anti-hormonal agents are anti-hormonal agents that act to regulate or inhibit hormone action on tumors, such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX® tamoxifen), raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY1 17018, onapristone, and FARESTON toremifene; aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE® megestrol acetate, AROMASIN®V exemestane, formestanie, fadrozole, RIVISOR® vorozole, FEMARA® letrozole, and ARIMIDEX®D anastrozole; and anti-and
  • PROLEUKIN® rIL-2 PROLEUKIN® rIL-2; LURTOTECAN® topoisomerase 1 inhibitor; ABARELX® rmRH; Vinorelbine and Esperamicins (see U.S. Pat. No. 4,675,187), and pharmaceutically acceptable salts, acids or derivatives of any of the above.
  • a Therapeutic Agent is administered to a subject in combination with an antibody that immunospecifically binds to programmed cell death (PD- 1) or a ligand thereof (e.g., PD-L1).
  • a method for preventing, treating and/or managing cancer comprising administering an IL- 15/IL-15Ra complex and administering an antibody that immunospecifically binds to PD-1 or a ligand thereof.
  • administering an IL-15/IL-15Ra complex increases (e.g., approximately 2 fold increase) expression levels of PD-1 (see, e.g., Figure 8 and Example 5), and an antibody that immunospecifically binds to PD-1 reduces expression levels of PD-1.
  • the antibody is administered after the IL-15/IL-15Ra complex is administered. In other embodiments, the antibody is administered before the IL- 15/IL-15Ra complex is administered. In specific embodiments, the cancer is melanoma, prostate cancer, or lung cancer.
  • a Therapeutic Agent is administered to a subject in combination with an antibody that immunospecifically binds to Her2 (e.g. , Herceptin®).
  • an antibody that immunospecifically binds to Her2 e.g. , Herceptin®
  • provided herein is a method for preventing, treating and/or managing cancer comprising administering an IL-15/IL-15Ra complex and administering an antibody that immunospecifically binds to Her2 (e.g. , Herceptin®)
  • the antibody is administered after the IL-15/IL-15Ra complex is administered.
  • the antibody is administered before the IL-15/IL-15Ra complex is
  • the cancer is breast cancer.
  • a Therapeutic Agent is administered to a subject in combination with an antibody that immunospecifically binds to CD20 (e.g.,
  • a method for preventing, treating and/or managing cancer comprising administering an IL-15/IL-15Ra complex and administering an antibody that immunospecifically binds to CD20.
  • the antibody is administered after the IL-15/IL-15Ra complex is administered.
  • the antibody is administered before the IL-15/IL-15Ra complex is administered.
  • the cancer is non-Hodgkin's lymphoma or chronic lymphocytic leukemia.
  • Cancers and related disorders that can be prevented, treated, or managed in accordance with the methods described herein include, but are not limited to, the following: Leukemias including, but not limited to, acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemias such as myeloblastic, promyelocytic, myelomonocytic, monocytic, erythroleukemia leukemias and myelodysplasia syndrome, chronic leukemias such as but not limited to, chronic myelocytic (granulocytic) leukemia, and chronic lymphocytic leukemia, hairy cell leukemia; polycythemia vera; lymphomas such as but not limited to Hodgkin's disease, and non-Hodgkin's disease; multiple myelomas such as but not limited to smoldering multiple myeloma, nonsecretory myeloma, osteosclerotic myelom
  • brain tumors including but not limited to, glioma, astrocytoma, brain stem glioma, ependymoma, oligodendroglioma, nonglial tumor, acoustic neurinoma,
  • breast cancer including, but not limited to, adenocarcinoma, lobular (small cell) carcinoma, intraductal carcinoma, medullary breast cancer, mucinous breast cancer, tubular breast cancer, papillary breast cancer, Paget' s disease, and inflammatory breast cancer; adrenal cancer, including but not limited to, pheochromocytom and
  • thyroid cancer such as but not limited to papillary or follicular thyroid cancer, medullary thyroid cancer and anaplastic thyroid cancer
  • pancreatic cancer including but not limited to, insulinoma, gastrinoma, glucagonoma, vipoma, somatostatin- secreting tumor, and carcinoid or islet cell tumor
  • pituitary cancers including but not limited to, Cushing's disease, prolactin-secreting tumor, acromegaly, and diabetes insipius
  • eye cancers including but not limited to, ocular melanoma such as iris melanoma, choroidal melanoma, and cilliary body melanoma, and retinoblastoma
  • vaginal cancers including but not limited to, squamous cell carcinoma, adenocarcinoma, and melanoma
  • vulvar cancer including but not limited to, squamous cell carcinoma, mela
  • esophageal cancers including but not limited to, squamous cancer, adenocarcinoma, adenoid cyctic carcinoma, mucoepidermoid carcinoma, adenosquamous carcinoma, sarcoma, melanoma, plasmacytoma, verrucous carcinoma, and oat cell (small cell) carcinoma; stomach cancers including but not limited to, adenocarcinoma, fungating (polypoid), ulcerating, superficial spreading, diffusely spreading, malignant lymphoma, liposarcoma, fibrosarcoma, and carcinosarcoma; colon cancers; rectal cancers; liver cancers including but not limited to hepatocellular carcinoma and hepatoblastoma; gallbladder cancers including but not limited to, adenocarcinoma; cholangiocarcinomas including but not limited to, pappillary, nodular, and diffuse; lung cancers including but not limited to, non-small cell
  • endotheliosarcoma lymphangioendotheliosarcoma, mesothelioma, synovioma,
  • the cancer is benign, e.g., polyps and benign lesions.
  • the cancer is metastatic.
  • the Therapeutic Agents can be used in the treatment of pre-malignant as well as malignant conditions.
  • Pre-malignant conditions include hyperplasia, metaplasia, and dysplasia.
  • Treatment of malignant conditions includes the treatment of primary as well as metastatic tumors.
  • the cancer is melanoma, prostate cancer, colon cancer, renal cell carcinoma, or lung cancer (e.g., non-small cell lung cancer).
  • the cancer is metastatic melanoma, metastaic colon cancer, metastatic renal cell carcinoma, or metastatic lung cancer (e.g., metastatic non- small cell lung cancer).
  • a Therapeutic Agent a composition comprising a
  • Therapeutic Agent, or combination therapies are administered to a subject suffering from or diagnosed with cancer.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or combination therapies are administered to a subject predisposed or susceptible to developing cancer.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or combination therapies are administered to a subject that lives in a region where there is a high occurrence rate of cancer.
  • the cancer is characterized by a pre-malignant tumor or a malignant tumor.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a mammal which is 0 to 6 months old, 6 to 12 months old, 1 to 5 years old, 5 to 10 years old, 10 to 15 years old, 15 to 20 years old, 20 to 25 years old, 25 to 30 years old, 30 to 35 years old, 35 to 40 years old, 40 to 45 years old, 45 to 50 years old, 50 to 55 years old, 55 to 60 years old, 60 to 65 years old, 65 to 70 years old, 70 to 75 years old, 75 to 80 years old, 80 to 85 years old, 85 to 90 years old, 90 to 95 years old or 95 to 100 years old.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a human at risk developing cancer.
  • composition comprising a Therapeutic Agent, or a combination therapy is administered to a human with cancer.
  • the patient is a human 0 to 6 months old, 6 to 12 months old, 1 to 5 years old, 5 to 10 years old, 5 to 12 years old, 10 to 15 years old, 15 to 20 years old, 13 to 19 years old, 20 to 25 years old, 25 to 30 years old, 20 to 65 years old, 30 to 35 years old, 35 to 40 years old, 40 to 45 years old, 45 to 50 years old, 50 to 55 years old, 55 to 60 years old, 60 to 65 years old, 65 to 70 years old, 70 to 75 years old, 75 to 80 years old, 80 to 85 years old, 85 to 90 years old, 90 to 95 years old or 95 to 100 years old.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a human infant or a premature human infant. In other embodiments, a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a human child. In other embodiments, a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a human adult. In yet other embodiments, a Therapeutic Agent, a
  • composition comprising a Therapeutic Agent, or a combination therapy is administered to an elderly human.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a pet, e.g., a dog or cat.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a farm animal or livestock, e.g. , pig, cows, horses, chickens, etc.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a primate, preferably a human, or another mammal, such as a pig, cow, horse, sheep, goat, dog, cat and rodent, in an immunocompromised state or immunosuppressed state or at risk for becoming
  • a primate preferably a human, or another mammal, such as a pig, cow, horse, sheep, goat, dog, cat and rodent
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject receiving or recovering from immunosuppressive therapy.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject that has or is at risk of getting AIDS, a viral infection, or a bacterial infection.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject that lives in a nursing home, a group home (i.e., a home for 10 or more subjects), or a prison.
  • a patient is administered a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is before any adverse effects or intolerance to therapies other than Therapeutic Agents develops.
  • Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies are administered to refractory patients.
  • refractory patient is a patient refractory to a standard anti-cancer therapy.
  • a patient with cancer is refractory to a therapy when the cancer has not significantly been eradicated and/or the symptoms have not been significantly alleviated.
  • a patient with cancer is refractory when a cancerous tumor has not decreased or has increased.
  • a Therapeutic Agent a composition comprising a
  • Therapeutic Agent, or combination therapy(ies) is administered to a patient to prevent the onset or reoccurrence of cancer in a patient at risk of developing such cancer.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or combination therapy(ies) is administered to a patient who is susceptible to adverse reactions to conventional therapies.
  • one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies are administered to a patient who has proven refractory to therapies other than Therapeutic Agents, but are no longer on these therapies.
  • the patients being managed or treated in accordance with the methods described herein are patients already being treated with antibiotics, anti-cancer agents, or other biological therapy/immunotherapy. Among these patients are refractory patients, patients who are too young for conventional therapies, and patients with reoccurring viral infections despite management or treatment with existing therapies.
  • the subject being administered one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies has not received a therapy prior to the administration of the Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies.
  • one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies are administered to a subject who has received a therapy prior to administration of one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies.
  • the subject administered a Therapeutic Agent or a composition comprising a Therapeutic Agent was refractory to a prior therapy or experienced adverse side effects to the prior therapy or the prior therapy was discontinued due to unacceptable levels of toxicity to the subject.
  • kits for treating, preventing and/or managing an infectious disease in a dose escalation regimen comprising administering an effective amount of a Therapeutic Agent or a composition comprising a Therapeutic Agent to a subject in need thereof.
  • the methods described herein do not involve a cyclical administration regimen of the Therapeutic Agent.
  • the induced or enhanced immune response by administration of a Therapeutic Agent to a patient in accordance with the methods described herein is increased production in the patient of antibodies to the infected cells or to the antigens of the pathogen.
  • the induced or enhanced immune response by administration of a Therapeutic Agent to a patient in accordance with the methods described herein is increased production of antibodies to the pathogen.
  • the induced or enhanced immune response by administration of a Therapeutic Agent to a patient in accordance with the methods described herein is an increase in effector cell function, e.g., antibody-dependent cellular cytotoxicity (ADCC) against the pathogen and/or cells infected with a pathogen in the patient.
  • ADCC antibody-dependent cellular cytotoxicity
  • the induced or enhanced immune response by administration of a Therapeutic Agent to a patient in accordance with the methods described herein is increase in lymphocyte number, lymphocyte proliferation, and/or lymphocyte activity.
  • the induced or enhanced immune response by administration of a Therapeutic Agent to a patient in accordance with the methods described herein is an increase in effector cell function, e.g., cytotoxic cells or antibody-dependent cellular cytotoxicity (ADCC) against the infected cells in the patient.
  • effector cell function e.g., cytotoxic cells or antibody-dependent cellular cytotoxicity (ADCC) against the infected cells in the patient.
  • a Therapeutic Agent can be administered in combination with one or more other therapies.
  • Non- limiting examples of other therapies that can be used in combination with Therapeutic Agents are described herein. See Section 5.9, infra, and in particular, Sections 5.9.2 and 5.9.3, infra.
  • Therapeutic Agent and one or more other therapies provides an additive therapeutic effect relative to the therapeutic effects of the Therapeutic Agent or Engineered Cell(s) alone or the one or more other therapies alone.
  • the combination of a Therapeutic Agent and one or more other therapies provides more than an additive therapeutic effect relative to the therapeutic effects of the Therapeutic Agent alone or the one or more other therapies alone.
  • the combination of a Therapeutic Agent and one or more other therapies provides a synergistic therapeutic effect relative to the therapeutic effects of the Therapeutic Agent alone or the one or more other therapies alone.
  • the one or more additional therapies are administered prior to, concurrently with, or after administration of a Therapeutic Agent, wherein the Therapeutic Agent is administered in accordance with the methods described herein.
  • Infectious diseases that can be treated, prevented, and/or managed by Therapeutic Agents are caused by infectious agents including but not limited to bacteria, fungi, protozae, and viruses.
  • Viral diseases that can be prevented, treated and/or managed in accordance with the methods described herein include, but are not limited to, those caused by hepatitis type A, hepatitis type B, hepatitis type C, influenza, varicella, Epstein-Barr virus, adenovirus, herpes simplex type I (HSV-I), herpes simplex type II (HSV-II), rinderpest, rhinovirus, echovirus, rotavirus, respiratory syncytial virus, papilloma virus, papova virus, cytomegalovirus, echinovirus, arbovirus, huntavirus, coxsackie virus, mumps virus, measles virus, rubella virus, polio virus, small pox virus, Epstein Barr virus, human immunodeficiency virus type I (HIV -I), human immunodeficiency virus type II (HIV-II), and agents of viral diseases such as viral meningitis, encephalitis,
  • Bacterial diseases caused by bacteria e.g. , Escherichia coli, Klebsiella pneumoniae, Staphylococcus aureus, Enterococcus faecials, Candida albicans, S.
  • bacteria e.g. , Escherichia coli, Klebsiella pneumoniae, Staphylococcus aureus, Enterococcus faecials, Candida albicans, S.
  • Mycobacterium tuberculosis, Clostridium tetani, Neisseria meningitides, Yersinia pestis, and Pseudomonas aeruginosa) that can be prevented, treated and/or managed in accordance with the methods described herein include, but are not limited to, mycoplasma, sepsis, and bubonic plague, Lyme disease, anthrax, tetanus, pertissus, cholera, plague, diptheria, chlamydia, pneumonia, toxic shock syndrome, scarlet fever, leprosy, meningococcal disease, necrotizing fasciitis, tuberculosis, and legionella.
  • the bacterial disease is pneumonia or tuberculosis.
  • Protozoal diseases caused by protozoa that can be prevented, treated and/or managed in accordance with the methods described herein include, but are not limited to, leishmania, kokzidioa, trypanosoma or malaria.
  • Parasitic diseases caused by parasites that can be prevented, treated and/or managed in accordance with the methods described herein include, but are not limited to, chlamydia and rickettsia.
  • administering a Therapeutic Agent or a composition comprising a Therapeutic Agent to a subject (in some embodiments, an animal model) infected with an infectious agent in accordance with the methods described herein inhibits or reduces replication of the infectious agent by at least 20% to 25%, preferably at least 25% to 30%, at least 30% to 35%, at least 35% to 40%, at least 40% to 45%, at least 45% to 50%, at least 50% to 55%, at least 55% to 60%, at least 60% to 65%, at least 65% to 70%, at least 70%) to 75%), at least 75% to 80%>, or up to at least 85% relative to a negative control as determined using an assay described herein or others known to one of skill in the art.
  • administering a Therapeutic Agent or a composition comprising a Therapeutic Agent to a subject (in some embodiments, an animal model) infected with an infectious agent in accordance with the methods described herein inhibits or reduces replication of the infectious agent by at least 1.5 fold, 2 fold, 2.5 fold, 3 fold, 4 fold, 5 fold, 8 fold, 10 fold, 15 fold, 20 fold, or 2 to 5 fold, 2 to 10 fold, 5 to 10 fold, or 5 to 20 fold relative to a negative control as determined using an assay described herein or others known to one of skill in the art.
  • administering a Therapeutic Agent or a composition comprising a Therapeutic Agent to a subject (in some embodiments, an animal model) infected with an infectious agent in accordance with the methods described herein inhibits or reduces replication of the infectious agent by 1 log, 1.5 logs, 2 logs, 2.5 logs, 3 logs, 3.5 logs, 4 logs, 5 logs or more relative to a negative control as determined using an assay described herein or others known to one of skill in the art.
  • administering a Therapeutic Agent or a composition comprising a Therapeutic Agent to a subject (in some embodiments, an animal model) infected with an infectious agent in accordance with the methods described herein reduces the titer of the infectious agent by at least 20% to 25%, preferably at least 25% to 30%, at least 30% to 35%, at least 35% to 40%, at least 40% to 45%, at least 45% to 50%, at least 50% to 55%, at least 55% to 60%, at least 60% to 65%, at least 65% to 70%, at least 70% to 75%, at least 75%) to 80%>, or up to at least 85% relative to a negative control as determined using an assay described herein or others known to one of skill in the art.
  • administering a Therapeutic Agent or a composition comprising a Therapeutic Agent to a subject (in some embodiments, an animal model) infected with an infectious agent in accordance with the methods described herein reduces the titer of the infectious agent by at least 1.5 fold, 2 fold, 2.5 fold, 3 fold, 4 fold, 5 fold, 8 fold, 10 fold, 15 fold, 20 fold, or 2 to 5 fold, 2 to 10 fold, 5 to 10 fold, or 5 to 20 fold relative to a negative control as determined using an assay described herein or others known to one of skill in the art.
  • administering aTherapeutic Agent or a composition comprising a Therapeutic Agent to a subject (in some embodiments, an animal model) infected with an infectious agent in accordance with the methods described herein reduces the titer of the infectious agent by 1 log, 1.5 logs, 2 logs, 2.5 logs, 3 logs, 3.5 logs, 4 logs, 5 logs or more relative to a negative control as determined using an assay described herein or others known to one of skill in the art.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject suffering from an infectious disease caused by infectious agents including, but not limited to bacteria, fungi, protozae, and viruses.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject predisposed or susceptible to an infectious disease.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject that lives in a region where there has been or might be an outbreak with infections by infectious agents.
  • the infection is a latent infection.
  • the infection by the infectious agent is an active infection.
  • the infection by the infectious agent is a chronic infection.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject with a chronic infection.
  • a Therapeutic Agent(s), a composition comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject with an infection that persists for weeks, months, years, decades or a lifetime.
  • the infection persists for a period of time (e.g., weeks, months, years or decades) without the subject manifesting symptoms.
  • infectious agents capable of inducing a chronic infection include viruses (e.g., cytomegalovirus, Epstein Barr virus, hepatitis B virus, hepatitis C virus, herpes simplex virus, types I and II, human immunodeficiency virus, types 1 and 2, human papillomavirus, human T lymphotrophic viruses, types 1 and 2, varicella zoster virus and the like), bacteria (e.g., cytomegalovirus, Epstein Barr virus, hepatitis B virus, hepatitis C virus, herpes simplex virus, types I and II, human immunodeficiency virus, types 1 and 2, human papillomavirus, human T lymphotrophic viruses, types 1 and 2, varicella zoster virus and the like), bacteria (e.g., cytomegalovirus, Epstein Barr virus, hepatitis B virus, hepatitis C virus, herpes simplex virus, types I and II, human immunodeficiency virus, types 1 and
  • Mycobacterium tuberculosis Mycobacterium tuberculosis, Listeria spp., Klebsiella pneumoniae, Streptococcus pneumoniae, Staphylococcus aureus, Borrelia spp., Helicobacter pylori, and the like), protozoan parasites (e.g., Leishmania spp., Plasmodium falciparum, Schistosoma spp., Toxoplasma spp., Trypanosoma spp., Taenia carssiceps and the like), and fungi (e.g., Aspergillus spp., Candida albicans, Coccidioides immitis, Histoplasma capsulatum,
  • protozoan parasites e.g., Leishmania spp., Plasmodium falciparum, Schistosoma spp., Toxoplasma spp., Trypanosoma spp., Taenia
  • Additional infectious agents include prions or misfolded proteins that affect the brain or neuron structure by further propagating protein misfolding in these tissues, resulting in the formation of amyloid plaques which cause cell death, tissue damage and eventual death.
  • Example of disease resulting from prion infection include:
  • GSS Gerstmann-Straussler-Scheinker syndrome
  • sFI fatal familial insomnia
  • BSE Bovine spongiform encephalopathy
  • encephalopathy e.g., transmissible mink encephalopathy (TME), chronic wasting disease (CWD) in white-tailed deer, elk and mule deer, feline spongiform encephalopathy, exotic ungulate encephalopathy (EUE) in nyala, oryx and greater kudu, spongiform encephalopathy of the ostrich).
  • TAE transmissible mink encephalopathy
  • CWD chronic wasting disease
  • EUE exotic ungulate encephalopathy
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject with a latent infection.
  • a Therapeutic Agent(s), a composition(s) comprising aTherapeutic Agent(s), or a combination therapy(ies) is administered to a subject with an active infection.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject with a bacterial infection.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) with a fungal infection is administered to a subject with a bacterial infection.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a mammal which is 0 to 6 months old, 6 to 12 months old, 1 to 5 years old, 5 to 10 years old, 10 to 15 years old, 15 to 20 years old, 20 to 25 years old, 25 to 30 years old, 30 to 35 years old, 35 to 40 years old, 40 to 45 years old, 45 to 50 years old, 50 to 55 years old, 55 to 60 years old, 60 to 65 years old, 65 to 70 years old, 70 to 75 years old, 75 to 80 years old, 80 to 85 years old, 85 to 90 years old, 90 to 95 years old or 95 to 100 years old.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s) or a combination therapy(ies) is administered to a human at risk for a virus infection.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s) or a combination therapy(ies) is administered to
  • Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a human with a virus infection.
  • the patient is a human 0 to 6 months old, 6 to 12 months old, 1 to 5 years old, 5 to 10 years old, 5 to 12 years old, 10 to 15 years old, 15 to 20 years old, 13 to 19 years old, 20 to 25 years old, 25 to 30 years old, 20 to 65 years old, 30 to 35 years old, 35 to 40 years old, 40 to 45 years old, 45 to 50 years old, 50 to 55 years old, 55 to 60 years old, 60 to 65 years old, 65 to 70 years old, 70 to 75 years old, 75 to 80 years old, 80 to 85 years old, 85 to 90 years old, 90 to 95 years old or 95 to 100 years old.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a human infant or premature human infant.
  • Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a human child.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a human adult.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to an elderly human.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a pet, e.g., a dog or cat.
  • Therapeutic Agent(s), or a combination therapy(ies) is administered to a farm animal or livestock, e.g., pig, cows, horses, chickens, etc.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a bird, e.g., ducks or chicken.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a primate, preferably a human, or another mammal, such as a pig, cow, horse, sheep, goat, dog, cat and rodent, in an immunocompromised state or immunosuppressed state or at risk for becoming
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject receiving or recovering from immunosuppressive therapy.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject that has or is at risk of getting cancer, AIDS, another infection, or a bacterial infection.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject that is HIV positive as assessed by techniques known to one skilled in the art.
  • a subject that is, will or has undergone surgery, chemotherapy and/or radiation therapy In certain embodiments, a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s),or a combination therapy(ies) is administered to a subject that has cystic fibrosis, pulmonary fibrosis, or another disease which makes the subject susceptible to an infection. In certain embodiments, a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject that has, will have or had a tissue transplant. In some
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject that lives in a nursing home, a group home ⁇ i.e., a home for 10 or more subjects), or a prison.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject that attends school ⁇ e.g., elementary school, middle school, junior high school, high school or university) or daycare.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject that works in the healthcare area, such as a doctor or a nurse, or in a hospital.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a subject that is pregnant or will become pregnant.
  • a patient is administered a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) before any adverse effects or intolerance to therapies other than Therapeutic Agents develops.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to refractory patients.
  • refractory patient is a patient refractory to a standard therapy.
  • a patient with an infection is refractory to a therapy when the infection has not significantly been eradicated and/or the symptoms have not been significantly alleviated.
  • a patient with an infection is refractory when replication of the infectious agent has not decreased or has increased.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a patient to prevent the onset or reoccurrence of infections ⁇ e.g., viral infections) in a patient at risk of developing such infections.
  • a Therapeutic Agent(s), a composition(s) comprising a Therapeutic Agent(s), or a combination therapy(ies) is administered to a patient who is susceptible to adverse reactions to conventional therapies.
  • one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies are administered to a patient who has proven refractory to therapies other than Therapeutic Agents, but are no longer on these therapies.
  • the patients being managed or treated in accordance with the methods of this invention are patients already being treated with antibiotics, anti-virals, anti-fungals, or other biological therapy/immunotherapy. Among these patients are refractory patients, patients who are too young for conventional therapies, and patients with reoccurring viral infections despite management or treatment with existing therapies.
  • the subject being administered one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies has not received a therapy prior to the administration of the Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies.
  • one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies are administered to a subject who has received a therapy prior to administration of one or more Therapeutic Agents or compositions comprising one or more Therapeutic Agents, or combination therapies.
  • Therapeutic Agent or a composition comprising a Therapeutic Agent was refractory to a prior therapy or experienced adverse side effects to the prior therapy or the prior therapy was discontinued due to unacceptable levels of toxicity to the subject.
  • kits for treating, preventing and/or managing an immunodeficiency or lymphopenia in a dose escalation regimen comprising administering an effective amount of a Therapeutic Agent or a composition comprising a Therapeutic Agent to a subject in need thereof.
  • the methods described herein do not involve a cyclical administration regimen of the Therapeutic Agent.
  • a Therapeutic Agent can be administered in combination with one or more other therapies.
  • Non- limiting examples of other therapies that can be used in combination with Therapeutic Agents are described herein. See Section 5.9, infra.
  • the combination of a Therapeutic Agent and one or more other therapies provides an additive therapeutic effect relative to the therapeutic effects of the Therapeutic Agent alone or the one or more other therapies alone.
  • the combination of a Therapeutic Agent and one or more other therapies provides more than an additive therapeutic effect relative to the therapeutic effects of the Therapeutic Agent alone or the one or more other therapies alone.
  • the combination of a Therapeutic Agent and one or more other therapies provides a synergistic therapeutic effect relative to the therapeutic effects of the Therapeutic Agent alone or the one or more other therapies alone.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a mammal which is 0 to 6 months old, 6 to 12 months old, 1 to 5 years old, 5 to 10 years old, 10 to 15 years old, 15 to 20 years old, 20 to 25 years old, 25 to 30 years old, 30 to 35 years old, 35 to 40 years old, 40 to 45 years old, 45 to 50 years old, 50 to 55 years old, 55 to 60 years old, 60 to 65 years old, 65 to 70 years old, 70 to 75 years old, 75 to 80 years old, 80 to 85 years old, 85 to 90 years old, 90 to 95 years old or 95 to 100 years old.
  • the patient is a human 0 to 6 months old, 6 to 12 months old, 1 to 5 years old, 5 to 10 years old, 5 to 12 years old, 10 to 15 years old, 15 to 20 years old, 13 to 19 years old, 20 to 25 years old, 25 to 30 years old, 20 to 65 years old, 30 to 35 years old, 35 to 40 years old, 40 to 45 years old, 45 to 50 years old, 50 to 55 years old, 55 to 60 years old, 60 to 65 years old, 65 to 70 years old, 70 to 75 years old, 75 to 80 years old, 80 to 85 years old, 85 to 90 years old, 90 to 95 years old or 95 to 100 years old.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a human infant or premature human infant. In other embodiments, a Therapeutic Agent, composition comprising a Therapeutic Agent, or a combination therapy is administered to a human child. In other embodiments, a Therapeutic Agent, composition comprising a Therapeutic Agent, or a combination therapy is administered to a human adult. In yet other embodiments, a
  • Therapeutic Agent a composition comprising a Therapeutic Agent, or a combination therapy is administered to an elderly human.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a pet, e.g., a dog or cat.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a farm animal or livestock, e.g. , pig, cows, horses, chickens, etc.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a bird, e.g. , ducks or chicken.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a primate, preferably a human, or another mammal, such as a pig, cow, horse, sheep, goat, dog, cat and rodent, in an immunocompromised state or immunosuppressed state or at risk for becoming
  • a primate preferably a human, or another mammal, such as a pig, cow, horse, sheep, goat, dog, cat and rodent
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a primate, preferably a human, or another mammal, such as a pig, cow, horse, sheep, goat, dog, cat and rodent, with an immunodeficiency.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject receiving or recovering from immunosuppressive therapy.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject that has or is at risk of getting cancer, AIDS, another infection, or a bacterial infection.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject that has, will have or had a tissue transplant.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject that lives in a nursing home, a group home (i.e., a home for 10 or more subjects), or a prison.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject that attends school (e.g., elementary school, middle school, junior high school, high school or university) or daycare.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject that works in the healthcare area, such as a doctor or a nurse, or in a hospital.
  • a Therapeutic Agent, a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject that is pregnant or will become pregnant.
  • a Therapeutic Agent a composition comprising a Therapeutic Agent, or a combination therapy is administered to a subject that has been diagnosed as lymphopenic.
  • lymphopenia or “lymphocytopenia” or “lymphocytic leucopenia” interchangeably refer to an abnormally small number of lymphocytes in the circulating blood or in peripheral circulation.
  • lymphopenia can be described by various cutoffs.
  • a patient is suffering from lymphopenia when their circulating blood total lymphocyte count falls below about 600/mm 3 .
  • a patient suffering from lymphopenia has less than about 2000/ ⁇ total circulating lymphocytes at birth, less than about 4500/ ⁇ total circulating lymphocytes at about age 9 months, or less than about ⁇ / ⁇ total circulating lymphocytes patients older than about 9 months.
  • Lymphocytopenia has a wide range of possible causes, including viral (e.g. , HIV or hepatitis infection), bacterial (e.g., active tuberculosis infection), and fungal infections; chronic failure of the right ventricle of the heart, Hodgkin's disease and cancers of the lymphatic system, leukemia, a leak or rupture in the thoracic duct, side effects of prescription medications including anticancer agents, antiviral agents, and glucocorticoids, malnutrition resulting from diets that are low in protein, radiation therapy, uremia, autoimmune disorders, immune deficiency syndromes, high stress levels, and trauma.
  • viral e.g. , HIV or hepatitis infection
  • bacterial e.g., active tuberculosis infection
  • fungal infections chronic failure of the right ventricle of the heart
  • Hodgkin's disease and cancers of the lymphatic system e.g., leukemia, a leak or rupture in the thora
  • Lymphopenia may also be of unknown etiology (i.e., idiopathic lymphopenia). Peripheral circulation of all types of lymphocytes or subpopulations of lymphocytes (e.g., CD4 + T cells) may be depleted or abnormally low in a patient suffering from lymphopenia. See, e.g., Lymphopenia Description, The Merck Manual (18 th Edition, 2006, Merck & Co.).
  • a patient is administered a Therapeutic Agent, a
  • compositions comprising a Therapeutic Agent, or a combination therapy before any adverse effects or intolerance to therapies other than Therapeutic Agents develops.
  • Therapeutic Agents, compositions comprising Therapeutic Agents or combination therapies are administered to refractory patients.
  • refractory patient is a patient refractory to a standard therapy.
  • Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies are administered to a patient to prevent the onset or reoccurrence of an immunodeficiency or lymphopenia in a patient at risk of developing such infections.
  • Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies are administered to a patient who is susceptible to adverse reactions to conventional therapies.
  • one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies are administered to a patient who has proven refractory to therapies other than Therapeutic Agents, but are no longer on these therapies.
  • the subject being administered one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies has not received a therapy prior to the administration of the Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies.
  • one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies are administered to a subject who has received a therapy prior to administration of one or more Therapeutic Agents, compositions comprising Therapeutic Agents, or combination therapies.
  • the subject administered a Therapeutic Agent or a composition comprising a Therapeutic Agent was refractory to a prior therapy or experienced adverse side effects to the prior therapy or the prior therapy was discontinued due to unacceptable levels of toxicity to the subject.
  • Other therapies that can be used in combination with a Therapeutic Agent(s) for the prevention, treatment and/or management of a disease that is affected by IL-15 function/signaling, e.g., cancer, infectious disease, lymphopenia, immunodeficiency and wounds, or the eradication or reduction of HIV in an HIV-infected subject include, but are not limited to, small molecules, synthetic drugs, peptides (including cyclic peptides), polypeptides, proteins, nucleic acids ⁇ e.g., DNA and R A nucleotides including, but not limited to, antisense nucleotide sequences, triple helices, R Ai, and nucleotide sequences encoding biologically active proteins, polypeptides or peptides), antibodies, synthetic or natural inorganic molecules, mimetic agents, and synthetic or natural organic molecules.
  • a Therapeutic Agent(s) for the prevention, treatment and/or management of a disease that is affected by IL-15 function/signaling, e.g.
  • Such therapies include, but are not limited to, immunomodulatory agents (e.g., interferon), anti-inflammatory agents (e.g., adrenocorticoids, corticosteroids (e.g., beclomethasone, budesonide, flunisolide, fluticasone, triamcinolone,
  • immunomodulatory agents e.g., interferon
  • anti-inflammatory agents e.g., adrenocorticoids
  • corticosteroids e.g., beclomethasone, budesonide, flunisolide, fluticasone, triamcinolone
  • methylprednisolone, prednisolone, prednisone, hydrocortisone), glucocorticoids, steriods, and non-steriodal anti- inflammatory drugs e.g., aspirin, ibuprofen, diclofenac, and COX-2 inhibitors
  • pain relievers e.g., aspirin, ibuprofen, diclofenac, and COX-2 inhibitors
  • leukotreine antagonists e.g., montelukast, methyl xanthines, zafirlukast, and zileuton
  • beta2-agonists e.g.
  • albuterol e.g., albuterol, biterol, fenoterol, isoetharie, metaproterenol, pirbuterol, salbutamol, terbutalin formoterol, salmeterol, and salbutamol terbutaline
  • anticholinergic agents e.g., ipratropium bromide and oxitropium bromide
  • sulphasalazine penicillamine, dapsone
  • antihistamines e.g., anti-malarial agents
  • anti-viral agents e.g., nucleoside analogs (e.g., zidovudine, acyclovir, gangcyclovir, vidarabine, idoxuridine, trifluridine, and ribavirin), foscarnet, amantadine, rimantadine, saquinavir, indinavir, ritonavir, and AZT) and antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, erythomycin, penicillin, mithramycin, and anthramycin (AMC)).
  • nucleoside analogs e.g., zidovudine, acyclovir, gangcyclovir, vidarabine, idoxuridine, trifluridine, and ribavirin
  • foscarnet amantadine, rimantadine, saquinavir, indinavir, ritonavir, and
  • Any therapy which is known to be useful, or which has been used or is currently being used for the prevention, management, and/or treatment of a disease that is affected by IL-15 function/signaling can be used in combination with a Therapeutic Agent(s). See, e.g., Gilman et al., Goodman and Gilman's: The Pharmacological Basis of Therapeutics, 10th ed., McGraw-Hill, New York, 2001; The Merck Manual of Diagnosis and Therapy, Berkow, M.D. et al.
  • therapies e.g., prophylactic or therapeutic agents
  • IL- 15 function/signaling e.g., cancer, infectious disease, lymphopenia, immunodeficiency and wounds, or eradicating or reducing HIV in HIV-infected subjects.
  • Non-limiting examples of one or more other therapies that can be used in combination with a Therapeutic Agent(s) include immunomodulatory agents, such as but not limited to, chemotherapeutic agents and non-chemotherapeutic immunomodulatory agents.
  • immunomodulatory agents include methotrexate, cyclosporin A, leflunomide, cisplatin, ifosfamide, taxanes such as taxol and paclitaxol, topoisomerase I inhibitors (e.g., CPT-1 1 , topotecan, 9-AC, and GG-21 1), gemcitabine, vinorelbine, oxaliplatin, 5-fluorouracil (5-FU), leucovorin, vinorelbine, temodal, cytochalasin B, gramicidin D, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daun
  • non-chemotherapeutic immunomodulatory agents include, but are not limited to, anti-T cell receptor antibodies (e.g., anti-CD4 antibodies (e.g., cM-T412 (Boeringer), IDEC-CE9.1® (IDEC and SKB), mAB 4162W94, Orthoclone and OKTcdr4a (Janssen-Cilag)), anti-CD3 antibodies (e.g., Nuvion (Product Design Labs) or OKT3 (Johnson & Johnson)), anti-CD20 antibodies (e.g., Rituxan (IDEC)), anti-CD5 antibodies (e.g., an anti-CD5 ricin- linked immunoconjugate), anti-CD7 antibodies (e.g., CHH-380 (Novartis)), anti-CD8 antibodies, anti-CD40 ligand monoclonal antibodies (e.g., IDEC-131 (IDEC)), anti-CD52 antibodies (e.g., CAMPATH 1H (Ilex)),
  • anti-B7 antibodies e.g., IDEC- 1 14) (IDEC)
  • anti-cytokine receptor antibodies e.g., anti-IFN receptor antibodies, anti-IL-2 receptor antibodies (e.g., Zenapax (Protein Design Labs)
  • anti-IL-4 receptor antibodies e.g., anti-IL-6 receptor antibodies, anti-IL- 10 receptor antibodies, and anti-IL- 12 receptor antibodies
  • anti-cytokine antibodies e.g., anti-IFN antibodies, anti-TNF-a antibodies, anti-IL- 1 ⁇ antibodies, anti-IL-6 antibodies, anti- IL-8 antibodies (e.g., ABX-IL-8 (Abgenix)
  • cytokine receptors e.g., the extracellular domain of a TNF-a receptor or a fragment thereof, the extracellular domain of an IL- ⁇ ⁇ receptor or a fragment thereof, and the extracellular domain of an IL-6 receptor or a fragment thereof
  • cytokines or fragments thereof e.g., interleukin (IL)-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-1 1 , IL-12, IL-15, IL-23, TNF-a, TNF- ⁇ , interferon (IFN)-a, IFN- ⁇ , IFN- ⁇ , and GM-CSF
  • anti-cytokine antibodies e.g., anti-IL-2 antibodies, anti-IL- 4 antibodies
  • an immunomodulatory agent is an immunomodulatory agent other than a chemotherapeutic agent.
  • an immunomodulatory agent is an immunomodulatory agent other than a cytokine or hemapoietic such as IL-1, IL-2, IL-4, IL- 12, IL-15, TNF, IFN-a, IFN- ⁇ , IFN- ⁇ , M-CSF, G-CSF, IL-3 or erythropoietin.
  • an immunomodulatory agent is an agent other than a chemotherapeutic agent and a cytokine or hemapoietic factor.
  • Non-limiting examples of anti-cancer agents that can be used as therapies in combination with aTherapeutic Agent(s) include, but are not limited to: acivicin; aclarubicin; acodazole hydrochloride; acronine; adozelesin; aldesleukin; altretamine; ambomycin;
  • ametantrone acetate aminoglutethimide; amsacrine; anastrozole; anthramycin; asparaginase; asperlin; azacitidine; azetepa; azotomycin; batimastat; benzodepa; bicalutamide; bisantrene hydrochloride; bisnafide dimesylate; bizelesin; bleomycin sulfate; brequinar sodium;
  • bropirimine busulfan; cactinomycin; calusterone; caracemide; carbetimer; carboplatin;
  • carmustine carubicin hydrochloride; carzelesin; cedefingol; chlorambucil; cirolemycin; cisplatin; cladribine; crisnatol mesylate; cyclophosphamide; cytarabine; dacarbazine;
  • dezaguanine mesylate diaziquone; docetaxel; doxorubicin; doxorubicin hydrochloride;
  • droloxifene droloxifene citrate; dromostanolone propionate; duazomycin; edatrexate;
  • eflornithine hydrochloride elsamitrucin; enloplatin; enpromate; epipropidine; epirubicin hydrochloride; erbulozole; esorubicin hydrochloride; estramustine; estramustine phosphate sodium; etanidazole; etoposide; etoposide phosphate; etoprine; fadrozole hydrochloride; camrabine; fenretinide; floxuridine; fludarabine phosphate; fluorouracil; flurocitabine;
  • idarubicin hydrochloride ifosfamide; ilmofosine; interleukin II (including recombinant interleukin II, or rIL2), interferon alpha-2a; interferon alpha-2b; interferon alpha-nl ;
  • lometrexol sodium lomustine; losoxantrone hydrochloride; masoprocol; maytansine;
  • mechlorethamine hydrochloride megestrol acetate; melengestrol acetate; melphalan;
  • menogaril mercaptopurine; methotrexate; methotrexate sodium; metoprine; meturedepa; mitindomide; mitocarcin; mitocromin; mitogillin; mitomalcin; mitomycin; mitosper;
  • mitotane mitoxantrone hydrochloride; mycophenolic acid; nocodazole; nogalamycin;
  • aclarubicin acylfulvene; adecypenol; adozelesin; aldesleukin; ALL-TK antagonists;
  • bisaziridinylspermine bisnafide; bistratene A; bizelesin; breflate; bropirimine; budotitane; buthionine sulfoximine; calcipotriol; calphostin C; camptothecin derivatives; canarypox IL-2; capecitabine; carboxamide-amino-triazole; carboxyamidotriazole; CaRest M3; CARN 700; cartilage derived inhibitor; carzelesin; casein kinase inhibitors (ICOS); castanospermine; cecropin B; cetrorelix; chlorlns; chloroquinoxaline sulfonamide; cicaprost; cis-porphyrin; cladribine; clomifene analogues; clotrimazole; collismycin A; collismycin B; combretastatin A4; combretastatin analogue;
  • cryptophycin A derivatives curacin A; cyclopentanthraquinones; cycloplatam; cypemycin; cytarabine ocfosfate; cytolytic factor; cytostatin; dacliximab; decitabine; dehydrodidemnin B; deslorelin; dexamethasone; dexifosfamide; dexrazoxane; dexverapamil; diaziquone;
  • dioxamycin diphenyl spiromustine; docetaxel; docosanol; dolasetron; doxifluridine;
  • droloxifene dronabinol; duocarmycin SA; ebselen; ecomustine; edelfosine; edrecolomab; eflornithine; elemene; emitefur; epirubicin; epristeride; estramustine analogue; estrogen agonists; estrogen antagonists; etanidazole; etoposide phosphate; exemestane; fadrozole; camrabine; fenretinide; filgrastim; finasteride; flavopiridol; flezelastine; fluasterone;
  • fludarabine fluorodaunorunicin hydrochloride; forfenimex; formestane; fostriecin;
  • iododoxorubicin ipomeanol, 4-; iroplact; irsogladine; isobengazole; isohomohalicondrin B; itasetron; jasplakinolide; kahalalide F; lamellarin-N triacetate; lanreotide; leinamycin;
  • lenograstim lentinan sulfate; leptolstatin; letrozole; leukemia inhibiting factor; leukocyte alpha interferon; leuprolide+estrogen+progesterone; leuprorelin; levamisole; liarozole; linear polyamine analogue; lipophilic disaccharide peptide; lipophilic platinum compounds;
  • HMG-CoA reductase inhibitor such as but not limited to, Lovastatin, Pravastatin, Fluvastatin, Statin, Simvastatin, and Atorvastatin); loxoribine; lurtotecan; lutetium texaphyrin; lysofylline; lytic peptides; maitansine; mannostatin A; marimastat; masoprocol; maspin; matrilysin inhibitors; matrix metalloproteinase inhibitors; menogaril; merbarone; meterelin; methioninase;
  • HMG-CoA reductase inhibitor such as but not limited to, Lovastatin, Pravastatin, Fluvastatin, Statin, Simvastatin, and Atorvastatin
  • loxoribine such as but not limited to, Lovastatin, Pravastatin, Fluvastatin, Statin, Simvastatin, and Atorvastatin
  • loxoribine such as
  • metoclopramide MIF inhibitor; mifepristone; miltefosine; mirimostim; mismatched double stranded RNA; mitoguazone; mitolactol; mitomycin analogues; mitonafide; mitotoxin fibroblast growth factor-saporin; mitoxantrone; mofarotene; molgramostim; monoclonal antibody, human chorionic gonadotrophin; monophosphoryl lipid A+myobacterium cell wall sk; mopidamol; multiple drug resistance gene inhibitor; multiple tumor suppressor 1 -based therapy; mustard anticancer agent; mycaperoxide B; mycobacterial cell wall extract;
  • myriaporone N-acetyldinaline; N-substituted benzamides; nafarelin; nagrestip;
  • naloxone+pentazocine napavin; naphterpin; nartograstim; nedaplatin; nemorubicin;
  • neridronic acid neutral endopeptidase; nilutamide; nisamycin; nitric oxide modulators;
  • nitroxide antioxidant nitrullyn; 06-benzylguanine; octreotide; okicenone; oligonucleotides; onapristone; ondansetron; ondansetron; oracin; oral cytokine inducer; ormaplatin; osaterone; oxaliplatin; oxaunomycin; paclitaxel; paclitaxel analogues; paclitaxel derivatives;
  • oligonucleotides single chain antigen binding protein; sizofiran; sobuzoxane; sodium borocaptate; sodium phenylacetate; solverol; somatomedin binding protein; sonermin; sparfosic acid; spicamycin D;
  • spiromustine splenopentin
  • spongistatin 1 squalamine
  • stem cell inhibitor stem-cell division inhibitors
  • stipiamide stem-cell division inhibitors
  • stromelysin inhibitors sulfinosine
  • superactive vasoactive intestinal peptide antagonist suradista; suramin; swainsonine; synthetic glycosaminoglycans;
  • tallimustine tallimustine; tamoxifen methiodide; tauromustine; tazarotene; tecogalan sodium; tegafur; tellurapyrylium; telomerase inhibitors; temoporfm; temozolomide; teniposide;
  • thrombopoietin mimetic thymalfasin; thymopoietin receptor agonist; thymotrinan; thyroid stimulating hormone; tin ethyl etiopurpurin; tirapazamine; titanocene bichloride; topsentin; toremifene; totipotent stem cell factor; translation inhibitors; tretinoin; triacetyluridine;
  • triciribine trimetrexate; triptorelin; tropisetron; turosteride; tyrosine kinase inhibitors;
  • tyrphostins UBC inhibitors; ubenimex; urogenital sinus-derived growth inhibitory factor; urokinase receptor antagonists; vapreotide; variolin B; vector system, erythrocyte gene therapy; velaresol; veramine; verdins; verteporfin; vinorelbine; vinxaltine; Vitaxin®;
  • a anti-cancer agent is not a chemotherapeutic agent.
  • Antiviral agents that can be used in combination with a Therapeutic Agent(s) include, but are not limited to, non-nucleoside reverse transcriptase inhibitors, nucleoside reverse transcriptase inhibitors, protease inhibitors, and fusion inhibitors.
  • the antiviral agent is selected from the group consisting of amantadine, oseltamivir phosphate, rimantadine, and zanamivir.
  • the antiviral agent is a non-nucleoside reverse transcriptase inhibitor selected from the group consisting of delavirdine, efavirenz, and nevirapine.
  • the antiviral agent is a nucleoside reverse transcriptase inhibitor selected from the group consisting of abacavir, didanosine, emtricitabine, emtricitabine, lamivudine, stavudine, tenofovir DF, zalcitabine, and zidovudine.
  • the antiviral agent is a protease inhibitor selected from the group consisting of amprenavir, atazanavir, fosamprenav, indinavir, lopinavir, nelfmavir, ritonavir, and saquinavir.
  • the antiviral agent is a fusion inhibitor such as enfuvirtide.
  • antiviral agents for use in combination with a Therapeutic Agent(s) include the following: rifampicin, nucleoside reverse transcriptase inhibitors (e.g., AZT, ddl, ddC, 3TC, d4T), non-nucleoside reverse transcriptase inhibitors (e.g., delavirdine efavirenz, nevirapine), protease inhibitors (e.g., aprenavir, indinavir, ritonavir, and saquinavir), idoxuridine, cidofovir, acyclovir, ganciclovir, zanamivir, amantadine, and palivizumab.
  • Other examples of anti-viral agents include but are not limited to acemannan; acyclovir; acyclovir sodium; adefovir; alovudine; alvircept sudotox;
  • amantadine hydrochloride SYMMETRELTM
  • aranotin arildone
  • atevirdine mesylate avridine
  • cidofovir cipamfylline
  • cytarabine hydrochloride delavirdine mesylate
  • desciclovir didanosine; disoxaril; edoxudine; enviradene; enviroxime; famciclovir; famotine hydrochloride; fiacitabine; fialuridine; fosarilate; foscamet sodium; fosfonet sodium;
  • ganciclovir ganciclovir sodium; idoxuridine; kethoxal; lamivudine; lobucavir; memotine hydrochloride; methisazone; nevirapine; oseltamivir phosphate (TAMIFLUTM); penciclovir; pirodavir; ribavirin; rimantadine hydrochloride (FLUMADINETM); saquinavir mesylate; somantadine hydrochloride; sorivudine; statolon; stavudine; tilorone hydrochloride;
  • valacyclovir hydrochloride vidarabine
  • vidarabine phosphate vidarabine sodium phosphate
  • viroxime zalcitabine
  • zanamivir RELENZATM
  • zidovudine and zinviroxime.
  • Antibacterial agents including antibiotics, that can be used in combination with a Therapeutic Agent(s) include, but are not limited to, aminoglycoside antibiotics,
  • antibiotics are administered in combination with a Therapeutic Agent to prevent, treat and/or manage a bacterial infection.
  • a Therapeutic Agent(s) are used in combination with other protein synthesis inhibitors, including but not limited to, streptomycin, neomycin, erythromycin, carbomycin, and spiramycin.
  • the antibacterial agent is selected from the group consisting of ampicillin, amoxicillin, ciprofloxacin, gentamycin, kanamycin, neomycin, penicillin G, streptomycin, sulfanilamide, and vancomycin.
  • the antibacterial agent is selected from the group consisting of azithromycin, cefonicid, cefotetan, cephalothin, cephamycin, chlortetracycline, clarithromycin, clindamycin, cycloserine, dalfopristin, doxycycline, erythromycin, linezolid, mupirocin, oxytetracycline, quinupristin, rifampin, spectinomycin, and trimethoprim.
  • antibacterial agents for use in combination with a Therapeutic Agent(s) include the following: aminoglycoside antibiotics (e.g., apramycin, arbekacin, bambermycins, butirosin, dibekacin, neomycin, neomycin, neomycin, aminoglycoside antibiotics (e.g., apramycin, arbekacin, bambermycins, butirosin, dibekacin, neomycin, neomycin,
  • amphenicol antibiotics e.g., azidamfenicol, chloramphenicol, florfenicol, and
  • ansamycin antibiotics e.g., rifamide and rifampin
  • carbacephems e.g., loracarbef
  • carbapenems e.g., biapenem and imipenem
  • cephalosporins e.g., cefaclor, cefadroxil, cefamandole, cefatrizine, cefazedone, cefozopran, cefpimizole, cefpiramide, and cefpirome
  • cephamycins e.g.
  • cefbuperazone, cefmetazole, and cefminox cefbuperazone, cefmetazole, and cefminox
  • folic acid analogs e.g., trimethoprim
  • glycopeptides e.g., vancomycin
  • lincosamides e.g., clindamycin, and lincomycin
  • macrolides e.g., azithromycin, carbomycin, clarithomycin, dirithromycin, erythromycin, and erythromycin acistrate
  • monobactams e.g.
  • aztreonam carumonam, and tigemonam
  • nitrofurans e.g., furaltadone, and furazolium chloride
  • oxacephems e.g., flomoxef, and moxalactam
  • oxazolidinones e.g., linezolid
  • penicillins e.g.
  • Additional examples include cycloserine, mupirocin, tuberin amphomycin, bacitracin, capreomycin, colistin, enduracidin, enviomycin, and 2,4 diaminopyrimidines (e.g., brodimoprim).
  • IL-15 sensitive cell line e.g., CTLL-2 cells, a mouse cytotoxic T lymphoma cell line (ATCC Accession No. TIB-214) or TFl- ⁇ cells. See, e.g., International Publication No. WO
  • the activity of a Therapeutic Agent can be assessed utilizing the assay described in Example 4, infra.
  • the Therapeutic Agent increases an immune response that can be, e.g., an antibody response (humoral response) or a cellular immune response, e.g., cytokine secretion (e.g., interferon-gamma), helper activity or cellular cytotoxicity.
  • an immune response can be, e.g., an antibody response (humoral response) or a cellular immune response, e.g., cytokine secretion (e.g., interferon-gamma), helper activity or cellular cytotoxicity.
  • cytokine secretion e.g., interferon-gamma
  • helper activity e.g., interferon-gamma
  • the increased immune response is increased cytokine secretion, antibody production, effector function, T cell proliferation, and/or NK cell proliferation.
  • cytokine secretion cytokine secretion, antibody production, effector function, T cell proliferation, and/or NK cell proliferation.
  • assays to measure such activities are well known in the art, and exemplary descriptions of such assays are provided below.
  • ELISA enzyme-linked immunosorbent assays
  • ELISA enzyme-linked immunosorbent assays
  • ELISA can be used, e.g., to assay the amount or concentration of IL-15 or IL-15Ra polypeptide.
  • the "tetramer staining" assay may be used to identify antigen- specific T-cells and to assess how Therapeutic Agents modulate (e.g., enhance or suppress) antigen-specific T cell responses.
  • an MHC molecule containing a specific peptide antigen such as a tumor-specific antigen, is multimerized to make soluble peptide tetramers and labeled, for example, by complexing to streptavidin.
  • the MHC-peptide antigen complex is then mixed with a population of T cells obtained from a subject administered with an immunogenic composition alone or in combination with a Therapeutic Agent. Biotin is then used to stain T cells expressing the tumor-specific antigen of interest.
  • the cytotoxicity of T cells can be tested in a 51 Cr-release assay as described, e.g., in Palladino et al., 1987, Cancer Res. 47:5074-5079. Briefly, the mixed lymphocyte culture is added to a target cell suspension to give different effector :target (E:T) ratios (usually 1 : 1 to 40: 1). The target cells are pre-labeled by incubating lxl 0 6 target cells in culture medium containing 500 Ci of 51 Cr per ml for one hour at 37°C. The cells are washed three times following labeling.
  • Each assay point (E:T ratio) is performed in triplicate and the appropriate controls incorporated to measure spontaneous 51 Cr release (no lymphocytes added to assay) and 100% release (cells lysed with detergent). After incubating the cell mixtures for 4 hours, the cells are pelleted by centrifugation at 200 g for 5 minutes. The amount of 51 Cr released into the supernatant is measured by a gamma counter. The percent cytotoxicity is measured as cpm in the test sample minus spontaneously released cpm divided by the total detergent released cpm minus spontaneously released cpm.
  • an ELISPOT assay can be used to measure cytokine release in vitro by T cells after administration of an effective amount of a Therapeutic Agent to a subject. Cytokine release is detected by antibodies which are specific for a particular cytokine, e.g., interleukin-2, tumor necrosis factor ⁇ or interferon- ⁇ (see, e.g., Scheibenbogen et al., 1997, Int. J. Cancer 71 :932-936). The assay is carried out in a microtitre plate which has been pre-coated with an antibody specific for a cytokine of interest which captures the cytokine secreted by T cells.
  • cytokine e.g., interleukin-2, tumor necrosis factor ⁇ or interferon- ⁇
  • T cells After incubation of T cells for 24-48 hours in the coated wells, the T cells are removed and replaced with a second labeled antibody that recognizes a different epitope on the cytokine. After extensive washing to remove unbound antibody, an enzyme substrate, which produces a colored reaction product is added to the plate. The number of cytokine-producing cells is counted under a microscope. This method has the advantages of short assay time, and sensitivity without the need of a large number of cytotoxic T cells.
  • the immune response induced or enhanced by a Therapeutic Agent is enhanced or increased by at least 2 fold, 3 fold, 4 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 11 fold, or 12 fold relative to an immune response elicited by a negative control as determined by any known assay in the art.
  • the immune response induced by the Therapeutic Agent is enhanced by at least 0.5-2 times, at least 2-5 times, at least 5-10 times, at least 10-50 times, at least 50-100 times, at least 100-200 times, at least 200-300 times, at least 300-400 times or at least 400-500 times relative to the immune response induced by a negative control as assayed by any known method in the art.
  • the assay used to assess immune response measures the level of antibody production, cytokine production, or cellular cytoxicity, and such assays are well known in the art.
  • the assay used to measure the immune response is an enzyme-linked immunosorbent assay (ELISA) that determines antibody or cytokine levels, an ELISPOT assay that determines cytokine release, or a 51 Cr release assay that determines cellular cytotoxicity.
  • ELISA enzyme-linked immunosorbent assay
  • ELISPOT assay that determines cytokine release
  • 51 Cr release assay that determines cellular cytotoxicity
  • the Therapeutic Agent induces or enhances an immune response in a subject that is measured by antibody titer in the serum of the subject, and the antibody titer is at least 0.2 to 5 times, 5 to 20 times, 10 to 30 times, 20 to 50 times, 50 to 200 times, 100 to 500, 200 to 1000 times, or 500 to 2,000 times higher as compared to the antibody titer in the serum of a subject administered a negative control.
  • the mean serum antibody titer against an antigen in the subject administered the Therapeutic Agent is increased by at least 0.5-2 times, at least 2-5 times, at least 5-10 times, at least 10-50 times, at least 50-100 times, at least 100-200 times, at least 200-300 times, at least 300-400 times or at least 400-500 times relative to the mean serum antibody titer in the subject administered a negative control as determined by methods well known in the art.
  • cytokine production or secretion e.g. , interferon- ⁇
  • methods of administering Therapeutic Agents to induce or enhance the level of cytokine production or secretion e.g. , interferon- ⁇ , (that may be 0.5 to 500 times higher) as compared to the level of cytokine production or secretion in a negative control sample.
  • the level of cytokine production or secretion e.g. , interferon- ⁇ , (that may be 0.5 to 500 times higher) as compared to the level of cytokine production or secretion in a negative control sample.
  • the level of cytokine production or secretion e.g. , interferon- ⁇
  • Therapeutic Agent induces or enhances an immune response that is measured by increased cytokine release, and the cytokine concentration is at least 0.2 to 5 times, 5 to 20 times, 10 to 30 times, 20 to 50 times, 50 to 200 times, 100 to 500, 200 to 1000 times, or 500 to 2,000 times higher as compared to the cytokine concentration of a negative control.
  • the mean serum cytokine concentration of samples obtained from a subject administered the Therapeutic Agent is increased by at least 0.5-2 times, at least 2-5 times, at least 5-10 times, at least 10-50 times, at least 50-100 times, at least 100-200 times, at least 200-300 times, at least 300-400 times or at least 400-500 times relative to the mean serum cytokine concentration of samples obtained from a subject administered a negative control as determined by methods well known in the art.
  • the negative control can be samples from the subject prior to administration of the Therapeutic Agent.
  • the Therapeutic Agent induces or enhances NK cell proliferation in a subject that by at least 0.2 to 5 times, 5 to 20 times, 10 to 30 times, 20 to 50 times, 50 to 200 times, 100 to 500, 200 to 1000 times, or 500 to 2,000 times higher relative to NK cell proliferation in a negative control.
  • the Therapeutic Agent induces or enhances T cell proliferation in a subject that by at least 0.2 to 5 times, 5 to 20 times, 10 to 30 times, 20 to 50 times, 50 to 200 times, 100 to 500, 200 to 1000 times, or 500 to 2,000 times higher relative to T cell proliferation in a negative control as determined by methods well known in the art, e.g., flow cytometry, CSFE staining, 3 H-thymidine incorporation.
  • Therapeutic Agents are preferably assayed in vivo for the desired therapeutic or prophylactic activity prior to use in humans.
  • a Therapeutic Agent can be administered to the animal at the same time as the onset of a disease or disorder in the animal.
  • a Therapeutic Agent can be administered to the animal prior to the onset of a disease or disorder in the animal.
  • a Therapeutic Agent can be administered to the animal subsequent to the onset of a disease or disorder in the animal.
  • the Therapeutic Agent is administered to the animal more than one time.
  • the Therapeutic Agent is administered in combination with another therapy.
  • Therapeutic Agents can be tested in animal models systems including, but are not limited to, rats, mice, chicken, cows, monkeys, pigs, goats, sheep, dogs, rabbits, guinea pigs, etc. In a specific embodiment, Therapeutic Agents are tested in a mouse model system. Such model systems are widely used and well-known to the skilled artisan.
  • the anti-cancer activity of a Therapeutic Agent can be determined by using various experimental animal models for the study of cancer well known in the art as described in, e.g., Relevance of Tumor Models for Anticancer Drug Development (1999, eds. Fiebig and Burger); Contributions to Oncology (1999, Karger); The Nude Mouse in Oncology Research (1991, eds. Boven and Winograd); and Anticancer Drug Development Guide (1997 ed. Teicher), incorporated herein by reference in their entireties.
  • Animal models for cancer can be used to assess the efficacy of a Therapeutic Agent or a composition thereof.
  • animal models for lung cancer include, but are not limited to, lung cancer animal models described by Zhang & Roth (1994, In vivo 8(5):755-69) and a transgenic mouse model with disrupted p53 function (see, e.g., Morris et al, 1998, J La State Med Soc 150(4): 179-85).
  • An example of an animal model for breast cancer includes, but is not limited to, a transgenic mouse that overexpresses cyclin Dl (see, e.g., Hosokawa et al, 2001, Transgenic Res 10(5):471-8).
  • An example of an animal model for colon cancer includes, but is not limited to, a TCR- ⁇ and p53 double knockout mouse (see, e.g., Kado et al, 2001, Cancer Res 61(6):2395-8).
  • animal models for pancreatic cancer include, but are not limited to, a metastatic model of Panc02 murine pancreatic adenocarcinoma (see, e.g., Wang et al, 2001, Int J Pancreatol 29(l):37-46) and nu-nu mice generated in subcutaneous pancreatic tumours (see, e.g., Ghaneh et al, 2001, Gene Ther 8(3): 199-208).
  • animal models for non-Hodgkin's lymphoma include, but are not limited to, a severe combined immunodeficiency ("SOD") mouse (see, e.g., Bryant et al, 2000, Lab Invest 80(4):553-73) and an IgHmu-HOXl 1 transgenic mouse (see, e.g., Hough et al, 1998, Proc Natl Acad Sci USA 95(23): 13853-8).
  • SOD severe combined immunodeficiency
  • An example of an animal model for esophageal cancer includes, but is not limited to, a mouse transgenic for the human papillomavirus type 16 E7 oncogene (see, e.g., Herber et al, 1996, J Virol
  • animal models for colorectal carcinomas include, but are not limited to, Ape mouse models (see, e.g., Fodde & Smits, 2001, Trends Mol Med 7(8):369-73 and Kuraguchi et al, 2000, Oncogene 19(50):5755-63).
  • the effectiveness of a Therapeutic Agent relative to a negative control can be assessed in animals infected with virus.
  • Samples obtained from these animals ⁇ e.g., serum, urine, sputum, semen, saliva, plasma, or tissue sample
  • can be tested for enhancement of immune function e.g. , enhancement in cytokine release, enhancement in antibody production, T cell proliferation, NK cell proliferation, with methods well known in the art and described herein.
  • Samples obtained from these animals ⁇ e.g., serum, urine, sputum, semen, saliva, plasma, or tissue sample
  • can also be tested for reduction in viral replication via well known methods in the art e.g. , those that measure altered viral replication (as determined, e.g.
  • tissue samples are homogenized in phosphate-buffered saline (PBS), and dilutions of clarified homogenates are adsorbed for 1 hour at 37°C onto monolayers of cells (e.g., Vero, CEF or MDCK cells).
  • PBS phosphate-buffered saline
  • histopathologic evaluations are performed after infection, preferably evaluations of the organ(s) the virus is known to target for infection.
  • Virus immunohistochemistry can be performed using a viral- specific monoclonal antibody.
  • Non-limiting exemplary animal models described below can be adapted for other viral systems.
  • HSV herpes simplex virus
  • MCMV mouse cytomegalovirus
  • HCMV human cytomegalovirus
  • animal models for viral infections can also be used to assess the efficacy of a Therapeutic Agent or a composition thereof, e.g., animal models for viral infections such as EBV-associated diseases, gammaherpesviruses, infectious mononucleosis, simian
  • the Therapeutic Agent, composition thereof, or combination therapy comprising the Therapeutic Agent can be tested for their ability to decrease the time course of viral infection.
  • Animal models for bacterial infections can also be used to assess the efficacy of a Therapeutic Agent or a composition thereo.
  • Animal models for bacterial infections such as H. pylori-infection, genital mycoplasmosis, primary sclerosing cholangitis, cholera, chronic lung infection with Pseudomonas aeruginosa, Legionnaires' disease, gastroduodenal ulcer disease, bacterial meningitis, gastric Helicobacter infection, pneumococcal otitis media, experimental allergic neuritis, leprous neuropathy, mycobacterial infection, endocarditis, Aeromonas-associated enteritis, Bacteroides fragilis infection, syphilis, streptococcal endocarditis, acute hematogenous osteomyelitis, human scrub typhus, toxic shock syndrome, anaerobic infections, Escherichia coli infections, and Mycoplasma pneumoniae infections have been developed (see, e.g., Sugi
  • Therapeutic Agent can be tested for their ability to decrease the time course of bacterial infection, e.g., a bacterial respiratory infection by at least 25%, at least 50%, at least 60%), at least 75%>, at least 85%>, at least 95%>, or at least 99%> relative to a negative control using methods well known in the art.
  • the efficacy of Therapeutic Agents or compositions thereof for the prevention, treatment and/or management of a fungal infection can be assessed in animal models for such infections.
  • Animal models for fungal infections such as Candida infections, zygomycosis, Candida mastitis, progressive disseminated trichosporonosis with latent trichosporonemia, disseminated candidiasis, pulmonary paracoccidioidomycosis, pulmonary aspergillosis, Pneumocystis carinii pneumonia, cryptococcal meningitis, coccidioidal meningoencephalitis and cerebrospinal vasculitis, Aspergillus niger infection, Fusarium keratitis, paranasal sinus mycoses, Aspergillus fumigatus endocarditis, tibial dyschondroplasia, Candida glabrata vaginitis, oropharyngeal candidiasis, X-linked chronic granulomatous disease
  • bronchopulmonary aspergillosis mycotic keratitis, Cryptococcus neoformans infection, fungal peritonitis, Curvularia geniculata infection, staphylococcal endophthalmitis, sporotrichosis, and dermatophytosis have been developed (see, e.g., Arendrup et al, 2002, Infection 30(5):286-91; Kamei, 2001, Mycopathologia 152(1):5-13; Guhad et al, 2000, FEMS Microbiol Lett. l92(l):27-31; Yamagata et al, 2000, J Clin Microbiol.
  • the Therapeutic Agents or compositions thereof can be tested for their ability to decrease the time course of fungal respiratory infection by at least 25%, at least 50%, at least 60%), at least 75%>, at least 85%>, at least 95%>, or at least 99%>. Techniques known to those of skill in the art can be used to analyze the function of the Therapeutic Agents or compositions thereof in vivo.
  • Example 1 Study Evaluating toxicity, plasma levels of IL-15 and immunological parameters after subcutaneous injections of rhesus macaques with IL-15/sIL- 15Ra at Different Doses
  • IL-15/soluble IL-15Ra a non-covalently linked but stable heterodimer of IL-15 and soluble form of IL-15Ra
  • Human HEK 293T cells were transfected with nucleic acid expression construct for IL-15 (e.g., SEQ ID NO: 23) in combination with a nucleic acid expression construct for IL-15Ra (e.g., SEQ ID NO: 25).
  • IL-15/soluble IL-15Ra complex composed of IL-15 (e.g., SEQ ID NO: 24 or SEQ ID NO: 1 without the signal peptide) and IL-15Ra (e.g., SEQ ID NO:33) were purified.
  • the IL-15/soluble IL-15Ra complex (otherwise referred to as heterodimeric IL-15 or IL-15 heterodimer) was composed of IL-15 (SEQ ID NO: l without the signal peptide) and soluble IL-15Ra (SEQ ID NO: 33).
  • Group 1 included 2 rhesus macaques that received 6 s.c.
  • IL-15/soluble IL-15Ra injections of IL-15/soluble IL-15Ra at the dose of 1 ⁇ g/kg on day 0, 2, 4, 7, 9 and 1 1.
  • Group 2 included 2 rhesus macaques that received 6 s.c. injections of IL-15/sIL-15Ra at the dose of 20 ⁇ g/kg on day 0, 2, 4, 7, 9 and 1 1.
  • Group 3 included 2 rhesus macaques that received 6 s.c. injections of IL-15/soluble IL-15Ra at the dose of 50 ⁇ g/Kg on day 0, 2, 4, 7, 9 and 1 1.
  • This example describes a dose escalation study to evaluate the effects of escalation of doses of a human IL-15/soluble IL-15Ra complex within individual macques.
  • the IL-15/soluble IL-15Ra complex used in this study is composed of IL-15 (SEQ ID NO: l without the signal peptide) and soluble IL-15Ra (SEQ ID NO: 33). The complex is produced as described in Example 1, supra.
  • Rhesus macaques are each administered subcutaneous injections of IL-15/soluble IL-15Ra complex at the following doses of 2 ⁇ g/kg, 4 ⁇ g/kg, 8 ⁇ g/kg, 16 ⁇ g/kg, 32 ⁇ g/kg, 64 ⁇ g/kg of IL-15 determined based on the mass of single chain IL-15, wherein each dose is administered once three times per week for two weeks ⁇ e.g., Monday, Wednesday, Friday, Monday, Wednesday and Friday).
  • Blood pressure and temperature of the macques are monitored over time. Blood is drawn at before and after the first and the last subcutaneous injections ⁇ e.g., 0, 6, 8, 12 and 24 hours after the last injections) and before and after the other injections ⁇ e.g., 0 and 6 hours after the the injections).
  • the concentration of human IL-15 in macaque plasma is evaluated using a colorimetric immunoassay (Quantikine human IL-15, R&D Systems), according to the manufacturer's recommendations.
  • hetIL- 15 (IL- 15/IL- 15Ra) (5 ⁇ g/kg per dose, 3x per week, MWF MWF, calculated as single-chain IL-15 equivalent) was performed in 8 macaques.
  • the hetIL-15 used in this study is composed of IL-15 (SEQ ID NO: l without the signal peptide) and soluble IL-15Ra (SEQ ID NO: 33).
  • the hetIL-15 was produced as described in Example 1, supra. There were no changes in blood pressure or temperature after treatment, whereas T lymphocytes and NK cells showed enhanced proliferation and an increase in numbers.
  • the use of SHIV-infected animals allowed for the evaluation of the effect of hetIL-15 treatment on viral load. No changes in viral load were detected, suggesting that IL-15 treatment is safe in the context of HIV infection.
  • NK92 cells are human lymphoblasts from a malignant non- Hodgkin's lymphoma, which requires cytokine signals for growth and can be maintained in media that is supplemented with IL-2 or IL-15.
  • the NK92 cell line was cultured in media supplemented with Hoffmann-La Roche IL-2 plus IL-15 at 37°C and 5% C0 2 . The day before assay, the cells were harvested, washed, counted and returned to culture in media without IL-2 or IL-15.
  • concentrations for the IL- 15/IL-15Ra Reference Standard Clone 19.7 and IL-15/IL-15Ra test sample EN627-01-13-001 were at 1000 ⁇ g/ml and 576 ⁇ g/ml, respectively.
  • Both the IL-15/IL-15Ra Reference Standard Clone 19.7 and IL-15/IL-15Ra test sample EN627-01- 13-001 were serially diluted to produce 9 different concentrations: 25 ng/ml, 10 ng/ml, 4 ng/ml, 2 ng/ml, 1 ng/ml, 0.5 ng/ml, 0.25 ng/ml, 0.05 ng/ml, 0.01 ng/ml.
  • Testing was performed to compare the bioactivity of IL-15/IL-15Ra Reference Standard Clone 19.7 to the IL-15/IL-15Ra test sample EN627-01-13-001 by culturing NK-92 cells with IL-15/IL-15Ra at the 9 concentrations.
  • the assay was set up with triplicate wells for each test dilution. Each plate was set up according to the plate map in Table 4.
  • Assay ID 11362 was set up on a total of 4 plates, and Assay ID 11436 was set up on a total of 2 plates.
  • MTT was added to each well of the culture, and the plates were returned to the incubator for an additional 5 hours.
  • Sodium dodecyl sulfate was then added to each well to stop the reaction and solubilize the formazan generated by metabolic activity of the cells.
  • the plates were incubated for an additional 20-26 hours at which point the plates were read on a spectrophotometer using a detection wavelength of 570 nm with a reference wavelength of 690 nm.
  • results of the assay were collected using SoftMax Pro software and a 4-parameter standard curve was generated.
  • the calculated concentration of IL-15/IL-15Ra test sample EN627-01-13-001 was evaluated against the standard curve and the mean dilution-corrected concentration of wells on the transitional portion of the standard curve (dilutions 5-7) were averaged.
  • the test sample was determined to have potency equivalent to the IL-15/IL-15Ra Reference Standard Clone 19.7 if mean calculated activity was in the range of 50% to 200% of the expected 25 ng/ml starting dilution.
  • Table 5 shows that the IL-15/IL-15Ra test sample EN627-01 -13-001 had bioactivity in the bioassay that fell within the specified range of 50% to 200% of the IL-15/IL-15Ra Reference Standard Clone 19.7 of the expected value of 25 ng/ml. Under both Assay ID 11362 and Assay ID 11436, the IL-15/IL-15Ra test sample EN627-01-13-001 passed the bioactivity test.
  • This example describes a dose escalation study to evaluate the effects of escalation of doses of a human IL-15/soluble IL-15Ra complex ("hetIL-15") within individual macques.
  • the IL-15/soluble IL-15Ra complex used in this study was composed of IL-15 (SEQ ID NO: l without the signal peptide) and soluble IL-15Ra (SEQ ID NO: 33). The complex was produced as described in Example 1, supra.
  • Rhesus macaque T138 was administered subcutaneous injections of IL-15/soluble IL-15Ra complex at the following doses of 2 ⁇ g/kg, 4 ⁇ g/kg, 8 ⁇ g/kg, 16 ⁇ g/kg, 32 ⁇ g/kg, and 64 ⁇ g/kg of IL-15 determined based on the mass of single chain IL-15, wherein each dose was administered once.
  • the macaque was treated three times per week for two weeks (e.g. , Monday, Wednesday, Friday, Monday, Wednesday and Friday).
  • FIG. 7 Blood and lymph node samples were analyzed before, during and after the two week hetIL-15 treatment. The results are presented in Figure 7, which shows that, in addition to blood increase, lymphocytes also increased in the lymph nodes. The effect on the increase of effector CD8 was strong, that is, hetIL-15 preferentially increased the presence of the effector CD8 population (CD28 CD95 ), which is normally very low in the lymph nodes.
  • Figure 8 shows T lymphocyte proliferation and PD1 expression within the lymph nodes with hetIL-15 treatment. The results indicate that both the proliferation and the PD1 marker expression increased in the lymph node lymphocytes after hetIL-15 treatment.
  • Table 6 compares the dose design in this example (Treatment No. 3) with other hetIL-15 treatment regimens.
  • Table 7 shows the symptoms and therapy for the animals under different hetIL-15 treatment regimens.
  • Table 8 shows the effects of different hetIL-15 treatments. Necropsy indicates the period after hetIL-15 administration, when the animals were sacrificed and their tisues studied extensively. Animal T138 was not sacrificed, but was biopsied at the same time after hetIL-15 administration.
  • the dose escalation treatment in this example (Treatment No. 3) was well tolerated in macaque T138. Tables 6 and 7 show comparison of this regimen with others, and indicates that the symptoms developed in Treatment No. 3 were mild and reversible. High fever was present only after the highest dose administered, and the decrease in blood pressure was minimal. In the low dose escalation treatment (treatment #3), low fever was seen at after the third dose (8 ⁇ g/kg), and in the high dose escalation treatment (Treatment No. 4), low fever was seen after the fifth injection (80 ⁇ g/kg). Generally, the symptoms in the low dose escalation animal were much milder and transient compared to those of the high dose escalation animal.
  • This example describes a dose escalation study to evaluate the effects of escalation of doses of a human IL-15/soluble IL-15Ra complex (hetIL-15) within individual macques.
  • the IL-15/soluble IL-15Ra complex used in this study was composed of IL-15 (SEQ ID NO: l without the signal peptide) and soluble IL-15Ra (SEQ ID NO: 33). The complex was produced as described in Example 1, supra.
  • Rhesus macaque were each administered subcutaneous injections of IL-15/soluble IL-15Ra complex (hetIL-15) at the following doses of 5 ⁇ g/kg, 10 ⁇ g/kg, 20 ⁇ g/kg, 40 ⁇ g/kg, 80 ⁇ g/kg, and 120 ⁇ g/kg of IL-15 determined based on the mass of single chain IL-15, wherein each dose was administered once. Animals were treated three times per week for two weeks ⁇ e.g., Monday, Wednesday, Friday, Monday, Wednesday and Friday).
  • the vascular endothelium comprises a significant barrier for large molecules and cells. Specifically, passive transport is possible only for small molecular weight blood components, while larger proteins and cells can enter the interstitial space through transport mechanisms and diapedesis. However, during systemic
  • the endothelial barrier becomes more permissive, allowing for the "leakage" of large molecular weight components, such as albumin through the capillary vasculature. This results in a loss of osmotic pressure in the circulating blood, and thus a loss of water to the interstitial space. Clinically, this manifests in bilateral interstitial edema (including lungs) and hypotension. Hypotension may be enhanced by vasodilatory effects of immune mediators.
  • albumin/globulin Ratio As indicators of vascular leakage, comparison of albumin profile is presented in Figure 9 and albumin/globulin (Alb/Glob) Ratio is presented in Figure 10.
  • This example describes a dose escalation study to evaluate the effects of escalation of doses of a human IL-15/soluble IL-15Ra complex in a macaque tumor.
  • Animal T138 developed a malignant hemangiosarcoma tumor, which was biopsied and studied before and after a 2 week dose escalation regimen with hetIL-15. The animal remained free from tumor regrowth for at least three months.
  • the IL-15/soluble IL-15Ra complex used in this study was composed of IL-15 (SEQ ID NO: l without the signal peptide) and soluble IL- 15Ra (SEQ ID NO: 33). The complex was produced as described in Example 1, supra.
  • Rhesus macaque T138 was administered subcutaneous injections of IL-15/soluble IL-15Ra complex at the following doses of 2 ⁇ g/kg, 4 ⁇ g/kg, 8 ⁇ g/kg, 16 ⁇ g/kg, 32 ⁇ g/kg, and 64 ⁇ g/kg of IL-15 determined based on the mass of single chain IL-15, wherein each dose is administered once.
  • the animal was injected three times per week for two weeks ⁇ e.g., Monday, Wednesday, Friday, Monday, Wednesday and Friday).
  • Macaque T138 developed a malignant tumor classified as malignant
  • hemangiosarcoma The tumor was biopsied, and isolated cells were evaluated by flow cytometry analysis both before and also after a 2 week dose escalation regimen of hetIL-15. The results suggest that hetIL-15 treatment promoted lymphocyte infiltration within the tumor and increased the expression of PD1, as shown in Figure 11.
  • This example describes a study to induce potent de novo and recall CTL responses in infected macaques, treated with antiretroviral therapy ("ART") by combining conserveed Element DNA vaccine and hetIL-15 recombinant cytokine, in order to compare the size of the virus reservoir upon ART treatment, in the presence or absence of therapeutic vaccination and hetIL-15 treatment.
  • ART antiretroviral therapy

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Cell Biology (AREA)
  • Virology (AREA)
  • Pulmonology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Molecular Biology (AREA)
  • Diabetes (AREA)
  • AIDS & HIV (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
PCT/US2015/042489 2014-07-29 2015-07-28 Il-15 and il-15ralpha heterodimer dose escalation regimens for treating conditions Ceased WO2016018920A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2017504713A JP6655061B2 (ja) 2014-07-29 2015-07-28 状態を治療するためのil−15およびil−15rアルファヘテロ二量体用量増加レジメン
US15/328,882 US10335460B2 (en) 2014-07-29 2015-07-28 IL-15 and IL-15Rα heterodimer dose escalation regimens for treating conditions
EP15828027.1A EP3174974B1 (en) 2014-07-29 2015-07-28 Il-15 and il-15ralpha heterodimer dose escalation regimens for treating conditions
ES15828027T ES2811974T3 (es) 2014-07-29 2015-07-28 Regímenes de aumento escalonado de la dosis del heterodímero de il-15 e il-15ralfa para tratar afecciones

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462030394P 2014-07-29 2014-07-29
US62/030,394 2014-07-29

Publications (2)

Publication Number Publication Date
WO2016018920A1 true WO2016018920A1 (en) 2016-02-04
WO2016018920A8 WO2016018920A8 (en) 2017-01-12

Family

ID=55218246

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/042489 Ceased WO2016018920A1 (en) 2014-07-29 2015-07-28 Il-15 and il-15ralpha heterodimer dose escalation regimens for treating conditions

Country Status (5)

Country Link
US (1) US10335460B2 (OSRAM)
EP (1) EP3174974B1 (OSRAM)
JP (1) JP6655061B2 (OSRAM)
ES (1) ES2811974T3 (OSRAM)
WO (1) WO2016018920A1 (OSRAM)

Cited By (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017177063A1 (en) 2016-04-06 2017-10-12 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Use of heterodimeric il-15 in adoptive cell transfer
WO2018013855A2 (en) 2016-07-14 2018-01-18 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Il-15/il-15 receptor alpha treatment regimens and use with therapeutic vaccines
WO2018134784A1 (en) * 2017-01-20 2018-07-26 Novartis Ag Combination therapy for the treatment of cancer
CN109496217A (zh) * 2016-05-27 2019-03-19 阿尔托生物科学有限公司 具有cd3结合域的基于多聚体il-15的分子的构造和表征
US10251922B2 (en) 2013-03-14 2019-04-09 Icahn School Of Medicine At Mount Sinai Newcastle disease viruses and uses thereof
US10308913B2 (en) 2005-12-02 2019-06-04 Icahn School Of Medicine At Mount Sinai Chimeric viruses presenting non-native surface proteins and uses thereof
JP2019517499A (ja) * 2016-06-02 2019-06-24 イムノコア リミテッド gp100特異的TCR−抗CD3 scFv融合タンパク質の投薬レジメン
WO2019150310A1 (en) * 2018-02-02 2019-08-08 Novartis Ag Combination of sting agonist and il-15/il15-ra for the treatment of cancer
US10973917B2 (en) 2016-05-18 2021-04-13 Modernatx, Inc. MRNA combination therapy for the treatment of cancer
US11058725B2 (en) 2019-09-10 2021-07-13 Obsidian Therapeutics, Inc. CA2 compositions and methods for tunable regulation
WO2021214658A1 (en) * 2020-04-22 2021-10-28 Novartis Ag Pharmaceutical compositions and pharmaceutical products of heterodimeric human interleukin-15 (hetil-15)
US20220106375A1 (en) * 2019-01-11 2022-04-07 Memorial Sloan Kettering Cancer Center Multimerization of il-15/il-15r-alpha-fc complexes to enhance immunotherapy
US11389495B2 (en) 2014-02-27 2022-07-19 Merck Sharp & Dohme Llc Combination method for treatment of cancer
US11446398B2 (en) 2016-04-11 2022-09-20 Obsidian Therapeutics, Inc. Regulated biocircuit systems
US11472856B2 (en) 2016-06-13 2022-10-18 Torque Therapeutics, Inc. Methods and compositions for promoting immune cell function
US11524033B2 (en) 2017-09-05 2022-12-13 Torque Therapeutics, Inc. Therapeutic protein compositions and methods of making and using the same
WO2024040132A2 (en) 2022-08-16 2024-02-22 The United States Of America, As Represented By The Secretary, Department Of Health And Human Servic Synergistic interactions for improved cancer treatment
US12042534B2 (en) 2017-05-12 2024-07-23 Icahn School Of Medicine At Mount Sinai Newcastle disease viruses and uses thereof
US12104178B2 (en) 2017-03-03 2024-10-01 Obsidian Therapeutics, Inc. DHFR tunable protein regulation
US12257286B2 (en) 2018-10-31 2025-03-25 Mayo Foundation For Medical Education And Research Methods and materials for treating cancer
US12264189B2 (en) 2018-10-31 2025-04-01 Mayo Foundation For Medical Education And Research Methods and materials for treating cancer
US12338458B2 (en) 2017-05-25 2025-06-24 Memorial Sloan Kettering Cancer Center Use of the IL-15/IL-15Rα complex in the generation of antigen-specific T cells for adoptive immunotherapy
US12391957B2 (en) 2018-08-17 2025-08-19 Icahn School Of Medicine At Mount Sinai Recombinant Newcastle disease viruses and uses thereof for the prevention of RSV disease or human metapneumovirus disease
US12448423B2 (en) 2018-12-20 2025-10-21 Xencor, Inc. Targeted heterodimeric Fc fusion proteins containing NKG2D antigen binding domains
US12509495B2 (en) 2018-04-18 2025-12-30 Xencor, Inc. LAG-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and LAG-3 antigen binding domains
US12624086B2 (en) 2018-10-31 2026-05-12 Mayo Foundation For Medical Education And Research Materials and methods for treating cancer

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3974520A1 (en) 2013-05-14 2022-03-30 Board of Regents, The University of Texas System Human application of engineered chimeric antigen receptor (car) t-cells
CA3190002A1 (en) 2014-02-14 2015-08-20 Board Of Regents, The University Of Texas System Chimeric antigen receptors and methods of making
TWI808055B (zh) 2016-05-11 2023-07-11 美商滬亞生物國際有限公司 Hdac 抑制劑與 pd-1 抑制劑之組合治療
TWI794171B (zh) 2016-05-11 2023-03-01 美商滬亞生物國際有限公司 Hdac抑制劑與pd-l1抑制劑之組合治療
CA3049652A1 (en) 2017-01-10 2018-07-19 Intrexon Corporation Modulating expression of polypeptides via new gene switch expression systems
CA3102821A1 (en) 2018-06-22 2019-12-26 Cugene Inc. Novel interleukin-15 (1l-15) fusion proteins and uses thereof
WO2019246392A1 (en) 2018-06-22 2019-12-26 Cugene Inc. Cytokine-based bioactivatable drugs and methods of uses thereof
WO2020086742A1 (en) * 2018-10-24 2020-04-30 Obsidian Therapeutics, Inc. Er tunable protein regulation
CN115151279B (zh) * 2019-12-13 2026-05-05 科优基因公司 基于细胞因子的可生物活化药物及其使用方法
US20230151095A1 (en) 2021-11-12 2023-05-18 Xencor, Inc. Bispecific antibodies that bind to b7h3 and nkg2d
WO2024102636A1 (en) 2022-11-07 2024-05-16 Xencor, Inc. Bispecific antibodies that bind to b7h3 and mica/b
US20250243279A1 (en) 2023-10-17 2025-07-31 Xencor, Inc. Bispecific antibodies that bind to nkp46 and mica/b
WO2025184249A1 (en) * 2024-02-28 2025-09-04 Emory University Cytokine therapies for managing hiv and other viral infections

Citations (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2034323A (en) 1978-12-18 1980-06-04 Inst Nat Sante Rech Med Production of DNA Comprising B Hepatitis Viral Genome
US4675187A (en) 1983-05-16 1987-06-23 Bristol-Myers Company BBM-1675, a new antibiotic complex
US4889803A (en) 1984-04-27 1989-12-26 Yeda Research & Development Co., Ltd. Production of interferon gamma
WO1993008656A1 (de) 1991-10-24 1993-04-29 Institut für Rundfunktechnik GmbH Verfahren zum übertragen oder speichern eines aus einer folge von informationsblöcken bestehenden digitalisierten, encodierten tonsignals über störbehaftete kanäle
WO1994012650A2 (en) 1992-12-03 1994-06-09 Transkaryotic Therapies, Inc. Activating expression of an amplifying endogenous gene by homologous recombination
WO1995030695A1 (en) 1994-05-06 1995-11-16 Immunex Corporation Interleukin-15 receptors
US5965726A (en) 1992-03-27 1999-10-12 The United States Of America As Represented By The Department Of Health And Human Services Method of eliminating inhibitory/ instability regions of mRNA
US6162432A (en) 1991-10-07 2000-12-19 Biogen, Inc. Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction
WO2001068882A2 (en) 2000-03-14 2001-09-20 Transkaryotic Therapies, Inc. Methods for homologous recombination
WO2002069904A2 (en) 2001-03-02 2002-09-12 Medimmune, Inc. Cd2 antagonists for treatment of autoimmune or inflammatory disease
US20050048549A1 (en) 2003-01-21 2005-03-03 Liangxian Cao Methods and agents for screening for compounds capable of modulating gene expression
WO2005085282A1 (en) 2004-02-27 2005-09-15 Inserm (Institut National De La Sante Et De La Recherche Medicale) Il-15 binding site for il15-ralpha and specific il-15 mutants having agonists/antagonists activity
WO2007070488A2 (en) 2005-12-12 2007-06-21 The Cbr Institute For Biomedical Research, Inc. Integrin alpha l i domain mutants with increased binding affinity
WO2007084342A2 (en) 2006-01-13 2007-07-26 The Government Of The United States, As Represented By The Secretary Of The Department Of Health And Human Services, National Institutes Of Health Codon optimi zed il- 15 and il- 15r-alpha genes for expression in mammalian cells
US20090238791A1 (en) 2005-10-20 2009-09-24 Institut National De La Sante Et De La Recherche Medicale Il-15ralpha sushi domain as a selective and potent enhancer of il-15 action through il-15beta/gamma, and hyperagonist (il-15ralpha sushi - il-15) fusion proteins
WO2010020047A1 (en) 2008-08-22 2010-02-25 Magna Seating Inc. Disc recliner with reduced backlash
US8124084B2 (en) 2005-05-17 2012-02-28 University Of Connecticut Compositions and methods for immunomodulation in an organism using IL-15 and soluble IL-15Ra
US8163879B2 (en) 2007-05-11 2012-04-24 Altor Bioscience Corporation Fusion molecules and IL-15 variants
US20120141413A1 (en) * 2009-08-14 2012-06-07 Pavlakis George N Use of il-15 preparations to treat lymphopenia
US8507222B2 (en) 2010-09-21 2013-08-13 Altor Bioscience Corporation Multimeric IL-15 soluble fusion molecules and methods of making and using same
WO2014066527A2 (en) * 2012-10-24 2014-05-01 Admune Therapeutics Llc Il-15r alpha forms, cells expressing il-15r alpha forms, and therapeutic uses of il-15r alpha and il-15/il-15r alpha complexes

Patent Citations (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB2034323A (en) 1978-12-18 1980-06-04 Inst Nat Sante Rech Med Production of DNA Comprising B Hepatitis Viral Genome
US4675187A (en) 1983-05-16 1987-06-23 Bristol-Myers Company BBM-1675, a new antibiotic complex
US4889803A (en) 1984-04-27 1989-12-26 Yeda Research & Development Co., Ltd. Production of interferon gamma
US6162432A (en) 1991-10-07 2000-12-19 Biogen, Inc. Method of prophylaxis or treatment of antigen presenting cell driven skin conditions using inhibitors of the CD2/LFA-3 interaction
WO1993008656A1 (de) 1991-10-24 1993-04-29 Institut für Rundfunktechnik GmbH Verfahren zum übertragen oder speichern eines aus einer folge von informationsblöcken bestehenden digitalisierten, encodierten tonsignals über störbehaftete kanäle
US5965726A (en) 1992-03-27 1999-10-12 The United States Of America As Represented By The Department Of Health And Human Services Method of eliminating inhibitory/ instability regions of mRNA
US6794498B2 (en) 1992-03-27 2004-09-21 The United States Of America As Represented By The Department Of Health And Human Services Method of eliminating inhibitory/instability regions of mRNA
US6174666B1 (en) 1992-03-27 2001-01-16 The United States Of America As Represented By The Department Of Health And Human Services Method of eliminating inhibitory/instability regions from mRNA
US6291664B1 (en) 1992-03-27 2001-09-18 The United States Of America As Represented By The Department Of Health And Human Services Method of eliminating inhibitory/instability regions of mRNA
US6414132B1 (en) 1992-03-27 2002-07-02 The United States Of America As Represented By The Department Of Health And Human Services Method of eliminating inhibitory/instability regions of mRNA
WO1994012650A2 (en) 1992-12-03 1994-06-09 Transkaryotic Therapies, Inc. Activating expression of an amplifying endogenous gene by homologous recombination
WO1995030695A1 (en) 1994-05-06 1995-11-16 Immunex Corporation Interleukin-15 receptors
WO2001068882A2 (en) 2000-03-14 2001-09-20 Transkaryotic Therapies, Inc. Methods for homologous recombination
WO2002069904A2 (en) 2001-03-02 2002-09-12 Medimmune, Inc. Cd2 antagonists for treatment of autoimmune or inflammatory disease
WO2002098370A2 (en) 2001-03-02 2002-12-12 Medimmune, Inc. Methods of administering/dosing cd2 antagonists for the prevention and treatment of autoimmune disorders or inflammatory disorders
US20050048549A1 (en) 2003-01-21 2005-03-03 Liangxian Cao Methods and agents for screening for compounds capable of modulating gene expression
WO2005085282A1 (en) 2004-02-27 2005-09-15 Inserm (Institut National De La Sante Et De La Recherche Medicale) Il-15 binding site for il15-ralpha and specific il-15 mutants having agonists/antagonists activity
US8124084B2 (en) 2005-05-17 2012-02-28 University Of Connecticut Compositions and methods for immunomodulation in an organism using IL-15 and soluble IL-15Ra
US20090238791A1 (en) 2005-10-20 2009-09-24 Institut National De La Sante Et De La Recherche Medicale Il-15ralpha sushi domain as a selective and potent enhancer of il-15 action through il-15beta/gamma, and hyperagonist (il-15ralpha sushi - il-15) fusion proteins
WO2007070488A2 (en) 2005-12-12 2007-06-21 The Cbr Institute For Biomedical Research, Inc. Integrin alpha l i domain mutants with increased binding affinity
WO2007084342A2 (en) 2006-01-13 2007-07-26 The Government Of The United States, As Represented By The Secretary Of The Department Of Health And Human Services, National Institutes Of Health Codon optimi zed il- 15 and il- 15r-alpha genes for expression in mammalian cells
US8163879B2 (en) 2007-05-11 2012-04-24 Altor Bioscience Corporation Fusion molecules and IL-15 variants
WO2010020047A1 (en) 2008-08-22 2010-02-25 Magna Seating Inc. Disc recliner with reduced backlash
US20120141413A1 (en) * 2009-08-14 2012-06-07 Pavlakis George N Use of il-15 preparations to treat lymphopenia
US8507222B2 (en) 2010-09-21 2013-08-13 Altor Bioscience Corporation Multimeric IL-15 soluble fusion molecules and methods of making and using same
WO2014066527A2 (en) * 2012-10-24 2014-05-01 Admune Therapeutics Llc Il-15r alpha forms, cells expressing il-15r alpha forms, and therapeutic uses of il-15r alpha and il-15/il-15r alpha complexes

Non-Patent Citations (158)

* Cited by examiner, † Cited by third party
Title
"Physicians' Desk Reference", 2012
"The Merck Manual", 2006, MERCK & CO., article "Lymphopenia Description"
"Useful proteins from recombinant bacteria", SCIENTIFIC AMERICAN, vol. 242, 1980, pages 74 - 94
AHMAD ET AL., AM J KIDNEY DIS., vol. 7, no. 2, 1986, pages 153 - 6
ALEXANDER ET AL., MOL. CELL. BIOL., vol. 7, 1987, pages 1436 - 1444
ALEXANDRAKIS ET AL., BR J OPHTHALMOL., vol. 82, no. 3, 1998, pages 306 - 11
ALTURE-WERBER EEDBERG SC, MYCOPATHOLOGIA, vol. 89, no. 2, 1985, pages 69 - 73
ANDRUTIS ET AL., J CLIN MICROBIOL., vol. 38, no. 6, 2000, pages 32606 - 23
ARATANI ET AL., MED MYCOL, vol. 40, no. 6, 2002, pages 557 - 563
ARENDRUP ET AL., INFECTION, vol. 30, no. 5, 2002, pages 286 - 91
ARICO ET AL., J INTERFERON CYTOKINE RES, vol. 22, no. 11, 2002, pages 1081 - 8
AYASH-RASHKOVSKY ET AL., FASEB J., vol. 19, 2005, pages 1149 - 1151
BALASUBRAMANIAN ET AL., IMMUNOBIOLOGY, vol. 191, no. 4-5, 1994, pages 395 - 401
BARBEE ET AL., AM J PATHOL., vol. 86, no. 1, 1977, pages 281 - 4
BEERS ET AL., J LAB CLIN MED., vol. 133, no. 5, 1999, pages 423 - 33
BERNOISTCHAMBON, NATURE, vol. 290, 1981, pages 304 - 310
BOLGER ET AL., ANTIVIRAL RES., vol. 35, 1997, pages 157 - 165
BONYHADI ET AL., MOL. MED. TODAY, vol. 3, 1997, pages 246 - 253
BOZZA ET AL., MICROBES INFECT, vol. 4, no. 13, 2002, pages 1281 - 1290
BRAVO ET AL., ANTIVIRAL RES., vol. 60, 2003, pages 41 - 49
BRAVO ET AL., J. INFECTIOUS DISEASES, vol. 193, 2006, pages 591 - 597
BRIELAND ET AL., IMMUNOPHARMACOLOGY, vol. 48, no. 3, 2000, pages 249 - 52
BRIGHT ET AL., NATURE, vol. 436, 2005, pages 973 - 978
BRINSTER ET AL., NATURE, vol. 296, 1982, pages 39 - 42
BROWN ET AL., AM J REPROD IMMUNOL., vol. 46, no. 3, 2001, pages 232 - 41
BROWNING ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 14637 - 14641
BRYANT ET AL., LAB INVEST, vol. 80, no. 4, 2000, pages 553 - 73
CACCIAPUOTI ET AL., ANTIMICROB AGENTS CHEMOTHER, vol. 44, no. 8, 2000, pages 2017 - 2022
CARBON ET AL., INT J BIOMED COMPUT., vol. 36, no. 1-2, 1994, pages 59 - 67
CAVANAUGH ET AL., J. VIROL., vol. 71, 1997, pages 3236 - 3243
CHAKRABARTI ET AL., J MED VET MYCOL., vol. 35, no. 4, 1997, pages 295 - 7
CHEN ET AL., VIROL. J, vol. 1, no. 11, 23 November 2004 (2004-11-23)
CHERTOVA ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 288, no. 25, 2013, pages 18093 - 103
CHU ET AL., AVIAN DIS., vol. 40, no. 3, 1996, pages 715 - 9
COCK ET AL., REV INST MED TROP SAO PAULO, vol. 42, no. 2, 2000, pages 59 - 66
COLE ET AL., FEMS MICROBIOL LETT. 15, vol. 126, no. 2, 1995, pages 177 - 80
CRUTE ET AL., NATURE MEDICINE, vol. 8, 2002, pages 386 - 391
CULLEY ET AL., J EXP MED, vol. 196, no. 10, 2002, pages 1381 - 1386
CURTIS ET AL., EXP BIOL MED, vol. 227, no. 9, 2002, pages 799 - 802
DAVISMATALON, NEWS PHYSIOL SCI, vol. 16, 2001, pages 185 - 90
DEBOER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 80, 1983, pages 21 - 25
EMINI ET AL., NATURE, vol. 304, 1983, pages 699
EMSLIE & NADE, REV INFECT DIS., vol. 8, no. 6, 1986, pages 841 - 9
ENGLER ET AL., MOL IMMUNOL, vol. 38, no. 6, 2001, pages 457 - 65
FEHNIGERCALIGIURI, BLOOD, vol. 97, 2001, pages 14 - 32
FIDEL ET AL., J INFECT DIS., vol. 173, no. 2, 1996, pages 425 - 31
FLAN ET AL., J. INFECT. DIS., vol. 185, 2002, pages 153 - 161
FLANO ET AL., IMMUNOL RES, vol. 25, no. 3, 2002, pages 201 - 17
FODDESMITS, TRENDS MOL MED, vol. 7, no. 8, 2001, pages 369 - 73
GANEMVARMUS, ANN. REV. BIOCHEM., vol. 56, 1987, pages 651 - 693
GARDNER ET AL., NUCL. ACIDS RES., vol. 9, 1981, pages 2871
GHANEH ET AL., GENE THER, vol. 8, no. 3, 2001, pages 199 - 208
GOKASLANANAISSIE, INFECT IMMUN., vol. 60, no. 8, 1992, pages 3339 - 44
GROSSCHEDL ET AL., CELL, vol. 38, 1984, pages 647 - 658
GUHAD ET AL., FEMS MICROBIOL LETT., vol. 192, no. 1, 2000, pages 27 - 31
GUIDOTTI ET AL., J. VIROL., vol. 69, 1995, pages 6158 - 6169
HABERBERGER ET AL., EXPERIENTIA, vol. 47, no. 5, 1991, pages 426 - 9
HAMMER ET AL., SCIENCE, vol. 235, 1987, pages 53 - 58
HAN ET AL., CYTOKINE, vol. 56, 2011, pages 804 - 810
HAYASHI ET AL., HISTOL HISTOPATHOL, vol. 17, no. 4, 2002, pages 1293 - 310
HERBER ET AL., J VIROL, vol. 274, no. 3, 1996, pages 1873 - 81
HERRERA-ESTRELLA ET AL., NATURE, vol. 310, 1984, pages 115 - 120
HONDA ET AL., MYCOPATHOLOGIA, vol. 144, no. 3, 1998, pages 141 - 146
HORI ET AL., EUR J IMMUNO, vol. 32, no. 5, 2002, pages 1282 - 1291
HOSOKAWA ET AL., TRANSGENIC RES, vol. 10, no. 5, 2001, pages 471 - 8
HOUGH ET AL., PROC NATL ACAD SCI USA, vol. 95, no. 23, 1998, pages 13853 - 8
HSIUNG ET AL., REV INFECT DIS., vol. 6, no. l, 1984, pages 33 - 50
HSU ET AL., NAT. BIOTECHNOL., vol. 21, 2003, pages 519 - 525
JENSENSCHONHEYDER, J EXP ANIM SCI., vol. 35, no. 4, 1993, pages 155 - 60
JOLICOEUR ET AL., LEUKEMIA, vol. 13, 1999, pages 34 37 - S80
KADO ET AL., CANCER RES, vol. 61, no. 6, 2001, pages 2395 - 8
KAMEI, MYCOPATHOLOGIA, vol. 152, no. 1, 2001, pages 5 - 13
KANE ET AL., ANTIMICROB AGENTS CHEMOTHER, vol. 20, no. 5, 1981, pages 595 - 9
KAZANJI, AIDS RES HUM RETROVIRUSES, vol. 16, no. 16, 2000, pages 1741 - 6
KERN ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 48, 2004, pages 4745 - 4753
KLOSE, TRENDS MICROBIOL., vol. 8, no. 4, 2000, pages 189 - 91
KNETEMAN ET AL., HEPATOLOGY, vol. 43, 2006, pages 1346 - 1353
KOEDELPFISTER, INFECT DIS CLIN NORTH AM., vol. 13, no. 3, 1999, pages 549 - 77
KOLLIAS ET AL., CELL, vol. 46, 1986, pages 485 - 495
KRUMLAUF ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 1639 - 1648
KULKARNI ET AL.: "Altered Response Hierarchy and Increased T-cell Breadth upon HIV-1 Conserved Element DNA Vaccination in Macaques", PLOS ONE, vol. 9, 2014, pages e86254
KULKARNI ET AL.: "HIV-1 Conserved Elements p24CE DNA Vaccine Induces Humoral Immune Responses with Broad Epitope Recognition in Macaques", PLOS ONE, vol. 9, pages e111085, XP055519060, DOI: 10.1371/journal.pone.0111085
KURAGUCHI ET AL., ONCOGENE, vol. 19, no. 50, 2000, pages 5755 - 63
KURUP ET AL., INT ARCH ALLERGY IMMUNOL, vol. 129, no. 2, 2002, pages 129 - 137
KURUP ET AL., J IMMUNOL., vol. 148, no. 12, 1992, pages 3783 - 8
LEE, BAILLIERES BEST PRACT RES CLIN GASTROENTEROL., vol. 14, no. l, 2000, pages 75 - 96
LEVY ET AL., J. CLIN. INVEST., vol. 119, 2009, pages 997 - 1007
MACDONALD, HEPATOLOGY, vol. 7, 1987, pages 425 - 515
MAEBASHI ET AL., J MED VET MYCOL., vol. 32, no. 5, 1994, pages 349 - 59
MAESTRONE ET AL., AM J VET RES., vol. 34, no. 6, 1973, pages 833 - 6
MARTIN ET AL., ANTIMICROB AGENTS CHEMOTHER., vol. 41, no. 1, 1997, pages 13 - 6
MASON ET AL., SCIENCE, vol. 234, 1986, pages 1372 - 1378
MCCAULEY ET AL., ANTIVIRAL RES., vol. 27, 1995, pages 179 - 186
MERCER ET AL., NAT. MED., vol. 7, 2001, pages 927 - 933
MORRIS ET AL., J LA STATE MED SOC, vol. 150, no. 4, 1998, pages 179 - 85
MORTIER ET AL., J. BIOL. CHEM., vol. 281, no. 3, 2006, pages 1612 - 9
MOSIER ET AL., HOSP. PRACT., vol. 31, 1996, pages 41 - 48,53-55,59-60
MOSIER ET AL., SEMIN. IMMUNOL., vol. 8, 1996, pages 255 - 262
MOSMANN, J. IMMUNOL. METHODS, vol. 65, no. 55, 1983, pages 63
MOTHE ET AL.: "A Human Immune Data-Informed Vaccine Concept Elicits Strong and Broad T-cell Specificities Associated with HIV-1 Control in Mice and Macaques", J TRANSL MED IN PRESS, 2015
NAJVAR ET AL., ANTIMICROB AGENTS CHEMOTHER., vol. 43, no. 2, 1999, pages 413 - 4
NEDRUD, FEMS IMMUNOL MED MICROBIOL., vol. 24, no. 2, 1999, pages 243 - 50
ONDERDONK ET AL., REV INFECT DIS., vol. 1, no. 2, 1979, pages 291 - 301
ONDERDONK ET AL., REV INFECT DIS., vol. 12, no. 2, 1990, pages 169 - 77
ORNITZ ET AL., COLD SPRING HARBOR SYMP. QUANT. BIOL., vol. 50, 1986, pages 399 - 409
OTTOLINI ET AL., J INFECT DIS, vol. 186, no. 12, 2002, pages 1713 - 1717
PAGE ET AL., INTL. J. OF ONCOLOGY, vol. 3, no. 473, 1993, pages 476
PALLADINO ET AL., CANCER RES., vol. 154 ; 155, 1987, pages 5074 - 5079
PERBAL, A PRACTICAL GUIDE TO MOLECULAR CLONING, 1984
PHILLIPS ET AL., J PSYCHOPHARMACOL., vol. 14, no. 3, 2000, pages 244 - 50
PIAZZA ET AL., CANCER RESEARCH, vol. 55, no. 3110, 1995, pages 16
PINKERT ET AL., GENES AND DEVEL., vol. 1, 1987, pages 161 - 171
PLETNIKOV ET AL., FRONT BIOSCI, vol. 7, 2002, pages d593 - 607
POLLOCK ET AL., NAT, vol. 9, no. 2, 1995, pages 202 - 9
PRELLNER ET AL., MICROB DRUG RESIST., vol. 5, no. 1, 1999, pages 73 - 82
QUIMBYNGUYEN, CRIT REV MICROBIOL., vol. 12, no. 1, 1985, pages 1 - 44
RASMUSSEN ET AL., LANCET HIV, vol. 1, 2014, pages e13 - e2l
READHEAD ET AL., CELL, vol. 48, 1987, pages 703 - 712
RIDGWAY ET AL., LAB ANIM SCI., vol. 36, no. 5, 1986, pages 481 - 5
RIVERA ET AL., J IMMUNO, vol. 168, no. 7, 2002, pages 3419 - 3427
ROSSI ET AL.: "Histone deacetylase inhibitors impair NK cell viability and effector functions through inhibition of activation and receptor expression.", JOURNAL OF LEUKOCYTE BIOLOGY, vol. 91, February 2012 (2012-02-01), pages 1 - 11, XP055392007 *
SAIF ET AL., ARCH VIROL SUPPL., vol. 12, 1996, pages 153 - 61
SALKOWSKIBALISH, INFECT IMMUN., vol. 58, no. 10, 1990, pages 3300 - 6
SAUERMANN, CURR MOL MED, vol. 1, no. 4, 2001, pages 515 - 22
SAWADA ET AL., J. EXP. MED., vol. 187, 1998, pages 1439 - 1449
SCHELD, J ANTIMICROB CHEMOTHER., vol. 20, no. A, 1987, pages 71 - 85
SCHITO ET AL., CURR. HIV RES., vol. 4, 2006, pages 379 - 386
SHEPHARD ET AL., RES VET SCI, vol. 74, no. 2, 2003, pages 187 - 190
SHETTYANTIA, INDIAN J LEPR., vol. 68, no. 1, 1996, pages 95 - 104
SHIBUYA ET AL., MICROB PATHOG., vol. 27, no. 3, 1999, pages 123 - 31
SIDWELL ET AL., ANTIVIRAL RES., vol. 48, 2000, pages 103 - 109
SINGH ET AL., MYCOPATHOLOGIA, vol. 112, no. 3, 1990, pages 127 - 37
SKEHAN ET AL., J. NAT'L CANCER INST., vol. 82, no. 1107, 1990, pages 12
SMITH, CIBA FOUND SYMP., vol. 42, 1976, pages 45 - 72
STOTLAND ET AL., PEDIATR PULMONOL., vol. 30, no. 5, 2000, pages 413 - 24
SUGIYAMA ET AL., J GASTROENTEROL., vol. 37, no. 13, 2002, pages 6 - 9
TAYLOR-ROBINSON, INFECTION, vol. 4, no. 1, 1976, pages 4 - 8
TIOLLAIS ET AL., NATURE, vol. 314, 1985, pages 283 - 286
UCHIDA ET AL., JPN J ANTIBIOT., vol. 47, no. 10, 1994, pages 1407 - 12
VASSALLO ET AL., AM J RESPIR CELL MOL BIOL, vol. 25, no. 2, 2001, pages 203 - 211
VIERLING, BEST PRACT RES CLIN GASTROENTEROL., vol. 15, no. 4, 2001, pages 591 - 610
VILLA-KAMAROFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 75, 1978, pages 3727 - 3731
VRIESENDORP, J INFECT DIS., vol. 176, no. 2, 1997, pages 164 - 8
WAGNER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 78, 1981, pages 1441 - 1445
WANG ET AL., INT J PANCREATOL, vol. 29, no. 1, 2001, pages 37 - 46
WANG ET AL., J. CLIN. INVEST., vol. 115, 2005, pages 128 - 137
WANG, CURR TOP MICROBIOL IMMUNOL., vol. 258, 2001, pages 201 - 19
WHITE ET AL., BRAIN PATHOL, vol. 11, no. 4, 2001, pages 475 - 9
WICHERWICHER, CRIT REV MICROBIOL., vol. 16, no. 3, 1989, pages 181 - 234
WILDER ET AL., AM J RESPIR CELL MOL BIOL, vol. 26, no. 3, 2002, pages 304 - 314
WILLIAMS ET AL., J INFECT DIS., vol. 178, no. 4, 1988, pages 1217 - 21
WU ET AL., GASTROENTEROLOGY, vol. 128, 2005, pages 1416 - 1423
YAMAMOTO ET AL., CELL, vol. 22, 1980, pages 787 - 797
YONEZAWA ET AL., J INFECT CHEMOTHER, vol. 6, no. 3, 2000, pages 155 - 161
YOSHIDA, KANSENSHOGAKU ZASSHI, vol. 72, no. 6, June 1998 (1998-06-01), pages 621 - 30
ZHANGROTH, IN VIVO, vol. 8, no. 5, 1994, pages 755 - 69
ZHU ET AL., ANTIMICROBIAL AGENTS AND CHEMOTHER., vol. 50, 2006, pages 3260 - 3268
ZHU ET AL., J. IMMUNOL., vol. 183, 2009, pages 3598

Cited By (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10308913B2 (en) 2005-12-02 2019-06-04 Icahn School Of Medicine At Mount Sinai Chimeric viruses presenting non-native surface proteins and uses thereof
US10251922B2 (en) 2013-03-14 2019-04-09 Icahn School Of Medicine At Mount Sinai Newcastle disease viruses and uses thereof
US11389495B2 (en) 2014-02-27 2022-07-19 Merck Sharp & Dohme Llc Combination method for treatment of cancer
WO2017177063A1 (en) 2016-04-06 2017-10-12 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Use of heterodimeric il-15 in adoptive cell transfer
US11446398B2 (en) 2016-04-11 2022-09-20 Obsidian Therapeutics, Inc. Regulated biocircuit systems
US10973917B2 (en) 2016-05-18 2021-04-13 Modernatx, Inc. MRNA combination therapy for the treatment of cancer
US11660341B2 (en) 2016-05-18 2023-05-30 Modernatx, Inc. mRNA combination therapy for the treatment of cancer
AU2017271593B2 (en) * 2016-05-27 2021-04-22 Altor Bioscience Corporation Construction and characterization of multimeric IL-15-based molecules with CD3 binding domains
EP3464352A4 (en) * 2016-05-27 2019-10-23 Altor BioScience Corporation CONSTRUCTION AND CHARACTERIZATION OF MULTIMED IL-15 BASED MOLECULES WITH CD3 BINDING DOMAINS
US10865230B2 (en) 2016-05-27 2020-12-15 Altor Bioscience, Llc Construction and characterization of multimeric IL-15-based molecules with CD3 binding domains
CN109496217A (zh) * 2016-05-27 2019-03-19 阿尔托生物科学有限公司 具有cd3结合域的基于多聚体il-15的分子的构造和表征
CN109496217B (zh) * 2016-05-27 2023-10-20 阿尔托生物科学有限公司 具有cd3结合域的基于多聚体il-15的分子的构造和表征
JP2019517499A (ja) * 2016-06-02 2019-06-24 イムノコア リミテッド gp100特異的TCR−抗CD3 scFv融合タンパク質の投薬レジメン
US11472856B2 (en) 2016-06-13 2022-10-18 Torque Therapeutics, Inc. Methods and compositions for promoting immune cell function
WO2018013855A3 (en) * 2016-07-14 2018-02-15 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Il-15/il-15 receptor alpha treatment regimens and use with therapeutic vaccines
WO2018013855A2 (en) 2016-07-14 2018-01-18 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Il-15/il-15 receptor alpha treatment regimens and use with therapeutic vaccines
WO2018134784A1 (en) * 2017-01-20 2018-07-26 Novartis Ag Combination therapy for the treatment of cancer
US12104178B2 (en) 2017-03-03 2024-10-01 Obsidian Therapeutics, Inc. DHFR tunable protein regulation
US12042534B2 (en) 2017-05-12 2024-07-23 Icahn School Of Medicine At Mount Sinai Newcastle disease viruses and uses thereof
US12338458B2 (en) 2017-05-25 2025-06-24 Memorial Sloan Kettering Cancer Center Use of the IL-15/IL-15Rα complex in the generation of antigen-specific T cells for adoptive immunotherapy
US11524033B2 (en) 2017-09-05 2022-12-13 Torque Therapeutics, Inc. Therapeutic protein compositions and methods of making and using the same
WO2019150310A1 (en) * 2018-02-02 2019-08-08 Novartis Ag Combination of sting agonist and il-15/il15-ra for the treatment of cancer
US12509495B2 (en) 2018-04-18 2025-12-30 Xencor, Inc. LAG-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and LAG-3 antigen binding domains
US12391957B2 (en) 2018-08-17 2025-08-19 Icahn School Of Medicine At Mount Sinai Recombinant Newcastle disease viruses and uses thereof for the prevention of RSV disease or human metapneumovirus disease
US12257286B2 (en) 2018-10-31 2025-03-25 Mayo Foundation For Medical Education And Research Methods and materials for treating cancer
US12264189B2 (en) 2018-10-31 2025-04-01 Mayo Foundation For Medical Education And Research Methods and materials for treating cancer
US12624086B2 (en) 2018-10-31 2026-05-12 Mayo Foundation For Medical Education And Research Materials and methods for treating cancer
US12448423B2 (en) 2018-12-20 2025-10-21 Xencor, Inc. Targeted heterodimeric Fc fusion proteins containing NKG2D antigen binding domains
US20220106375A1 (en) * 2019-01-11 2022-04-07 Memorial Sloan Kettering Cancer Center Multimerization of il-15/il-15r-alpha-fc complexes to enhance immunotherapy
US12497435B2 (en) * 2019-01-11 2025-12-16 Memorial Sloan Kettering Cancer Center Multimerization of IL-15/IL-15R-alpha-fc complexes to enhance immunotherapy
US11058725B2 (en) 2019-09-10 2021-07-13 Obsidian Therapeutics, Inc. CA2 compositions and methods for tunable regulation
WO2021214658A1 (en) * 2020-04-22 2021-10-28 Novartis Ag Pharmaceutical compositions and pharmaceutical products of heterodimeric human interleukin-15 (hetil-15)
JP2023523218A (ja) * 2020-04-22 2023-06-02 ノバルティス アーゲー ヘテロ二量体ヒトインターロイキン-15(hetIL-15)の医薬組成物及び医薬製品
WO2024040132A2 (en) 2022-08-16 2024-02-22 The United States Of America, As Represented By The Secretary, Department Of Health And Human Servic Synergistic interactions for improved cancer treatment

Also Published As

Publication number Publication date
US10335460B2 (en) 2019-07-02
EP3174974A1 (en) 2017-06-07
WO2016018920A8 (en) 2017-01-12
JP2017523187A (ja) 2017-08-17
JP6655061B2 (ja) 2020-02-26
US20170202924A1 (en) 2017-07-20
ES2811974T3 (es) 2021-03-15
EP3174974B1 (en) 2020-05-20
EP3174974A4 (en) 2018-04-18

Similar Documents

Publication Publication Date Title
US10335460B2 (en) IL-15 and IL-15Rα heterodimer dose escalation regimens for treating conditions
US20250108092A1 (en) Il-15r alpha forms, cells expressing il-15r alpha forms, and therapeutic uses of il-15r alpha and il-15/il-15r alpha complexes
US11110150B2 (en) Complexes of IL-15 and IL-15Ralpha and uses thereof
AU2013203204B2 (en) Complexes of il-15 and il-15r.alpha and uses thereof
AU2016206235B2 (en) Complexes of il-15 and il-15ralpha and uses thereof
CA2888896C (en) Il-15r alpha forms, cells expressing il-15r alpha forms, and therapeutic uses of il-15r alpha and il-15/il-15r alpha complexes
HK1197881B (en) Complexes of il-15 and il-15r alpha and uses thereof
HK1197881A (en) Complexes of il-15 and il-15r alpha and uses thereof
HK1143084B (en) Complexes of il-15 and il-15ralpha and uses thereof
WO2023192990A2 (en) Antibodies against human siglec-9 and use thereof for immunotherapy

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15828027

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2015828027

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015828027

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 15328882

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2017504713

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE