WO2015162195A1 - Acides aminés acylés par un acide gras pour l'administration de peptides par voie orale - Google Patents
Acides aminés acylés par un acide gras pour l'administration de peptides par voie orale Download PDFInfo
- Publication number
- WO2015162195A1 WO2015162195A1 PCT/EP2015/058758 EP2015058758W WO2015162195A1 WO 2015162195 A1 WO2015162195 A1 WO 2015162195A1 EP 2015058758 W EP2015058758 W EP 2015058758W WO 2015162195 A1 WO2015162195 A1 WO 2015162195A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- glp
- ethoxy
- amino acid
- pharmaceutical composition
- peptide
- Prior art date
Links
- 0 *C(C(O*)=O)N(*)C(*)=O Chemical compound *C(C(O*)=O)N(*)C(*)=O 0.000 description 4
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
- A61K47/183—Amino acids, e.g. glycine, EDTA or aspartame
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/20—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing sulfur, e.g. dimethyl sulfoxide [DMSO], docusate, sodium lauryl sulfate or aminosulfonic acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/4891—Coated capsules; Multilayered drug free capsule shells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P5/00—Drugs for disorders of the endocrine system
- A61P5/48—Drugs for disorders of the endocrine system of the pancreatic hormones
- A61P5/50—Drugs for disorders of the endocrine system of the pancreatic hormones for increasing or potentiating the activity of insulin
Definitions
- compositions comprising a GLP-1 peptide and a fatty acid acylated amino acid (FA-aa), and wherein the stereo configuration of the chiral carbon atom in the amino acid moiety of said FA-aa is in the D-configuration, as well as use thereof, including use thereof in medicine.
- FA-aa fatty acid acylated amino acid
- GLP-1 therapies are based on invasive and inconvenient parenteral administration.
- the oral route of administration is non-invasive and has a great potential to decrease the patient's discomfort related to drug administration and to increase drug compliance.
- Gl gastrointestinal
- the oral route of administration is complex and establishment of a composition suitable for treatment of patients with an effective bioavailability of GLP-1 is desired.
- the invention relates to an oral pharmaceutical composition
- a GLP-1 peptide and at least one amino acid acylated at a free amino group with a fatty acid comprising an alkyl group consisting of 5 to 19 carbon atoms, and wherein the stereo configuration of the chiral carbon atom in the amino acid moiety of said FA-aa is in the D-configuration.
- the invention relates to the composition as defined herein for use as a medicament.
- the invention relates to use of the composition as defined herein for increasing the oral bioavailability of a GLP-1 peptide.
- the present invention relates to pharmaceutical compositions comprising a GLP-1 peptide and a fatty acid acylated amino acid (FA-aa), and wherein the stereo configuration of the chiral carbon atom in the amino acid moiety of said FA-aa is in the D-configuration.
- the FA- aa's of the invention were surprisingly found to be permeation enhancers suitable for oral administration of GLP-1 peptides.
- the term "permeation enhancer” when used herein refers to compounds that promote the absorption of the GLP-1 peptide across the gastrointestinal tract.
- the FA-aa of the invention is suitable for increasing the bioavailability and/or absorption of GLP-1 peptides.
- a FA-aa is an amino acid-based surfactant and thus a mild and biodegradable surfactant with low toxicity.
- the term "surfactant” refers to any substance, in particular a detergent, that can adsorb at surfaces and interfaces, such as but not limited to liquid to air, liquid to liquid, liquid to container or liquid to any solid.
- the surfactant has no charged groups in its hydrophilic groups.
- the fatty acid N-acylated amino acids of the invention increase the absorption of GLP-1 peptides after oral administration to a higher degree than commonly used permeation enhancers known in the art.
- oral bioavailability refers to the amount of administered drug and/or active moieties thereof in systemic circulation after oral administration (estimated as the area under the plasma concentration versus time curve) relative to the amount of administered drug and/or active moieties thereof in systemic circulation after intravenous administration of said drug.
- the invention relates to use of the pharmaceutical composition as defined herein for increasing the oral bioavailability of a GLP-1 peptide.
- the invention relates to a method for increasing bioavailability of a GLP-1 peptide comprising oral administration of the pharmaceutical composition as defined herein.
- the invention relates to a method for increasing bioavailability of a GLP-1 peptide comprising the steps of including a FA-aa in a pharmaceutical composition of a GLP-1 peptide administered to a subject.
- the invention relates to a method for increasing the plasma concentration of a GLP-1 peptide comprising the step of exposing the gastrointestinal tract of a subject to a pharmaceutical composition comprising a GLP-1 peptide and a FA-aa resulting in an increased plasma concentration of said GLP-1 peptide in said subject.
- said exposure is achieved by oral administration of said pharmaceutical composition.
- the invention relates to a method for increasing the uptake of a GLP-1 peptide comprising the step of: exposing the gastrointestinal tract of a subject to a GLP-1 peptide and at least one FA-aa, whereby the plasma concentration of said GLP-1 peptide in said subject is increased compared to an exposure not including the at least one FA-aa.
- the invention relates to a method for increasing uptake of a GLP-1 peptide across an/the epithelia cell layer of the gastro intestinal tract comprising the steps of administering a pharmaceutical composition comprising a GLP-1 peptide and at least one FA-aa to a subject, whereby an increased uptake of said GLP-1 peptide is obtained compared to the uptake of said GLP-1 peptide obtained when said GLP-1 peptide composition does not include the at least one FA-aa.
- the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising i) a GLP-1 peptide and ii) at least one fatty acid amino acid (FA-aa) or a salt of said FA-aa, and wherein the stereo configuration of the chiral carbon atom in the amino acid moiety of said FA-aa is in the D- configuration.
- the pharmaceutical composition is an oral
- the pharmaceutical composition comprising a GLP-1 peptide and at least one amino acid acylated at a free amino group with a fatty acid, which are referred to as fatty acid acylated amino acids (FA-aa) herein.
- the invention relates to a pharmaceutical composition comprising a GLP-1 peptide and at least one amino acid acylated at its alpha-amino group with a fatty acid.
- amino acid refers to any molecule that contains both amine and carboxyl functional groups.
- the stereo configuration of the chiral carbon atom in the amino acid moiety of said FA-aa is in the D-configuration.
- the term "the stereo configuration of the chiral carbon atom in the amino acid moiety of said FA-aa is in the D- configuration" refers to that the amino acid moiety of the FA-aa comprises a D-isomer.
- the term "the stereo configuration of the chiral carbon atom in the amino acid moiety of said FA-aa is in the D-configuration” refers to the amino acid moiety of the FA- aa is a D-isomer.
- the amino acid moiety of the FA-aa may comprise a carbon atom the D- configuration before or after acylation to the fatty acid.
- the FA-aa comprises a fatty acid acylated to an amino acid which is an alpha— amino acid.
- the FA-aa comprises the amino acid residue of a non- cationic amino acid.
- the FA-aa may be represented by the general formula A-X, wherein A is the amino acid residue of a non-cationic amino acid and X is a fatty acid attached by acylation to A's alpha-amino group.
- non-cationic amino acid refers to an amino acid selected from the group consisting of non- polar hydrophobic amino acids, polar non-charged amino acids, and polar acidic amino acids.
- non-cationic amino acid refers to amino acids selected from the group consisting of Alanine (Ala), Valine (Val), Leucine (Leu), Isoleucine (lie), Phenylalanine (Phe), Tryptophane (Trp), Methionine (Met), Proline (Pro), Sarcosine, Serine (Ser), Threonine (Thr), Cysteine (Cys), Tyrosine (Tyr), Asparagine (Asn), and Glutamine (Gin), Aspartic acid (Asp), and Glutamic acid (Glu).
- the FA-aa comprises the amino acid residue of a non-polar hydrophobic amino acid.
- the FA-aa may be represented by the general formula A-X, wherein A is the amino acid residue of a non-polar hydrophobic amino acid and X is a fatty acid attached by acylation to A's alpha-amino group.
- non-polar hydrophobic amino acid refers to categorisation of amino acids used by the person skilled in the art.
- non-polar hydrophobic amino acid refers to an amino acid selected from the group consisting of Alanine (Ala), Valine (Val), Leucine (Leu), Isoleucine (lie), Phenylalanine (Phe), Tryptophane (Trp), Methionine (Met), Proline (Pro) and Sarcosine.
- the FA-aa comprises the amino acid residue of a polar non- charged amino acid.
- the FA-aa may be represented by the general formula A-X, wherein A is the amino acid residue of a polar non-charged amino acid and X is a fatty acid attached by acylation to A's alpha-amino group.
- A is the amino acid residue of a polar non-charged amino acid
- X is a fatty acid attached by acylation to A's alpha-amino group.
- polar non-charged amino acid refers to categorisation of amino acids used by the person skilled in the art.
- polar non-charged amino acid refers to an amino acid selected from the group consisting of Serine (Ser), Threonine (Thr), Cysteine (Cys), Tyrosine (Tyr), Asparagine (Asn), and Glutamine (Gin).
- the FA-aa comprises the amino acid residue of a polar acidic amino acid.
- the FA-aa may be represented by the general formula A-X, wherein A is the amino acid residue of a polar acidic amino acid and X is a fatty acid attached by acylation to A's alpha-amino group.
- polar acidic amino acid refers to categorisation of amino acids used by the person skilled in the art.
- polar acidic amino acid refers to an amino acid selected from the group consisting of Aspartic acid (Asp) and Glutamic acid (Glu).
- the amino acid residue of the FA-aa comprises the amino acid residue of an amino acid that is not encoded by the genetic code.
- Modifications of amino acids by acylation may be readily performed using acylation agents known in the art that react with e.g. the free alpha-amino group.
- the amino acid may be attached to the fatty acid via an N-acylation, i.e. resulting in an amide or ester bond.
- FA-aa's of the invention may be prepared using the method described in Leone-Bay et al (1995): "N-acylated alpha-amino acids as novel oral delivery agents for proteins", Journal of Medicinal Chemistry, 38(21 ), 4263-4269.
- FA-aa's of the invention may be prepared using the following method for synthesis of N-tetradecanoyl-D-threonine: 1 ) A solution of D-threonine (1 .2 mmol) and sodium bicarbonate (1.2 mmol) in water, 2 ml.
- amino acids and/or amino acid residues herein are the D- isomers. In some embodiments amino acids and/or amino acid residues herein are the L- isomers. In some embodiments of the invention the amino acid moiety is in the form of a mixture of enantiomers.
- the amino acid residue is in the free acid form and/or a salt thereof, such as a sodium (Na+) salt or a potassium (K+) salt thereof.
- the FA-aa may be represented by the general formula I:
- R1 is an alkyl group comprising 5 to 19 carbon atoms
- R2 is H (i.e. hydrogen), CH 3 (i.e. methyl group), or covalently attached to R4 via a (CH 2 )3 group
- R3 is H or absent
- R4 is an amino acid side chain or covalently attached to R2 via a (CH 2 )3 group, and wherein the stereo configuration of the chiral carbon atom in the amino acid moiety of said FA-aa is in the D-configuration; or a salt thereof.
- the FA-aa of the invention is acylated with a fatty acid comprising an alkyl group consisting of 5 to 19 carbon atoms.
- the alkyl group consists of 7 to 17 carbon atoms.
- the alkyl group consists of 9-15 carbon atoms.
- the alkyl group consists of 1 1 -13 carbon atoms.
- the alkyl group consists of 9 carbon atoms.
- the alkyl group consists of 1 1 carbon atoms.
- the alkyl group consists of 13 carbon atoms.
- the alkyl group consists of 15 carbon atoms.
- the alkyl group consists of 17 carbon atoms.
- an FA-aa of the invention first denotes the fatty acid acylation group, such as e.g. dodecanoyl for CH 3 (CH 2 )ioC(0)-, followed by the amino acid which is being acylated on its alpha-amino group such as e.g. L-alanine.
- the FA-aa named "N-dodecanoyl-L-alanine" is the same as the FA-aa of general formula I
- R1 is an alkyl group consisting of 1 1 carbon atoms
- R2 is H
- R3 is H
- R4 is the amino acid side chain of alanine and thus CH 3 (ie. a methyl group) and the configuration is of alanine is L.
- the FA-aa forms a salt e.g. with an alkali metal
- the naming starts with denoting the alkali metal forming the salt such as e.g. sodium, followed by the fatty acid acylation group and ending by the amino acid which is being acylated on its alpha- amino group.
- the FA-aa named "sodium N-dodecanoyl alaninate" is the same as the FA-aa of general formula I
- R1 is an alkyl group consisting of 1 1 carbon atoms
- R2 is H
- R3 is absent
- R4 is the amino acid side chain of alanine and thus CH 3 (ie. a methyl group) and sodium forms a salt with said FA-aa.
- the FA-aa is soluble at intestinal pH values, particularly in the range pH 5.5 to 8.0, such as in the range pH 6.5 to 7.0. In some embodiments the FA-aa is soluble below pH 9.0.
- the FA-aa has a solubility of at least 5mg/ml_. In some embodiments the FA-aa has a solubility of at least 10mg/ml_. In some embodiments the FA- aa has a solubility of at least 20mg/ml_. In some embodiments the FA-aa has a solubility of at least 30mg/ml_. In some embodiments the FA-aa has a solubility of at least 40 mg/mL. In some embodiments the FA-aa has a solubility of at least 50mg/ml_. In some embodiments the FA-aa has a solubility of at least 60mg/ml_.
- the FA-aa has a solubility of at least 70mg/ml_. In some embodiments the FA-aa has a solubility of at least 80mg/ml_. In some embodiments the FA-aa has a solubility of at least 90mg/ml_. In some embodiments the FA-aa has a solubility of at least 100mg/ml_. In some embodiments solubility of the FA-aa is determined in an aqueous solution at a pH value 1 unit above or below pKa of the FA-aa at 37°C. In some embodiments solubility of the FA-aa is determined in an aqueous solution at pH 8 at 37°C.
- solubility of the FA-aa is determined in an aqueous solution at a pH value 1 unit above or below pi of the FA-aa at 37°C. In some embodiments solubility of the FA-aa is determined in an aqueous solution at a pH value 1 units above or below pi of the FA-aa at 37°C, wherein said FA-aa two or more ionisable groups with opposite charges. In some embodiments solubility of the FA-aa is determined in an aqueous 50 mM sodium phosphate buffer, pH 8.0 at 37°C.
- R1 is alkyl group comprising 5 to 19 carbon atoms
- R2 is H (i.e. hydrogen) or CH 3 (i.e. methyl group)
- R3 is H; or a salt or the free acid form thereof.
- the FA-aa is selected from the group consisting of N- dodecanoyl-D-alanine, N-dodecanoyl-D-isoleucine, N-dodecanoyl-D-leucine, N-dodecanoyl- D-methionine, N-dodecanoyl-D-phenylalanine, sodium N-dodecanoyl prolinate, N- dodecanoyl-D-proline, N-dodecanoyl-D-tryptophane, sodium N-dodecanoyl valinate, N- dodecanoyl-D-valine, N-dodecanoyl-D-sarcosine, N-oleoyl-D-sarcosine and N-decyl-D- leucine.
- the FA-aa is selected from the group consisting of N- decanoyl-D-alanine, N-decanoyl-D-leucine, N-decanoyl-D-phenylalanine, N-decanoyl-D- valine.
- the FA-aa is selected from the group consisting of sodium N- decanoyl alaninate, N-decanoyl-D-alanine, N-decanoyl-D-isoleucine, N-decanoyl-D-leucine, N-decanoyl-D-methionine, N-decanoyl-D-phenylalanine, N-decanoyl-D-proline, N-decanoyl- D-threonine, N-decanoyl-D-tryptophane, N-decanoyl-D-valine, and N-decanoyl-D-Sarcosine.
- the FA-aa may be selected from the group consisting of N- dodecanoyl-D-alanine, N-dodecanoyl-D-leucine, N-dodecanoyl-D-phenylalanine, and N- dodecanoyl-D-valine.
- the FA-aa may be selected from the group consisting of N- dodecanoyl-D-asparagine, N-dodecanoyl-D-aspartic acid, N-dodecanoyl-D-cysteine, N- dodecanoyl-D-glutamine, N-dodecanoyl-D-serine, N-dodecanoyl-D-threonine, N-dodecanoyl- D-tyrosine, N-decanoyl-D-asparagine, N-decanoyl-D-aspartic acid, N-decanoyl-D-cysteine, N-decanoyl-D-glutamine, N-decanoyl-D-serine, N-decanoyl-D-threonine, and N-decanoyl-D- tyrosine, N-dodecanoyl-D-asparag
- the FA-aa may be selected from the group consisting of N- dodecanoyl-D-asparagine, N-dodecanoyl-D-aspartic acid, N-dodecanoyl-D-glutamic acid, N- decanoyl-D-asparagine, N-decanoyl-D-aspartic acid, and N-decanoyl-D-glutamic acid.
- Amisoft HS-1 1 P (sodium StearoyI Glutamate, Amisoft MS-1 1 (sodium MyristoyI Glutamate)), Amisoft LS-1 1 (sodium Dodecanoyl Glutamate), Amisoft CS-1 1 (sodium Cocoyl Glutamate) and N-cocoyl glutamic acid, N-dodecanoyl-D-asparagine, N-dodecanoyl-D-aspartic acid, N- dodecanoyl-D-glutamic acid, N-decanoyl-D-asparagine, N-decanoyl-D-aspartic acid, and N- decanoyl-D-glutamic acid.
- the FA-aa may be selected from the group consisting of Amisoft HS-1 1 P (sodium StearoyI Glutamate, Amisoft MS-1 1 (sodium MyristoyI Glutamate)), Amisoft LS-1 1 (sodium Dodecanoyl Glutamate), Amisoft CS-1 1 (sodium Cocoyl Glutamate), and sodium N-cocoyl glutamate.
- the FA-aa may be selected from the group consisting of N- dodecanoyl-D-asparagine, N-dodecanoyl-D-aspartic acid, N-dodecanoyl-D-glutamic acid, N- decanoyl-D-asparagine, N-decanoyl-D-aspartic acid, and N-decanoyl-D-glutamic acid.
- the FA-aa may be selected from the group consisting of Amisoft HS-1 1 P (sodium N-stearoyl glutamate), Amisoft MS-1 1 (sodium N-myristoyl glutamate)), Amisoft LS-1 1 (sodium N-dodecanoyl glutamate), Amisoft CS-1 1 (sodium N- cocoyl glutamate), and sodium N-cocoyl glutamate.
- the FA-aa may be selected from the group consisting of N- dodecanoyl-D-asparagine, N-dodecanoyl-D-aspartic acid, N-dodecanoyl-D-glutamic acid, N- decanoyl-D-asparagine, N-decanoyl-D-aspartic acid, and N-decanoyl-D-glutamic acid.
- the FA-aa may be selected from the group consisting of N- dodecanoyl-D-alanine, N-tetradecanoyl D-Alanine, N- hexadecanoyi D-Alanine, N- octadecanoyl D-Alanine, N-dodecanoyl-D-lsoleucine, N-tetradecanoyl D-lsoleucine, N- hexadecanoyl D-lsoleucine, N-octadecanoyl D-lsoleucine, N-dodecanoyl-D-Leucine, N- tetradecanoyl D-Leucine, N- hexadecanoyi D-Leucine, N-octadecanoyl D-Leucine, N- dodecanoyl-D-Proline, N-tetradecanoyl D-Proline, N- hexadecano
- the FA-aa may be selected from the group consisting of Amisoft HS-1 1 P (sodium StearoyI Glutamate, Amisoft MS-1 1 (sodium MyristoyI Glutamate)), Amisoft LS-1 1 (sodium Dodecanoyl Glutamate), Amisoft CS-1 1 (sodium Cocoyl Glutamate) and sodium N-cocoyl glutamate.
- the FA-aa is N-myristoyl D-leucine, N-dodecanoyl D-leucine,
- N-myristoyl D-valine or N-palmitoyl D-aspartic acid.
- fatty acid N-acylated amino acid refers to an amino acid that is acylated with a fatty acid at its alpha-amino group.
- the FA-aa of the invention may be part of a pharmaceutical composition.
- composition may be an oral pharmaceutical composition.
- the composition comprises a GLP-1 peptide and at least one FA-aa.
- composition or “pharmaceutical composition” are used interchangeably herein and refer to a pharmaceutical composition.
- the composition comprises at least one GLP-1 peptide and at least one FA-aa.
- the composition comprises at least one GLP-1 peptide and two or more FA-aa's (i.e. different FA-aa's).
- the composition comprises one or more commercially available FA-aa's.
- the composition comprises at least one pharmaceutically acceptable excipient.
- excipient as used herein broadly refers to any component other than the active therapeutic ingredient(s).
- the excipient may be an inert substance, which is inert in the sense that it substantially does not have any therapeutic and/or prophylactic effect per se.
- the excipient may serve various purposes, e.g.
- a delivery agent as a delivery agent, absorption enhancer, vehicle, filler (also known as diluents), binder, lubricant, glidant, disintegrant, crystallization retarders, acidifying agent, alkalizing agent, preservative, antioxidant, buffering agent, chelating agent, complexing agents, surfactant agent, emulsifying and/or solubilizing agents, sweetening agents, wetting agents stabilizing agent, colouring agent, flavouring agent, and/or to improve administration, and/or absorption of the active substance.
- a person skilled in the art may select one or more of the aforementioned excipients with respect to the particular desired properties of the solid oral dosage form by routine experimentation and without any undue burden.
- each excipient used may vary within ranges conventional in the art. Techniques and excipients which may be used to formulate oral dosage forms are described in Handbook of Pharmaceutical Excipients, 6th edition, Rowe et al., Eds., American Pharmaceuticals Association and the Pharmaceutical Press, publications department of the Royal Pharmaceutical Society of Great Britain (2009); and Remington: the Science and Practice of Pharmacy, 21 th edition,
- the composition comprises a preservative, such as phenol, m-cresol, or a mixture of phenol and m-cresol.
- a preservative such as phenol, m-cresol, or a mixture of phenol and m-cresol.
- the term "preservative” as used herein refers to a compound which is added to a composition to prevent or delay microbial activity (growth and metabolism).
- the composition comprises up to 90% surfactant; or up to 90% polar organic solvent, such as polyethylene glycol (PEG) 300 g/mol, PEG 400 g/mol, PEG 600 g/mol, PEG 1000 g/mol; or up to 90% of a lipid component.
- PEGs are prepared by polymerization of ethylene oxide and are commercially available over a wide range of molecular weights from 300 g/mol to 10,000,000 g/mol.
- the composition may be liquid (e.g. aqueous), semisolid, or solid.
- the composition is in the form of a solid, such as capsules, tablets, dragees, pills, lozenges, powders, and granules.
- the term "solid” refers to liquid compositions encapsulated in a soft or hard capsule technology in addition to other solid compositions, such as tablets and multiparticulates. Multiparticulates may be pellets, microparticles, nanoparticles, liquid or semisolid fill formulations in soft or hard capsules, or enteric coated soft or hard capsules.
- the composition is in the form of a liquid or semisolid.
- the pharmaceutical composition of the invention has a pH in the range of 7-10. In some embodiments the pharmaceutical composition of the invention has a pH in the range of 7.5-9.5. In some embodiments the pharmaceutical composition of the invention has a pH in the range of 8.0-9.0. In some embodiments the pharmaceutical composition of the invention has a pH in the range of 7-8.5.
- the composition comprises at least one pH neutralised GLP-1 peptide.
- the pH neutralised GLP-1 peptide is prepared by dissolving the GLP-1 peptide and adjusting the pH of the resulting solution to a value, which is 1 unit, alternatively 2 units and alternatively 2.5 pH units, above or below the pi of the GLP-1 peptide, where after said resulting solution is optionally freeze or spray dried, said pH adjustment may be performed with a non-volatile acid or base.
- SEDDS SMEDDS or SNEDDS
- the composition is a SEDDS, SMEDDS or SNEDDS.
- the SEDDS, SMEDDS or SNEDDS may be solid, liquid or semisolid.
- SEDDS, SMEDDS or SNEDDS may be seen as pre-concentrates because they spontaneously form colloidal structures, such as emulsions, microemulsions, nanoemulsions, and/or other colloidal systems, e.g., oil-in-water emulsion, oil-in-water microemulsion or oil-in-water nanoemulsion, swollen micelle, micellar solution, when the SEDDS, SMEDDS or SNEDDS is exposed to an aqueous medium under conditions of gentle agitation (e.g.
- SEDDS self-emulsifying drug delivery systems
- SEDDS self-emulsifying drug delivery systems
- hydrophilic component a surfactant, optionally a co- surfactant or lipid component, and a GLP-1 peptide that spontaneously forms an oil-in-water emulsion when exposed to aqueous media under conditions of gentle agitation or digestive motility that would be encountered in the Gl tract.
- SMEDDS self-micro-emulsifying drug delivery systems
- SNEDDS self-nano-emulsifying drug delivery systems
- emulsion refers to a slightly opaque, opalescent or opaque colloidal coarse dispersion that is formed
- an emulsion contains homogenously dispersed particles or domains, for example of a solid or liquid state (e.g., liquid lipid particles or droplets), of a mean diameter of more than 150 nm as measured by standard light scattering techniques, e.g. using a MALVERN ZETASIZER Nano ZS.
- microemulsion refers to a clear or translucent, slightly opaque, opalescent, nonopaque or substantially non-opaque colloidal dispersion that is formed spontaneously or substantially spontaneously when its components are brought into contact with an aqueous medium; a microemulsion is thermodynamically stable and contains homogenously dispersed particles or domains, for example of a solid or liquid state (e.g., liquid lipid particles or droplets), of a mean diameter of less than 150 nm as measured by standard light scattering techniques, e.g. using a MALVERN ZETASIZER Nano ZS.
- a microemulsion when the composition is brought into contact with an aqueous medium a microemulsion is formed which contains homogenously dispersed particles or domains of a mean diameter of less than 100 nm, such as less than 50 nm, less than 40 nm and less than 30 nm.
- domain refers to an area of a composition with predominantly lipophilic or hydrophilic composition and said domain may be spherical or have other shapes, such as rod-like or oval.
- nanoemulsion refers to a clear or translucent, slightly opaque, opalescent, non-opaque or substantially non-opaque colloidal dispersion with particle or droplet size below 20 nm in diameter (as e.g. measured by PCS) that is formed spontaneously or substantially spontaneously when its components are brought into contact with an aqueous medium.
- a nanoemulsion is formed which contains
- homogenously dispersed particles or domains of a mean diameter of less than 20 nm such as less than 15 nm, less than 10 nm.
- a nanoemulsion when the composition is brought into contact with an aqueous medium a nanoemulsion is formed which contains homogenously dispersed particles or domains of a mean diameter of less than 20 nm, such as less than 15 nm, less than 10 nm, and optionally greater than about 2-4 nm.
- the SEDDS, SMEDDS or SNEDDS self-emulsifies upon dilution in an aqueous medium for example in a dilution of 1 :5, 1 :10, 1 :50, 1 :100 or higher.
- the composition forms the microemuslion or nanoemulsion comprising particles or domains of a size below 100 nm in diameter.
- domain size refers to repetitive scattering units and may be measured by e.g., small angle X- ray.
- the domain size, particle size or droplet size is less than 150 nm, such as less than 100 nm or less than 50 nm.
- the domain size, particle size or droplet size is less than 20 nm, such as less than 15 nm or less than 10nm.
- the composition comprises at least one GLP-1 peptide, at least one FA-aa, propylene glycol, and at least one non-ionic surfactant (such as at least two non-ionic surfactants).
- non-ionic surfactant refers to any substance, in particular a detergent, that can adsorb at surfaces and interfaces, like liquid to air, liquid to liquid, liquid to container or liquid to any solid and which has no charged groups in its hydrophilic group(s) (sometimes referred to as "heads").
- the non-ionic surfactant may be selected from a detergent such as ethoxylated castor oil, polyglycolyzed glycerides, acetylated monoglycerides and sorbitan fatty acid esters, polysorbate such as polysorbate-20, polysorbate-40, polysorbate-60, polysorbate-80, super refined polysorbate 20, super refined polysorbate 40, super refined polysorbate 60 and super refined polysorbate 80 (where the term "super refined” is used by the supplier Croda for their high purity Tween products), poloxamers such as poloxamer 188 and poloxamer 407, polyoxyethylene sorbitan fatty acid esters, polyoxyethylene derivatives such as alkylated and alkoxylated derivatives (Tweens, e.g. Tween-20 or Tween-80), block copolymers such as
- polyethyleneoxide/polypropyleneoxide block copolymers e.g. Pluronics/Tetronics, Triton X- 100 and/or Synperonic PE/L 44 PEL
- ethoxylated sorbitan alkanoates surfactants e. g. Tween-20, Tween-40, Tween-80, Brij-35
- diglycerol laurate diglycerol caprate, diglycerol caprylate, diglycerol monocaprylate, polyglycerol laurate, polyglycerol caprate, and polyglycerol caprylate.
- the composition comprises at least one GLP-1 peptide, at least one FA-aa, and propylene glycol. In some embodiments the composition comprises from 5% to 20% propylene glycol, such as 5% (w/w) to 20% (w/w) propylene glycol.
- the composition comprises at least one GLP-1 peptide, at least one FA-aa, propylene glycol, polysorbate 20, and a co-surfactant.
- polysorbate 20 is a polysorbate surfactant whose stability and relative non- toxicity allows it to be used as a detergent and emulsifier in a number of domestic, scientific, and pharmacological applications; the number 20 refers to the total number of oxyethylene - (CH 2 CH 2 0)- groups found in the molecule.
- the composition comprises at least one GLP-1 peptide, at least one FA-aa, propylene glycol, polysorbate 20, and a polyglycerol fatty acid ester.
- the oral pharmaceutical composition comprises at least one GLP-1 peptide, at least one FA-aa, propylene glycol, polysorbate 20 and a co-surfactant.
- the oral pharmaceutical composition comprises at least one
- GLP-1 peptide at least one FA-aa, propylene glycol, polysorbate 20 and a polyglycerol fatty acid ester such as diglycerol monocaprylate.
- the composition comprises a polar or semipolar solvent, such as water or propylene glycol.
- the composition is a liquid and comprises at least one GLP-1 peptide, at least one FA-aa, at least one polyglycerol fatty acid ester, at least one
- polyethylene glycol sorbitan fatty acid ester such as Tween 20 or Tween 85
- a polar or semipolar solvent such as water or propylene glycol
- the sorbitan fatty acid ester is selected from the group consisting of Span 10, Span 20, Span 40, Span 60, or Span 80.
- the sorbitan fatty acid ester is selected from the group consisting of sorbitan laurate (commercially known as Span 20), sorbitan mono palmitate (commercially known as Span 40), sorbitan mono stearate (commercially known as Span 60), and sorbitan oleate (commercially known as Span 80).
- the composition is a liquid and comprises at least one GLP-1 peptide, at least one FA-aa, at least one polyglycerol fatty acid ester, at least one
- composition forms a microemulsion after dilution in an aqueous medium.
- the polyethylene glycol sorbitan fatty acid ester which may be selected form the group consisting of Tween 20, Tween 21 , Tween 40, Tween 60, Tween 65, Tween 80, Tween 81 , and Tween 85.
- the polyethylene glycol sorbitan fatty acid ester is a polyethylene glycol sorbitan trioleate (commercially known as Tween 85) or polyethylene glycol sorbitan monolaurate (commercially known as Tween 20).
- the composition is a liquid and comprises at least one GLP-1 peptide, at least one FA-aa, at least one polyglycerol fatty acid ester, at least one sorbitan fatty acid ester, and optionally a polar or semipolar solvent.
- the composition comprises at least one FA-aa, propylene glycol, polysorbate 20, and a co-surfactant. In some embodiments the composition comprises at least one FA-aa, propylene glycol, polysorbate 20, and a polyglycerol fatty acid ester, such as diglycerol monocaprylate.
- Polysorbate 20 is a polysorbate surfactant whose stability and relative non-toxicity allows it to be used as a detergent and emulsifier in a number of domestic, scientific, and pharmacological applications; the number 20 refers to the total number of oxyethylene -(CH 2 CH 2 0)- groups found in the molecule.
- the composition comprises at least one GLP-1 peptide, at least one FA-aa, at least one high HLB surfactant, at least one low HLB co-surfactant, and a polar solvent.
- a low HLB surfactant has a HLB value ⁇ 10 and/or is oil soluble.
- co-surfactant refers to an additional surfactant added to a composition, wherein a first surfactant is present.
- the composition comprises at least one GLP-1 peptide, at least one FA-aa, at least two high HLB surfactants, and a polar solvent.
- a high HLB surfactant has a HLB value >10 and/or is water soluble.
- HLB Hydrophilic-lipophilic balance
- a surfactant or lipophilic component is a measure of the degree to which it is hydrophilic or lipophilic, determined by calculating values for the different regions of the molecule, as described by Griffin (Griffin WC: “Classification of Surface-Active Agents by 'HLB,'” Journal of the Society of Cosmetic Chemists 1 (1949): 31 1 ) or by Davies (Davies JT: "A quantitative kinetic theory of emulsion type, I. Physical chemistry of the emulsifying agent," Gas/Liquid and Liquid/Liquid Interface. Proceedings of the International Congress of Surface Activity (1957): 426-438).
- the composition comprises less than 10% (w/w) water. In some embodiments the composition comprises less than 9% (w/w) water. In some embodiments the composition comprises less than 8% (w/w) water. In some embodiments the composition comprises less than 7% (w/w) water. In some embodiments the composition comprises less than 6% (w/w) water. In some embodiments the composition comprises less than 5% (w/w) water. In some embodiments the composition comprises less than 4% (w/w) water. In some embodiments the composition comprises less than 3% (w/w) water. In some embodiments the composition comprises less than 2% (w/w) water. In some embodiments the composition comprises less than 1 % (w/w) water. In some embodiments the composition comprises 0% (w/w) water.
- the composition is non-aqueous.
- non-aqueous refers to a composition to which no water is added during preparation of the composition. It is known to the person skilled in the art that a composition which has been prepared without addition of water may take up small amounts of water from the surroundings during handling of the pharmaceutical composition, such as e.g. a soft capsule or a hard capsule used to encapsulate the composition. Also, the GLP-1 peptide and/or one or more of the excipients in the composition may have small amounts of water bound to it before preparing the composition according to the invention. The non-aqueous composition according to the invention may thus contain small amounts of water.
- the non-aqueous composition comprises less than 10%(w/w) water, such as less than 5%(w/w) water, less than 4%(w/w) water, or less than 3%(w/w) water, or such as less than 2%(w/w) water or less than 1 %(w/w) water.
- the composition of the invention may be encapsulated.
- the composition e.g. liquid or semisolid SEDDS, SMEDDS or SNEDDS compositions comprising a GLP-1 peptide and a FA-aa
- the soft capsule technology used for encapsulating a composition according to the present invention is gelatine free.
- the soft capsule technology is the gelatine free Vegicaps® (available from Catalent®).
- the term "enteric soft or hard capsule technology" when used herein refers to soft or hard capsule technology comprising at least one element with enteric properties, such as at least one layer of an enteric coating.
- composition of the invention may comprise one or more enteric or modified release coatings.
- the composition may comprise one or more enteric or modified release coatings in addition to soft or hard capsule technology.
- the enteric or modified release coating may be poly(meth)acrylates, commercially known as Eudragit ® . In some
- the enteric or modified release coating comprises at least one release modifying polymer which may be used to control the site where the GLP-1 peptide is released.
- the release modifying polymer may be a polymethacrylate polymer, such as those sold under the Eudragit® trade name (Evonik Rohm GmbH, Darmstadt, Germany), for example Eudragit® L30 D55, Eudragit® L100-55, Eudragit® L100, Eudragit® S100, Eudragit® S12,5, Eudragit® FS30D, Eudragit® NE30D and mixtures thereof as e.g.
- enteric coating means a polymer coating that controls disintegration and release of the oral dosage form; the site of disintegration and release of the solid dosage form may be designed depending on the pH of the targeted area, where absorption of the GLP-1 peptide is desired, thus also includes acid resistant protective coatings; the term includes known enteric coatings, but also any other coating with enteric properties, wherein said term "enteric properties" means properties controlling the
- modified release coating refers to a coating which comprises special excipients (e.g. a polymer) or which is prepared by special procedures, or both, designed to modify the rate, the place or the time at which the active substance(s) are released.
- modified release coating include prolonged-release coating, delayed-release coating, and pulsatile-release coating Modified release may be achieved by pH-dependent or pH- independent polymer coating.
- the encapsulated or coated composition e.g. a liquid or semisolid SEDDS, SMEDDS or SNEDDS comprising a GLP-1 peptide and a FA-aa
- a liquid or semisolid SEDDS, SMEDDS or SNEDDS comprising a GLP-1 peptide and a FA-aa comprises less than 10% (w/w) water.
- Coatings such as enteric coatings, or modified release coatings may be prepared according to methods well known in the art.
- GLP-1 peptides may be prepared according to methods well known in the art.
- the composition of the invention comprises a GLP-1 peptide, such as a GLP-1 analogue or a derivative thereof. In some embodiments the composition comprises at least one GLP-1 peptide. In some embodiments the GLP-1 peptide comprises a lipophilic side chain, such as a GLP-1 peptide comprising an alkyl moiety with at least 14 carbon atoms. In some embodiments the GLP-1 peptide is an acylated peptide. In some
- the GLP-1 peptide is acylated with a fatty acid or a fatty diacid.
- the GLP-1 peptide comprises substituent comprising a fatty acid or a fatty diacid, such as formula (X)
- the GLP-1 peptide comprises one or more 8-amino-3,6-dioxaoctanoic acid (OEG).
- GLP-1 peptide refers to a compound, which fully or partially activates the human GLP-1 receptor.
- the GLP-1 peptide binds to a GLP-1 receptor, e.g., with an affinity constant (K D ) or activate the receptor with a potency (EC 50 ) of below 1 ⁇ , e.g. below 100 nM as measured by methods known in the art (see e.g. WO98/08871 ) and exhibits insulinotropic activity, where insulinotropic activity may be measured in vivo or in vitro assays known to those of ordinary skill in the art.
- the GLP-1 peptide may be administered to an animal with increased blood glucose (e.g.
- IVGTT Intravenous Glucose Tolerance Test
- a person skilled in the art will be able to determine a suitable glucose dosage and a suitable blood sampling regime, e.g. depending on the species of the animal, for the IVGTT) and the plasma insulin concentration measured over time.
- the biological activity of a GLP-1 peptide may be measured in an assay as known by a person skilled in the art, e.g. as described in
- the GLP-1 peptide is a GLP-1 analogue, optionally comprising one substituent.
- analogue as used herein referring to a GLP-1 peptide (hereafter “peptide") means a peptide wherein at least one amino acid residue of the peptide has been substituted with another amino acid residue and/or wherein at least one amino acid residue has been deleted from the peptide and/or wherein at least one amino acid residue has been added to the peptide and/or wherein at least one amino acid residue of the peptide has been modified. Such addition or deletion of amino acid residues may take place at the N- terminal of the peptide and/or at the C-terminal of the peptide.
- GLP-1 peptide designates an analogue of GLP-1 (7-37) wherein the naturally occurring Ala in position 8 has been substituted with Aib.
- the GLP-1 peptide comprises a maximum of twelve, such as a maximum of 10, 8 or 6, amino acids which have been altered, e.g., by substitution, deletion, insertion and/or modification, compared to e.g. GLP-1 (7-37).
- the analogue comprises up to 10 substitutions, deletions, additions and/or insertions, such as up to 9 substitutions, deletions, additions and/or insertions, up to 8 substitutions, deletions, additions and/or insertions, up to 7 substitutions, deletions, additions and/or insertions, up to 6 substitutions, deletions, additions and/or insertions, up to 5 substitutions, deletions, additions and/or insertions, up to 4 substitutions, deletions, additions and/or insertions or up to 3 substitutions, deletions, additions and/or insertions, compared to e.g. GLP-1 (7-37). Unless otherwise stated the GLP-1 comprises only L-amino acids.
- GLP-1 analogue or “analogue of GLP-1" as used herein refers to a peptide, or a compound, which is a variant of the human Glucagon-Like Peptide-1 (GLP-1 (7-37)).
- GLP-1 (7-37) has the sequence HAEGTFTSDV
- variant refers to a compound which comprises one or more amino acid substitutions, deletions, additions and/or insertions.
- the GLP-1 peptide exhibits at least 60%, 65%, 70%, 80% or 90% sequence identity to GLP-1 (7-37) over the entire length of GLP-1 (7-37).
- sequence identity As an example of a method for determination of sequence identity between two analogues the two peptides [Aib8]GLP-1 (7-37) and GLP-1 (7-37) are aligned.
- the sequence identity of [Aib8]GLP-1 (7-37) relative to GLP-1 (7-37) is given by the number of aligned identical residues minus the number of different residues divided by the total number of residues in GLP-1 (7-37).
- sequence identity is (31 -1 )/31.
- the C-terminal of the GLP-1 peptide is an amide.
- the GLP-1 peptide is GLP-1 (7-37) or GLP-1 (7-36)amide. In some embodiments the GLP-1 peptide is exendin-4, the sequence of which is
- HGEGTFITSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID No: 2).
- the GLP-1 peptide comprises one substituent which is covalently attached to the peptide.
- the substituent comprises a fatty acid or a fatty diacid.
- the substituent comprises a C16, C18 or C20 fatty acid.
- the substituent comprises a C16, C18 or C20 fatty diacid.
- the substituent comprises formula (X) (X), wherein n is at least 13, such as n is 13, 14, 15, 16, 17, 18 or 19.
- the substituent comprises formula (X), wherein n is in the range of 13 to 19, such as in the range of 13 to 17.
- the substituent comprises formula (X), wherein n is 13, 15 or 17.
- the substituent comprises formula (X), wherein n is 13. In some embodiments the substituent comprises formula (X), wherein n is 15. In some embodiments the substituent comprises formula (X), wherein n is 17. In some embodiments the substituent comprises one or more 8-amino-3,6- dioxaoctanoic acid (OEG), such as two OEG.
- OEG 8-amino-3,6- dioxaoctanoic acid
- the substituent is [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17- carboxyheptadecanoylamino) butyrylamino]ethoxy ⁇ ethoxy)acetylamino]
- the substituent is [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-( ⁇ trans-4- [(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl ⁇
- the GLP-1 peptide is semaglutide, also known as N- epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-(17-carboxyheptadecanoylamino)
- composition comprises the GLP-1 peptide or a pharmaceutically acceptable salt, amide, or ester thereof. In some embodiments the composition comprises the GLP-1 peptide one or more pharmaceutically acceptable counter ions.
- the amount of GLP-1 peptide is no more than 20 % (w/w), such as no more than 15 % (w/w) or no more than 10 % (w/w), or such as 1-5 % (w/w).
- the dosage of GLP-1 is in the range of 0.01 mg to 100 mg.
- the composition comprises an amount of a GLP-1 peptide in the range of at least 1 mg, such as at least 5 mg or at least 10 mg. In some embodiments the composition comprises 10 mg GLP-1 peptide.
- the composition comprises an amount of a GLP-1 peptide in the range of 0.05 to 25 ⁇ , such as in the range of 0.5 to 20 ⁇ .
- the GLP-1 peptide is selected from one or more of the GLP-1 peptides mentioned in W093/19175, W096/29342, WO98/08871 , WO99/43707, WO99/43706, W099/43341 , WO99/43708, WO2005/027978, WO2005/058954,
- the GLP-1 peptide is selected from the group consisting of N- epsilon37 ⁇ 2-[2-(2- ⁇ 2-[2-((R)-3-carboxy-3- ⁇ [1 -(19-carboxynonadecanoyl) piperidine-4- carbonyl]amino ⁇ propionylamino)ethoxy]ethoxy ⁇ acetylamino)ethoxy]ethoxy ⁇ acetyl
- N-epsilon26 [2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4-carboxy-4-( ⁇ 4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl ⁇ amino)butyrylamino] ethoxy ⁇ ethoxy) acetylamino]ethoxy ⁇ ethoxy)acetyl[Aib8, Lys 26]GLP-1 (7-37)amide; N-epsilon26 [2-(2-[2-(2-(2-(S)-2-[trans-4-((9-carboxynonadecanoylamino] methyl) cyclohexylcarbonylamino]-4- carboxybutanoylamino)ethoxy)ethoxy]acetylamino) ethoxy]ethoxy)acetyl][Aib8, Lys26
- propionyl [DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1 (7-37)-amide; N-epsilon37- ⁇ 2-(2- (2-(2-[2-(2-(4-(hexadecanoylamino)-4-carboxybutyryl-amino)ethoxy) ethoxy]
- the GLP-1 peptide is N-epsilon26-[2-(2- ⁇ 2-[2-(2- ⁇ 2-[(S)-4- carboxy-4-(17-carboxyheptadecanoylamino) butyrylamino]ethoxy ⁇ ethoxy)acetylamino] ethoxy ⁇ ethoxy)acetyl][Aib8,Arg34]GLP-1 (7-37), also known as semaglutide.
- GLP-1 peptides may be produced by appropriate
- GLP-1 moiety of the GLP-1 peptide of the invention may for instance be produced by classical peptide synthesis, e.g., solid phase peptide synthesis using t-Boc or Fmoc chemistry or other well established techniques, see, e.g., Greene and Wuts, "Protective Groups in Organic Synthesis", John Wiley & Sons, 1999, Florencio Zaragoza Dorwald, Organic Synthesis on solid Phase",
- GLP-1 peptides may be produced by recombinant methods, viz. by culturing a host cell containing a DNA sequence encoding the GLP-1 peptide and capable of expressing the peptide in a suitable nutrient medium under conditions permitting the expression of the peptide.
- host cells suitable for expression of these peptides are: Escherichia coli, Saccharomyces cerevisiae, as well as mammalian BHK or CHO cell lines.
- GLP-1 peptides of the invention which include non-natural amino acids and/or a covalently attached N-terminal mono- or dipeptide mimetic may e.g. be produced as described in the experimental part, or see e.g., Hodgson et al: "The synthesis of peptides and proteins containing non-natural amino acids", Chemical Society Reviews, vol. 33, no. 7 (2004), p. 422-430; and WO 2009/083549 A1 entitled "Semi-recombinant preparation of GLP-1 analogues".
- the GLP-1 peptide has a solubility of at least 50mg/mL, such as at least 60mg/mL, at least 70mg/mL, or at least 80mg/mL, such as at least 90mg/mL, at least 100mg/mL, or at least 1 10mg/mL, such as at least 120mg/mL, at least 130mg/mL, or at least 140mg/mL in water, such as at least 150/mL, at least 160mg/mL, or at least 170mg/mL, such as at least 180mg/mL, at least 190mg/mL, or at least 200mg/mL, such as at least 210mg/mL, at least 220mg/mL, or at least 230mg/mL, or such as at least 240mg/mL in aqueous sodium phosphate buffer at pH 8.5 and room temperature.
- the GLP-1 peptide has a protracted pharmacokinetic profile, i.e. the GLP-1 peptide protracted.
- protraction may be determined as half-life (T 1 ⁇ 2 ) in vivo in minipigs after i.v. administration.
- the half-life is at least 24 hours, such as at least 48 hours, at least 60 hours, at least 72 hours, or such as at least 84 hours, at least 96 hours, or at least 108 hours.
- a suitable assay for determining half-life in vivo in minipigs after i.v. administration is the following, wherein the purpose is to determine the protraction in vivo of GLP-1 agonists after i.v.
- minipigs i.e. the prolongation of their time of action; this is done in a pharmacokinetic (PK) study, where the terminal half-life of the GLP-1 agonist in question is determined.
- terminal half-life is generally meant the period of time it takes to halve a certain plasma concentration, measured after the initial distribution phase.
- Male Gottingen minipigs are obtained from Ellegaard Gottingen Minipigs (Dalmose, Denmark) approximately 7-14 months of age and weighing from approximately 16-35 kg are used in the studies. The minipigs are housed individually and fed restrictedly once or twice daily with SDS minipig diet (Special Diets
- the GLP-1 agonist is dissolved in 50 mM sodium phosphate, 145 mM sodium chloride, 0.05% tween 80, pH 7.4 to a concentration of usually from 20-60 nmol/ml.
- Intravenous injections (the volume corresponding to usually 1 -2 nmol/kg, for example 0.033ml/kg) of the compounds are given through one catheter, and blood is sampled at predefined time points for up till 13 days post dosing (preferably through the other catheter). Blood samples (for example 0.8 ml) are collected in EDTA buffer (8mM) and then centrifuged at 4°C and 1942G for 10 minutes. Plasma is pippetted into Micronic tubes on dry ice, and kept at -20°C until analyzed for plasma concentration of the respective GLP-1 compound using ELISA or a similar antibody based assay or LC-MS. Individual plasma concentration-time profiles are analyzed by a non-compartmental model in WinNonlin v. 5.0 (Pharsight Inc., Mountain View, CA, USA), and the resulting terminal half-lives
- the present invention also relates to a composition of the invention for use as a medicament.
- the composition is administered orally.
- the composition is administered to a subject, such as a human.
- composition of the invention may be used for the following medical treatments, all preferably relating one way or the other to diabetes: (i) prevention and/or treatment of all forms of diabetes, such as hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, non-insulin dependent diabetes, MODY (maturity onset diabetes of the young), gestational diabetes, and/or for reduction of HbA1 C;
- diabetes such as hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, non-insulin dependent diabetes, MODY (maturity onset diabetes of the young), gestational diabetes, and/or for reduction of HbA1 C;
- ITT impaired glucose tolerance
- diabetes prevention and/or treatment of diabetic complications, such as neuropathy, including peripheral neuropathy; nephropathy; or retinopathy;
- lowering triglycerides lowering cholesterol; increasing HDL; lowering plasma levels of lipoprotein a (Lp(a)) in a human; inhibiting generation of apolipoprotein a (apo(a)) in vitro and/or in vivo;
- cardiovascular diseases such as syndrome X; atherosclerosis; myocardial infarction; coronary heart disease; stroke, cerebral ischemia; an early cardiac or early cardiovascular disease, such as left ventricular hypertrophy; coronary artery disease; essential hypertension; acute hypertensive emergency; cardiomyopathy; heart insufficiency; exercise tolerance; chronic heart failure; arrhythmia; cardiac dysrhythmia; syncopy; atheroschlerosis; mild chronic heart failure; angina pectoris; cardiac bypass reocclusion; intermittent claudication (atheroschlerosis oblitterens); diastolic dysfunction; and/or systolic dysfunction;
- cardiovascular diseases such as syndrome X; atherosclerosis; myocardial infarction; coronary heart disease; stroke, cerebral ischemia; an early cardiac or early cardiovascular disease, such as left ventricular hypertrophy; coronary artery disease; essential hypertension; acute hypertensive emergency; cardiomyopathy; heart insufficiency; exercise tolerance; chronic heart failure; arrhythm
- prevention and/or treatment of gastrointestinal diseases such as inflammatory bowel syndrome; small bowel syndrome, or Crohn's disease; dyspepsia; and/or gastric ulcers;
- prevention and/or treatment of critical illness such as treatment of a critically ill patient, a critical illness poly-nephropathy (CIPNP) patient, and/or a potential CIPNP patient; prevention of critical illness or development of CIPNP; prevention, treatment and/or cure of systemic inflammatory response syndrome (SIRS) in a patient; and/or for the prevention or reduction of the likelihood of a patient suffering from bacteraemia, septicaemia, and/or septic shock during hospitalisation; and/or
- CIPNP critical illness poly-nephropathy
- SIRS systemic inflammatory response syndrome
- the indication is selected from the group consisting of (i)-(iii) and (v)-(iix), such as indications (i), (ii), and/or (iii); or indication (v), indication (vi), indication (vii), and/or indication (iix).
- the indication is (i). In a further particular embodiment the indication is (v). In a still further particular embodiment the indication is (iix).
- the invention relates to a composition of the invention for treatment of diabetes or obesity, wherein said composition is administered orally. In some embodiments the invention relates to a method for treatment of diabetes or obesity comprising oral administration of a composition of the invention to a patient in need thereof.
- Type 2 diabetes and/or obesity are particularly preferred.
- a pharmaceutical composition comprising i) a GLP-1 peptide and ii) at least one fatty acid amino acid (FA-aa) or a salt of said FA-aa, wherein the stereo configuration of the chiral carbon atom in the amino acid moiety of said FA-aa is in the D-configuration.
- FA-aa fatty acid amino acid
- composition according to any of the preceding embodiments, wherein the composition is an oral pharmaceutical composition.
- FA-aa has the general formula I:
- R1 is an alkyl group consisting of 5 to 19 carbon atoms
- R2 is H (i.e. hydrogen), CH 3 (i.e. methyl group), or covalently attached to R4 via a (CH 2 )3 group;
- R3 is H or absent
- R4 is an amino acid side chain, or covalently attached to R2 via a (CH 2 )3 group.
- alkyl group e.g. R1
- said alkyl group consists of 7 to 17 carbon atoms, such as 9-15 carbon atoms or 1 1 -13 carbon atoms.
- GLP-1 peptide is a GLP-1 analogue or a derivative thereof comprising less than 10 substitutions, deletions or insertions compared to human GLP-1 (7-37).
- said GLP-1 peptide is an acylated GLP-1 peptide, such as semaglutide. 1 1 .
- said composition comprises less than 10 % (w/w) water.
- the amino acid side chain (e.g. R4) of the FA-aa is selected from the group consisting of a non-cationic amino acid side chain, a non-polar hydrophobic amino acid side chain, a polar non-charged amino acid side chain, or a polar acidic amino acid side chain.
- said FA-aa comprises an amino acid residue selected from the group consisting of a non-cationic amino acid residue, a non-polar hydrophobic amino acid residue, a polar non-charged amino acid residue, or a polar acidic amino acid residue.
- said FA-aa is in the form of its free acid or the salt thereof, such as the sodium salt or the potassium salt.
- the amino acid residue of said FA-aa is the amino acid residue of an amino acid selected from the group consisting of Alanine (Ala), Valine (Val), Leucine (Leu), Isoleucine (lie), Phenylalanine (Phe), Tryptophane (Trp), Methionine (Met), Proline (Pro), Sarcosine, Serine (Ser), Threonine (Thr), Cysteine (Cys), Tyrosine (Tyr), Asparagine (Asn), and Glutamine (Gin), Aspartic acid (Asp) and Glutamic acid (Glu).
- the amino acid residue is a sarcosine residue, a glutamic acid residue, or a leucine residue.
- the FA-aa is selected from the group consisting of N-dodecanoyl-D-alanine, N-dodecanoyl-D-asparagine, N-dodecanoyl-D-aspartic acid, sodium N-dodecanoyl cysteinate, N-dodecanoyl-D-cysteine, N-dodecanoyl-D-glutamic acid, N-dodecanoyl- D-glutamine, N-dodecanoyl-D-histidine, N-dodecanoyl-D-isoleucine, N-dodecanoyl-D- leucine, N-dodecanoyl-D-methionine, N-dodecanoyl-D-phenylalanine, N-dodecanoyl- D-proline, N-dodecanoyl-D-
- the FA-aa is selected from the group consisting of N-dodecanoyl-D-alanine, N-tetradecanoyl D-Alanine, N- hexadecanoyl D-Alanine, N-octadecanoyl D-Alanine, N- dodecanoyl-D-lsoleucine, N-tetradecanoyl D-lsoleucine, N- hexadecanoyl D- Isoleucine, N-octadecanoyl D-lsoleucine, N-dodecanoyl-D-Leucine, N-tetradecanoyl D-Leucine, N- hexadecanoyl D-Leucine, N-octadecanoyl D-Leucine, N-dodecanoyl-D- Proline, N-tetradecanoyl D-Proline,
- composition according to any of the preceding embodiments, wherein the FA-aa is N-decyl leucine, such as sodium N-decyl D-leucinate.
- composition according to any of the preceding embodiments, wherein the FA-aa is N-dodecanoyl sarcosine, such as sodium N-dodecanoyl sarcosinate.
- composition according to any of the preceding embodiments, wherein the FA-aa is N-myristoyl glutamine, such as sodium N-myristoyl D-glutamate or disodium N-myristoyl D-glutamate.
- N-myristoyl glutamine such as sodium N-myristoyl D-glutamate or disodium N-myristoyl D-glutamate.
- composition according to any of the preceding embodiments, wherein said composition comprises propylene glycol.
- composition according to any of the preceding embodiments, wherein said composition comprises SEDDS, SMEDDS or SNEDDS.
- composition according to any of the preceding embodiments, wherein said composition comprises one or more additional pharmaceutically acceptable excipients.
- composition according to any of the preceding embodiments, wherein said composition is in the form of a solid, a liquid, or a semisolid.
- composition according to any of the preceding embodiments, wherein said composition is in the form of a tablet or a multiparticulate.
- composition according to any of the preceding embodiments, wherein said composition is in the form of a capsule.
- composition further comprises an enteric or modified release coating.
- composition has a pH in the range of 7-10.
- composition according to any of the preceding embodiments, wherein said composition has a pH in the range of 7.5-9.5.
- composition according to any of the preceding embodiments, wherein said composition has a pH in the range of 8.0-9.0.
- composition according to any of the preceding embodiments, wherein said composition has a pH in the range of 7-8.5.
- a method for increasing bioavailability of a GLP-1 peptide comprising oral
- a method for increasing bioavailability of a GLP-1 peptide comprising the steps of including a FA-aa in a pharmaceutical composition of a GLP-1 peptide administered to a subject.
- a method for increasing the plasma concentration of a GLP-1 peptide comprising the step of exposing the gastrointestinal tract of a subject to a pharmaceutical composition comprising a GLP-1 peptide and a FA-aa resulting in an increased plasma
- a method for increasing the uptake of a GLP-1 peptide comprising the step of:
- a method for increasing uptake of a GLP-1 peptide across an/the epithelia cell layer of the gastro intestinal tract comprising the steps of, administering a pharmaceutical composition comprising a GLP-1 peptide and at least one FA-aa to a subject, whereby an increased uptake of said GLP-1 peptide is obtained compared to the uptake of said GLP-1 peptide obtained when said GLP-1 peptide composition does not including the at least one FA-aa.
- Semaglutide may be prepared as described in WO2006/097537, Example 4. General Methods of Detection and Characterisation
- Plasma All blood samples were collected into test tubes containing EDTA for stabilisation and kept on ice until centrifugation. Plasma was separated from whole blood by centrifugation and the plasma was stored at -20°C or lower until analysis.
- the plasma was analysed for semaglutide using a Luminescence Oxygen Channeling Immunoassay (LOCI).
- LOCI Luminescence Oxygen Channeling Immunoassay
- the LOCI assay employs donor beads coated with streptavidin and acceptor beads conjugated with a monoclonal antibody binding to a mid-molecular region of semaglutide.
- the three reactants were combined with 15 the semaglutide which form a two-sited immuno-complex. Illumination of the complex releases singlet oxygen atoms from the donor beads which channels into the acceptor beads and trigger chemiluminescence which was measured in the EnVision plate reader.
- the amount of light was proportional to the concentration of semaglutide and the lower limit of quantification (LLOQ) in plasma was 100 pM.
- LLOQ lower limit of quantification
- the purpose of this experiment was to determine oral bioavailability of a GLP-1 peptide in an aqueous composition comprising a fatty acid acylated amino acid, wherein said amino acid is the D-isomer.
- Semaglutide (1000 nmol/ml) and the fatty acid acylated amino acid sodium N-myristoyl D- leucinate or sodium N-myristoyl D-valinate (100 mM) was dissolved in 50 mM TRIS, pH 8.5.
- Semaglutide (1000 nmol/ml) and the fatty acid acylated amino acid sodium N-palmitoyl D- aspartate (100 mM) was dissolved in 100 mM phosphate buffer, pH 8. It was observed that the compositions were clear.
- Plasma exposure and area under the curve (AUC) of 100 mM sodium N-myristoyl D- leucinate, sodium N-myristoyl D-valinate, and sodium N-palmitoyl D-aspartate was determined as described in Assay (I). The results are shown in Table 1.
- the purpose of this experiment was to determine the permeation enhancing effect of different fatty acid acylated amino acids on the transepithelial absorption of a GLP-1 peptide in Caco-2 monolayers.
- Caco-2 cells were obtained from the American Type Culture Collection (Manassas, Virginia). Cells were seeded in culturing flasks and passaged in Dulbecco's Modified Eagle' medium supplemented with 10% fetal bovine serum, 1 % penicillin/streptomycin (100 U/ml and 100 ⁇ g/ml, respectively), 1 % L-glutamine and 1 % nonessential amino acids. Caco-2 cells were seeded onto tissue culture treated polycarbonate filters in 12-well Transwell® plates (1 .13 cm2, 0.4 ⁇ pore size) at a density of 10 5 cells/well. Monolayers were grown in an atmosphere of 5% C0 2 -95% 0 2 at 37 °C. Growth media were replaced every other day. The experiment was performed on day 10-14 after seeding of Caco-2 cells.
- the amount of compound transported from the donor chamber (apical side) to the receiver chamber (basolateral side) was measured.
- the transport study was initiated by adding 400 ⁇ solution (100 ⁇ of semaglutide + 0.5 mM fatty acid acylated amino acid) and 0.4 ⁇ / ⁇ [3H]manntiol in transport buffer to the donor chamber and 1000 ⁇ transport buffer to the receiver chamber.
- the transport buffer consisted of Hank's balanced saline solution containing 10 mM HEPES, 0.1 % adjusted to pH 7.4 after addition of compounds.
- the transport of [ 3 H]mannitol, a marker for paracellular transport, was measured to verify the integrity of the epithelium.
- the Caco-2 cells were equilibrated for 60 min with transport buffer on both sides of the epithelium. Buffer was then removed and the experiment initiated. Donor samples (20 ⁇ ) were taken at 0 min and at the end of the experiment. Receiver samples (200 ⁇ ) were taken every 15 min. The study was performed in an atmosphere of 5% C0 2 -95% 0 2 at 37 °C on a shaking plate (30 rpm).
- TEER transepithelial electrical resistance
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Medicinal Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Diabetes (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Child & Adolescent Psychology (AREA)
- Emergency Medicine (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
La présente invention concerne des compositions pharmaceutiques orales comprenant un peptide GLP-1 et un acide aminé acylé par un acide gras, la stéréo-configuration de l'atome de carbone chiral dans le fragment d'acide aminé associé se trouvant dans la configuration D ; ainsi que l'utilisation desdites compositions.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP14165618.1 | 2014-04-23 | ||
EP14165618 | 2014-04-23 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2015162195A1 true WO2015162195A1 (fr) | 2015-10-29 |
Family
ID=50513795
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2015/058758 WO2015162195A1 (fr) | 2014-04-23 | 2015-04-23 | Acides aminés acylés par un acide gras pour l'administration de peptides par voie orale |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2015162195A1 (fr) |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9833411B2 (en) | 2015-01-12 | 2017-12-05 | Enteris Biopharma, Inc. | Solid oral dosage forms |
WO2020006617A1 (fr) | 2018-07-05 | 2020-01-09 | Biozeus Desenvolvimento De Produtos Biofarmacêuticos | Peptides synthétiques, promédicaments, compositions pharmaceutiques et utilisations |
WO2020014428A1 (fr) * | 2018-07-11 | 2020-01-16 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Procédé de traitement de troubles d'oxydation d'acides gras à l'aide d'acides gras oméga-3/oméga-6 à chaîne insaturée ou ramifiée |
EP4180060A1 (fr) | 2021-11-15 | 2023-05-17 | Adocia | Compositions solides comportant un peptide ou une protéine et un acide aminé acylé |
WO2023084118A1 (fr) | 2021-11-15 | 2023-05-19 | Adocia | Compositions solides comprenant un peptide ou une protéine et un acide aminé acylé |
EP4299057A1 (fr) | 2022-06-30 | 2024-01-03 | Adocia | Compositions solides comportant un peptide ou une protéine et un acide aminé acylé |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1999029336A1 (fr) * | 1997-12-05 | 1999-06-17 | Eli Lilly And Company | Formulations de glp-1 |
WO2001035998A1 (fr) * | 1999-11-12 | 2001-05-25 | Pharmaderm Laboratories, Ltd. | Compositions pour administration transdermique et transmuqueuse d'agents therapeutiques |
US20040147578A1 (en) * | 2001-03-28 | 2004-07-29 | Nicolas Calvet | Use of lipoaminoacids as absorption promoters in a pharmaceutical composition |
WO2012140155A1 (fr) * | 2011-04-14 | 2012-10-18 | Novo Nordisk A/S | Acides aminés acylés par un acide gras pour l'administration de peptides par voie orale |
WO2014060447A1 (fr) * | 2012-10-17 | 2014-04-24 | Novo Nordisk A/S | Acides d-aminés acylés par un acide gras pour l'administration de peptides par voie orale |
WO2014060472A1 (fr) * | 2012-10-17 | 2014-04-24 | Novo Nordisk A/S | Acides aminés acylés par un acide gras pour l'administration de peptides par voie orale |
-
2015
- 2015-04-23 WO PCT/EP2015/058758 patent/WO2015162195A1/fr active Application Filing
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1999029336A1 (fr) * | 1997-12-05 | 1999-06-17 | Eli Lilly And Company | Formulations de glp-1 |
WO2001035998A1 (fr) * | 1999-11-12 | 2001-05-25 | Pharmaderm Laboratories, Ltd. | Compositions pour administration transdermique et transmuqueuse d'agents therapeutiques |
US20040147578A1 (en) * | 2001-03-28 | 2004-07-29 | Nicolas Calvet | Use of lipoaminoacids as absorption promoters in a pharmaceutical composition |
WO2012140155A1 (fr) * | 2011-04-14 | 2012-10-18 | Novo Nordisk A/S | Acides aminés acylés par un acide gras pour l'administration de peptides par voie orale |
WO2014060447A1 (fr) * | 2012-10-17 | 2014-04-24 | Novo Nordisk A/S | Acides d-aminés acylés par un acide gras pour l'administration de peptides par voie orale |
WO2014060472A1 (fr) * | 2012-10-17 | 2014-04-24 | Novo Nordisk A/S | Acides aminés acylés par un acide gras pour l'administration de peptides par voie orale |
Non-Patent Citations (2)
Title |
---|
LEONE-BAY A ET AL: "N-acylated alpha-amino acids as novel oral delivery agents for proteins", JOURNAL OF MEDICINAL CHEMISTRY, AMERICAN CHEMICAL SOCIETY, US, vol. 38, no. 21, 13 October 1995 (1995-10-13), pages 4263 - 4269, XP002286601, ISSN: 0022-2623, DOI: 10.1021/JM00021A015 * |
SAM MAHER ET AL: "Overcoming poor permeability: translating permeation enhancers for oral peptide delivery", DRUG DISCOVERY TODAY: TECHNOLOGIES, vol. 9, no. 2, June 2012 (2012-06-01), pages e113 - e119, XP055127722, ISSN: 1740-6749, DOI: 10.1016/j.ddtec.2011.11.006 * |
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9833411B2 (en) | 2015-01-12 | 2017-12-05 | Enteris Biopharma, Inc. | Solid oral dosage forms |
WO2020006617A1 (fr) | 2018-07-05 | 2020-01-09 | Biozeus Desenvolvimento De Produtos Biofarmacêuticos | Peptides synthétiques, promédicaments, compositions pharmaceutiques et utilisations |
WO2020014428A1 (fr) * | 2018-07-11 | 2020-01-16 | University Of Pittsburgh - Of The Commonwealth System Of Higher Education | Procédé de traitement de troubles d'oxydation d'acides gras à l'aide d'acides gras oméga-3/oméga-6 à chaîne insaturée ou ramifiée |
US11844775B2 (en) | 2018-07-11 | 2023-12-19 | University of Pittsburgh—of the Commonwealth System of Higher Education | Method of treating fatty acid oxidation disorders using Omega3/Omega6 unsaturated or branched chain fatty acids |
EP4180060A1 (fr) | 2021-11-15 | 2023-05-17 | Adocia | Compositions solides comportant un peptide ou une protéine et un acide aminé acylé |
WO2023084118A1 (fr) | 2021-11-15 | 2023-05-19 | Adocia | Compositions solides comprenant un peptide ou une protéine et un acide aminé acylé |
EP4299057A1 (fr) | 2022-06-30 | 2024-01-03 | Adocia | Compositions solides comportant un peptide ou une protéine et un acide aminé acylé |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20150273069A1 (en) | Fatty acid acylated amino acids for oral peptide delivery | |
WO2015162195A1 (fr) | Acides aminés acylés par un acide gras pour l'administration de peptides par voie orale | |
US8785381B2 (en) | Oral GLP-1 formulations | |
JP6030630B2 (ja) | 経口ペプチド送達のための脂肪酸アシル化アミノ酸 | |
RU2517135C2 (ru) | Композиции пептидов и способы их получения | |
US8492330B2 (en) | Formulation comprising GLP-1 | |
JP2019048815A (ja) | インスリン分泌促進性ペプチドの懸濁製剤及び使用 | |
JP5675347B2 (ja) | 安定した非水性薬学的組成物 | |
JP4716987B2 (ja) | 骨関節症におけるカルシトニンの使用 | |
TWI829687B (zh) | 包含glp-1促效劑與n-(8-(2-羥基苯甲醯基)胺基)辛酸之鹽的固體組成物 | |
JP2005537232A (ja) | アミリンアゴニストペプチドの製剤 | |
NZ552558A (en) | Compositions for delivering peptide YY and PYY agonists | |
US20220265777A1 (en) | Solid compositions comprising a glp-1 agonist, an sglt2 inhibitor and a salt of n-(8-(2-hydroxybenzoyl)amino)caprylic acid | |
US20120219603A1 (en) | Use of Calcitonin for the Treatment of RA | |
US20170258711A1 (en) | Fatty Acid Acylated D-Amino Acids for Oral Peptide Delivery | |
JP2022535556A (ja) | Glp1/2二重アゴニストの非経口医薬組成物 | |
JP5892940B2 (ja) | クラウン化合物及び/又は対イオンと複合体化されたペプチドを含む粘膜送達組成物 | |
WO2022049310A1 (fr) | Formulations pharmaceutiques améliorées d'agonistes du récepteur glp-1 | |
JP2012111773A (ja) | 経口吸収改善用医薬組成物 | |
EP3856767B1 (fr) | Formulations d'analogues glucagon-like-peptide-2 (glp-2) | |
US20210283226A1 (en) | Stable liquid formulations of glucagon-like peptide 1 or analogues thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15721594 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 15721594 Country of ref document: EP Kind code of ref document: A1 |