WO2014187571A1 - Process of providing plants with abiotic stress resistance - Google Patents
Process of providing plants with abiotic stress resistance Download PDFInfo
- Publication number
- WO2014187571A1 WO2014187571A1 PCT/EP2014/001403 EP2014001403W WO2014187571A1 WO 2014187571 A1 WO2014187571 A1 WO 2014187571A1 EP 2014001403 W EP2014001403 W EP 2014001403W WO 2014187571 A1 WO2014187571 A1 WO 2014187571A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- plant
- plants
- interest
- dna
- providing
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8273—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for drought, cold, salt resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/32—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Bacillus (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8201—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation
- C12N15/8202—Methods for introducing genetic material into plant cells, e.g. DNA, RNA, stable or transient incorporation, tissue culture methods adapted for transformation by biological means, e.g. cell mediated or natural vector
- C12N15/8205—Agrobacterium mediated transformation
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/10—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
- Y02A40/146—Genetically Modified [GMO] plants, e.g. transgenic plants
Definitions
- the present invention relates to a process of providing a plant with increased resistance against abiotic stress such as drought stress.
- the invention also relates to an agricultural crop or plant production system and process that allows reacting to abiotic stress occurring during a growing season.
- the invention also relates to a composition comprising Agrobacterium cells, an Agrobacterium strain and to a suspension containing cells of an Agrobacterium strain for such process.
- the invention further provides a process of protecting a plurality of plants grown on a farm field from abiotic stress. Further, a plant treated with the composition and having an increased abiotic stress tolerance compared to a plant before treatment is provided.
- WO 2005/033318 relates to methods for enhancing stress tolerance in plants, and describes transgenic plants stably transformed with a DNA encoding a cold shock protein from gram positive bacteria, such as Bacillus subtilis. Increased abiotic stress tolerance is reported for transgenic plants.
- One cold shock protein mentioned in WO 2005/033318 is B. subtilis CspB.
- transgenic plants Abiotic stress is due to environmental conditions and thus generally affects the entire plant. This seems to be the reason as to why transgenic plants have been used in the prior art for providing plants with proteins that increase stress tolerance.
- generation of transgenic crop plant lines is a time-consuming process, requiring many years of development.
- planting of transgenic crops is not allowed or severely restricted (such as to use as animal feed) in several countries, whereby the approaches described in the prior art cannot be used in such countries.
- transgenic plants generally contain selectable marker genes that were used for selecting transformed plants or cells thereof.
- the present invention provides the following:
- a process of providing a plant with improved abiotic stress tolerance comprising providing aerial parts of said plant with a suspension containing cells of an Agrobacterium strain comprising a nucleic acid molecule comprising a nucleic acid construct containing a nucleotide sequence of interest, said nucleotide sequence of interest providing said plant with increased abiotic stress resistance upon expression in said plant.
- Agrobacterium strain comprising a nucleic acid molecule comprising a nucleic acid construct containing a nucleotide sequence of interest, said nucleotide sequence of interest providing said plants with increased abiotic stress resistance upon expression in said plants.
- nucleotide sequence of interest providing said plant with increased abiotic stress tolerance, comprising providing aerial parts of said plant with said suspension containing cells of said Agrobacterium strain.
- nucleotide sequence of interest encodes a protein capable of providing said plant(s) with said increased abiotic stress tolerance.
- said protein comprises an amino acid sequence having at least 80 % identity over the entire range of SEQ ID NO: 1 or NO:2.
- DNA molecule or vector for Agrobacterium-mediated transformation of plants comprising in T-DNA a nucleic acid construct containing a DNA sequence of interest operably linked to a promoter; said DNA sequence of interest encoding a protein capable of providing a plant with increased abiotic stress tolerance; said T-DNA not containing a selectable marker allowing selection of plant cells containing said T-DNA.
- Agrobacterium cell comprising the DNA molecule of item 20.
- Agrobacterium strain comprising a heterologous DNA molecule comprising in T- DNA a nucleic acid construct containing a heterologous DNA sequence of interest operably linked to a promoter; said heterologous DNA sequence of interest encoding a protein capable of providing a plant with increased drought resistance; said T-DNA not containing a selectable marker allowing selection of plant cells containing said T-DNA.
- composition containing cells of an Agrobacterium strain comprising a heterologous DNA molecule comprising a nucleic acid construct containing a heterologous DNA sequence of interest operably linked to a promoter; said nucleotide sequence of interest providing a plant with increased abiotic stress resistance upon expression in said plant; said composition optionally further comprising a preferably non- ionic wetting agent such as an organosilicone surfactant.
- composition according to item 23 further comprising at least one abrasive.
- a plant treated with a composition containing cells of an Agrobacterium strain comprising a nucleic acid molecule comprising a nucleic acid construct containing a nucleotide sequence of interest, said nucleotide sequence of interest providing said plant with increased abiotic stress resistance upon expression in said plant; said plant containing in cells thereof said nucleotide sequence of interest and expresses said nucleotide sequence of interest.
- Method of conferring abiotic stress tolerance to a plant comprising the following steps: preparing a suspension containing cells of an Agrobacterium strain comprising a nucleic acid molecule comprising a nucleic acid construct containing a nucleotide sequence of interest, said nucleotide sequence of interest providing said plant with increased abiotic stress resistance upon expression in said plant; and applying the suspension prepared in the previous step to aerial parts of said plant.
- the inventors have surprisingly found that it is possible to achieve increased abiotic stress resistance such as drought resistance in plants by transiently expressing in plants endangered by an abiotic stress a nucleotide sequence of interest providing said plant with increased abiotic stress resistance upon expression in said plant.
- the nucleotide sequence of interest encodes a protein capable of providing said plants with increased abiotic stress resistance.
- the invention provides an abiotic stress protection system, kit and method for plants, wherein provision of a foreign gene (such as the nucleotide sequence of interest) to said plant can be restricted to environmental conditions where abiotic stress such as drought occurs or is expected to occur. If no abiotic stress occurs or is to be expected, providing a foreign gene or transgene e.g.
- the invention provides and enables a crop management system wherein plants that were provided with increased abiotic stress resistance according to the processes of the invention may be excluded from being used for food production for humans, but may instead be used for animal feed production or for biofuel production. However, plants that were not provided with increased abiotic stress resistance due to favourable environmental conditions in a growing season may be used for human food production.
- the invention represents a large improvement compared to prior art abiotic stress improvement methods (WO 2005/033318; Castiglioni et al., Plant Physiology 147 (2008) 446-455) wherein transgenic plants are planted even in growing seasons where no improved stress tolerance is needed.
- nucleotide sequence of interest that is, upon expression, capable of providing said plants with increased abiotic stress resistance is provided to said plants transiently, i.e. without the need for a selectable marker gene such as an antibiotic resistance gene or a herbicide resistance gene and without selecting for plant cells having incorporated such antibiotic resistance gene or a herbicide resistance gene, no antibiotic resistance gene or a herbicide resistance gene is inserted into plants, and spread of such genes in the environment with these plants can be largely avoided.
- the process of the invention has improved environmental safety compared to the abiotic stress protection systems of the prior art that rely on transgenic plants.
- Providing the nucleotide sequence of interest of the invention transiently to plants under abiotic stress conditions provides a selective advantage for the treated plants.
- Fig. 1 shows schematically plasmid vectors used for cloning of genes of interest.
- pNMD2492 is a transcriptional non-replicating vector.
- RB and LB stand for the right and left borders of T-DNA.
- P35S cauliflower mosaic virus 35S promoter;
- O omega translational enhancer;
- P19 PTGS suppressor P19 from Tomato Bushy Stunt Virus;
- Tnos nopaline synthase terminator; Toes: ocs terminator.
- pNMD035 is a TMV-based viral vector with cell- to cell movement ability.
- Pact2 promoter of Arabidopsis actin2 gene; o: 5' end from TVCV (turnip vein clearing virus); RdRp: RNA-dependent RNA polymerase open reading frame (ORF) from cr-TMV (crucifer-infecting tobamovirus); MP: movement protein ORF from cr- TMV; N: 3'-non-translated region from cr-TMV; Tnos or nos: nopaline synthase terminator; white segments interrupting grey segments in the RdRp and MMP ORFs indicate introns inserted into these ORFs for increasing the likelihood of RNA replicon formation in the cytoplasm of plant cells, which is described in detail in WO2005049839.
- pNMD661 is a TMV-based vector lacking cell-to cell movement ability. A point mutation in the MP ORF leads to a frame shift preventing correct MP translation.
- pNMD670 is a PVX (potato virus X)-based vectors with cell-to-cell movement ability. PVX-pol: RNA-dependent RNA polymerase from PVX; CP: coat protein ORF; 25K, 12K and 8 together indicate the 25KDA, 12 kDa and 8 kDa triple gene block modules from PVX; N: 3'-untranslated region from PVX.
- pNMD694 is a PVX-based vector with deletion of the coat protein coding sequence were disabled for both systemic and cell-to cell movement.
- Fig. 2 shows schematically transcriptional vectors for the expression of Arabidopsis thaliana nuclear transcription factor Y subunit B-1 (NF-YB1 ) (GenBank: NM_129445.2) (plasmid construct pN D3486) and Cold shock protein CspB from Bacillus subtilis subsp. subtilis str JH642 (GenBank: AAB01346) (plasmid construct pNMD3493).
- Fig. 3 shows Brassica napus N90-740 plants 11 days post spraying, 11 days drought.
- Fig. 4 shows Brassica napus N90-740 plants 18 days post spraying, 1 days drought, 7 days rewatering.
- Fig. 5 shows Brassica napus N90-740 plants 26 days post spraying, 11 days drought, 7 days rewatering, 8 days drought.
- Fig. 6 shows Brassica napus N90-740 plants 26 days post spraying, 11 days drought, 7 days rewatering, 13 days drought, 1 day rewatering.
- Fig. 7 shows schematically PVX viral vectors with systemic movement ability used for expression of genes of interest in tomato plants.
- RB and LB stand for the right and left borders of T-DNA.
- P35S cauliflower mosaic virus 35S promoter
- PVX-POL RNA- dependent RNA polymerase from PVX
- CP coat protein ORF
- 25K, 12K and 8 together indicate the 25KDA, 12 kDa and 8 kDa triple gene block modules from PVX
- N 3'- untranslated region from PVX
- GmRD22 coding sequence of GmRD22 (apoplast-localized BURP-domain protein) from soybean Glycine max
- BnLAS coding sequence of BnLAS (GRAS family gene) from rapeseed Brassica napus
- GFP coding sequence of Green Fluorescent Protein from jellyfish.
- VirG N54D stands for the coding sequence of VirG protein from Agrobacterium tumefaciens GV3101 with N54D mutation.
- Fig. 8 shows phenotypes of transfected tomato Lycopersicon esculentum cv.
- Fig. 9 shows fruits of transfected tomato Lycopersicon esculentum cv. Balcony Red plants exposed to drought three weeks post spraying with agrobacteria harboring PVX vectors for the expression of BnLAS and GmRD22 genes. Drought exposure was performed for 14 days. Fruit yield was evaluated 100 days post spraying. Numerals 1 , 2, 3 etc. stand for individual plants.
- Fig. 10 shows biomass of fruits harvested from transfected tomato Lycopersicon esculentum cv. Balcony Red plants exposed to drought three weeks post spraying with agrobacteria harboring PVX vectors. Drought exposure was performed for 14 days. Fruit yield was evaluated 100 days post spraying and calculated as an average per plant.
- 1 untransfected plant; 2: plants expressing BnLAS gene; 3: plants expressing GmRD22 gene; 4: plants expressing GFP.
- Fig.11 depicts phenotypes of GmRD22, BnLAS and GFP transfected tomato Blacony Red seedlings exposed to the PEG6000 treatment.
- Fig. 12 shows Lycopersicon esculentum cv. Balcony Red seedlings transfected with GFP and BnLAS expressing PVX vectors after 10 days of withholding irrigation and following recovery (2h after watering). Plants were sprayed with agrobacteria 12 days post sowing and exposed to drought 12 days post spraying.
- the processes of the invention have their main application in agriculture, i.e. on a large scale. Thus, these processes are generally carried with a plurality of plants.
- the processes are generally applied to a plurality of plants sown or planted e.g. on a farm field.
- the sown or planted plants preferably do not contain an expressible gene that provides the plants with the abiotic stress tolerance provided in the processes of the invention.
- the plants are preferably not transgenic for such gene.
- a user After having sown or planted the plants, a user which is typically a farmer may observe growth of the plants and the health state of the plants. Further, the user may observe environmental conditions such as the weather and/or the condition of the soil for determining whether abiotic stress conditions for the plants have developed, are developing or may develop. Determining whether abiotic stress conditions are present may involve taking samples from the soil and examining the soil. Alternatively or additionally, determining whether abiotic stress conditions are present may involve taking samples from the plants or from a fraction of said plants and examining the plants.
- determining drought stress or salt stress one ore more soil samples may be examined for water content or salt content, respectively.
- the processes of the invention are used for improving the tolerance or resistance (these terms are used interchangeably herein) of the plants against drought.
- determining drought stress and the further development of such stress may involve following weather forecasts for assessing the probability of rain.
- Soil measures and/or plant measures may be used for determining or following a water status affecting the plants.
- the known methods may also be classified into direct methods and indirect methods. Among direct methods, measurement of the relative water content (RWC) of soil or plant material and direct measurement of the leaf water potential e.g. with a pressure chamber, or using of sap flow sensors may be mentioned.
- RWC relative water content
- remote infrared technologies based on the evaluation of canopy temperature or remote spectrometric methods based on the measuring of canopy spectral reflectance may be mentioned.
- crop temperatures rise because they cannot transpire enough water to keep themselves cool.
- transpiration decreases, thus reducing the leaf cooling effect and causing the crop temperature to rise.
- All objects emit energy or radiation that is measured as their temperature.
- the temperature is usually measured with a thermal infrared thermometer. Infrared
- thermometers are commercially available. Irmak et al., Agronomy Journal, 92, 1221- 1227, 2000) describe the determination of crop water stress index (CWSI) for the purpose of irrigation timing, but may also be used for determining drought stress in plants for the present invention. Other measures for following the water status are turgor pressure or stromatal conduct, and water potential in soil or the plants. In order not to depend on absolute determinations of the water status measures mentioned above, one may follow the water status continuously or regularly for easily recognizing development of drought stress.
- CWSI crop water stress index
- the plants or parts thereof are provided with a suspension containing cells of an Agrobacterium strain comprising a nucleic acid molecule comprising a nucleic acid construct containing a nucleotide sequence of interest.
- the nucleotide sequence of interest can, upon expression in the plants, provide the plants with increased tolerance against the abiotic stress.
- the invention also provides a process of producing plants or parts of said plants, comprising the following steps:
- step (C) if it was determined in step (B) that drought stress affects or may affect said plants, providing aerial parts of said plants with a suspension containing cells of an Agrobacterium strain comprising a nucleic acid molecule comprising a nucleic acid construct containing a nucleotide sequence of interest, said nucleotide sequence of interest providing said plants with increased drought stress resistance upon expression in said plants;
- step (E) if step (C) was performed, using the harvest of step (D) for a purpose for which having performed step (C) is acceptable; or, if step (C) was not performed, using the harvest of step (D) for a purpose for which having performed step (C) is not acceptable.
- a purpose for which performing step (C) may not be acceptable is food production for human consumption.
- a purpose for which performing step (C) may be acceptable is animal feed production or production of biofuel.
- the invention provides a crop production system and method for entire growing seasons, that strongly improves overall efficiency. On the one hand, loss of crop or plant material due to drought can be reduced, and the saved crops or biomass can be used for purposes for which genetic modification is not of concern. On the other hand, in seasons where no measures for increasing the drought tolerance are required due to favourable weather conditions, the plants grown are non-genetically modified, which is preferred by some consumers or in some countries.
- the nucleotide sequence of interest may encode a protein capable of providing said plants with increased abiotic stress resistance such as drought resistance.
- the nucleotide sequence of interest may produce, upon expression, an RNA that may provide the plants with the increased abiotic stress resistance.
- the nucleic acid molecule is generally a DNA molecule.
- the nucleotide sequence of interest contained therein is DNA sequence of interest.
- parts of said plants are transiently transfected with said nucleic acid molecule (vector) for transient expression of said nucleotide sequence of interest.
- vector nucleic acid molecule
- transient means that no selection methods are used for selecting cells or plants transfected with the nucleic acid molecule (vector) or with the nucleic acid construct from non-transfected cells or plants using, e.g. a selectable agent and a selectable marker gene capable of detoxifying the selectable agent.
- the transfected nucleic acid is generally not stably introduced into plant chromosomal DNA.
- transient expression methods make use of the effect of transfection in the very plant cells transfected.
- a possible way of achieving expression of said nucleotide sequence of interest is the use of self-replicating (viral) replicons containing a nucleotide sequence encoding said nucleotide sequence of interest.
- Plant viral expression systems have been described in many publications both for the use of DNA viral vectors and for the use of RNA viral vectors, such as in WO2008028661 , WO2006003018, WO2005071090, WO2005049839, WO2006012906, WO02101006 or WO02068664 and many more publications are cited in these documents.
- Agrobacteria are preferably used for transfecting plants with the nucleic acid molecule (vector) or nucleic acid construct e.g. by agroinfiltration.
- a system and method for large scale infiltration of plants by agrobacteria is described in WO2009095183.
- plants or plant parts are sprayed with a suspension containing cells of an Agrobacterium strain, which is well suitable for large scale applications to many plants such as to plants on a farm field. Such spray transfection processes are described in detail in WO2012/019660.
- the Agrobacterium strain may belong to the species Agrobacterium tumefaciens or Agrobacterium rhizogenes that are commonly used for plant transformation and
- the Agrobacterium strain to be used in the processes of the invention comprises a DNA molecule (Ti-plasmid) as said nucleic acid molecule, comprising a nucleic acid construct containing a DNA sequence of interest.
- the DNA sequence of interest may encode one or more than one protein to be expressed in plants.
- the nucleic acid construct is typically present in T-DNA of Ti-plasmids for introduction of the nucleic construct into plant cells by the secretory system of the Agrobacterium strain. On at least one side or on both sides, the nucleic acid construct is flanked by a T-DNA border sequence for allowing transfection of said plant(s) and introduction into cells of said plant of said nucleic acid construct.
- said nucleic acid construct is present in T-DNA and flanked on both sides by T- DNA border sequences.
- the nucleic acid construct is present in T-DNA of a Ti-plasmid of the Agrobacterium strain.
- Ti-plasmids may contain a selectable marker outside of said T- DNA for allowing cloning and genetic engineering in bacteria.
- the T-DNA that is transferred into cells of said plant preferably does not contain a selectable marker that would, if present, allow selection of plant or plant cells containing said T-DNA.
- selectable marker genes that should, in this embodiment, not be present in T-DNA of the Ti-plasmid are an antibiotic resistance gene or a herbicide resistance gene.
- the processes of the invention use transient transfection and expression of said nucleotide sequence of interest (or said protein), the processes do not comprise a step of selecting for plant cells having incorporated the nucleic acid molecule of the invention by using such antibiotic resistance gene or a herbicide resistance gene. Accordingly, no antibiotic resistance gene or a herbicide resistance gene needs to be incorporated into said plants, whereby the probability of spreading such genes in the environment is low in the processes of the invention.
- the nucleic acid construct comprises the nucleotide sequence of interest such that the latter is expressible in plant cells.
- the nucleotide sequence of interest may be, in said nucleic acid construct, under the control of a promoter active in plant cells.
- the nucleotide sequence of interest encodes a protein capable of providing plants with increased abiotic stress tolerance.
- the nucleotide sequence of interest are a DNA sequence encoding a DNA viral replicon or an RNA viral replicon, or a gene to be expressed.
- the gene provides, upon expression, the plant with the increased abiotic stress tolerance.
- the gene encodes a protein capable of providing the plant with increases abiotic stress tolerance.
- the viral replicons encode such protein to be expressed in cells of the plant(s).
- the nucleic acid construct may comprise, in addition to the nucleotide sequence of interest, other sequences such as regulatory sequences for expression of the nucleotide sequence of interest, such as a transcription promoter and terminator.
- the nucleic acid construct may comprise a further gene to be expressed, e.g. a gene encoding a suppressor of gene silencing such as the P19 protein. Expression of such further gene may be under the control of the same or a different promoter as the promoter used for expressing the protein of the invention, gene transfer and vectors therefor are known to the skilled person, e.g. from the references cited above or from text books on plant biotechnology such as Slater, Scott and Fowler, Plant
- promoter active in plant cells means a DNA sequence that is capable of controlling (initiating) transcription in a plant cell. This includes any promoter of plant origin, but also any promoter of non-plant origin which is capable of directing transcription in a plant cell, i.e., certain promoters of viral or bacterial origin such as the cauliflower mosaic virus 35S promoter (CaMV35S promoter) (Harpster et al. (1988) Mol Gen Genet.
- CaMV35S promoter cauliflower mosaic virus 35S promoter
- the subterranean clover virus promoter No 4 or No 7 (WO9606932), or T-DNA gene promoters but also tissue-specific or organ-specific promoters including but not limited to seed-specific promoters (e.g., WO89/03887), organ- primordia specific promoters (An et al. (1996) Plant Cell 8(1 ):15-30), stem-specific promoters (Keller et al., (1988) EMBO J. 7(12): 3625-3633), leaf specific promoters (Hudspeth et al. (1989) Plant Mol Biol.
- mesophyl-specific promoters such as the light-inducible Rubisco promoters
- root-specific promoters such as the light-inducible Rubisco promoters
- tuber-specific promoters such as the tuber-specific promoters
- vascular tissue specific promoters such as the vascular tissue specific promoters (Peleman et al. (1989) Gene 84: 359-369)
- stamen- selective promoters WO 89/10396, WO 92/13956
- dehiscence zone specific promoters WO 97/13865 and the like.
- constitutive promoters i.e. promoters that are not developmentally regulated, are preferably used. However, constitutive promoters may be tissue-specific or organ-specific. Preferred promoters are those used in the Examples described below.
- construct means a recombinant construct comprising a nucleotide sequence of interest.
- the construct encodes at least a protein capable of providing said plants with increased abiotic stress resistance.
- the nucleic acid construct may encode a viral vector that can replicate in plant cells to form replicons of the viral vector.
- the viral vector and the replicons contain an origin of replication that can be recognized by a nucleic acid polymerase present in plant cells, such as by the viral polymerase expressed from the replicon.
- RNA viral vectors referred to as "RNA replicons”
- the replicons may be formed by transcription under the control of a promoter active in plant cells, from the DNA construct after the latter has been introduced into plant cell nuclei.
- the replicons may be formed by recombination between two recombination sites flanking the sequence encoding the viral relicon in the DNA construct, e.g. as described in WO00/17365 and WO 99/22003. If the replicon is encoded by the DNA construct, RNA replicons are preferred.
- Use of DNA and RNA viral vectors has been extensively described in the literature over the years. Some examples are the following patent publications: WO2008028661 , WO2007137788, WO 2006003018, WO2005071090, WO2005049839, WO02097080, WO02088369, WO02068664.
- DNA viral vectors are those based on geminiviruses.
- viral vectors or replicons based on plant RNA viruses notably those based on plus-sense single-stranded RNA viruses may be used.
- the viral replicon may be a plus-sense single-stranded RNA replicon.
- the processes of the invention comprise spraying aerial parts of said plant with a suspension containing cells of an Agrobacterium strain comprising a DNA molecule comprising a nucleic acid construct containing a DNA sequence of interest preferably encoding said protein.
- the suspension that may be used for providing aerial parts of said plant is a liquid composition comprising Agrobacterium cells suspended in the liquid.
- the suspension is generally aqueous, which means that the liquid contains at least 50, preferably at least 80, more preferably at least 90 % by weight water.
- Other components in the liquid may be other liquid components compatible with the maintenance of the Agrobacterium cells in a viable form, which may be polar solvents such as polyhydric alcohols or dimethylsulfoxide. Further components may be nutrients, minerals or salts, buffering agents or spray adjuvants (see further below).
- the suspension used for spraying plants or plant parts in the process of the invention may have a concentration of Agrobacterium cells of at most 1.1 -10 9 cfu/ml, which corresponds approximately to an Agrobacterium culture in LB-medium of an optical density at 600 nm of 1. Due to the high transfection efficiency achievable, notably if spraying is done with the use of an abrasive and/or a surfactant or wetting agent (see below), much lower concentrations may, however, be used, which allows treatment of many plants such as entire farm fields without the need for huge fermenters for Agrobacterium production.
- the concentration may be at most 2.2- 10 7 cfu/ml, preferably at most 1.1 -10 7 cfu/ml, more preferably at most 4.4- 10 6 cfu/ml. In one embodiment, the concentration is at most 1.1 -10 6 cfu/ml of the suspension. For avoiding determination of cell concentrations in terms of cfu/ml, concentrations of agrobacterial suspensions are frequently assessed by measuring the apparent optical density at 600 nm using a spectrophotometer.
- the concentration of 1.1 -10 7 cfu/ml corresponds to a calculated optical density at 600 nm of 0.01 , whereby the calculated optical density is defined by a 100-fold dilution with water or buffer of a suspension having an optical density of 1.0 at 600 nm.
- the calculated optical density is defined by a 100-fold dilution with water or buffer of a suspension having an optical density of 1.0 at 600 nm.
- concentrations of 4.4-10 6 cfu/ml and 1.1 -10 6 cfu/ml correspond to a calculated optical density at 600 nm of 0.004 and 0.001 , respectively, whereby the calculated optical densities are defined by a 250-fold or 1000-fold, respectively, dilution with water or buffer of a suspension having an optical density of 1.0 at 600 nm.
- the suspension containing cells of an Agrobacterium strain used for spraying the plants or parts of a plant may contain at least one abrasive suspended in said suspension for improving transfection efficiency.
- the abrasive that may be used is a particulate material that is essentially insoluble in the aqueous suspension of Agrobacterium cells.
- the abrasive is believed to weaken, notably if used together with a wetting agent, the surface of plant tissue such as leaves, and thereby facilitates penetration of Agrobacterium cells into the intercellular space of plant tissue. As a result, the transfection efficiency is high.
- the particulate material to be used as the abrasive of the invention may be carrier material as commonly used as carriers in wettable powder (WP) of pesticide formulations.
- WP wettable powder
- these carriers are also referred to in the field of pesticide formulations as "fillers” or "inert fillers”.
- Wettable powder formulations are part of the general knowledge in the field of plant protection. Reference is made to the handbook PESTICIDE SPECIFICATIONS, ..Manual for Development and Use of FAO and WHO Specifications for Pesticides", edited by the World Health Organisation (WHO) and the FOOD and Agriculture Organization of the United States, Rome, 2002, ISBN 92-5-104857- 6. Wettable powder formulations for plant protection are for example described in EP 1810569, EP1488697, EP1908348 and EP0789510.
- the abrasive may be a mineral material, typically an inorganic material. Examples of such carrier materials are
- diatomaceous earth talc
- clay calcium carbonate
- bentonite acid clay
- attapulgite zeolite
- sericite sepiolite or calcium silicate.
- quartz powder such as the highly pure quartz powder described in WO02/087324.
- silica such as precipitated and fumed hydrophilic silica, and carborundum.
- the abrasive properties of diluents or fillers such as silica used in wettable powders are known (see proportionPesticide Application Methods" by G.A. Matthews, third edition, Blackwell Science, 2000, on page 52 thereof).
- hydrophilic silica SipernatTM 22S and SipernatTM 50 S manufactured by Evonic Degussa may be mentioned.
- Other products are "Hi-SilTM 257”, a synthetic, amorphous, hydrated silica produced by PPG Industries Taiwan Ltd. or "Hubersorb 600TM”, a synthetic calcium silicate, manufactured by Huber Corporation.
- Hi- SilTM 233 PPG Industries having an average particle size of around 0.02 pm.
- the abrasive may have a median particle size between 0.01 and 40, preferably between 0.015 and 30, more preferably between 0.05 and 30, even more preferably between 0.1 and 30, even more preferably between 0.1 and 20, even more preferably between 0.5 and 20, and most preferably between 1.0 and 16 ⁇ .
- the median particle size is between 0.015 and 1 or between 0.02 and 0.5 pm.
- the median particle size is the volume median particle size that can be measured by laser diffraction using a MastersizerTM from Malvern Instruments, Ltd.
- the maximum particle size of the largest particles contained in the abrasive should be at most 45 Mm, preferably at most 40 pm, which may be determined by sieving.
- the abrasive may have a D90 value of at most 40 ⁇ , preferably of at most 30 ⁇ , measured by laser diffraction as described above.
- the particle sizes above relate to primary particle sizes.
- the content of the abrasive in the aqueous suspension of the invention may be between 0.01 and 3, preferably between 0.02 and 2, more preferably between 0.05 and 1 and even more preferably between 0.1 and 0.5 % by weight of said suspension.
- the suspension usable for spraying parts of the plants preferably contains an agricultural spray adjuvant.
- the spray adjuvant may be a surfactant or wetting agent.
- the surfactant or wetting agent has multiple advantages in the present invention. It reduces the surface tension of the water of the aqueous suspension and makes the waxy surface of plant leaves more permeable for agrobacteria. It further improves the stability of the suspension and reduces settling of the abrasive in the suspension.
- Surfactants used in the present invention are not particularly limited. However, nonionic surfactants are preferred. A measurement frequently used to describe surfactants is the HLB (hydrophilic/lipophilic balance). The HLB describes the ability of the surfactant to associate with hydrophilic and lipophilic compounds.
- HLB value should be 12 or greater, preferably at least 13.
- organo-silicone surfactants such as polyalkyleneoxide-modified heptamethyltrisiloxane are most preferred in the present invention.
- a commercial product is Silwet L77TM spray adjuvant from GE Advanced Materials.
- Agrobacterium strains usable in the invention are those that are generally used in the art for transfecting or transforming plants.
- binary vector systems and binary strains are used, i.e. the wr genes required for transfer of T-DNA into plant cells on the one hand and the T-DNA on the other hand are on separate plasmids.
- Examples of usable Agrobacterium strains are given in the article of Hellens et al., Trends in Plant Science 5 (2000) 446-451 on binary Agrobacterium strains and vector systems.
- the plasmid containing the wr genes is referred to as "vir plasmid" or "vir helper plasmid”.
- the plasmid containing the T-DNA to be transfected is the so-called binary vector that is also referred to herein as "DNA molecule" or "vector".
- the term "strain” or "Agrobacterium strain” relates to components of the Agrobacterium other than the binary vector.
- a binary Agrobacterium strain not containing a binary vector and after introduction of a binary vector are referred to by the same strain name.
- the suspension of agrobacteria may be produced as follows.
- the DNA molecule or vector containing the nucleic acid construct may be transformed into the Agrobacterium strain and transformed Agrobacterium cultures are grown optionally under application of selective pressure for maintenance of said DNA molecule. In one method, the
- Agrobacterium strain to be used in the processes of the invention is then inoculated into a culture medium and grown to a high cell concentration. Larger cultures may be inoculated with small volumes of a highly concentrated culture medium for obtaining large amounts of the culture medium. Agrobacteria are generally grown up to a cell concentration
- Such highly concentrated agrobacterial suspensions are then diluted to achieve the desired cell concentration.
- water is used for diluting the highly concentrated agrobacterial suspensions.
- the water may contain a buffer or salts.
- the water may further contain the surfactant mentioned above.
- the concentrated agrobacterial suspensions may be diluted with water, and any additives such as the surfactant and the optional buffer substances are added after or during the dilution process.
- the abrasive may be added before, during or after dilution. It is however preferred to agitate the suspension during addition of the abrasive to uniformly disperse the abrasive in the agrobacterial suspension.
- the step of diluting the concentrated agrobacterial suspension may be carried out in the spray tank of the sprayer used for spraying the diluted suspensions.
- the sprayer to be used for transfecting plants or plant parts in the process of the invention mainly depends on the number of plants or the area to be sprayed.
- pump sprayers as widely used in household and gardening can be used. These may have volumes of the spray tank of between 0.5 and 2 liters.
- manually operated hydraulic sprayers such as lever-operated knapsack sprayers or manually operated compression sprayers may be used.
- the high transfection efficiency achieved in the invention has its full potential in the transfection of many plants such as plants growing on a farm field or in a greenhouse.
- power-operated hydraulic sprayers such as tractor-mounted hydraulic sprayers equipped with spray booms can be used.
- sprayers used in the invention should produce spray of a droplet size at least of fine spray.
- medium spray or coarse spray in the classification of sprays used in the above-mentioned book by G.A. Matthews, page 74 may be used.
- the main purpose of the spraying in the invention is wetting of plant tissue with the suspension.
- the exact droplet size is not critical.
- the transfection efficiency may be further improved by providing the spray to plant surfaces with increased pressure.
- the invention also provides a composition containing cells of an Agrobacterium strain, said Agrobacterium strain comprising a heterologous DNA molecule comprising a nucleic acid construct containing a heterologous DNA sequence of interest operably linked to a promoter; said nucleotide sequence of interest providing a plant with increased abiotic stress resistance upon expression in said plant.
- the composition may be liquid or solid. Examples of solid compositions are dried or lyophilized compositions containing cells of said Agrobacterium strain. An example of a liquid composition is the suspension mentioned below. Lyophilized compositions may be prepared by freeze drying suspensions containing Agrobacterium cells, preferably in the presence of freeze-protection agents such as glycerol.
- the composition may further comprise a the spray adjuvant or the preferably non- ionic wetting agent such as an organosilicone surfactant mentioned above.
- composition may be used for producing the suspension for spraying e.g. by dilution with water or an aqueous solvent.
- said nucleotide sequence of interest or said protein capable of providing said plants with increased abiotic stress resistance may be expressed in multi-cellular plants, notably, higher plants.
- Crop plants used in agriculture are preferred. Both monocot and dicot (crop) plants can be used.
- Common crop plants for the use in present invention include alfalfa, barley, beans, canola, cowpeas, cotton, corn, clover, lotus, lentils, lupine, millet, oats, peas, peanuts, rice, rye, sweet clover, sunflower, sweetpea, soybean, sorghum triticale, yam beans, velvet beans, vetch, wheat, wisteria, and nut plants.
- the plant species preferred for practicing this invention include, but not restricted to, representatives of Gramineae, Compositeae, Solanaceae and Rosaceae.
- Preferred plants are plants that do not normally enter the food chain such as Nicotiana species such as N. tabacum and N. benthamiana may be used.
- the protein is expressed in the cytosol of cells of said plants or plant parts.
- no signal peptide directing the protein into a particular compartment is added to the enzyme.
- the protein capable of providing said plants with increased abiotic stress resistance expressed and used in the present invention is generally a heterologous protein to the plant or plant part in which it is to be expressed in the invention, i.e. the plant or its part does not produce the protein naturally. It is possible to optimise codon usage of genes encoding these enzymes for expression in plants, notably in the plant employed for expressing them. Codon optimisation is a standard method for increasing expression yields. Codon- optimised genes and nucleic acids can be ordered from commercial sources such as Entelechon GmbH, Regensburg, Germany.
- Increased abiotic stress resistance of a plant may be determined by treating a plant with the suspension of the invention and treating, as a control or reference, the same type of plant under otherwise identical conditions with a suspension not containing said cells of said Agrobacterium strain. Both plants are then subjected to identical conditions of abiotic stress. Increased abiotic stress resistance of the plant treated according to the invention can be detected by a more vigorous growth or better health condition.
- abiotic stress resistances that may be increased according to the invention are the following: drought resistance, salt resistance, osmotic stress resistance, cold resistance, freezing resistance, heat resistance, resistance to heavy metals, resistance to hypoxia or oxidative stress resistance.
- nucleotide sequences of interest and proteins for improving drought stress tolerance in plants are given in the following. References to the genes and proteins are also given.
- E.coli cold shock protein 7.4 (cspA) gene A coding sequence of the CspA protein suitable for expression in plants is given SEQ ID NO: 3. The amino acid sequence is given as SEQ ID NO: 4. Arabidopsis thaliana nuclear transcription factor Y subunit B-1 (NF-YB1 )
- NM_129445.2 increases drought resistance in transgenic plants; cf. Nelson et al., PNAS 104 (2007) 16450-16455.
- a coding sequence is given SEQ ID NO: 5.
- An amino acid sequence is given as SEQ ID NO: 6.
- BnLAS - GRAS family gene Ectopic expression thereof in plants inhibits growth, delays flowering, delays leaf senescence and increases drought resistance, cf. Yang et al.
- IPT isopentenyl transferase expression prevents the degradation of photosynthetic protein complexes during drought, cf. Rivero et al., Plant Cell Physiol. 51 (2010) 1929- 1941 , and Ori et al., The Plant Cell 11(1999) 1073-1080.
- An IPT coding sequence is given as SEQ ID NO: 21.
- An amino acid sequence is given as SEQ ID NO: 22.
- a coding sequence of BcWRKY46 is given SEQ ID NO: 11.
- An amino acid sequence is given as SEQ ID NO: 12.
- HaHB1 from sunflower, AtHB13, AtPR2, AtPR4 and AtGLU - homeodomain-leucine zipper transcription factors confer tolerance to drought and salinity stress, cf. Cabello & Chan (2012) Plant Biotechnol. J. 10 (2012) 815-825.
- a complete coding sequence with removed splice sites is given SEQ ID NO: 13.
- An amino acid sequence is given as SEQ ID NO: 14.
- HCD hypersensitive cell death
- AVP1 H+ Pump (vacuolar H 1 -pyrophosphatase) - plants overexpressing the vacuolar H1 -pyrophosphatase are much more resistant to high concentrations of NaCI and to water deprivation than the isogenic wild-type strains; cf. Gaxiola et al. 2001 PNAS 98 (20) 11444-11449; Park et al., PNAS 102 (2005) 18830-18835; Zhang et al. (2011 ) Plant Signaling & Behavior 6: 6, 861-863.
- a coding sequence is given as SEQ ID NO: 17.
- An amino acid sequence is given as SEQ ID NO: 18.
- GmRD22 apoplast-localized BURP-domain protein from soybean
- SEQ ID NO: 9 An amino acid sequence is given as SEQ ID NO: 10.
- HaHB1 from sunflower, AtHB13, AtPR2, AtPR4 and AtGLU - homeodomain-leucine zipper transcription factors as mentioned above can be used for increasing salt tolerance of plants.
- AVP1 H+ Pump (vacuolar H 1 -pyrophosphatase) - Transgenic plants
- vacuolar H1 -pyrophosphatase are much more resistant to high concentrations of NaCI and to water deprivation than the isogenic wild-type strains; cf. Gaxiola et al. 2001 PNAS 98 (20) 11444-11449; Zhang et al. (2011 ) Plant Signaling & Behavior 6: 6, 861-863; for sequences see above.
- GenBank: DQ394702 - SNAC1 (STRESS-RESPONSIVE NAC 1 ) enhances drought salt tolerance in transgenic rice in the field under severe drought stress conditions, cf. Hu et al. (2006) PNAS 103: 12987-12992.
- a coding sequence is given as SEQ ID NO: 19.
- An amino acid sequence is given as SEQ ID NO: 20.
- Cold tolerance may be increased by expressing in plants the following protein:
- BcWRKY46 - TF the member of WRKY protein family. Constitutive expression in transgenic tobacco reduced susceptibility to cold, ABA, salt and dehydration stress. Wang et al. (2012) Mol Biol Rep.
- the SNAC1 -targeted gene OsSROIc modulates oxidative stress tolerance by regulating hydrogen peroxide in rice; cf. You et al., J. Experimantal Botany (2013). LeCYPI - Tomato Cyclophilin.
- a coding sequence is given as SEQ ID NO: 23.
- An amino acid sequence is given as SEQ ID NO: 24. Drought resistance though improved root formation;cf. Oh et al. (2006) Planta 224: 133-144.
- any of the proteins of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 may be expressed in the plants.
- the same aim may be achieved by expressing in said plants a protein comprising an amino acid sequence having a sequence identity to any of the sequences of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24 of less than 100%.
- the protein to be expressed may be a variant protein having an amino acid sequence having at least 80% sequence identity to the entire amino acid sequence of any one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24.
- the amino acid sequence identity may be at least 85%, preferably at least 90%, more preferably at least 95% and even more preferably at least 97% to any one of amino acid sequence of any one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24.
- percent amino acid sequence identity two sequences are aligned optimally and the number of identical matches of nucleotides or amino acid residues between the two sequences is determined. The number of identical matches is divided by the length of the aligned region (i.e., the number of aligned amino acid residues) and multiplied by 100 to arrive at a percent sequence identity value.
- a gap i.e.
- amino acid sequence identities may be determined using BLASTX 2.2.14 using the standard settings. The standard settings allow, for example, for sequence gaps in alignments.
- the length of the aligned region is preferably over the entire length of the respective protein of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, or 24.
- the protein to be expressed comprises or consists of an amino acid sequence of at least 80 %, preferably at least 90 %, more preferably at least 95% of the number of amino acid residues of any one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24, and a sequence identity of at least 90% to SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, or 24, respectively, over such length.
- the protein to be expressed comprises or consists of an amino acid sequence of at least 80 %, preferably at least 90 %, more preferably at least 95% of the number of amino acid residues of any one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24, and a sequence identity of at least 95% to SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, or 24, respectively, over such length.
- the variant protein is preferably still capable of providing the plants with increased abiotic stress resistance of the respective protein of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, or 24, respectively.
- the variant protein may have, or consist of, an amino acid sequence having from 1 to several amino acid additions, substitutions or deletions compared to the amino acid sequence of any one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24, wherein the variant protein is preferably still capable of providing said plants with increased abiotic stress resistance.
- the maximum number of amino acid additions, substitutions or deletions may be at most 20, preferably at most 15, more preferably at most 10, and even more preferably at most 5, whereby the total number of additions, substitutions and additions together determine the number of "amino acid additions, substitutions or deletions".
- the protein to be expressed has an amino acid sequence similarity of at least 90% compared to the amino acid sequence of any one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24 over the entire length of these SEQ ID NOs.
- sequence identity is at least 95%, more preferably at least 98% over the entire length of these SEQ ID NOs.
- the protein to be expressed comprises or consists of an amino acid sequence of at least 80 %, preferably at least 90 %, more preferably at least 95% of the number of amino acid residues of any one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24, and a sequence similarity of at least 90%, preferably at least 95%, more preferably at least 98% to any one of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, and 24, respectively, over such length.
- Sequence similarity of protein sequences uses a substitution matrix with scores for all possible exchanges of one amino acid with another.
- the degree of similarity between protein sequences can, for example, be evaluated with the BLOSUM 62 substitution matrix (Henikoff and Henikoff, 1992, Proc. Natl. Acad. Sci. U. S. A.89:10915).
- the protein capable of providing said plants with increased drought stress resistance may have a cold shock domain, preferably said protein is an RNA chaperone having a binding site for single-stranded RNA.
- RNA chaperones such as cold shock proteins are believed to resolve misfolded RNA molecules by destabilizing RNA duplexes or binding to single-stranded nucleic acids (see e.g. Hunger et al., J. Bacteriol. 188 (2006) 240-248).
- the protein is or is a variant (as defined above) of B. subtiliis CspB of SEQ ID NO: 2.
- the protein comprises the amino acid sequence of SEQ ID NO: 2.
- the protein is a variant of the protein defined by the amino acid sequence of SEQ ID NO:2, said protein has at least the amino acid residues of CspA from E. coli W11 , F18, F20, F31 , H33, and F34 at positions corresponding to these positions in CspA from E. coli. Positions corresponding to positions in CspA from E. coli can be determined by alignment and correspond to an optimal alignment of the protein sequences.
- the abiotic stress tolerance is drought tolerance
- said protein is plant transcription factor LAS of SEQ ID NO: 8 or GmRE222 of SEQ ID NO: 10 or a variant thereof as defined above.
- the plant may be a dicot plant, preferably a Solanaceae plant, and more preferably a tomato plant.
- the concentration of Agrobacterium cells in liquid suspension in terms of colony forming units per ml (cfu/ml) of liquid suspensions can be determined using the following protocol.
- Cells of Agrobacterium tumefaciens strain ICF 320 transformed with construct pNMD620 were grown in 7.5 ml of liquid LBS medium containing 25 mg/L kanamycin (AppliChem, A1493) and 50 mg/L rifampicin (Carl Roth, 4163.2).
- the bacterial culture was incubated at 28°C with continuous shaking.
- Absorbance or optical density of bacterial culture expressed in absorbance units (AU) was monitored in 1-ml aliquots of the culture using a spectrophotometer at 600 nm wavelength (OD600).
- the cell concentration estimated as a number of colony-forming units per milliliter of liquid culture can be analyzed at OD600 values 1 ; 1.3; 1.5; 1.7 and 1.8.
- 250- ⁇ aliquots of liquid culture were diluted with LBS-medium to achieve a final volume of 25 ml (dilution 1 :100).
- 2.5 ml of such 1 :100 dilution were mixed with 22.5 ml of LBS to achieve the dilution 1 :1000.
- Liquid culture dilutions 1 :100; 1 :1 ,000; 1 :10,000; 1 :100,000; 1 :1 ,000,000; 1 :10,000,000 and 1 :100,000,000 were prepared similarly.
- an OD600 of 1.0 corresponds to 1.1 x 10 9 cfu/ml.
- soya peptone papaic hydrolysate of soybean meal; Duchefa, S1330
- yeast extract 0.5% yeast extract (Duchefa, Y1333)
- liquid LBS medium was supplemented with 1.5% agar (Carl Roth, 2266.2). Media were autoclaved at 121 °C for 20 min.
- Example 1 Vectors used in the following examples
- Plasmid maps for all five types of cloning vectors are represented Fig. 1. In all cases the gene of interest is insterted using Bsal cloning sites with catg and gate (taag) 5 ' and 3 ' overhangs, respectively.
- pNMD2492 transcriptional vector was created on the basis of pICBVIO, a pBIN19-derived binary vector (Marillonnet et al., 2004, 2006). It contains two expression cassettes inserted between T-DNA right and left borders.
- An expression cassette adjacent to the right border comprised CAMV 35S promoter, omega translational enhancer, Bsal cloning site for the insertion of gene of interest and the nos terminator (listed in sequential order).
- Expression cassette adjacent to the left border contained 35S promoter followed by omega translational enhancer, coding sequence of P19 suppressor of silencing from Tomato Bushy Stunt Virus (TBSV) (GenBank accession no. CAB56483.1 ) and ocs terminator.
- TMV-based vector with cell-to cell movement ability pNMD035, TMV-based vector lacking cell-to cell movement ability pNMD661 , PVX-based vector with cell-to-cell and systemic movement ability pNMD670 and PVX-based vector disabled for both systemic and cell-to cell movement pNMD694 have been already described in the patent "Process for transfecting plants".
- Plasmid construct pNMD3486 was created by direct insertion of coding sequence of Arabidopsis thaliana nuclear transcription factor Y subunit B-1 (NF-YB1 ) (GenBank: NM_129445.2) into pNMD1426 cloning vector using Bsal cloning site. Similarly, codon- optimized coding sequence of Cold shock protein CspB from Bacillus subtilis subsp. subtilis str JH642 (GenBank: AAB01346) was inserted into same cloning vector resulting in plasmid construct pNMD3493 (Fig. 2).
- Example 2 Influence of transient expression of NF-YB1 and CspB genes on the drought resistance of rapeseed plants.
- Agrobacterium tumefaciens CryX strain harboring pNMD3486 and pNMD3493 constructs transcriptional vectors containing NF-YB1 and CspB coding sequences under the control of 35S promoter, respectively (Fig. 2).
- A. tumefaciens strain CryX is described in International Patent Application PCT/EP2013/000994. Watering of plants was stopped on the day of spraying. After 11 days of drought, plants were watered next 7 days. After that plants were subjected to 13 days of drought and watered again for 1 day.
- Example 3 Influence of transient expression of BnLAS and GmRD22 genes on the drought resistance of tomato plants.
- the fruit yield of tomato plants exposed to the drought was evaluated 100 days post spraying with agrobacteria. Fruits harvested for individual plants included in the experiment are shown in Fig. 9. After the drought exposure, GmRD22 transfected plants showed higher fruit biomass if compared with untransfected plants and plants transfected with BnLAS and GFP plants (Fig. 10).
- Example 4 Influence of transient expression of BnLAS and GmRD22 genes on the osmotic stress resistance of tomato plants.
- GmRD22 insertion GmRD22 insertion
- pNMD5800 GFP insertion, transfection control
- SEQ ID NO: 1 complete CDS, codon optimized for Brassica napus, synthesized by Entelechon, GenBank: AAB01346
- SEQ ID NO: 2 Amino acid sequence:
- E.coli cold shock protein 7.4 (cspA) gene complete cds
- SEQ ID NO: 4 Protein:
- SEQ ID NO: 5 ORF original sequence, synthesized by Entelechon GenBank: N _129445.2 atggcggatacgccttcgagcccagctggagatggcggagaaagcggcggttccgttagggagcagg atcgataccttcctatagctaatatcagcaggatcatgaagaaagcgttgcctcctaatggtaagat tggaaaagatgctaaggatacagttcaggaatgcgtctctgagttcatcagcttcatcactagcgag gccagtgataagtgtcaaaaagagaaaaggaaaactgtgaatggtgatgatttgtgtgggcaatgg caacattaggatttgaggattacctggaacctctaaagatatacctagcgaggtacaggg
- SEQ ID NO: 6 Amino acid sequence
- SEQ ID NO: 7 Complete CDS, synthesized by Eurofins MWG Operon Splice sites removed: 454-456 :AG-»TC, C651T
- SEQ ID NO: 8 Amino acid sequence
- SEQ ID NO: 9 Complete CDS, synthesized by Eurofins M G Operon (C843G silent mutation for Bsal site removal)
- SEQ ID NO: 10 Amino acid sequence
- SEQ ID NO: 11 Complete CDS, synthesized by Eurofins MWG Operon.
- SEQ ID NO: 12 Amino acid sequence MA EEKLVINELEQGRELAQ LMSNLKDTSSIESSK LISEILSIYQNAISMLDDKKVLKRSREIDD KDSK VIKKRQVFEKKTEKVSFFVGAGQEKGSIDDGYCWRKYGQKEIHGSINPRGYFRCTHRFTQNC LAVKQVQKSDRDPSIFEVKYVGSHTCNNTTTSPKTPNFSISMFQQEDIKPTKTEEA SLEDLESTK NIFRTFSFSNYEIENAGGG KGNLFHEDQLSPAATTSGSGITSEVATAPASVENSETADSYFSSLDN IIDFGPDWLLSCDVLNW
- SEQ ID NO: 13 Complete CDS, synthesized by Eurofins MWG Operon; splice sites removed G561A, G750A
- SEQ ID NO: 14 Amino acid sequence
- SEQ ID NO: 15 Complete CDS, synthesized by Eurofins MWG Operon. GenBank: D43624
- SEQ ID NO: 16 Amino acid sequence
- SEQ ID NO: 17 Complete CDS, synthesized by Eurofins MWG Operon; (with E229D mutation; splices sites removed: A261G, C2004G, A2190T)
- SEQ ID NO: 18 Amino acid sequence
- SNAC1 - Oryza sativa japonica cultivar-group stress-induced Transcription factor NAC1 (SNAC1)
- SEQ ID NO: 19 Complete CDS, codon optimized for Nicotiana benthamiana, Synthesized by Entelechon
- SEQ ID NO: 20 Amino acid sequence
- SEQ ID NO: 21 CDS, E88G Mutation Gen Bank: AB025109.1
- SEQ ID NO: 22 Amino acid sequence
- SEQ ID NO: 24 Amino acid sequence
- SEQ ID NO: 25 T-DNA region of pNMD2492
- SEQ ID NO: 26 T-DNA region of pNMD035
- SEQ ID NO: 27 T-DNA region of pNMD661
- SEQ ID NO: 28 T-DNA region of pNMD670
- SEQ ID NO: 29 T-DNA region of pNMD694
- SEQ ID NO: 30 T-DNA region of pNMD3486
- SEQ ID NO: 31 T-DNA region of pNMD3493
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicinal Chemistry (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Botany (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2014270707A AU2014270707B2 (en) | 2013-05-23 | 2014-05-23 | Process of providing plants with abiotic stress resistance |
| EP14727372.6A EP2999790B1 (en) | 2013-05-23 | 2014-05-23 | Process of providing plants with abiotic stress resistance |
| US14/892,866 US20160097056A1 (en) | 2013-05-23 | 2014-05-23 | Process of Providing Plants with Abiotic Stress Resistance |
| ES14727372T ES2697324T3 (es) | 2013-05-23 | 2014-05-23 | Proceso para proporcionar a las plantas resistencia al estrés abiótico |
| JP2016514302A JP6453315B2 (ja) | 2013-05-23 | 2014-05-23 | 植物に非生物的ストレス抵抗性をもたらす方法 |
| CA2913068A CA2913068C (en) | 2013-05-23 | 2014-05-23 | Process of providing plants with abiotic stress resistance |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP13002691.7 | 2013-05-23 | ||
| EP13002691 | 2013-05-23 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014187571A1 true WO2014187571A1 (en) | 2014-11-27 |
Family
ID=48470702
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2014/001403 Ceased WO2014187571A1 (en) | 2013-05-23 | 2014-05-23 | Process of providing plants with abiotic stress resistance |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20160097056A1 (https=) |
| EP (1) | EP2999790B1 (https=) |
| JP (1) | JP6453315B2 (https=) |
| AU (1) | AU2014270707B2 (https=) |
| CA (1) | CA2913068C (https=) |
| ES (1) | ES2697324T3 (https=) |
| WO (1) | WO2014187571A1 (https=) |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3097783A1 (en) | 2015-05-26 | 2016-11-30 | Nomad Bioscience GmbH | Colicin m for the control of ehec |
| EP3178313A1 (en) | 2015-12-09 | 2017-06-14 | Leibniz-Institut für Pflanzenbiochemie | Gene and protein for the synthesis of oxidized zingiberene derivatives |
| EP3372091A1 (en) | 2017-03-07 | 2018-09-12 | Nomad Bioscience GmbH | Method of reducing contamination of an object with clostridium |
| EP3378485A1 (en) | 2017-03-24 | 2018-09-26 | Nomad Bioscience GmbH | Bacteriocins for control of salmonella enterica |
| WO2019122146A1 (en) * | 2017-12-21 | 2019-06-27 | Instituto Nacional De Investigación Agropecuaria | Methods for improving plant abiotic stress tolerance and yield |
| WO2019158653A1 (en) | 2018-02-15 | 2019-08-22 | Icon Genetics Gmbh | Immunogenic composition and vaccine for generating an immune response to norovirus |
| WO2020128968A1 (en) * | 2018-12-20 | 2020-06-25 | Benson Hill, Inc. | Pre-conditioning treatments to improve plant transformation |
| WO2020182860A1 (en) | 2019-03-12 | 2020-09-17 | Icon Genetics Gmbh | Norovirus-like particles with improved stability |
| WO2020245376A1 (en) | 2019-06-06 | 2020-12-10 | Nomad Bioscience Gmbh | Klebicins for the control of klebsiella |
| WO2022012926A1 (en) | 2020-07-16 | 2022-01-20 | Nomad Bioscience Gmbh | Products for oral consumption with reduced sugar content |
| EP4248987A1 (en) | 2022-03-21 | 2023-09-27 | Nomad Bioscience GmbH | Chimeric bacteriocins and method for the control of pseudomonas |
| EP4692365A1 (en) | 2024-08-08 | 2026-02-11 | Leibniz-Institut für Pflanzenbiochemie (IPB) Stiftung des öffentlichen Rechts | Genes, proteins, and processes for the synthesis of blue anthocyanins in eukaryotic cells |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3456829A1 (en) * | 2017-09-18 | 2019-03-20 | Nomad Bioscience GmbH | Method of improving potexviral vector stability |
| CN113025624B (zh) * | 2021-04-02 | 2022-07-05 | 河南大学 | 一种与油菜抗旱性相关的基因、过表达载体、细胞系、宿主菌及其应用 |
Citations (26)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1989003887A1 (en) | 1987-10-20 | 1989-05-05 | Plant Genetic Systems N.V. | A process for the production of biologically active peptide via the expression of modified storage seed protein genes in transgenic plants |
| WO1989010396A1 (en) | 1988-04-28 | 1989-11-02 | Plant Genetic Systems N.V. | Plants with modified stamen cells |
| WO1992013956A1 (en) | 1991-02-08 | 1992-08-20 | Plant Genetic Systems, N.V. | Stamen-specific promoters from rice |
| WO1996006932A1 (en) | 1994-08-30 | 1996-03-07 | Commonwealth Scientific And Industrial Research Organisation | Plant transcription regulators from circovirus |
| WO1997013865A1 (en) | 1995-10-06 | 1997-04-17 | Plant Genetic Systems, N.V. | Seed shattering |
| EP0789510A1 (en) | 1994-11-04 | 1997-08-20 | Daratech Pty. Ltd. | Wettable powder formulations |
| WO1999022003A1 (en) | 1997-10-24 | 1999-05-06 | E.I. Du Pont De Nemours And Company | Binary viral expression system in plants |
| WO2002068664A1 (en) | 2001-02-27 | 2002-09-06 | Icon Genetics Ag | Recombinant viral switches for the control of gene expression in plants |
| WO2002088369A1 (en) | 2001-04-30 | 2002-11-07 | Icon Genetics Ag | Processes and vectors for amplification or expression of nucleic acid sequences of interest in plants |
| WO2002087324A1 (fr) | 2001-04-24 | 2002-11-07 | Kumiai Chemical Industry Co., Ltd. | Compositions granulaires et leur procede de production |
| WO2002097080A2 (en) | 2002-04-30 | 2002-12-05 | Icon Genetics Ag | Amplification vectors based on trans-splicing |
| WO2002101006A2 (en) | 2001-06-08 | 2002-12-19 | Icon Genetics, Inc. | Production of proteins in plants |
| EP1488697A1 (en) | 2002-03-27 | 2004-12-22 | Kumiai Chemical Industry Co., Ltd. | Granulated wettable powder |
| WO2005033318A2 (en) | 2003-09-29 | 2005-04-14 | Monsanto Technology Llc | Methods for enhancing stress tolerance in plants and methods thereof |
| WO2005049839A2 (en) | 2003-11-10 | 2005-06-02 | Icon Genetics Ag | Rna virus-derived plant expression system |
| WO2005071090A1 (en) | 2004-01-23 | 2005-08-04 | Icon Genetics Ag | Two-component rna virus-derived plant expression system |
| WO2006003018A2 (en) | 2004-07-07 | 2006-01-12 | Icon Genetics Ag | Biologically safe transient protein expression in plants |
| WO2006012906A1 (en) | 2003-11-10 | 2006-02-09 | Icon Genetics Ag | Rna virus-derived plant expression system |
| EP1810569A2 (de) | 2006-01-20 | 2007-07-25 | Degussa GmbH | Pflanzenschutzmittelabsorbate und Erzeugnisse für den Pflanzenschutz |
| WO2007137788A1 (en) | 2006-05-29 | 2007-12-06 | Icon Genetics Gmbh | Plant virus-based inducible expression system |
| WO2008028661A2 (en) | 2006-09-06 | 2008-03-13 | Icon Genetics Gmbh | Potexvirus- derived replicon |
| EP1908348A1 (en) | 2005-06-15 | 2008-04-09 | Nissan Chemical Industries, Ltd. | Agricultural-chemical granulated wettable powder and process for producing the same |
| WO2008043268A1 (en) * | 2006-09-29 | 2008-04-17 | The Chinese University Of Hong Kong | Gmrd22-like genes and use thereof to protect against abiotic stress |
| WO2009095183A1 (en) | 2008-02-01 | 2009-08-06 | Bayer Innovation Gmbh | System and method for large-scale infiltration of plants |
| WO2010019838A2 (en) * | 2008-08-15 | 2010-02-18 | Monsanto Technology Llc | Stress tolerant transgenic crop plants |
| WO2012019660A1 (en) | 2010-08-07 | 2012-02-16 | Nomad Bioscience Gmbh | Process of transfecting plants |
-
2014
- 2014-05-23 CA CA2913068A patent/CA2913068C/en active Active
- 2014-05-23 US US14/892,866 patent/US20160097056A1/en not_active Abandoned
- 2014-05-23 WO PCT/EP2014/001403 patent/WO2014187571A1/en not_active Ceased
- 2014-05-23 EP EP14727372.6A patent/EP2999790B1/en active Active
- 2014-05-23 AU AU2014270707A patent/AU2014270707B2/en active Active
- 2014-05-23 JP JP2016514302A patent/JP6453315B2/ja active Active
- 2014-05-23 ES ES14727372T patent/ES2697324T3/es active Active
Patent Citations (27)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1989003887A1 (en) | 1987-10-20 | 1989-05-05 | Plant Genetic Systems N.V. | A process for the production of biologically active peptide via the expression of modified storage seed protein genes in transgenic plants |
| WO1989010396A1 (en) | 1988-04-28 | 1989-11-02 | Plant Genetic Systems N.V. | Plants with modified stamen cells |
| WO1992013956A1 (en) | 1991-02-08 | 1992-08-20 | Plant Genetic Systems, N.V. | Stamen-specific promoters from rice |
| WO1996006932A1 (en) | 1994-08-30 | 1996-03-07 | Commonwealth Scientific And Industrial Research Organisation | Plant transcription regulators from circovirus |
| EP0789510A1 (en) | 1994-11-04 | 1997-08-20 | Daratech Pty. Ltd. | Wettable powder formulations |
| WO1997013865A1 (en) | 1995-10-06 | 1997-04-17 | Plant Genetic Systems, N.V. | Seed shattering |
| WO1999022003A1 (en) | 1997-10-24 | 1999-05-06 | E.I. Du Pont De Nemours And Company | Binary viral expression system in plants |
| WO2002068664A1 (en) | 2001-02-27 | 2002-09-06 | Icon Genetics Ag | Recombinant viral switches for the control of gene expression in plants |
| WO2002087324A1 (fr) | 2001-04-24 | 2002-11-07 | Kumiai Chemical Industry Co., Ltd. | Compositions granulaires et leur procede de production |
| WO2002088369A1 (en) | 2001-04-30 | 2002-11-07 | Icon Genetics Ag | Processes and vectors for amplification or expression of nucleic acid sequences of interest in plants |
| WO2002101006A2 (en) | 2001-06-08 | 2002-12-19 | Icon Genetics, Inc. | Production of proteins in plants |
| EP1488697A1 (en) | 2002-03-27 | 2004-12-22 | Kumiai Chemical Industry Co., Ltd. | Granulated wettable powder |
| WO2002097080A2 (en) | 2002-04-30 | 2002-12-05 | Icon Genetics Ag | Amplification vectors based on trans-splicing |
| WO2005033318A2 (en) | 2003-09-29 | 2005-04-14 | Monsanto Technology Llc | Methods for enhancing stress tolerance in plants and methods thereof |
| WO2005049839A2 (en) | 2003-11-10 | 2005-06-02 | Icon Genetics Ag | Rna virus-derived plant expression system |
| WO2006012906A1 (en) | 2003-11-10 | 2006-02-09 | Icon Genetics Ag | Rna virus-derived plant expression system |
| WO2005071090A1 (en) | 2004-01-23 | 2005-08-04 | Icon Genetics Ag | Two-component rna virus-derived plant expression system |
| WO2006003018A2 (en) | 2004-07-07 | 2006-01-12 | Icon Genetics Ag | Biologically safe transient protein expression in plants |
| EP1908348A1 (en) | 2005-06-15 | 2008-04-09 | Nissan Chemical Industries, Ltd. | Agricultural-chemical granulated wettable powder and process for producing the same |
| EP1810569A2 (de) | 2006-01-20 | 2007-07-25 | Degussa GmbH | Pflanzenschutzmittelabsorbate und Erzeugnisse für den Pflanzenschutz |
| WO2007137788A1 (en) | 2006-05-29 | 2007-12-06 | Icon Genetics Gmbh | Plant virus-based inducible expression system |
| WO2008028661A2 (en) | 2006-09-06 | 2008-03-13 | Icon Genetics Gmbh | Potexvirus- derived replicon |
| EP2061890A2 (en) | 2006-09-06 | 2009-05-27 | Icon Genetics GmbH | Potexvirus- derived replicon |
| WO2008043268A1 (en) * | 2006-09-29 | 2008-04-17 | The Chinese University Of Hong Kong | Gmrd22-like genes and use thereof to protect against abiotic stress |
| WO2009095183A1 (en) | 2008-02-01 | 2009-08-06 | Bayer Innovation Gmbh | System and method for large-scale infiltration of plants |
| WO2010019838A2 (en) * | 2008-08-15 | 2010-02-18 | Monsanto Technology Llc | Stress tolerant transgenic crop plants |
| WO2012019660A1 (en) | 2010-08-07 | 2012-02-16 | Nomad Bioscience Gmbh | Process of transfecting plants |
Non-Patent Citations (40)
| Title |
|---|
| "Manual for Development and Use of FAO and WHO Specifications for Pesticides", 2002, article "handbook PESTICIDE SPECIFICATIONS" |
| AN ET AL., PLANT CELL, vol. 8, no. 1, 1996, pages 15 - 30 |
| CABELLO; CHAN, PLANT BIOTECHNOL. J., vol. 10, 2012, pages 815 - 825 |
| CASTIGLIONI ET AL., PLANT PHYSIOLOGY, vol. 147, 2008, pages 446 - 455 |
| G.A. MATTHEWS: "Pesticide Application Methods", 2000, BLACKWELL SCIENCE, pages: 52 |
| GAXIOLA ET AL., PNAS, vol. 98, no. 20, 2001, pages 11444 - 11449 |
| GIRITCH A ET AL: "Transient Expression Technologies as an Alternative to Genetically Modified Plants", INTERNET CITATION, 1 January 2011 (2011-01-01), pages 1, XP002676667, Retrieved from the Internet <URL:http://conference.icbge.org.ua/en/abstracts/30-transient-expression-technologies-as-an-alternative-to-genetically-modified-plants> [retrieved on 20120523] * |
| HARPSTER ET AL., MOL GEN GENET, vol. 212, no. 1, 1988, pages 182 - 90 |
| HELLENS ET AL., TRENDS IN PLANT SCIENCE, vol. 5, 2000, pages 446 - 451 |
| HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. U. S. A., vol. 89, 1992, pages 10915 |
| HONGMEI WANG ET AL: "Expression of an apoplast-localized BURP-domain protein from soybean (GmRD22) enhances tolerance towards abiotic stress", PLANT, CELL & ENVIRONMENT, vol. 35, no. 11, 22 November 2012 (2012-11-22), pages 1932 - 1947, XP055135104, ISSN: 0140-7791, DOI: 10.1111/j.1365-3040.2012.02526.x * |
| HU ET AL., PNAS, vol. 103, 2006, pages 12987 - 12992 |
| HUDSPETH ET AL., PLANT MOL BIOL., vol. 12, 1989, pages 579 - 589 |
| HUNGER ET AL., J. BACTERIOL., vol. 188, 2006, pages 240 - 248 |
| IDSO, AGRICULTURAL METEOROLOGY, vol. 27, 1982, pages 59 - 70 |
| IRMAK ET AL., AGRONOMY JOURNAL, vol. 92, 2000, pages 1221 - 1227 |
| JONES ET AL., JOURNAL OF EXPERIMENTAL BOTANY, vol. 58, no. 2, 2007, pages 119 - 130 |
| KEIL ET AL., EMBO J., vol. 8, no. 5, 1989, pages 1323 - 1330 |
| KELLER ET AL., EMBO J., vol. 7, no. 12, 1988, pages 3625 - 3633 |
| KELLER ET AL., GENES DEV., vol. 3, 1989, pages 1639 - 1646 |
| MINGGUI YANG ET AL: "Overexpression of the Brassica napus BnLAS gene in Arabidopsis affects plant development and increases drought tolerance", PLANT CELL REPORTS, vol. 30, no. 3, 1 March 2011 (2011-03-01), pages 373 - 388, XP055135103, ISSN: 0721-7714, DOI: 10.1007/s00299-010-0940-7 * |
| NELSON ET AL., PNAS, vol. 104, 2007, pages 16450 - 16455 |
| OH ET AL., PLANTA, vol. 224, 2006, pages 133 - 144 |
| ORI ET AL., THE PLANT CELL, vol. 11, 1999, pages 1073 - 1080 |
| PARK ET AL., PNAS, vol. 102, 2005, pages 18830 - 18835 |
| PELEMAN ET AL., GENE, vol. 84, 1989, pages 359 - 369 |
| RIVERO ET AL., PLANT CELL PHYSIOL., vol. 51, 2010, pages 1929 - 1941 |
| SHIMADA ET AL., JOURNAL OF ARID LAND STUDIES, vol. 22-1, 2012, pages 251 - 254 |
| SLATER; SCOTT; FOWLER: "Plant Biotechnology", 2008, OXFORD UNIVERSITY PRESS |
| WANG ET AL., MOL BIOL REP, 2012 |
| WANG ET AL., MOL. BIOL. REP, vol. 39, 2012, pages 4553 - 4564 |
| WANG ET AL., PLANT CELL ENVIRON, vol. 35, 2012, pages 1932 - 1947 |
| XIAO-YUN JIA1 ET AL: "Molecular cloning and characterization of wheat calreticulin (CRT) gene involved in drought-stressed responses", JOURNAL OF EXPERIMENTAL BOTANY, OXFORD UNIVERSITY PRESS, GB, vol. 59, no. 4, 1 January 2008 (2008-01-01), pages 739 - 751, XP007922149, ISSN: 0022-0957, DOI: 10.1093/JXB/ERM369 * |
| YAMAMOTO ET AL., J. EXP BOTANY, vol. 56, 2005, pages 1785 - 1796 |
| YANG ET AL., PLANT CELL REP, vol. 30, no. 3, 2011, pages 373 - 88 |
| YANG SHUJUN ET AL: "Narrowing Down the Targets: Towards Successful Genetic Engineering of Drought-Tolerant Crops", MOLECULAR PLANT, OXFORD UNIVERSITY PRESS, GB, vol. 3, no. 3, 1 May 2010 (2010-05-01), pages 469 - 490, XP009147655, ISSN: 1674-2052, DOI: 10.1093/MP/SSQ016 * |
| YOU ET AL., J. EXPERIMANTAL BOTANY, 2013 |
| ZHANG ET AL., J. EXP. BOT., vol. 62, 2011, pages 4229 - 4238 |
| ZHANG ET AL., PLANT SIGNALING & BEHAVIOR, vol. 6, no. 6, 2011, pages 861 - 863 |
| ZVI PELEG ET AL: "Hormone balance and abiotic stress tolerance in crop plants", CURRENT OPINION IN PLANT BIOLOGY, vol. 14, no. 3, 4 March 2011 (2011-03-04), pages 290 - 295, XP028223979, ISSN: 1369-5266, [retrieved on 20110217], DOI: 10.1016/J.PBI.2011.02.001 * |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3097783A1 (en) | 2015-05-26 | 2016-11-30 | Nomad Bioscience GmbH | Colicin m for the control of ehec |
| EP3178313A1 (en) | 2015-12-09 | 2017-06-14 | Leibniz-Institut für Pflanzenbiochemie | Gene and protein for the synthesis of oxidized zingiberene derivatives |
| EP3372091A1 (en) | 2017-03-07 | 2018-09-12 | Nomad Bioscience GmbH | Method of reducing contamination of an object with clostridium |
| WO2018162570A1 (en) | 2017-03-07 | 2018-09-13 | Nomad Bioscience Gmbh | Method for reducing contamination of an object with clostridium |
| WO2021053242A2 (en) | 2017-03-24 | 2021-03-25 | Nomad Bioscience Gmbh | Bacteriocins for control of salmonella enterica |
| EP3378485A1 (en) | 2017-03-24 | 2018-09-26 | Nomad Bioscience GmbH | Bacteriocins for control of salmonella enterica |
| WO2018172065A1 (en) | 2017-03-24 | 2018-09-27 | Nomad Bioscience Gmbh | Bacteriocins for control of salmonella enterica |
| WO2019122146A1 (en) * | 2017-12-21 | 2019-06-27 | Instituto Nacional De Investigación Agropecuaria | Methods for improving plant abiotic stress tolerance and yield |
| WO2019158653A1 (en) | 2018-02-15 | 2019-08-22 | Icon Genetics Gmbh | Immunogenic composition and vaccine for generating an immune response to norovirus |
| WO2020128968A1 (en) * | 2018-12-20 | 2020-06-25 | Benson Hill, Inc. | Pre-conditioning treatments to improve plant transformation |
| WO2020182860A1 (en) | 2019-03-12 | 2020-09-17 | Icon Genetics Gmbh | Norovirus-like particles with improved stability |
| WO2020245376A1 (en) | 2019-06-06 | 2020-12-10 | Nomad Bioscience Gmbh | Klebicins for the control of klebsiella |
| WO2022012926A1 (en) | 2020-07-16 | 2022-01-20 | Nomad Bioscience Gmbh | Products for oral consumption with reduced sugar content |
| EP4248987A1 (en) | 2022-03-21 | 2023-09-27 | Nomad Bioscience GmbH | Chimeric bacteriocins and method for the control of pseudomonas |
| WO2023180197A1 (en) | 2022-03-21 | 2023-09-28 | Nomad Bioscience Gmbh | Chimeric bacteriocins and method for the control of pseudomonas |
| EP4692365A1 (en) | 2024-08-08 | 2026-02-11 | Leibniz-Institut für Pflanzenbiochemie (IPB) Stiftung des öffentlichen Rechts | Genes, proteins, and processes for the synthesis of blue anthocyanins in eukaryotic cells |
| WO2026033022A1 (en) | 2024-08-08 | 2026-02-12 | Leibniz-Institut für Pflanzenbiochemie (IPB) Stiftung des öffentlichen Rechts | Genes, proteins, and processes for the synthesis of blue and red anthocyanins |
Also Published As
| Publication number | Publication date |
|---|---|
| US20160097056A1 (en) | 2016-04-07 |
| JP2016522686A (ja) | 2016-08-04 |
| AU2014270707B2 (en) | 2019-12-12 |
| AU2014270707A1 (en) | 2015-12-24 |
| ES2697324T3 (es) | 2019-01-23 |
| EP2999790A1 (en) | 2016-03-30 |
| CA2913068C (en) | 2023-01-10 |
| JP6453315B2 (ja) | 2019-01-16 |
| CA2913068A1 (en) | 2014-11-27 |
| EP2999790B1 (en) | 2018-10-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2014270707B2 (en) | Process of providing plants with abiotic stress resistance | |
| Goel et al. | Transformation of tomato with a bacterial codA gene enhances tolerance to salt and water stresses | |
| Shah et al. | Piercing and incubation method of in planta transformation producing stable transgenic plants by overexpressing DREB1A gene in tomato (Solanum lycopersicum Mill.) | |
| Kathuria et al. | Advances in transgenic rice biotechnology | |
| EP2390336A2 (en) | Transgenic plants with increased stress tolerance and yield | |
| Tang et al. | Overexpression of a peanut NAC gene, AhNAC4, confers enhanced drought tolerance in tobacco | |
| CN103068992A (zh) | 具有增强的产量相关性状的植物和用于制备该植物的方法 | |
| CN103929947A (zh) | 具有增强的产量相关性状的植物和用于产生该植物的方法 | |
| Jia et al. | Overexpression of the Arabidopsis DREB1A gene enhances potato drought-resistance | |
| CN102584965B (zh) | 苔藓植物耐逆蛋白PpLEA3-20及其编码基因与应用 | |
| Dubrovna et al. | Water deficiency tolerance of genetically modified common wheat cv. Zymoyarka, containing a heterologous ornithine-δ-aminotransferase gene | |
| CN101809155A (zh) | 具有增加的胁迫耐受性和产量的转基因植物 | |
| CN104164440B (zh) | 植物胁迫反应性myc类转录因子及其编码基因和应用 | |
| CN104349665A (zh) | 具有高种子生产力的环境应激抗性植物及生成该植物的方法 | |
| CN113666993B (zh) | 紫花苜蓿MsSPL12蛋白及其相关生物材料与它们在提高植物抗逆性中的应用 | |
| CN104178497B (zh) | 源于棉花的myc类转录因子、其编码基因及在调控植物胁迫抗性中的应用 | |
| US8889949B2 (en) | Method for increasing resistance of monocot plants against abiotic stresses, TPSP fusion enzyme gene constructs, and transformants | |
| CN103320448B (zh) | 一种岷江百合bZIP转录因子基因LrbZIP1及应用 | |
| US20140223604A1 (en) | Crop plants with improved water use efficiency and grain yield and methods of making them | |
| CN105175522B (zh) | 百脉根ap2/erf转录因子及其编码基因和应用 | |
| CN116655761B (zh) | 枳转录因子PtrTGA2及其在植物抗寒遗传改良中的应用 | |
| KR101341932B1 (ko) | 동해 및 가뭄 저항성 고추 전사인자 CaWRKY1 유전자 및 이의 용도 | |
| CN102971427A (zh) | 具有增强的产量相关性状的植物和用于产生该植物的方法 | |
| Assem et al. | Genetic transformation of the Nicotiana protein kinase (NPK1) gene confers osmotic tolerance in Egyptian maize | |
| JP2006505279A (ja) | Tps植物遺伝子構築体及び形質転換体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14727372 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 2913068 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14892866 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016514302 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014727372 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2014270707 Country of ref document: AU Date of ref document: 20140523 Kind code of ref document: A |