WO2014174054A1 - Novel vaccines against apicomplexan pathogens - Google Patents
Novel vaccines against apicomplexan pathogens Download PDFInfo
- Publication number
- WO2014174054A1 WO2014174054A1 PCT/EP2014/058409 EP2014058409W WO2014174054A1 WO 2014174054 A1 WO2014174054 A1 WO 2014174054A1 EP 2014058409 W EP2014058409 W EP 2014058409W WO 2014174054 A1 WO2014174054 A1 WO 2014174054A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- fusion protein
- recombinant fusion
- seq
- recombinant
- parasite
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/44—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from protozoa
- C07K14/445—Plasmodium
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/002—Protozoa antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/002—Protozoa antigens
- A61K39/015—Hemosporidia antigens, e.g. Plasmodium antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/02—Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
- A61P33/06—Antimalarials
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the technology provided herein generally relates to novel fusion proteins suitable as human and/or animal vaccines against parasites or pathogens of the phylum Apicomplexa.
- the present disclosure relates to novel fusion proteins as a basis for vaccines against Plasmodium parasites, including P. falciparum, P. vivax, P. malariae, P. ovale and P. knowlesi.
- the Apicomplexa are an eukaryotic protozoan phylum of around 5000 species including parasites which belong to the most successful and devastating pathogens today, infecting a wide range of animals from mollusks to mammals. Many species of Apicomplexa cause diseases of medical and veterinary importance and represent a significant economic burden and global healthcare challenge. Members of the phylum include:
- Plasmodium the etiological agent of malaria, afflicting 10-40% of world population and accounting for one-in-five deaths among children under the age of five in Africa
- Toxoplasma gondii the causative agent of toxoplasmosis. From one-third to half of the world's human population is estimated to carry a Toxoplasma infection. It is a major pathogen to humans with a weakened immune system, such as AIDS patients or pregnant women Cryptosporidium, a waterborne pathogen which typically does not cause serious illness in healthy people, but is a big health problem for immuno-compromised people, and - the agricultural parasites Eimeria (Infects poultry and causes annual losses in revenue totaling nearly a billion dollars), Neospora (an important pathogen in cattle and dogs), Babesia (thought to be the second most common blood parasites of mammals with a major health impact on domestic animals) and Theileria causitve agent of theileriosis a disease of cattle, sheep and goats).
- Eimeria Infects poultry and causes annual losses in revenue totaling nearly a billion dollars
- Neospora an important pathogen in cattle and dogs
- Babesia thought to
- the apicomplexan life cycle is complex and can be divided into three main stages wherein the first two serve for the asexual replication of the pathogen (more precise of the invasive stages of these protists called sporozoites and merozoites) and the third stage defines the sexual reproduction of the parasite. While the general life cycle is common to the Apicomplexa phylum, there are striking differences between species.
- Figure 1 shows the apicomplexan life cycles.
- the members of Apicomplexa share a generalized life cycle, even though each species has its own specializations.
- Plasmodium spp. and Theileria spp. are transmitted and undergo sexual recombination in an insect vector, the Anopheles mosquito and Rhipicephalus tick, respectively.
- Cryptosporidium is able to autoinfect its host; the oocyst can sporulate and excyst in the same host, maintaining the infection for months to years.
- the Coccidian parasites are represented in this figure by Toxoplasma, which is able to infect the majority of warm-blooded animals.
- the differentiation of Toxoplasma tachyzoites into gametocytes is triggered only when members of the cat family (Felidae) are infected (Wasmuth et al., 2009).
- Apicomplexa require a single host (e.g. Cryptosporidium), whereas others are more complex, requiring sexual reproduction in the vector species for transmission (e.g. Theileria and Plasmodium; see Figure 2).
- Malaria is a disease caused by infection with parasites of the phylum Apicomplexa protozoan, namely parasites of the genus Plasmodium, globally causing more than 200 million new infections and 700 thousand deaths every year. Malaria is especially a serious problem in Africa, where one in every five (20%) childhood deaths is due to the effects of the disease. An African child has on average between 1.6 and 5.4 episodes of malaria fever each year.
- Malarial diseases in humans are caused by five species of the Plasmodium parasite: P. falciparum, P. vivax, P. ovale, P. malariae and P. knowlesi, wherein the most prevalent being Plasmodium falciparum and Plasmodium vivax.
- Malaria caused by Plasmodium falciparum also called malignantor malaria, falciparum malaria or malaria tropica
- Malaria caused by Plasmodium falciparum malaria is the most dangerous form of malaria, with the highest rates of complications and mortality. Almost all malarial deaths are caused by P. falciparum.
- the plasmodial life cycle in man starts with the inoculation of a few sporozoites through the bite of an Anopheles mosquito. Within minutes, sporozoites invade the hepatocyte and start their development, multiplying by schizogony. In the case of P. vivax and P. ovale, some sporozoites may differentiate into hypnozoites, responsible for late relapses of the infection. After a period of 5-14 days - depending on the plasmodial species - schizonts develop into thousands of merozoites that are freed into the bloodstream and invade the red blood cells (RBCs).
- RBCs red blood cells
- each merozoite develops into a trophozoite that matures and divides, generating a schizont that, after fully matured, gives rise to up to 32 merozoites within 42-72 h, depending on the plasmodial species.
- the merozoites, released into the bloodstream, will invade other RBC, maintaining the cycle.
- Some merozoites, after invading a RBC develop into sexual forms - the male or female gametocytes which also enter the bloodstream after maturation and erythrocyte rupture. When a female Anopheles mosquito takes its blood meal and ingests the gametocytes, it will become infected.
- the male gametocyte fuses with the female gametocyte, forming the ookinete, which binds to and passes through the gut wall, remains attached to its external face and transforms into the oocyst.
- the oocyst will divide by sporogony, giving rise to thousands of sporozoites that are released in the body cavity of the mosquito and eventually migrate to its salivary gland, where they will maturate, becoming capable of starting a new infection in humans when the mosquito bites the host for a blood meal.
- Malaria vaccines are not limited to a single mode of action and hold the potential to dramatically alleviate the burden of malaria.
- MSP1 , MSP2, AMA1 , and RESA have primarily been selected for clinical testing because of their ability to induce growth-inhibitory antibodies in pre-clinical animal models.
- MSP2 AMA1 , and RESA have in general proved poorly immunogenic in human volunteers and the induced antibodies were predominantly unable to inhibit the in vitro growth of P. falciparum.
- a pre-erythrocytic vaccine would protect against the infectious form (sporozoite) injected by a mosquito and/or inhibit parasite development in the liver.
- sporozoite infectious form
- a pre-erythrocytic vaccine would eventually enter the blood-stage, multiply within the erythrocytes and establish a full-blown disease.
- An erythrocytic or asexual blood-stage vaccine would inhibit the invasion and multiplication of the parasite in the red blood cells, thus preventing (or diminishing) severe disease symptoms during the blood infection. However, it would not prevent the transmission of the parasite.
- a sexual-stage vaccine would not protect the person being vaccinated, but instead interrupt the cycle of transmission by inhibiting the development of parasites once they are ingested by the mosquito along with antibodies produced in response to the vaccine. Transmission- blocking vaccines could be part of a multi-faceted strategy directed towards parasite elimination and reduction of overall resistance to anti pre-erythrocytic or erythrocytic treatment.
- falciparum escape mutants can be achieved by either genetically linking (full-size) antigens together, by a mixture of recombinant proteins or by synthetic-peptide-based (15-25-mer), chemically synthesized vaccines containing several peptides derived from different parasite proteins and stages.
- a poly-protein approach being comprised of several different antigens or several different alleles of a single antigen (to induce antibodies with synergistic activities against the parasite) is hindered by antigenic diversity and the capacity of P. falciparum for immune evasion (Richards, Beeson, 2009).
- a large number of antigens have been evaluated as potential vaccine candidates, but most clinical trials have not shown significant impact on preventing clinical malaria although some of them have shown to reduce parasite growth.
- the size of the resulting fusion protein/ vaccine candidate is another limiting factor allowing only the combination of a few selected antigens, not excluding that the chosen antigens are not targets of natural immunity and/or exhibit significant genetic polymorphism.
- SPf66 vaccine was the pioneer multi-epitope, multi-stage peptide-based malaria vaccine. It was first formulated and tested in Colombia (Patarroyo, 1988) and later also manufactured in the USA. SPf66 consists of epitopes of merozoite surface protein 1 (MSP1 ) linked by a peptide derived from the NANP repeat sequence of the circumsporozoite protein (CSP) adjuvanted with alum, and more recently tested with QS-21 (Schwartz, 2012). Since then, a number of synthetic peptide vaccines have been produced for both murine (P. berghei and P. yoelii) and human (P. falciparum and P.
- MSP1 merozoite surface protein 1
- CSP circumsporozoite protein
- the present disclosure relates to novel fusion proteins, in particular recombinant fusion proteins suitable as human and/or animal vaccines against a parasite of the phylum Apicomplexa, in particular against Plasmodium falciparum comprising a plurality of isolated heat stable fragments derived from at least two different Apicomplexa surface proteins presented on the surface of the parasite in at least two different life cycle main stages of the parasite, wherein each fragment contains at least one folded domain.
- embodiments of the disclosure provide methods of producing and/or purifying recombinant fusion proteins according to the present disclosure comprising the steps of: a) providing a nucleic acid construct comprising a nucleic acid encoding a fusion protein according to the present disclosure, b) introducing the nucleic acid construct into a host cell, and
- embodiments of this disclosure relate to methods of preparing a biologically active, therapeutic agent substantially free of active virus, wherein a source for a given fusion protein and/or vaccine according to the present disclosure is subjected to a viral inactivation step under conditions sufficient to inactivate any virus present, in particular via a heat treatment and/or an acidic-treatment.
- embodiments of this disclosure relate to methods for purifying a recombinant fusion protein according to the present disclosure, comprising
- embodiments of this disclosure relate to methods for purifying a recombinant fusion protein according to the present disclosure, comprising
- embodiments of this disclosure relate to antibody compositions comprising isolated antibodies or fragments thereof binding to one or more recombinant fusion protein(s) according to the present disclosure.
- embodiments of this disclosure relate to compositions comprising a recombinant fusion protein according to the present disclosure and/or an amino acid sequence selected from the group consisting of SEQ ID NO.193 to SEQ ID NO.195, SEQ ID NO.202 and SEQ ID NO.205, or homologous polypeptides thereof, wherein the composition is preferably a pharmaceutical and/or diagnostic composition.
- a further aspect of the present disclosure pertains to pharmaceutical compositions comprising the recombinant fusion protein according to the present disclosure and/or an amino acid sequence selected from the group consisting of SEQ ID NO.193 to SEQ ID NO.195, SEQ ID NO.202 and SEQ ID NO.205, or homologous polypeptides thereof, and a pharmaceutically acceptable carrier.
- embodiments of this disclosure relate to pharmaceutical and/or diagnostic compositions comprising a recombinant fusion protein according to the present disclosure.
- embodiments of this disclosure relate to vaccine compositions for immunizing a susceptible mammal against malaria comprising as an active ingredient the recombinant fusion protein according to the present disclosure and a carrier in a physiologically acceptable medium.
- embodiments of this disclosure relate to vaccine compositions for immunizing a susceptible mammal against a parasite of the phylum Apicomplexa comprising as an active ingredient a recombinant fusion protein according to the present disclosure and/or an amino acid sequence selected from the group consisting of SEQ ID NO.193 to SEQ ID NO.195, SEQ ID NO.202 and SEQ ID NO.205, or homologous polypeptides thereof, and a carrier in a physiologically acceptable medium.
- embodiments of this disclosure provide nucleic acids encoding said recombinant fusion protein, as well as vectors and host cells comprising such nucleic acids.
- this disclosure relates to use of recombinant fusion protein according to the present disclosure in the prevention of malaria tropica.
- methods of immunizing humans against an Apicomplexa infection, in particular against Plasmodium falciparum, comprising administering an effective amount of a fusion protein of the present disclosure, a composition comprising the recombinant fusion protein the present disclosure or a vaccine composition according to the present disclosure are disclosed.
- the present disclosure relates to vaccine compositions suitable as human and/or animal vaccine against a parasite of the phylum Apicomplexa comprising a plurality, in particular at least four isolated heat stable fragments derived from at least two different Apicomplexa surface proteins presented on the surface of the parasite in at least two different stages in the life cycle of the parasite, wherein each fragment contains at least one folded domain.
- embodiments of this disclosure relate to methods for purifying a recombinant fusion protein according to the present disclosure from a eukaryotic expression host by means of a heat-treatment of the cell culture supernatant or extract.
- embodiments of this disclosure relate to viral inactivation of the recombinant protein product during downstream processing by heat-treatment.
- Figure 1 is a scheme of the general life cycle of different apicomplexan parasites (Wasmuth et al., 2009).
- Figure 2 is a summary of intermediate and definitive hosts for different apicomplexan parasites (Wasmuth et al., 2009).
- Figure 3 is a diagram showing a time-controlled heat-treatment of an advantageous embodiment of a heat stable fusion protein according to the present disclosure.
- Figure 4 shows an exemplary sequence alignment of P. falciparum EGF9_Ripr (SEQ ID NO.16) and its orthologs in different apicomplexan species.
- Figure 5 is a Coomassie stained gel (A) and an Immunoblot analysis (B) showing the transient production of a multi-stage, multi-fragment malaria vaccine candidate (SEQ ID NO.198) and further fusion protein constructs according to the present disclosure based on heat stable fragments of different P. falciparum surface proteins in Nicotiana benthamiana.
- Figure 6 shows a schematic flow chart of the protein purification processes according to the present disclosure.
- Figure 7 shows the results of immunofluorescence assays of different P. falciparum stages using purified polyclonal rabbit antibodies raised against a multi-stage, multi-fragment vaccine candidate (SEQ ID NO.197) according to the present disclosure.
- Figure 8 is a schematic representation of an advantageous embodiment of a heat stable multi-stage multi-fragment fusion protein according to the present disclosure.
- Figure 9 shows the sequence of a typical EGF domain. DETAILED DESCRIPTION OF THIS DISCLOSURE
- the present disclosure pertains to therapeutically and diagnostic fusion proteins, compositions and antibodies suitable as human and/or animal vaccines against parasites of the phylum Apicomplexa, in particular against parasites of the genus Plasmodium like Plasmodium falciparum.
- the recombinant fusion proteins and compositions according to the present disclosure combine heat stable fragments from different Apicomplexa surface proteins from different stages of the parasite development, wherein each heat stable fragment comprises at least one folded domain.
- One advantage of using heat stable fragments with folded domains in place of full-length antigen proteins is to circumvent the limitation of the protein size, to allow better fusion protein heat stability and to improve the protein expression capacity.
- the heat stability of the fusion proteins enables an efficient purification step by heating up the cell culture supernatant or cell extract.
- Many host cell proteins are denatured during that step and precipitate (see Fig. 3). They can thus be easily removed by centrifugation or filtration.
- many host cell proteases are thermally inactivated, resulting in increased stability of the target recombinant fusion protein during downstream processing.
- heat stability is moreover an extremely useful property for viral inactivation steps during downstream processing in vaccine manufacturing. Such steps are mandatory for ensuring product safety, but may not always be compatible with the activity of the target protein. In such cases expensive ultra/nano-filtration procedures have to be employed, including tedious and expensive process validation. By being able to employ simple heat treatment of the product, the overall process becomes cheaper and more efficient and results in a safer product. These properties are highly important for generating a vaccine that is particularly useful and applicable for developing countries.
- heat stability is an important feature during the formulation (e.g. lyophilisation) of the product and the storage.
- vaccines destined for developing countries in sub-Saharan Africa generally cannot rely on a cold chain, thus rendering many potentially promising vaccines completely useless.
- the heat stability of the fusion proteins according to this disclosure also results in longer shelf-life of the vaccine, thereby further reducing total costs for health systems.
- the inventors found that also the immune responses directed against such heat stable fragments with a folded domain are more robust, especially resulting in balanced immune responses against all represented components. Immuno-dominant and immuno- silent regions have not been found, even for candidates comprising a high number of different domains.
- the selection of these heat stable fragments enables different (virtually all) combinations, i.e. the domains can generally be combined freely, resulting in recombinant fusion proteins comprising the same components but in a different order (e.g. A-B-C vs. B-C-A).
- a recombinant fusion protein comprising several (in particular > 4) heat stable fragments from different Apicomplexa surface proteins from the same but preferably from different life-cycle stages and can be efficiently produced.
- the recombinant fusion proteins according to the present disclosure comprise at least four, in particular at least six heat stable fragments.
- the heat stable building blocks comprise folded protein domains that are fundamentally different from isolated small linear epitopes. Such linear epitopes are highly efficient for T-cell responses but are generally not suited as immunogens for inducing neutralizing antibodies.
- apicomplexan parasites and in particular parasites of the genus Plasmodium have many proteins containing repetitive linear sequences, and their role is to divert the humoral immune response. It is therefore another particular aspect that the fusion proteins according to this disclosure do not comprise only these repetitive linear peptide epitopes.
- the fusion proteins according to the present disclosure (i) comprise domains derived from different Apicomplexa surface proteins and (ii) were designed using building blocks (domains) that have been experimentally identified and verified as heat stable (temperature tolerant).
- the recombinant fusion proteins of the present disclosure can be well expressed in different expression systems, are heat stable, have a high immunological relevance and have an improved immunogenicity.
- the recombinant fusion proteins of the present disclosure used as vaccines have the ability to elicit protective immunity that blocks infection as well as prevents pathology and interrupts transmission of parasites, and would most likely be a combination vaccine composed of subunits from different parasite stages.
- the isolated heat stable fragments have the advantage that they are small protein fragments with a conserved stable protein fold (like the Epidermal growth factor-like domain (EGF) and the Thrombospondin type 1 repeats (TSR) domain) in contrast e.g. to specifically selected Plasmodium linear T/B-cell epitopes used in the prior art.
- EGF Epidermal growth factor-like domain
- TSR Thrombospondin type 1 repeats
- epitopes or antigenic determinants Parts/Fragments of an antigen that are recognized by the immune system, more specifically by antibodies, B cells, or T cells are defined as epitopes or antigenic determinants.
- Such protein structures that are composed of amino acids that have been brought together in three-dimensional structure (e.g. in a folded domain) are known as conformational epitopes.
- a single peptide chain lacking secondary structure is termed a linear epitope.
- B cell epitopes are conformational even though some antibodies bind linear peptide fragments of antigens.
- T cell epitopes are linear peptides presented on the surface of an antigen-presenting cell, where they are bound to MHC molecules.
- T cell epitopes presented by MHC class I molecules are typically peptides between 8 and 1 1 amino acids in length, whereas MHC class II molecules are at least 13 amino acids long, but can be much longer.
- the clusters of conserved residues that bind the two ends of a peptide in MHC class I molecules are not found in MHC class II molecules, and the ends of the peptides are not bound. Instead, the peptide lies in an extended conformation along the MHC class II peptide- binding pocket.
- T cell epitopes HLA-peptide binding studies
- B cell epitopes in vitro immunological studies
- recombinant fusion proteins suitable as human and/or animal vaccines against a parasite of the phylum Apicomplexa comprising a plurality of isolated heat stable fragments from at least two different Apicomplexa surface proteins, wherein each fragment contains at least one folded domain, wherein the isolated heat stable fragments are derived from Apicomplexa surface proteins presented on the surface of the parasite in at least two different stages in the life cycle of the parasite.
- the terms "recombinant fusion protein” and “fusion protein” are used herein interchangeably to refer for example to a protein produced by recombinant technology which comprises segments i.e. amino acid sequences, from heterologous sources, such as different proteins or different organisms.
- a recombinant fusion protein is encoded by a nucleotide sequence, which is obtained by genetically joining nucleotide sequences derived from different regions of one gene and/or by joining nucleotide sequences derived from two or more separate genes. These nucleotide sequences can be derived from a parasite of the phylum Apicomplexa and in particular derived from P. falciparum, but they may also be derived from other organisms, the plasmids used for the cloning procedures or from other nucleotide sequences.
- the encoding nucleotide sequences may be synthesized in vitro without the need for initial template DNA samples e.g. by oligonucleotide synthesis from digital genetic sequences and subsequent annealing of the resultant fragments.
- Desired protein sequences can be "reverse translated” e.g. using appropriate software tools. Due to the degeneracy of the universal genetic code, synonymous codons within the open-reading frame (i.e. the recombinant protein coding region) can be exchanged in different ways, e.g. to remove cis- acting instability elements (e.g. AUUUA), to remove, introduce or modify the secondary and tertiary mRNA structures (e.g.
- a recombinant fusion protein comprising a heat stable fragment from a Apicomplexa surface protein, in particular from a Plasmodium surface protein can be a recombinant product prepared using recombinant DNA methodology and expression in a suitable host cell, as is known in the art (see for example Sambrook et al., (2001 ) Molecular Cloning, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N. Y). Nucleotide sequences encoding specific isolated protein domain may be conveniently prepared, for example by polymerase chain reaction using appropriate oligonucleotide primers corresponding to the 5' and 3' regions of the domain required for isolation, and a full length coding of the isolated protein domain sequence as template.
- the source of the full length coding protein sequence may be for example, DNA extracted from parasite cells or a plasmid vector containing a cloned full- length gene.
- the protein coding sequence may partially or completely be synthesized in vitro or a combination of different approaches may be used.
- Non-limiting examples of properties of the fusion proteins according to the present disclosure are heat stability and pH stability. Especially the thermal performance of the fusion proteins in combination with the improved immunogenicity via using heat stable fragments comprising a folded domain is considered an important characteristic of the fusion proteins according to the present disclosure.
- the heat stability for example may be determined as described in Example 4.
- the Apicomplexa (also referred to as Apicomplexia) are a large group of protists, most of which possess a unique organelle called apicoplast and an apical complex structure involved in penetrating a host's cell. They are a diverse group including organisms such as coccidia, gregarines, piroplasms, haemogregarines, and Plasmodia (Plasmodium falciparum, Plasmodium vivax, Plasmodium ovale, Plasmodium malariae, Plasmodium knowlesi).
- apicomplexan organisms include, but are not limited to Babesiosis (Babesia), Malaria (Plasmodium), Coccidian diseases including Cryptosporidiosis (Cryptosporidium parvum), Cyclosporiasis (Cyclospora cayetanensis), Isosporiasis (Isospora belli) and Toxoplasmosis (Toxoplasma gondii).
- the recombinant fusion proteins as well as the compositions according to the present disclosure are suitable as human and/or animal vaccines against a parasite of the genus Plasmodium including Plasmodium falciparum, Plasmodium vivax, Plasmodium malariae and/or Plasmodium ovale.
- the parasite is Plasmodium falciparum.
- Apicomplexa surface proteins are preferably membrane-bound or associated proteins or proteins known to be secreted. These proteins can e.g. be identified by analyzing the Genome or known genes for the presence of an N-terminal Signal peptid, the presence of a PEXEL motif, the presence of a GPI anchor motif, or the presence of one or more transmembrane domains using generally available software tools. These proteins and their homologues e.g. include but are not limited to: - CelTOS (cell traversal protein for ookinetes and sporozoites), Antigen 2 (PfAg2,
- EBA175 (Erythrocyte binding antigen 175)
- EXP1 (Exported Protein 1 ); synonyms: CRA1 (Circumsporozoite-Related Antigen-1 / Cross-Reactive Antigen-1 ), AG 5.1 (Exported antigen 5.1 ), QF1 19
- MSP1 Malozoite surface protein 1
- MSA1 Malozoite surface antigen 1
- PMMSA Proliferative protein 1
- p190 Proliferative protein 1
- p195 Proliferative protein 1
- gp190 Proliferative protein 1
- gp195 Proliferative protein 1
- MSP3 Malozoite surface protein 3
- SPAM secreted polymorphic antigen associated with the merozoite
- MTRAP merozoite TRAP homologue, merozoite TRAP homolog, merozoite TRAP- like protein
- Rh2b Reticulocyte binding protein 2 homolog b, Reticulocyte binding protein 2 homologue b
- Rh4 Reticulocyte binding protein homolog 4, Reticulocyte binding protein homologue 4
- Rh5 Reticulocyte binding protein homolog 5
- Pfs25 25 kDa ookinete surface antigen, Sexual stage antigen pfs25 .
- TRAMP thrombospondin-related apical membrane protein
- PTRAMP - TRAP Thrombospondin-related anonymous protein
- SSP2 Sporozoite
- Heat stable fragments in the recombinant fusion protein or in the vaccine compositions according to the present disclosure may be from the same Apicomplexa surface protein, in particular from the same Plasmodium surface protein or preferably from different Apicomplexa surface proteins.
- the fusion proteins or the vaccine compositions according to the present disclosure comprise a plurality of isolated heat stable fragments from at least two different Apicomplexa surface proteins, wherein each fragment contains at least one folded domain.
- the fusion proteins or the compositions according to the present disclosure comprise more than one, in particular at least three, more particular at least four isolated heat stable fragments from different Apicomplexa surface proteins.
- the recombinant fusion proteins comprise at least four different isolated heat stable fragments.
- the Apicomplexa surface proteins are presented on the surface of the parasite in at least two different stages in the life cycle of the parasite.
- the fusion proteins or the vaccine compositions according to the present disclosure comprise at least four different isolated heat stable fragments from at least two different Apicomplexa surface proteins presented on the surface of the parasite in at least two different stages in the life cycle of the parasite.
- a vaccine candidate covers at least two different antigen fragments per life stage.
- more than one parasite life stage should be targeted. This would equal four antigen fragments and two life stages per minimal vaccine.
- the number of covered antigens and life stages may be less for one vaccine if it is used as a composition with a complementary vaccine so that the sum of both vaccines equals at least four antigen fragments and two life stages.
- the present disclosure is also directed to vaccine compositions suitable as human and/or animal vaccine against a parasite of the phylum Apicomplexa comprising a plurality, in particular at least four isolated heat stable fragments derived from at least two different Apicomplexa surface proteins presented on the surface of the parasite in at least two different stages in the life cycle of the parasite, wherein each fragment contains at least one folded domain.
- the isolated heat stable fragments in the vaccine compositions according to the present disclosure are comprised in at least two different recombinant fusion proteins, wherein in an advantageous embodiment one recombinant fusion protein comprises two or more heat stable fragments derived from at least one Apicomplexa surface protein presented on the surface of the parasite in a single stage of the life cycle of the parasite and wherein the other recombinant fusion protein comprises two or more heat stable fragments derived from at least one Apicomplexa surface protein presented on the surface of the parasite in a different stage of the life cycle.
- the vaccine compositions according to the present disclosure may comprise different fusion proteins having heat stable fragments derived from different Apicomplexa surface proteins for directing the parasite in more than one stages of the life cycle of the parasite.
- one or more heat stable fragments derived from at least one Apicomplexa surface protein presented on the surface of the parasite in at least one stage of the life cycle of the parasite are repeated several times within the fusion proteins according to the present disclosure.
- the repeated fragments may be 100% identical, e.g. to increase the valence, or the repeated fragments may represent the same region of the full-length surface protein but actually comprise sequences derived from different strains, different species or different genera.
- fragment refers to a continuous part of a natural full-length protein, with or without mutations, which is separate from and not in the context of a full length Apicomplexa surface protein. It may be a structural/topographical or functional subunit of a full length or complete protein.
- fragments expressly excludes polypeptides corresponding to full-length amino acid sequences of an Apicomplexa surface protein but also excludes short peptides from Apicomplexa surface proteins, not folding into domains. For example, in some embodiments of the present disclosure fragments having an amino acid sequence of less than 90 % of the parent full-length surface protein are used.
- the heat stable fragments are isolated heat stable fragments.
- isolated when used in relation to a nucleic acid or protein (e. g. an protein domain), refers to a nucleic acid sequence or protein that is identified and separated from at least one contaminant (nucleic acid or protein, respectively) with which it is ordinarily associated in its natural source. Isolated nucleic acid or protein is present in a form or setting that is different from that in which it is found in nature. In contrast, non-isolated nucleic acids or proteins are found in the state they exist in nature.
- heat stable refers in particular to the ability of the protein fragments or fusion proteins to withstand a temperature treatment of at least 50°C for 5 minutes, preferably of 60°C for 5 minutes, more preferably of 65°C for 5 minutes, most preferably of 70°C for 5 minutes while retaining a binding activity of at least 60%, preferably 70%, more preferably 80% and most preferably 90% to at least one antibody recognizing a conformational epitope and having a recovery rate of at least 70%.
- the protein fragments or fusion proteins according to the present disclosure are able to withstand a temperature treatment of at least 80°C for 5 minutes while retaining a binding activity of at least 60%, preferably 70%, more preferably 80% and most preferably 90% to at least one antibody recognizing a conformational epitope and having a recovery rate of at least 60 %.
- the protein fragments or fusion proteins according to the present disclosure are able to withstand a temperature treatment of at least 90°C for 5 minutes while retaining a binding activity of at least 60%, preferably 70%, more preferably 80% and most preferably 90% to at least one antibody recognizing a conformational epitope and having a recovery rate of at least 50 %.
- Such heat stable protein fragments or fusion proteins have a wide range of applications, as they are more robust than other proteins.
- the heat precipitation is exemplary described in point 4 of the Methods and Examples part in the present description.
- Figure 3 illustrates a time-controlled heat-treatment according to the present disclosure.
- pH stable refers in particular to the ability of the protein fragments or fusion proteins to withstand incubation for at least 5 minutes at low and/or high pH, at least below a pH of 5 and/or above a pH of 8, preferably below a pH of 4 and/or above a pH of 9 and more preferably below a pH of 3 and/or above a pH of 10, where at least 50%, preferably at least 60%, more preferably at least 70% and most preferably at least 80% of the protein fragments or fusion proteins remain in solution and where a binding activity of at least 60%, preferably 70%, more preferably 80% and most preferably 90% to at least one antibody recognizing a conformational epitope is retained.
- the underlying pH stability is exemplary described for the immunoaffinity chromatography (IAC) in point 9 of the Methods and Examples part in the present description.
- formational epitope refers to an epitope of the protein fragments or fusion proteins that is characterized by a loss of the binding activity to a corresponding antibody or a reduction of the binding activity of at least 50%, preferably 70% and more preferably 90% to a corresponding antibody after reduction of disulfide bridges or by treating the protein fragment or fusion protein with reagents known to denature proteins, e.g. 8 M urea, 6 M guanidinium chloride or 1 % SDS.
- binding activity refers to an assay, where the protein fragments or fusion proteins are incubated with an antibody or another ligand (e.g. native interacting protein) recognizing a conformational epitope or binding region and where a quantitative readout is generated.
- the generated readout is proportional to the amount of protein fragments or fusion proteins that have bound to the antibody or other ligand or vice versa.
- Suitable methods include but are not limited to immune-assays such as ELISA, RIA, surface plasmon resonance spectroscopy based assays, electrophoretic mobility shift assays, size- exclusion chromatography based shift assays, spectroscopic techniques such as fluorescence polarization, light scattering, fluorescence resonance energy transfer (FRET) and affinity chromatography.
- immune-assays such as ELISA, RIA, surface plasmon resonance spectroscopy based assays, electrophoretic mobility shift assays, size- exclusion chromatography based shift assays, spectroscopic techniques such as fluorescence polarization, light scattering, fluorescence resonance energy transfer (FRET) and affinity chromatography.
- FRET fluorescence resonance energy transfer
- the different heat stable fragments are linked to each other.
- Linked refers to non-covalent or covalent bonding between two or more molecules. Linking may be direct or indirect. Two molecules are indirectly linked when the two molecules are linked via a connecting molecule (linker). Two molecules are directly linked when there is no intervening molecule linking them. As mentioned above, the isolated protein domains are linked either directly or indirectly to each other, preferably via peptide bonds or disulfide bonds.
- An example of indirect covalent linking is that an intervening amino acid sequence, such as a peptide linker is juxtaposed between segments forming the fusion protein.
- the heat stable fragments are directly linked to each other. In other embodiments, the heat stable fragments are indirectly linked to each other via a linker, wherein in some examples the linker is a polypeptide with a size of less or equal twenty amino acids, in particular 2 to 6 amino acids.
- each heat stable fragment contains at least one folded domain.
- folded domain refers to a protein sequence that is known or predicted to adapt a structurally distinct three dimensional structure of known structural class, fold or superfamily comprising at least one conformational epitope. Therefore, a folded domain is part of a structural/topographical or functional subunit of a full length or complete protein. It may be kept within the context of the full length or complete protein, or may be separated therefrom, as in an isolated domain. Domains corresponding to structural/ topographical subunits include for example, a cytoplasmic domain, an extracellular domain or a transmembrane domain.
- Domains corresponding to functional subunits include for example, a receptor binding domain or in particular an antibody binding domain.
- the folded domains according to this invention exhibit a higher structural order.
- the folded domains according to this invention are characterized by the existence of at least one peptide, protein or monoclonal antibody that binds to a conformational epitope within the folded domain under physiological conditions (e.g. PBS pH 7.4).
- the folded domain is an "EGF-like domain" which is an EGF-like motif that may be found in a variety of proteins, as well as EGF and Notch and Notch ligands, including those involved in the blood clotting cascade (Furie and Furie, 1988, Cell 53: 505-518).
- this motif has been found in extracellular proteins such as the blood clotting factors IX and X (Rees et al., 1988, EMBO J. 7:2053-2061 ; Furie and Furie, 1988, Cell 53: 505-518), in other Drosophila genes (Knust et al., 1987 EMBO J. 761-766; Rothberg et al., 1988, Cell 55:1047-1059 ), and in some cell-surface receptor proteins, such as thrombomodulin (Suzuki et al., 1987, EMBO J. 6:1891-1897) and LDL receptor (Sudhof et al., 1985, Science 228:815-822 ).
- a protein binding site has been mapped to the EGF repeat domain in thrombomodulin and urokinase (Kurosawa et al., 1988, J. Biol. Chem 263:5993- 5996; Appella et al., 1987, J. Biol. Chem. 262:4437-4440 ).
- EGF domain may include six cysteine residues which have been shown (in EGF) to be involved in disulfide bonds.
- the main structure is proposed, but not necessarily required, to be a two-stranded beta-sheet followed by a loop to a C- terminal short two-stranded sheet.
- Subdomains between the conserved cysteines strongly vary in length as shown in Figure 9, wherein "C” represents conserved cysteine involved in a disulfide bond, "G” represents often-conserved glycine, "a” represents often conserved aromatic amino acid and "x" represents any residue.
- the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is normally present in most EGF-like domains and force the assembly of several well-defined discontinuous epitopes (Farley and Long, 1995, Exp. Parasitol. 80, 328-332; McBride and Heidrich, 1987, supra; Uthaipibull et al, 2001 , J. Mol. Biol. 307,1381 1394).
- the EGF-like domain used in the recombinant fusion proteins or compositions according to the present disclosure may be derived from any suitable Apicomplexa surface protein, expressed in any life cycle stage, including for example the pre-erythrocytic stage, the blood stage and the sexual stage.
- the surface proteins may occur on the different forms of the apicomplexan parasite, in particular of Plasmodium falciparum.
- the EGF-like domains are derived from Plasmodium vivax and/or Plasmodium falciparum.
- the term "EGF-like domain" as used herein includes sequence variants, fragments, derivatives and mimetics having activity corresponding to naturally occurring domains.
- TSR domain is a small about 60-residue domain found in extracellular proteins or in the extracellular part of transmembrane proteins that are involved in immunity, cell adhesion, cell-cell-interactions and neuronal development (Tucker, 2004). Structures of TSR domains from thrombospondin-1 (TSP-1 ; Tan et al. 2002) and F-spondin (PDB codes 1 SZL and 1VEX) have been solved. These show that a TSR domain has an elongated structure consisting of an antiparallel three-stranded ⁇ -sheet. The domain core is formed by a stacked array of side chains of conserved tryptophans, arginines, and cysteines.
- TSRs of several proteins have been reported to mediate glycosaminoglycan (GAG) binding.
- GAG glycosaminoglycan
- Plasmodium surface proteins Plasmodium CS and TRAP both contain an adhesive thrombospondin type 1 domain, TSR.
- the recombinant fusion proteins and the vaccine compositions according to the present disclosure comprise at least two folded domains from at least two different Apicomplexa surface proteins, wherein the first folded protein domain is an isolated EGF-like domain and the second domain is an isolated EGF-like domain or an isolated TSR domain.
- the heat stable isolated fragments in the recombinant fusion proteins or vaccine compositions may comprise one or more further folded domains.
- the heat stable isolated fragments may comprise 2 to 12 different folded protein domains, in particular 4 to 10, in particular 6 to 8 different folded domains, wherein at least one folded domain is an EGF-like domain.
- the recombinant fusion protein according to the present disclosure has a cysteine content of at least 5%, in particular of at least 7.5%, more particular of at least 10%. It is one further advantage of the present invention that also non-heat stable isolated fragments which are for example highly immunogenic can be embedded into a fusion protein having a plurality of isolated heat stable fragments, wherein the entire fusion protein is still heat stable. Therefore, in some embodiments, recombinant fusion proteins according to the present disclosure may comprise at least one non-heat stable isolated fragment derived from an Apicomplexa surface protein, wherein the entire fusion protein is heat stable.
- the folded domains of the fragments in the fusion proteins and the vaccines according to the present disclosure comprise at least one conformational epitope.
- epitope refers to a region of a protein molecule to which an antibody can bind.
- an “epitope” may be defined as an array of 3-20 amino acids aligned along the surface of a protein.
- the amino acids are joined sequentially and follow the primary structure of the protein.
- a “conformational epitope” the amino acids are arranged in a specific three-dimensional structure in a context-dependent manner (e.g. a folded domain). With respect to conformational epitopes, the length of the epitope-defining sequence can be subject to wide variations.
- the portions of the primary structure of the antigen between the residues defining the epitope may not be critical to the structure of the conformational epitope. For example, deletion or substitution of these intervening sequences may not necessarily affect the conformational epitope provided sequences critical to epitope conformation are maintained (e.g. cysteines involved in disulfide bonding, glycosylation sites, etc.).
- a conformational epitope may also be formed by association of 2 or more subunits into homo-or hetero-oligomers.
- a conformational epitope may be a folded domain or an accessible part thereof that is recognized by the immune system and capable of eliciting an immune response.
- the fusion protein of the present disclosure has a molecular weight of less or equal 160 kDa if the fusion protein comprises heat stable fragments derived from a plurality of Apicomplexa surface proteins presented on the surface of the parasite in all stages of the Plasmodium life cycle or if the fusion protein comprises heat stable fragments derived from Apicomplexa surface proteins from selected stages of less or equal 120kDa.
- the recombinant fusion proteins and/or vaccine compositions suitable as human and/or animal vaccine against a parasite of the phylum Apicomplexa may combine heat stable fragments from different stages of the parasite development, inducing several mechanisms of protection.
- the recombinant fusion proteins and/or vaccine compositions of the present disclosure comprises heat stable fragments for pre-erythrocytic and blood stage coverage and can be used for prophylactic and/or therapeutic vaccines.
- the recombinant fusion proteins and/or vaccine compositions of the present disclosure comprises heat stable fragments for pre-erythrocytic and blood stage coverage as well as heat stable fragments for sexual stage coverage.
- the heat stable fragments are derived from different Apicomplexa surface proteins which are expressed in the same stage of the Apicomplexa life cycle, in particular in the blood stage.
- the heat stable fragments are from different Apicomplexa surface proteins which are expressed in different stages of the Apicomplexa life cycle, in particular in the blood stage and in the pre- erythrocyte stage.
- the heat stable fragments are from different Apicomplexa surface protein antigens which are expressed in different stages of the Apicomplexa life cycle, in particular the blood stage, the sexual stage and the pre-erythrocyte stage.
- the heat stable fragments are derived from different Plasmodium falciparum surface proteins which are expressed in the same stage of the Plasmodium life cycle, in particular in the blood stage.
- the heat stable fragments are from different Plasmodium falciparum surface proteins which are expressed in different stages of the Plasmodium falciparum life cycle, in particular in the blood stage and in the pre-erythrocyte stage.
- the heat stable fragments are from different Plasmodium falciparum surface protein antigens which are expressed in different stages of the Plasmodium falciparum life cycle, in particular the blood stage, the sexual stage and the pre-erythrocyte stage.
- the isolated heat stable fragments may be from different Plasmodium surface proteins, which are expressed in the different Plasmodium life cycle main stages:
- the sporozoite remains in the bloodstream for a very short period of time before invading a hepatocyte.
- Examples for Plasmodium protein antigens expressed in the sporozoite are the circumsporozoite protein (CSP), the major constituent of the outer membrane of the sporozoite (Nussenzweig et al., 1989). Induced antibodies may be able to block the binding and the entrance of the sporozoite into the hepatocyte.
- CSP circumsporozoite protein
- Induced antibodies may be able to block the binding and the entrance of the sporozoite into the hepatocyte.
- liver-stage antigens include liver- stage antigen-1 (LSA-1 ), LSA-2, LSA-3, SALSA and STARP, among others (Hoffman et al., 1996;).
- the asexual blood main stage c) Merozoite Besides the sporozoite, the merozoite is the only stage in the human host in which the malaria parasite is extracellular. In contrast to the sporozoite, several cycles of merozoite release will occur during a malaria infection, making them often available.
- a major ligand in P. falciparum is the erythrocyte-binding antigen-175 (EBA-175), located in the microneme (Chitnis et al., 1994).
- EBA-175 erythrocyte-binding antigen-175
- MSPs merozoite surface proteins
- MSP-1 the major MSP
- MSP-1 a role has been postulated in merozoite binding to the RBC and in the subsequent biochemical mechanisms involved in invasion.
- This protein is synthesized as a precursor of 185-210 kDa in the late schizont stage and is processed to generate several polypeptides of varied molecular weights.
- a 42 kDa polypeptide (MSP1 -42) is kept attached to the merozoite membrane, and it is further processed to generate a 19 kDa polypeptide (MSP1-19), which goes into the host cell.
- MSP1-19 19 kDa polypeptide
- merozoite surface-associated antigen is the acidic-basic repeat antigen (ABRA).
- ABRA acidic-basic repeat antigen
- Proteins located in merozoite apical organelles have also been identified (e.g. the rhoptry proteins apical membrane antigen-1 (AMA-1 ), rhoptry-associated protein-1 (RAP-1 ) and RAP-2).
- AMA-1 rhoptry proteins apical membrane antigen-1
- RAP-1 rhoptry-associated protein-1
- RAP-2 rhoptry-associated protein-1
- the parasite Once it has invaded the RBC, the parasite is supposed to have found a safer place to stay.
- RSA ring erythrocyte surface antigen
- SERP serine-rich protein
- SERA serine-rich protein
- EMP-1 erythrocyte membrane protein-1
- EMP-2 erythrocyte membrane protein-1
- EMP-3 EMP-3
- PfEMP-1 which binds to the receptors such as CD36 in the endothelium, is a family of proteins encoded by the so-called var genes.
- Plasmodium protein antigens are expressed in sexually differentiated parasite stages such as Ps25, Ps28, Ps48/45 or Ps230. Antibodies against these sexual stage proteins may block the development of the parasite in mosquitoes.
- each of the heat stable fragments are from different Plasmodium surface proteins expressed in at least two different stages of the Plasmodium life cycle.
- the heat stable fragments are selected from the group consisting of heat stable fragments comprising an EGF-like domain from MSP1 , MSP4, MSP8, MSP10, PfRipr and Pfs25.
- the heat stable fragments are selected from the group consisting of heat stable fragments comprising a TSR domain is selected from CSP, mTRAP, TRAP and TRAMP. In other advantageous embodiments, the heat stable fragments are selected from the group consisting of heat stable fragments from Pfs230, Pfs45/48, CelTos and Ron2, MSP3 and EXP1. In advantageous embodiments, the heat stable fragments comprised in the recombinant fusion protein and/or vaccine compositions according to the present disclosure are selected from the group listed in Table 1.
- the heat stable fragments comprised in the recombinant fusion protein and/or vaccine compositions according to the present disclosure are selected from the group listed in Table 2.
- Table 2 shows sequences of Plasmodium falciparum antigens and their orthologs in other Apicomplexa like Toxoplasma, Theileria, Neospora, Babesia and Cryptosporidium.
- the heat stable fragments of surface proteins from one member preferably from one strain of an Apicomplexa are used in a fusion protein according to the present disclosure.
- heat stable fragments of surface proteins from different members also from different strains are used in a fusion protein according to the present disclosure useful as general vaccines.
- Aglyc/GKO aglycosylated/glycosylation site knock-out
- EGF1 of MSP10 short 1 10
- Pfs230 C0IPF3D SEVDKTDLFKFIEGGEGDDVYKVDGSKVLLDDDTI 7 0209000 SRVSKKHTARDGEYGEYGEAVEDGENVIKIIRSVL Pfs230 part CO: QSGALPSVGVDELDKIDLSYETTESGDTAVSEDSY short Pfs230 CO DKYASNN
- EBSIPVX 08891 ESSFFDLSDNTMLMRLLIKPQAAILLIIESFIMMTPS 0 PTRDAKTYCKKALVNGQLIETSDLNAATEEDDLINE
- Pfs230 part CO DFVKHITMKEASKKVVICEMKIQEPLVKVKILCPTK short Pfs230 CO YADVIKYGSMEFF
- EBS2IPKH 0004 GMDYMSELPKEQRKIKEKCDRKLYYTNLRICTMSP 90 CNDSCKLYDQWITRKKKQWDVLSTKFSSVKKGQII
- EBS2IPKH 0623 GRDYMSELPKEQGKLNEKCASKLYYNNMAICMLP 00 LCHDACKSYDQWITRKKKQWDVLSTKFSSVKKTQ
- EBS2IPKH 1345 RDYMSEFREQRRKLNEKCEDKLYYSTMLICTLPPC 80 NNACKSYDEWITGKKKQWDVLSTKFSSVKKAQKI
- EBSIPKH 05021 ESSFFDLSDNTMLMRLIIKPQASILFIIQSFIMMTPSP 0 TRDARMYCKKKLVNGQLIENNDLKAETEEEDMINE GAMA FSSKYNLFYERLKMEELREIEQDRKSLKNSKGNLS erythrocyte VLEVRNSQNGPDGKEVNGSGDAANGNNMNGGN binding NGSASSLIVVVRDDLAEKTDDIIKNNVDLESLKADV sequence: short EQAFRNFEYQSG
- NcanlNCLIV 069 VCTNTVGSYVCSCLPGYTASDDGRTCTDIDECAT
- NcanlNCLIV 069 VCTNTVGSYVCSCLPGYTASDDGRTCTDIDECAT
- NcanlNCLIV 022 DREGQGVTPAVRLQQQRELQGGRLLPGRPALCD 530 QKCLNLVGKYECGCYPGFVLQPDGRCDDINECLD
- NcanlNCLIV 022 GRLLPGRPALCDQKCLNLVGKYECGCYPGFVLQP
- NcanlNCLIV 069 ECAEGVDTCPRQGGRCVNTPGSYKCECEAGYTY
- NcanlNCLIV 022 GRLLPGRPALCDQKCLNLVGKYECGCYPGFVLQP
- NcanlNCLIV 069 ECESGDFHCPANSHCVDTEGSYKCDCNTGYASD
- NcanlNCLIV 022 RCDDINECLDPSLHGCEQLCVNLPGTYSCQCRQG
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Tropical Medicine & Parasitology (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP14719741.2A EP2988776B1 (en) | 2013-04-24 | 2014-04-24 | Novel vaccines against apicomplexan pathogens |
| JP2016509477A JP6461100B2 (ja) | 2013-04-24 | 2014-04-24 | アピコンプレクサ病原体に対する新規ワクチン |
| CA2910322A CA2910322A1 (en) | 2013-04-24 | 2014-04-24 | Novel vaccines against apicomplexan pathogens |
| US14/786,509 US10131697B2 (en) | 2013-04-24 | 2014-04-24 | Vaccines against apicomplexan pathogens |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361815486P | 2013-04-24 | 2013-04-24 | |
| US61/815,486 | 2013-04-24 | ||
| EP13165161.4 | 2013-04-24 | ||
| EP20130165161 EP2796147A1 (en) | 2013-04-24 | 2013-04-24 | Novel vaccines against apicomplexan pathoges |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014174054A1 true WO2014174054A1 (en) | 2014-10-30 |
Family
ID=48143209
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2014/058409 Ceased WO2014174054A1 (en) | 2013-04-24 | 2014-04-24 | Novel vaccines against apicomplexan pathogens |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US10131697B2 (https=) |
| EP (2) | EP2796147A1 (https=) |
| JP (1) | JP6461100B2 (https=) |
| CA (1) | CA2910322A1 (https=) |
| WO (1) | WO2014174054A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018088507A1 (ja) | 2016-11-11 | 2018-05-17 | 大日本住友製薬株式会社 | マラリアワクチン |
| WO2022045173A1 (ja) | 2020-08-26 | 2022-03-03 | 国立大学法人愛媛大学 | 抗マラリア原虫抗体 |
| WO2024092112A3 (en) * | 2022-10-27 | 2024-05-30 | University Of Maryland, Baltimore | Method for identifying antigenic epitopes in plasmodium falciparum and uses thereof |
| US12202865B2 (en) | 2019-04-04 | 2025-01-21 | Statens Serum Institut | Multivalent malaria transmission-blocking vaccines |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3081575A1 (en) | 2015-04-12 | 2016-10-19 | Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. | Anti-plasmodium parasite antibodies |
| US20180311326A1 (en) * | 2015-11-10 | 2018-11-01 | Fraunhofer-Gesellschaft Zur Foerderung Der Angewandten Forschung E.V. | Immunoassemblin (ia) protein complexes |
| US20180372742A1 (en) * | 2015-12-10 | 2018-12-27 | Immport Therapeutics, Inc. | Babesia Biomarkers for Diagnostic and Screening In Vitro Diagnostic Test |
| US12544441B2 (en) | 2016-11-01 | 2026-02-10 | Washington University | Compositions comprising CelTOS immunogens and antibodies and method of use thereof |
| US12398184B2 (en) | 2016-11-01 | 2025-08-26 | Washington University | Compositions comprising CelTOS immunogens and antibodies and method of use thereof |
| US20180348218A1 (en) * | 2017-06-05 | 2018-12-06 | Tokitae Llc | Serology assay for recent malaria infection |
| GB202301244D0 (en) * | 2023-01-27 | 2023-03-15 | Univ Oxford Innovation Ltd | Vaccine |
| WO2025100417A1 (ja) * | 2023-11-06 | 2025-05-15 | 株式会社ダイセル | Aavのフルカプシドに対するアフィニティポリペプチド |
| CN120550099A (zh) * | 2025-06-12 | 2025-08-29 | 宁夏农林科学院畜牧兽医研究所(有限公司) | 一种牛焦虫疫苗制造方法 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007027860A2 (en) * | 2005-08-31 | 2007-03-08 | Genvec, Inc. | Adenoviral vector-based malaria vaccines |
| WO2012047679A2 (en) * | 2010-09-27 | 2012-04-12 | The Trustees Of The University Of Pennsylvania | Consensus antigen constructs and vaccines made there form, and methods of using same to treat malaria |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE2322552C2 (de) | 1972-11-06 | 1986-08-28 | Pharmacia AB, Uppsala | Verfahren zum Abtrennen von Protein A aus Staphylococcus aureus aus einer Flüssigkeit |
| US4599231A (en) | 1984-03-09 | 1986-07-08 | Scripps Clinic And Research Foundation | Synthetic hepatitis B virus vaccine including both T cell and B cell determinants |
| US4599230A (en) | 1984-03-09 | 1986-07-08 | Scripps Clinic And Research Foundation | Synthetic hepatitis B virus vaccine including both T cell and B cell determinants |
| US4608251A (en) | 1984-11-09 | 1986-08-26 | Pitman-Moore, Inc. | LHRH analogues useful in stimulating anti-LHRH antibodies and vaccines containing such analogues |
| US4601903A (en) | 1985-05-01 | 1986-07-22 | The United States Of America As Represented By The Department Of Health And Human Services | Vaccine against Neisseria meningitidis Group B serotype 2 invasive disease |
| US7931908B2 (en) * | 2007-02-23 | 2011-04-26 | Philadelphia Health Education Corporation | Chimeric MSP-based malaria vaccine |
| EP2352751A2 (en) | 2008-09-28 | 2011-08-10 | Fraunhofer USA, Inc. | Plasmodium vaccines, antigens, compositions and methods |
-
2013
- 2013-04-24 EP EP20130165161 patent/EP2796147A1/en not_active Withdrawn
-
2014
- 2014-04-24 WO PCT/EP2014/058409 patent/WO2014174054A1/en not_active Ceased
- 2014-04-24 JP JP2016509477A patent/JP6461100B2/ja not_active Expired - Fee Related
- 2014-04-24 US US14/786,509 patent/US10131697B2/en not_active Expired - Fee Related
- 2014-04-24 EP EP14719741.2A patent/EP2988776B1/en not_active Not-in-force
- 2014-04-24 CA CA2910322A patent/CA2910322A1/en not_active Abandoned
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007027860A2 (en) * | 2005-08-31 | 2007-03-08 | Genvec, Inc. | Adenoviral vector-based malaria vaccines |
| WO2012047679A2 (en) * | 2010-09-27 | 2012-04-12 | The Trustees Of The University Of Pennsylvania | Consensus antigen constructs and vaccines made there form, and methods of using same to treat malaria |
Non-Patent Citations (4)
| Title |
|---|
| B. MAHAJAN ET AL: "Multiple Antigen Peptide Vaccines against Plasmodium falciparum Malaria", INFECTION AND IMMUNITY, vol. 78, no. 11, 1 November 2010 (2010-11-01), pages 4613 - 4624, XP055011928, ISSN: 0019-9567, DOI: 10.1128/IAI.00533-10 * |
| KUMAR SANJAI ET AL: "A MULTILATERAL EFFORT TO DEVELOP DNA VACCINES AGAINST FALCIPARUM MALARIA", TRENDS IN PARASITOLOGY, ELSEVIER CURRENT TRENDS, GB, vol. 18, no. 3, 1 March 2002 (2002-03-01), pages 129 - 135, XP009072327, ISSN: 1471-4922, DOI: 10.1016/S1471-4922(01)02207-3 * |
| LAUREN SCHWARTZ ET AL: "A review of malaria vaccine clinical projects based on the WHO rainbow table", MALARIA JOURNAL, BIOMED CENTRAL, LONDON, GB, vol. 11, no. 1, 9 January 2012 (2012-01-09), pages 11, XP021130762, ISSN: 1475-2875, DOI: 10.1186/1475-2875-11-11 * |
| STOWERS ANTHONY W ET AL: "Structural conformers produced during malaria vaccine production in yeast", YEAST, vol. 18, no. 2, 30 January 2001 (2001-01-30), pages 137 - 150, XP002698509, ISSN: 0749-503X * |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018088507A1 (ja) | 2016-11-11 | 2018-05-17 | 大日本住友製薬株式会社 | マラリアワクチン |
| US11273212B2 (en) | 2016-11-11 | 2022-03-15 | Sumitomo Dainippon Pharma Co., Ltd. | Malaria vaccine |
| US12202865B2 (en) | 2019-04-04 | 2025-01-21 | Statens Serum Institut | Multivalent malaria transmission-blocking vaccines |
| WO2022045173A1 (ja) | 2020-08-26 | 2022-03-03 | 国立大学法人愛媛大学 | 抗マラリア原虫抗体 |
| WO2024092112A3 (en) * | 2022-10-27 | 2024-05-30 | University Of Maryland, Baltimore | Method for identifying antigenic epitopes in plasmodium falciparum and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| US10131697B2 (en) | 2018-11-20 |
| EP2796147A1 (en) | 2014-10-29 |
| CA2910322A1 (en) | 2014-10-30 |
| JP2016523821A (ja) | 2016-08-12 |
| EP2988776B1 (en) | 2018-12-26 |
| US20160083439A1 (en) | 2016-03-24 |
| JP6461100B2 (ja) | 2019-01-30 |
| EP2988776A1 (en) | 2016-03-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10131697B2 (en) | Vaccines against apicomplexan pathogens | |
| US10183066B2 (en) | Multi-component-multistage malaria vaccines | |
| López et al. | What is known about the immune response induced by Plasmodium vivax malaria vaccine candidates? | |
| Sala et al. | The Plasmodium berghei sexual stage antigen PSOP12 induces anti-malarial transmission blocking immunity both in vivo and in vitro | |
| US20070003562A1 (en) | GLURP-MSP3 fusion protein, immunogenic compositions and malarial vaccines containing it | |
| Favuzza et al. | Generation of Plasmodium falciparum parasite-inhibitory antibodies by immunization with recombinantly-expressed CyRPA | |
| US9919040B2 (en) | Soluble recombinant plasmodium falciparum circumsporozoite protein, use in vaccines, methods of making and uses thereof | |
| Mazumdar et al. | Plasmodium falciparum merozoite surface protein 1 (MSP-1)-MSP-3 chimeric protein: immunogenicity determined with human-compatible adjuvants and induction of protective immune response | |
| Hadj-Kaddour et al. | Recombinant protein Bd37 protected gerbils against heterologous challenges with isolates of Babesia divergens polymorphic for the bd37 gene | |
| EP3191122A1 (en) | Three-component-multistage malaria vaccine | |
| US20180311326A1 (en) | Immunoassemblin (ia) protein complexes | |
| Valencia et al. | Platform for Plasmodium vivax vaccine discovery and development | |
| Zhang et al. | Construction and evaluation of a multistage combination vaccine against malaria | |
| EP2409987B1 (en) | Ribosomal P protein complex from Plasmodium falciparum as antigen in vaccines against malaria | |
| CA2542924A1 (en) | Msp-3-like family of genes | |
| Boes et al. | LLLLGGG GGGGGGG GGG LLL GGGGGG | |
| EP2501717B1 (en) | Enhanced malaria msp-1 subunit vaccine | |
| EP2223937A1 (en) | Polypeptides for the prevention or treatment of malaria | |
| EP1808443A1 (en) | Purified polypeptide comprising or consisting of a C-terminus MSP1 antigen from Plasmodium falciparum carrying a Glycosyl-phosphatidyl-inositol group (GPI) | |
| Wu et al. | Malaria Vaccine Development | |
| Chen et al. | proteins are bound to the Ni"-chelated surface in a uniform | |
| Kei | Expression of a Hexa-histidine TaggedPlasmodium falciparum Merozoite Surface Protein-1 C-terminal Processing Fragment (C-HisPfMSP-l42) in Silkworm Larvae usingBombyx mori Nuclear Polyhedrosis Virus | |
| Alkahtani | Recombinant Expression and Immuno-screening for Vaccine Candidates in Plasmodium falciparum Saad M. Alkahtani Thesis submitted for the degree of Doctor of Philosophy University of Edinburgh | |
| Salavatifar et al. | Evaluation of BALB/c Mice Antibody Responses to Two Variant Forms of Plasmodium vivax Apical Membrane Antigen-1 Recombinant Protein as a Malaria Vaccine Candidate |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14719741 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14786509 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2910322 Country of ref document: CA Ref document number: 2016509477 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014719741 Country of ref document: EP |