WO2014152776A1 - Apolipoprotein mimetics and uses thereof - Google Patents
Apolipoprotein mimetics and uses thereof Download PDFInfo
- Publication number
- WO2014152776A1 WO2014152776A1 PCT/US2014/027719 US2014027719W WO2014152776A1 WO 2014152776 A1 WO2014152776 A1 WO 2014152776A1 US 2014027719 W US2014027719 W US 2014027719W WO 2014152776 A1 WO2014152776 A1 WO 2014152776A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- apo
- mimetic
- treatment cycle
- rest phase
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/775—Apolipopeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
Definitions
- the disclosed invention relates generally to the treatment of atherosclerosis.
- the treatment pertains to a specific dosing regimen that includes a treatment cycle followed by a rest phase that provides prolonged therapeutic effects even after the treatment is withdrawn.
- cardiovascular disease In the United States, heart disease is the leading cause of death in both men and women. Several causative factors are implicated in the development of cardiovascular disease including hereditary predisposition to the disease, gender, lifestyle factors such as smoking and diet, age, hypertension, and hyperlipidemia, including hypercholesterolemia. Several of these factors, particularly hyperlipidemia and hypercholesteremia (high blood cholesterol concentrations) provide a significant risk factor associated with atherosclerosis.
- Atherosclerosis is associated with an inflammatory response caused by the accumulation of low-density lipoprotein (LDL) molecules in blood vessels. It can be asymptomatic for years. Atherosclerosis causes hardening and narrowing of blood vessels.
- LDL low-density lipoprotein
- Atherosclerosis There are several treatments for atherosclerosis, such as lifestyle change, medication and medical procedures.
- Statins are a well-known treatment for atherosclerosis. Statins have proven to reduce cardiac risk however the withdrawal of statin therapy abrogrates the protective effect (Heeschen et al. Circulation.105: 1446-1452, 2002).
- the current approach to treating atherosclerosis is to provide earlier intervention and life-long treatment. This approach is problematic as it requires identifying asymptomatic patients early in their life cycle and, since risk increases with age, maintaining therapy for the duration of their life. Further, the most efficacious currently available therapies are unable to prevent major cardiac events in all patients whether as primary or secondary interventions. Therefore, there is a need for therapies that can provide rapid benefit in reducing
- compositions and methods disclosed herein provide an atherosclerosis therapy with sustained therapeutic effects even after the treatment is withdrawn.
- Dosing regimens containing at least one treatment cycle followed by a rest phase are provided. Also provided are methods of treating atherosclerosis involving administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle followed by a rest phase.
- the treatment cycles and rest phases of the dosing regimens and the methods of treating can be the same.
- the treatment cycle contains the administration of an effective amount of an Apo E mimetic to cause an immediate benefit illustrated by a decrease in atherosclerosis, a decrease in artery wall stiffness, a decrease in isolated systolic hypertension, a decrease in arterial inflammation, an increase in anti-oxidant capability of the HDL fraction and/or an improvement in myocardial function, and to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic.
- the treatment cycle can include the administration of an effective amount of the Apo E mimetic once a week for four weeks or once a week for three months. In some instances, the treatment cycle includes the administration of an effective amount of the Apo E mimetic once every two weeks for up to 12 weeks.
- the rest phase is a period of time wherein the Apo E mimetic is not administered.
- the rest phase can be at least four weeks.
- An atherosclerosis therapeutic other than an Apo E mimetic can be administered during the rest phase.
- the atherosclerosis therapeutic other than an Apo E mimetic can be a conventional lipid lowering therapy, such as a statin or bile acid sequestrant, and/or a therapeutic such as a PCSK9 inhibitor, a VLDL synthesis inhibitor and/or a CETP inhibitor.
- Both the dosing regimen and the methods of treating can further include a second treatment cycle after the rest phase.
- the second treatment cycle can be administered after a four week rest phase or one or more years from the end of the initial treatment cycle.
- the Apo E mimetic can be hEl 8A (LRKLRKRLLRDWLKAFYDKVAEKLKEAF (SEQ ID NO:l)).
- Figures 1A, IB, and 1C show the design of mR18L.
- Figure 2 is a schematic diagram of the experimental protocol used in Apo E null mice.
- Figures 3A and 3B show the amount of plasma cholesterol (mg/dl).
- Figure 4 is a bar graph of plasma triglycerides (mg/dl) versus different treatments (saline, mR18L or hEl 8 A).
- Figures 5A and 5B are bar graphs of reactive oxygen species (ROS) and paraoxanase (PON) versus the different treatments, respectively.
- ROS reactive oxygen species
- PON paraoxanase
- Figures 6A and 6B are a combination of a line graph showing the absorbance in the different elutions and polyacrylamide gels were stained to show PON-1 activity in the HDL fractions (29-32).
- the plasma cholesterol lipoprotein fractions were analyzed by the CLiP method.
- the solid lines show the cholesterol content of the various lipoprotein fractions, displayed as dashed lines.
- Figure 7 is a line graph showing the plasma cholesterol levels (mg/dl) over a 60 day time period. Peptide was administered during the first 30 days The final time point is four weeks after the end of treatment with saline, mR18L or hE18A. Cholesterol levels in all treatment groups were the same at the end of the study.
- Figures 8A and 8B are bar graphs of PON activity versus different treatments and ROS versus different treatments, respectively. The samples were from four weeks after treatment.
- Figures 9A and 9B show that aortic lesions were reduced in hE18A treated mice even after treatment had been withdrawn for four weeks.
- Figure 10 shows that lesions in the aortic sinus were reduced in hE18A treated mice even after treatment had been withdrawn for four weeks. mRl 8L had no effect on aortic sinus lesions at study termination.
- Figure 11 shows a trend towards decreased macrophage coverage in the aortic sinus of mice treated with hE18A, relative to the other treatment groups, at study termination.
- Figure 12 is a schematic diagram of the study design used in Apo E -/- mice.
- Figures 13 A and 13B are graphs showing the plasma lipid levels after treatment with a control or an Apo E mimetic.
- Each graph shows the lipid levels after the treatment has been withdrawn for four weeks (control and hE18A) and the lipid levels immediately after four weeks of treatment (control Term. 1 and hE18A Term. 1).
- Figures 14 is a bar graph showing the liver cholesteryl ester and free cholesterol.
- Figure 15 is a diagram of the aorta showing the regions that were analyzed for plaques or lesions.
- Figure 16 is a bar graph of percent plaque in the aorta versus the different treatments. "Term 1" represents the results after the initial four weeks of treatment. “Term 2" represents the results after treatment has been withdrawn for four weeks.
- Figures 17 is a bar graph showing plaque area in the aortic arch at week 5 and week 8.
- Figures 18A and 18B are graphs showing the diastolic (A) and the systolic (B) area.
- Ranges may be expressed herein as from “about” one particular value, and/or to "about” another particular value.
- the term “about” is used herein to mean approximately, in the region of, roughly, or around. When the term “about” is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. In general, the term “about” is used herein to modify a numerical value above and below the stated value by a variance of 20%. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent "about,” it will be understood that the particular value forms another embodiment. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint.
- amino acid sequence refers to a list of abbreviations, letters, characters or words representing amino acid residues.
- the amino acid abbreviations used herein are conventional one letter codes for the amino acids and are expressed as follows: A, alanine; C, cysteine; D aspartic acid; E, glutamic acid; F, phenylalanine; G, glycine; H histidine; I isoleucine; K, lysine; L, leucine; M, methionine; N, asparagine; P, proline; Q, glutamine; R, arginine; S, serine; T, threonine; V, valine; W, tryptophan; Y, tyrosine;.
- Apo E mimetics are peptides that are related to, characteristic of, or mimic Apo E.
- Apo E mimetics include Apo E peptides (i.e. peptides derived from full length Apo E).
- Dosing regimen refers to at least one treatment cycle followed by at least one rest phase.
- a dosing regimen can include more than one treatment cycle and more than one rest phase.
- a dosing regimen can be a three month treatment cycle followed by a one year rest phase.
- Another example can be a six month treatment cycle followed by a six month rest phase and then a three month treatment cycle followed by a one year rest phase.
- treatment cycle refers to the administration of Apo E mimetics for an established period of time.
- a treatment cycle includes a wide range of dosages of Apo E mimetics as well as different lengths of time for administering the Apo E mimetics.
- a treatment cycle can be a three month period wherein an Apo E mimetic is administered twice a week for the three month period.
- Dose or “dosage” as used herein refers to a specific quantity of a therapeutic agent, such as an Apo E mimetic, that is taken at specific times.
- an effective amount is meant to mean a sufficient amount of the composition or Apo E mimetic to provide the desired effect.
- an effective amount of an Apo E mimetic can be an amount that provides a therapeutic affect and provides sustained therapeutic effects after withdrawal of the treatment.
- An effective amount of an Apo E mimetic is an amount that is able to cause a benefit illustrated by a decrease in atherosclerosis, a decrease in artery wall stiffness, a decrease in isolated systolic
- hypertension a decrease in arterial inflammation, an increase in anti-oxidant capability of the HDL fraction and/or an improvement in myocardial function, as well as an amount that allows for a sustained therapeutic effect after withdrawal of the Apo E mimetic.
- the exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of disease (or underlying genetic defect) that is being treated, the particular compound used, its mode of administration, and the like. Thus, it is not possible to specify an exact “effective amount.” However, an appropriate "effective amount” may be determined by one of ordinary skill in the art using only routine experimentation.
- sustained therapeutic effect is a therapeutic effect that persists after the therapeutic has been withdrawn. For example, the sustained therapeutic effect is maintained even after the acute cholesterol lowering effect is gone.
- Rapid phase refers to a period of time wherein an Apo E mimetic is not administered.
- Atherosclerotic burden as used herein is the amount of atherosclerosis in the arteries of a patient. This may include the coronary, carotid, peripheral and other arteries.
- the atheroma may be complex lesions with a smooth muscle and collagen containing fibrous cap, areas of calcification, cholesterol crystals and cholesterol laden macropahges (foam cells) and/or less complex and more unstable lesions with less calcification and a thinner fibrous cap, and more foam cells and cholesterol (unstable lesions).
- the unstable lesions may intrude into the lumen of the artery or expand away from the lumen of the artery.
- Peptide refers to any peptide, oligopeptide, polypeptide, gene product, expression product, or protein.
- a peptide is comprised of consecutive amino acids.
- the term “peptide” encompasses naturally occurring or synthetic molecules.
- reverse oriented refers to a peptide, or a portion of the peptide, has a reverse amino acid sequence as compared to a non-reverse oriented peptide (i.e., the original sequence is read (or written) from right to left).
- a non-reverse oriented peptide i.e., the original sequence is read (or written) from right to left.
- reverse analog or a peptide having its reverse sequence is as follows: EDCBA.
- EDCBA In a dual domain peptide for example, Ac-hE-18A-NH2, either the hE sequence is read from right to left or the 18A sequence is read from right to left.
- LRKLRKRLLR- DWLKAFYDKVAEKLKEAF (SEQ ID NO: l) can be RLLRKRLKRL- DWLKAFYDKVAEKLKEAF (SEQ ID NO:2) or LRKLRKRLLR- FAEKLKEAVKDYFAKLWD (SEQ ID NO: 3).
- a "dual-domain peptide”, a “dual-domain synthetic peptide”, or a “dual-domain Apo E mimicking peptide” is meant to mean a peptide comprising a lipid- associating peptide/domain and a receptor binding peptide/domain.
- a "single-domain peptide”, a “single-domain synthetic peptide”, or a “single-domain Apo E mimicking peptide” is meant to mean a peptide comprising either a lipid-associating peptide/domain or a receptor binding peptide/domain, but not both.
- domain switched As used herein "domain switched”, “switched domain”, or “switched” peptide is meant to mean that the lipid-associating peptide is covalently linked to the receptor binding domain of apolipoprotein E such that the lipid-associating peptide is at the N-terminus of the synthetic apolipoprotein E-mimicking peptide.
- the peptide 18A-hE is exemplary of a domain switched peptide.
- “scrambled” “scrambled version”, or “scrambled peptide” is meant to mean that the composition of the amino acid sequence is the same as the unscrambled peptide, however the sequence of the amino acids is altered thus rendering the peptide unable to form either an a-amphipathic helix or does not possess lipid associating (or HSPG associating) properties. However, in some cases, as described in this invention, the scrambled peptide remains able to form a different helical structure, such as a ⁇ -helix.
- Scrambled peptides are often denoted as having a "Sc" prior to the portion of the peptide that is scrambled.
- Sc-hE- 18A denoted that the hE portion of the peptide is scrambled.
- sample is meant to mean an animal; a tissue or organ from an animal; a cell (either within a subject, taken directly from a subject, or a cell maintained in culture or from a cultured cell line); a cell lysate (or lysate fraction) or cell extract; or a solution containing one or more molecules derived from a cell or cellular material (e.g. a polypeptide or nucleic acid), which is assayed as described herein.
- a sample may also be any body fluid or excretion (for example, but not limited to, blood, urine, stool, saliva, tears, bile) that contains cells or cell components.
- subject refers to the target of administration, e.g. an animal.
- the subject of the disclosed methods can be a vertebrate, such as a mammal.
- the subject can be a human.
- the term does not denote a particular age or sex.
- Subject can be used interchangeably with “individual” or “patient”.
- modulate is meant to mean to alter, by increasing or decreasing.
- lipid binding domain E and "lipid-associating peptide” are used interchangeably. As used herein, both terms can mean the lipid binding domain of apolipoprotein E.
- isolated polypeptide or “purified polypeptide” is meant to mean a polypeptide (or a fragment thereof) that is substantially free from the materials with which the polypeptide is normally associated in nature.
- the polypeptides of the invention, or fragments thereof can be obtained, for example, by extraction from a natural source (for example, a mammalian cell), by expression of a recombinant nucleic acid encoding the polypeptide (for example, in a cell or in a cell-free translation system), or by chemically synthesizing the polypeptide.
- polypeptide fragments may be obtained by any of these methods, or by cleaving full length proteins and/or polypeptides.
- treat is meant to mean administer one of the disclosed compositions to a subject, such as a human or other mammal (for example, an animal model), that has atherosclerosis, in order to prevent or delay a worsening of the effects of the disease or condition, or to partially or fully reverse the effects of the disease.
- a subject such as a human or other mammal (for example, an animal model), that has atherosclerosis, in order to prevent or delay a worsening of the effects of the disease or condition, or to partially or fully reverse the effects of the disease.
- prevent is meant to mean minimize the chance that a subject who has an increased susceptibility for developing atherosclerosis will develop
- lipoprotein or lipoproteins
- lipoproteins is meant to mean a biochemical assembly that contains both proteins and lipids.
- the lipids or their derivatives may be covalently or non-covalently bound to the proteins.
- Many enzymes, transporters, structural proteins, antigens, adhesins, and toxins are lipoproteins. Examples include the high density and low density lipoproteins of the blood, the transmembrane proteins of the mitochondrion and the chloroplast, and bacterial lipoproteins
- high-density lipoprotein is meant to mean a class of lipoproteins, varying somewhat in their size (8-11 nm in diameter), that can transport cholesterol.
- HDL cholesterol is cholesterol that is associated with HDLs. About one-fourth to one-third of blood cholesterol is carried by high-density lipoprotein (HDL).
- HDL cholesterol is known as "good” cholesterol, because high levels of HDL seem to protect against heart attack.
- Low levels of HDL (less than 40 mg/dL in men and less than 50 mg/dL in women) also increase the risk of heart disease. Medical experts think that HDL tends to carry cholesterol away from the arteries and back to the liver, where it is passed from the body. Some experts believe that that HDL removes excess cholesterol from arterial plaque, thus slowing its buildup
- VLDL very Low Density Lipoproteins
- LDL low density lipoprotein
- low-density lipoprotein or “LDL” is mean to mean a lipoprotein that varies in size (approx. 22 nm) and can contain a changing number of triglycerides and cholesteryl esters they actually have a mass and size distribution.
- Each native LDL particle contains a single apolipoproteinB-100 molecule (Apo B-100, a protein with 4536 amino acid amino acid residues) and a phospholipid coat that circles the triglycerides and cholesteryl esters, keeping them soluble in the aqueous environment.
- LDL is commonly referred to as bad cholesterol.
- LDL cholesterol is cholesterol that is associated with LDLs.
- LDL cholesterol When too much LDL cholesterol circulates in the blood, it can slowly build up in the inner walls of the arteries that feed the heart and brain. Together with other substances, it can form plaque, a thick, hard deposit that can narrow the arteries and make them less flexible. This condition is known as atherosclerosis. If a clot forms and blocks a narrowed artery, then heart attack or stroke can result.
- Cholesterol cannot dissolve in the blood. It has to be transported to and from the cells by carriers called lipoproteins. LDLs and HDLs along with triglyceride-rich lipoproteins (VLDL) and Lp(a) cholesterol, make up your total cholesterol count, which can be determined through a blood test.
- VLDL triglyceride-rich lipoproteins
- Lp(a) cholesterol make up your total cholesterol count, which can be determined through a blood test.
- nucleic acid refers to a naturally occurring or synthetic oligonucleotide or polynucleotide, whether DNA or RNA or DNA-RNA hybrid, single-stranded or double-stranded, sense or antisense, which is capable of hybridization to a complementary nucleic acid by Watson-Crick base-pairing.
- Nucleic acids of the invention can also include nucleotide analogs (e.g., BrdU), and non-phosphodiester internucleoside linkages (e.g., peptide nucleic acid (PNA) or thiodiester linkages).
- nucleic acids can include, without limitation, DNA, RNA, cDNA, gDNA, ssDNA, dsDNA or any combination thereof
- dosing regimens comprising at least one treatment cycle of an effective amount of an Apo E mimetic followed by a rest phase.
- the rest phase of the dosing regimen is a period of time where the Apo E mimetic is not administered.
- dosing regimens comprising at least one treatment cycle followed by a rest phase, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the Apo E mimetic is not administered during the rest phase.
- an effective amount of Apo E mimetic result in sustained therapeutic effects, but it is also an amount sufficient to cause an acute beneficial effect.
- the effects of the Apo E mimetic can be measured and seen during the treatment cycle, at the end of the treatment cycle and during the rest phase.
- the sustained therapeutic effects are the therapeutic effects seen even after the acute cholesterol lowering effect is gone.
- dosing regimens comprising at least one treatment cycle followed by a rest phase, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the Apo E mimetic is not administered during the rest phase, wherein the treatment cycle comprises administration of an effective amount of the Apo E mimetic once a week for three months or wherein the treatment cycle comprises
- dosing regimens comprising at least one treatment cycle followed by a rest phase, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the Apo E mimetic is not administered during the rest phase, wherein the dosing regimen further comprises a second treatment cycle after the rest phase.
- dosing regimens comprising at least one treatment cycle followed by a rest phase, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the ApoE mimetic consists of the amino acid sequence LRKLRKRLLRDWLKAFYDKVAEKLKEAF (SEQ ID NO: 1), wherein the Apo E mimetic is not administered during the rest phase.
- the amino acid sequence LRKLRKRLLRDWLKAFYDKVAEKLKEAF SEQ ID NO: l
- the dosing regimen can further include a second treatment cycle after the rest phase.
- a second rest phase can occur after the second treatment cycle.
- a third, fourth, fifth, sixth, seventh, eighth, ninth or tenth treatment cycle can be administered wherein each treatment cycle is followed by a rest phase.
- the dosing regimen includes infinite treatment cycles, each followed by a rest phase.
- a subject may be prescribed a dosing regimen that involves consecutive treatment cycles followed by rest phases for the duration of their life.
- a second dosing regimen can be prescribed based on the reoccurrence of atherosclerotic lesions or other atherosclerosis factors.
- the second dosing regimen can be administered 1, 2, 3, 4, 5 years or more than 5 years after the initial dosing regimen was administered.
- the second dosing regimen can be the same as the initial dosing regimen or can be different.
- the initial dosing regimen can be a three month treatment cycle followed by a one year rest phase. After the one year rest phase the subject can be tested and if atherosclerotic lesions are building up again then a second dosing regimen consisting of another three month treatment cycle followed by a rest phase or a six month treatment cycle followed by a rest phase can be prescribed.
- the dose of Apo E mimetic can vary between the initial dosing regimen and any additionally prescribed dosing regimens.
- the treatment cycle can include the administration of different dosages of Apo E mimetic as well as administration at different time points.
- the Apo E mimetic can be administered for varying amounts of time for up to 6 months. In some instances, the administration can occur for up to one, two, three, four, five or six months.
- the Apo E mimetic can be administered once a week for 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, or 24 weeks.
- the length of time for each treatment cycle can vary depending on the amount of Apo E administered per dosage.
- a treatment cycle can include the administration of Apo E mimetic once, twice or three times a week.
- the Apo E mimetic can be administered daily.
- the Apo E mimetic can be administered once every two weeks or even once a month.
- the Apo E mimetic can be administered every two weeks for 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, or 24 weeks.
- the treatment cycle can include administering an Apo E mimetic once a week for four weeks or once every two weeks for up to six months.
- each treatment cycle includes an established length of time for administration as well as an established dosing schedule during that time frame.
- more than one Apo E mimetic can be administered during the treatment cycles.
- the more than one Apo E mimetic can be formulated together or in separate compositions.
- one or more Apo E mimetic is administered in combination with one or more other therapeutic agents, such as cholesterol lowering drugs.
- the disclosed dosing regimen includes at least one treatment cycle followed by a rest phase.
- the rest phase is a period of time wherein Apo E mimetic is not administered and the length of the period of time can vary.
- the length of the rest phase is dependent on how long the sustained therapeutic effects of the Apo E mimetic administered during the treatment cycle last.
- the rest phase can be at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months.
- the rest phase can be at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 years.
- the rest phase can be at least four weeks (one month).
- One way to determine how long the rest phase should last is to test the subject to determine the progression of the atherosclerosis burden in the subject's arteries. If the atherosclerosis burden has progressed to a level that increases the risk of cardiovascular disease, then the subject can be prescribed a second dosing regimen. If the atherosclerosis burden is stable then the rest phase can be prolonged. Subjects can be tested on a regular basis. For example, a subject can be tested every 3, 6, 9, 12, 18, 24, 30 or 36 months.
- the rest phase can be decreased or extended depending on the dose of Apo E mimetic administered and the reduction in atherosclerosis achieved during the treatment cycle.
- the rest phase can be extended if the dose of Apo E mimetic during the treatment cycle is increased and the atherosclerosis burden is substantially reduced.
- the length of the rest phase can also vary based on the length of the treatment cycle. For instance, if a subject receives a certain dose of Apo E mimetic once a week for three months then the rest phase may be shorter than a subject that receives the same dose of Apo E mimetic once a week for six months.
- an atherosclerosis therapeutic other than an Apo E mimetic can be administered during the rest phase.
- the atherosclerosis therapeutic other than an Apo E mimetic can be a conventional lipid lowering therapy, such as a statin, a bile acid sequestrant or a fibrate, or a novel anti- atherosclerosis therapeutic like a CETP inhibitor, a VLDL synthesis inhibitor, a PCSK9 inhibitor, and/or an arterial inflammation inhibitor.
- the beneficial effects of the Apo E mimetic can still be present in a subject even after the treatment cycle is complete.
- the half-life of the Apo E mimetic is less than 1, 2, 3, 4, 5, 10, 15, 20, 25, or 30 days.
- the Apo E mimetic is no longer detectable in a subject after the treatment cycle is complete. Thus, the long-term therapeutic effects are not from residual Apo E mimetic.
- the dose or dosage of Apo E mimetic can vary depending on many factors, such as but not limited to, age, condition, sex and extent of the disease in the patient, route of administration, length of treatment cycle, or whether other drugs are included in the regimen, and can be determined by one of skill in the art. [0079] Effective dosages can be determined empirically, and making such
- the dosage ranges for the administration of the compositions are those large enough to produce the desired effect in which the disease is treated.
- the dosage can be an amount effective to provide therapeutic effects and provide or allow for sustained therapeutic effects even after the treatment (i.e. Apo E mimetic) is withdrawn.
- the therapeutic effects can be, but are not limited to, a reduction in atherosclerotic lesions, decrease in arterial stiffness, decrease in isolated systolic
- the therapeutic effects can be measured by markers of arterial inflammation such as, but not limited to, C-reactive protein.
- the therapeutic effects can be measured by atherosclerosis imaging techniques, including MRI, intravascular ultrasound, ultrafast imaging CT scans, B-mode ultrasonography, virtual histology intravascular ultrasound, optical coherence tomography, or other known methods.
- the dosage should not be so large as to cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like.
- the dosage can be adjusted by the individual physician in the event of any counter-indications. Dosage can vary, and can be administered in one or more dose administrations daily, for one or several days. Guidance can be found in the literature for appropriate dosages for given classes of pharmaceutical products.
- Suitable dosages include, but are not limited to amounts between 0.01 mg/kg and 10 mg/kg.
- disclosed herein are methods involving administering one or more of the disclosed Apo E mimetics to a subject, wherein the Apo E mimetic is administered in an amount of about 0.15 mg/kg to about 5 mg/kg.
- the Apo E mimetic dose can be administered as a bolus injection or as an infusion over one or more hours.
- Apolipoprotein-E mimicking peptides or Apo E mimetics Disclosed are apolipoprotein-E mimicking peptides or Apo E mimetics. Non- limiting examples of the Apo E mimetics are provided herein. The Apo E mimetics can be single domain or dual domain peptides. Compositions containing the Apo E mimetics are also disclosed. [0084] Apolipoprotein E mimetics have both direct cholesterol lowering effects by providing an alternative ligand for receptors on the liver to clear atherogenic Apolipoprotein B containing lipoproteins (LDL, VDLD and ⁇ -VLDL), and direct beneficial effects on the artery wall.
- LDL, VDLD and ⁇ -VLDL lipoproteins
- the Apo E mimetics can enhance the removal of cholesterol from the artery wall, working in conjunction with HDL, increasing the formation of lipid poor prep-HDL that accept cholesterol from macrophages.
- the Apo E mimetics can stimulate macrophage- mediated clearance of dead and dying cells in the artery wall (efferocytosis), improve the quality of HDL by increasing PON-1 levels and bringing down plasma lipid hydroperoxide levels, decrease macrophage content in atherosclerotic lesions resulting in more stable lesions, and decrease inflammation in the artery wall.
- Apolipoprotein E plays an important role in the metabolism of triglyceride-rich lipoproteins, such as very low density lipoprotein (VLDL) and
- Apolipoprotein E mediates the high affinity binding of Apo E-containing lipoproteins to the low density lipoprotein (LDL) receptor (Apo B, E receptor) and the members of its gene family, including LDL receptor related protein (LRP), very low density lipoprotein receptor (VLDLR) and the Apo E2 receptor (Apo E2R) (Mahley, R. W., (1988) Science 240, 622-630).
- LRP LDL receptor related protein
- VLDLR very low density lipoprotein receptor
- Apo E2R Apo E2 receptor
- Apo E is a protein that binds lipid and has two major domains (Mahley, R.W., et al. J. Lipid Res. 1999, 40:622-630). The 22 kDa amino terminal domain has been shown by X-ray crystallographic studies to be a 4-helix bundle (Wilson, C, et al. Science
- Apo E is secreted as a 299 amino acid residue protein with a molecular weight of 34,200. Based on thrombin cleavage of Apo E into two fragments, a two-domain hypothesis was initially suggested to explain the fact that the C-terminal region of Apo E (192-299) is essential for its binding to hypertriglyceridemic VLDL and the N-terminal 22 kDa domain (1- 191), binds to the LDL-R (Bradley, W. A., et al., (1986) J. Lipid Res. 27, 40-48).
- a minimal arginine-rich Apo E receptor binding domain (141-150) was sufficient to enhance low density lipoprotein (LDL) and very low density lipoprotein (VLDL) uptake and clearance when covalently linked to a class A amphipathic helix
- LDL low density lipoprotein
- VLDL very low density lipoprotein
- a peptide was synthesized in which the receptor binding domain of human Apo E, LRKLRKRLLR (SEQ ID NO:4) (hApo E[141-150] also referred to as "hE"), was linked to 18A, a well characterized high affinity lipid-associating peptide
- hApo E[141-150]-18A also referred to as "hE-18A”
- hE-18A also referred to as "hE-18A”
- U.S. Patent No. 6,506,880 which is hereby incorporated by reference in its entirety for its teaching of specific Apo E mimetics and their uses.
- Also synthesized was an end protected analog of hE-18A, denoted Ac-hE18A-NH2.
- LRKMRKRLMR- 18 A (SEQ ID NO:7) (also referred to as "mE18A"), whereby the receptor binding domain of human Apo E was modified to substitute arginine (R) residues for lysine (K) residues at positions 143 and 146 (LRRLRRRLLR; SEQ ID NO:6) and whereby the receptor binding domain of mouse Apo E (LRKMRKRLMR; SEQ ID NO: 7), were linked to 18A, respectively.
- the effect of the dual character peptides on the uptake and degradation of human LDL/VLDL by cells was then determined.
- LRP LDL receptor related protein
- the single-domain synthetic Apo E mimetics can consist of a receptor binding domain of Apo E or a lipid- associating peptide.
- the receptor binding domain peptide for the synthetic Apo E mimetics can be a human receptor binding domain peptide of Apo E.
- receptor binding domain peptide of the disclosed synthetic Apo E mimetics can comprise the amino acid sequence of LRKLRKRLLR (SEQ ID NO:4), LRRLRRRLLR (SEQ ID NO:6), or LRKLRKRFFR (SEQ ID NO:7).
- the receptor binding domain peptide of such synthetic Apo E mimetics can also be from a species selected from the group consisting of mouse, rabbit, monkey, rat, bovine, pig and dog.
- the italicized residues in Table 1 indicate changes from the human sequence; however, the property of the amino acid is conserved.
- the bold- italicized residues in Table 1 indicate the difference from the human sequence at that position.
- the receptor binding domain peptide for the synthetic Apo E mimetics can also be the LDL receptor (LDLR) binding domain of apolipoprotein B (ApoB).
- the LDL receptor (LDLR) binding domain of ApoB can have the sequence RLTRKRGLK (SEQ ID NO: 13).
- ApoB-100 is a 550,000 Da glycoprotein with nine amino acids (3359-3367) serving as the binding domain for the LDL receptor (Segrest et al, J. Lipid. Res. 42, pp. 1346-1367 (2001)).
- LDL Upon binding to LDLR in clathrin coated pits, LDL is internalized via endocytosis and moves into the endosome where a drop in pH causes the receptor to dissociate from the LDL. The receptor is recycled back to the surface of the cell while the LDL is moved into the lysosome where the particle is degraded (Goldstein et al, Ann. Rev. Cell Biol. 1, pp. 1- 39 (1985)).
- the LDL receptor (LDLR) binding domain of ApoB when used with the disclosed peptides can also be altered and/or modified as described throughout this application for Apo E.
- LDL receptor (LDLR) binding domain of ApoB can be used with the disclosed lipid-associating peptides, wherein the LDL receptor (LDLR) binding domain of ApoB is covalently linked to said lipid-associating peptide.
- the LDL receptor (LDLR) binding domain of ApoB can be scrambled, reverse-oriented, can be part of a domain switched peptide as described below.
- Lipid-associating peptides can be used alone or in combination with the Apo E- mimicking peptides.
- the lipid associating peptide for these synthetic Apo E mimetics can be, but are not limited to, class A amphipathic helical peptides, class A amphipathic helical peptide mimetics of apoA-I having aromatic or aliphatic residues in the non-polar face, small peptides including pentapeptides, tetrapeptides, tripeptides, dipeptides and pairs of amino acids, Apo-J (G* peptides), and peptide mimetics, e.g., as described below.
- the lipid-associating peptides for use in the disclosed methods include class A amphipathic helical peptides, e.g. as described in U.S. Pat. No. 6,664,230, and PCT Publications WO 02/15923 and WO 2004/034977. It was discovered that peptides comprising a class A amphipathic helix (“class A peptides”), are capable of mitigating one or more symptoms of atherosclerosis as well as treating other disorders.
- Class A peptides are characterized by formation of an a-helix that produces a segregation of polar and non-polar residues thereby forming a polar and a nonpolar face with the positively charged residues residing at the polar-nonpolar interface and the negatively charged residues residing at the center of the polar face (see, e.g., Anantharamaiah (1986) Meth. Enzymol, 128: 626-668). It is noted that the fourth exon of apo A-I, when folded into 3.667 residues/turn produces a class A amphipathic helical structure.
- One class A peptide designated 18A (see, e.g., Anantharamaiah (1986) Meth. Enzymol, 128: 626-668) was modified as described herein to produce peptides orally administrable and highly effective at inhibiting or preventing one or more symptoms of atherosclerosis and/or other indications described herein. Without being bound by a particular theory, it is believed that the disclosed peptides can act in vivo by picking up seeding molecule(s) that mitigate oxidation of LDL.
- a number of these class A peptides were made including, the peptide designated 4F, D4F, 5F, and D5F, and the like.
- Various class A peptides inhibited lesion development in atherosclerosis-susceptible mice.
- the peptides show varying, but significant degrees of efficacy in mitigating one or more symptoms of the various pathologies described herein. A number of such peptides are illustrated in Table 2.
- NMA is N-Methyl Anthranilyl
- the peptides include variations of 4F (D-W-F-K-A-F-Y-D-K- V-A-E-K-F-K-E-A-F (SEQ ID NO: 16) in Table 2), also known as L-4F, where all residues are L form amino acids) or D-4F where one or more residues are D form amino acids).
- 4F D-W-F-K-A-F-Y-D-K- V-A-E-K-F-K-E-A-F (SEQ ID NO: 16) in Table 2
- L-4F L-4F, where all residues are L form amino acids
- D-4F where one or more residues are D form amino acids
- the C-terminus, and/or N-terminus, and/or internal residues can be blocked with one or more blocking groups as described herein.
- peptides of Table 2 are illustrated with an acetyl group or an N- methylanthranilyl group protecting the amino terminus and an amide group protecting the carboxyl terminus, any of these protecting groups may be eliminated and/or substituted with another protecting group as described herein.
- the peptides can comprise one or more D-form amino acids as described herein. In certain aspects, every amino acid (e.g., every amino acid (e.g., every other amino acid).
- enantiomeric amino acid of the peptides of Table 2 is a D-form amino acid.
- Table 2 is not fully inclusive.
- other suitable class A amphipathic helical peptides can routinely be produced (e.g., by conservative or semi-conservative substitutions (e.g., D replaced by E), extensions, deletions, and the like).
- one embodiment utilizes truncations of any one or more of peptides shown herein (e.g., peptides identified as 2F, 3F, 3F14, 4F, 5F, 6F, or 7F-in Table 2).
- A-F-Y-D-K-V-A-E-K-L-K-E-A-F (amino acids 5-18 of SEQ ID NO:5) illustrates a peptide comprising 14 amino acids from the C-terminus of 18A comprising one or more D amino acids, while others illustrate other truncations.
- Longer peptides are also suitable. Such longer peptides may entirely form a class A amphipathic helix, or the class A amphipathic helix (helices) can form one or more domains of the peptide. In addition, this invention contemplates multimeric versions of the peptides
- peptides illustrated herein can be coupled together
- Illustrative polymeric peptides include 18A-Pro-18A and the peptides in the following table, in certain embodiments comprising one or more D amino acids, more preferably with every amino acid a D amino acid as described herein and/or having one or both termini protected.
- Aromatic or Aliphatic Residues in the Non-Polar Face are Aromatic or Aliphatic Residues in the Non-Polar Face.
- modified class A amphipathic helix peptides incorporate one or more aromatic residues at the center of the nonpolar face, e.g., 3F Clt , (as present in 4F), or with one or more aliphatic residues at the center of the nonpolar face, e.g., 3F lK , see, e.g., Table 3.
- the central aromatic residues on the nonpolar face of the peptide 3F Clt due to the presence of ⁇ electrons at the center of the nonpolar face can allow water molecules to penetrate near the hydrophobic lipid alkyl chains of the peptide-lipid complex, which in turn would enable the entry of reactive oxygen species (such as lipid hydroperoxides) shielding them from the cell surface.
- the peptides with aliphatic residues at the center of the nonpolar face e.g., 3F lK , can act similarly but not quite as effectively as 3F Clt .
- the peptides can convert pro-inflammatory HDL to antiinflammatory HDL or make anti-inflammatory HDL more anti-inflammatory, and/or decrease LDL-induced monocyte chemotactic activity generated by artery wall cells equal to or greater than D4F or other peptides shown in Table 2.
- Class A amphipathic helical peptides that have an amino acid composition identical to one or more of the class A amphipathic helical peptides described above.
- this invention contemplates peptides having an amino acid composition identical to 4F.
- this invention includes active agents that comprise a peptide that consists of 18 amino acids, where the 18 amino acids consist of 3 alanines (A), 2 aspartates (D), 2 glutamates (E), 4 phenylalanines (F), 4 lysines (K), 1 valine (V), 1 tryptophan (W), and 1 tyrosine (Y); and where the peptide forms a class A amphipathic helix; and protects a phospholipid against oxidation by an oxidizing agent.
- the peptides comprise least one "D” amino acid residue; and in certain embodiments, the peptides comprise all "D: form amino acid residues.
- Table 4 Reverse (retro-), inverse, retro-inverso-, and circularly permuted forms of these peptides are also contemplated.
- Lipid-associating peptides can comprise a peptide that is 18 amino acids in length and forms a class A amphipathic helix where the peptide has the amino acid composition 2 aspartates, 2 glutamates, 4 lysines, 1 tryptophan, 1 tyrosine, no more than one leucine, no more than 1 valine, no less than 1 and no more than 3 alanines, and with 3 to 6 amino acids from the group: phenylalanine, alpha- naphthalanine, beta-naphthalanine, histidine, and contains either 9 or 10 amino acids on the polar face in a helical wheel representation of the class A amphipathic helix including 4 amino acids with positive charge at neutral pH with two of the positively charged residues residing at the interface between the polar and non-polar faces and with two of the four positively charged residues on the polar face that are contiguous and on the non-polar face two of the amino acid residues from the group: phenylalanine
- Class Y amphipathic helical peptides are known to those of skill in the art (see, e.g., Segrest et al. (1992) J. Lipid Res. 33 : 141-166; Oram and Heinecke (2005) Physiol Rev. 85: 1343- 1372, and the like). These peptides include, but are not limited to, an 18 amino acid peptide that forms a class A amphipathic helix or a class Y amphipathic helix described by formula I:
- D X X K Y X X D K X Y D KX K D Y X (SEQ ID NO:367) I where the D's are independently Asp or Glu; the Ks are independently Lys or Arg; the Xs are independently Leu, norLeu, Val, He, Trp, Phe, Tyr, ⁇ -Nal, or a-Nal and all X residues are on the non-polar face (e.g., when viewed in a helical wheel diagram) except for one that can be on the polar face between two K residues; the Y's are independently Ala, His, Ser, Gin, Asn, or Thr non-polar f ace (e.g., when viewed in a helical wheel diagram) and the Y's are independently one Ala on the polar face, one His, one Ser, one Gin one Asn, or one Thr on the polar face (e.g., when viewed in a helical wheel diagram), where no more than two K
- Illustrative peptides of this kind which include peptides with histidine, and/or alpha- and/or beta-napthalanine are shown in Table 5. Reverse (retro-), inverse, retro-inverso-, and circularly permuted forms of these peptides are also present.
- R2-4F-2 Ac- -DRWKAVYDKFAEAFKEFF-NH2 (SEQ ID NO: 547)
- R4-4F-2 Ac- -DKWRAVYDKFAEAFKEFF-NH2 (SEQ ID NO:548)
- R9-4F-2 Ac- -DKWKAVYDRFAEAFKEFF-NH2 (SEQ ID NO:549)
- R14-4F-2 Ac- -DKWKAVYDKFAEAFREFF-NH2 (SEQ ID NO: 550)
- Rev4F-2 Ac- -FFEKFAEAFKDYVAKWKD-NH2 (SEQ ID NO:551)
- Rev-R4-4F-2 Ac- -FFERFAEAFKDYVAKWKD-NH2 (SEQ ID NO:554)
- Rev-R10-4F-2 Ac- -EFERFAEAFRDYVAKWKD-NH2 (SEQ ID NO:555)
- Rev-R15-4F-2 Ac- -FFEKFAEAFKDYVARWKD-NH2 (SEQ ID NO:556)
- Rev-R17-4F-2 Ac- -FFERFAEAFKDYVAKWRD-NH2 (SEQ ID NO:557)
- any of the peptides described herein can comprise non-natural amino acids in addition to or instead of the corresponding the natural amino acids identified herein.
- Such modifications include, but are not limited to acetylation, amidation, formylation, methylation, sulfation, and the like.
- Illustrative non-natural amino acids include, but are not limited to Ornithine, norleucine, norvaline, N-methylvaline, 6-N-methyllysine, N- methylisoleucine, N-methylglycine, sarcosine, inosine, allo-isoleucine, isodesmolysine, 4- hydroxyproline, 3-hydroxyproline, allo-hydroxylysine, hydoxylisine, N-ethylasparagine, N- ethylglycine, 2,3-diaminopropionic acid, 2,2'-diaminopropionic acid, desmosine, 2,4- diaminobutyric acid, 2-aminopimelic acid, 3-aminoisobutyric acid, 2-aminoisobutyric acid, 2- aminoheptanoic acid, 6-aminocaproic acid, 4-aminobutyric acid, 2-aminobutyric acid, beta- alanine, 3-a
- this invention contemplates particularly the use of modified lysines.
- modifications include, but are not limited to, biotin modification of epsilon lysines and/or methylation of the epsilon lysines.
- Illustrative peptide comprising epsilon methylated lysines include, but are not limited to: Ac-D-W-F-K(eCH 3 ) 2 -A-F-Y-D- K(eCH 3 ) 2 -V-A-E-K(eCH 3 )- 2-F-K(eCH 3 )2-E-A-F-NH(CH 3 )2 (SEQ ID NO: 573) and: Ac- DWFK(eCH 3 ) 2 AFYDK(eCH 3 ) 2 VAEK(eCH 3 ) 2 FK(eCH 3 ) 2 EAF-NH(CH 3 ) (SEQ ID NO:574).
- Other modified amino acids include but are not limited to ornithine analogs and
- Dual domain peptides are also disclosed. Dual domain peptides can be synthetic Apo E mimetics, consisting of a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide.
- synthetic Apo E mimetics consisting of a combination of the disclosed receptor binding domains of apolipoprotein B and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide.
- Non-limiting examples of the disclosed synthetic Apo E mimetics are provided in Table 7.
- the disclosed synthetic Apo E mimetics can also be N-terminally protected using acetyl and amino groups.
- the synthetic Apo E mimetics consist of: a receptor binding domain of apolipoprotein E comprising the amino acid sequence of LRKLRKRFFR (SEQ ID NO: 12); and a lipid-associating peptide, wherein said receptor binding domain is covalently linked to said lipid-associating peptide.
- the receptor binding domain replaced the two leucine (L) residues at positions 148 and 149 of
- LRKLRKRLLR (SEQ ID NO:4) (hApoE[141-150], LRKLRKRLLR; SEQ ID NO:4) with two phenylalanine (F) residues.
- the synthetic Apo E mimetics comprise: a lipid binding domain of apolipoprotein E comprising the amino acid sequence of E-W-L-K- A-F-Y-D-K-V-F-E-K-F-K-E-A-F (SEQ ID NO:28); and a receptor binding domain peptide, wherein said lipid binding domain is covalently linked to said receptor binding domain peptide.
- the lipid binding domain replaced the two leucine (L) residues of
- DWLKAFYDKVAEKLKEAF (SEQ ID NO: 5) (18A) with two phenylalanine (F) residues resulting in the sequence DWFKAFYDKVAEKFKEAF (SEQ ID NO: 16), also referred to as modified 18A or ml 8A).
- synthetic Apo E mimetics consisting of a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide in a domain switched orientation.
- synthetic Apo E mimetics consisting of a combination of the disclosed receptor binding domains of apolipoprotein B and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide in a domain switched orientation.
- These peptides can be referred to as "domain switched" "switched domain", or "switched” peptides.
- synthetic Apo E mimetics consisting of a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide in a domain switched orientation to those described above and in Table 7.
- the lipid-associating peptide is covalently linked to the receptor binding domain of apolipoprotein E such that the lipid-associating peptide is at the N-terminus of the synthetic apolipoprotein E-mimicking peptide.
- Non-limiting examples of the disclosed synthetic Apo E mimetics are provided in Table 8. Table 8 - Non-limiting Examples of Disclosed Synthetic Apo E mimetics
- the disclosed domain switched synthetic Apo E mimetics can also be N- terminally protected using acetyl and amino groups.
- synthetic Apo E mimetics consisting of a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein said receptor binding domain is covalently linked to said lipid-associating peptide in a reversed orientation.
- synthetic Apo E mimetics consisting of a combination of the disclosed receptor binding domains of apolipoprotein E and the disclosed lipid-associating peptides, wherein either the sequence of the receptor binding domain or the sequence of the lipid-associating peptide or both sequences are in the reversed orientation.
- Non-limiting examples of the disclosed synthetic Apo E mimetics are provided in Table 9.
- RVLRKRVNRL DWLKAFYDKVAEKLKEAF
- synthetic Apo E mimetics consisting of: a receptor binding domain of apolipoprotein E and a lipid-associating peptide, wherein said receptor binding domain is covalently linked to said lipid-associating peptide, wherein the receptor binding domain of apolipoprotein E is scrambled.
- synthetic Apo E mimetics consisting of: a receptor binding domain of apolipoprotein E and a lipid-associating peptide, wherein said receptor binding domain is covalently linked to said lipid-associating peptide, wherein the receptor binding domain of apolipoprotein E is scrambled.
- apolipoprotein E-mimicking peptide consisting of: a receptor binding domain of
- apolipoprotein E comprising the amino acid sequence of D-W-L-K-A-F-V-Y-D-K-V-F-K- L-K-E-F-F (SEQ ID NO:69); and a lipid-associating peptide, wherein said receptor binding domain is covalently linked to said lipid-associating peptide.
- synthetic Apo E mimetics consisting of: a receptor binding domain of apolipoprotein B and a lipid- associating peptide, wherein said receptor binding domain is covalently linked to said lipid- associating peptide, wherein the receptor binding domain of apolipoprotein B is scrambled.
- a synthetic Apo E mimetics comprising: a lipid binding domain of apolipoprotein E comprising the amino acid sequence of E-W-L-K-A-F-V-Y-E-K-V-F-K-L-K-E-F-F (SEQ ID NO:70) and a receptor binding domain peptide, wherein said lipid binding domain is covalently linked to said receptor binding domain peptide.
- Non-limiting examples of the disclosed scrambled synthetic Apo E mimetics are provided in Table 10.
- the disclosed scrambled synthetic Apo E mimetics can also be N-terminally and C-terminally protected using acetyl and amide groups.
- the disclosed scrambled synthetic Apo E mimetics can also be reverse-oriented as described above,
- Any suitable linker can be used in accordance with the present invention.
- One particularly preferred non-peptide linkage is— CH 2 NH— .
- Such peptide mimetics may have significant advantages over polypeptide embodiments, including, for example: more economical production, greater chemical stability, enhanced pharmacological properties (half-life, absorption, potency, efficacy, etc.), reduced antigenicity, and others.
- the linker is a cleavable linker.
- cleavable linkers include protease cleavable peptide linkers, nuclease sensitive nucleic acid linkers, lipase sensitive lipid linkers, glycosidase sensitive carbohydrate linkers, pH sensitive linkers, hypoxia sensitive linkers, photo-cleavable linkers, heat-labile linkers, enzyme cleavable linkers (e.g., esterase cleavable linker), ultrasound-sensitive linkers, x-ray cleavable linkers, etc.
- protease cleavable peptide linkers include protease cleavable peptide linkers, nuclease sensitive nucleic acid linkers, lipase sensitive lipid linkers, glycosidase sensitive carbohydrate linkers, pH sensitive linkers, hypoxia sensitive linkers, photo-cleavable linkers, heat-labile linkers, enzyme cleavable linkers (e.g., este
- the receptor binding domain or the lipid-associating peptide can be modified or altered as described above.
- the receptor binding domain or the lipid-associating peptide can be mutated, scrambled, and/or reverse-oriented. Any other modifications or alterations disclosed herein for the dual-domain polypeptides can also be used for the single- domain peptides.
- peptides disclosed herein are also contemplated.
- scrambled peptides can also be reverse-oriented, or can be in a switched orientation.
- reverse-oriented peptides can be in a switched orientation. All other combinations of the disclosed peptides are also contemplated.
- Non- limiting examples of the peptides have been described herein (see Tables 1-5, for example).
- the term “analog” is used interchangeably with "variant” and “derivative.”
- variants and derivatives are well understood to those of skill in the art and can involve amino acid sequence modifications. Such, amino acid sequence modifications typically fall into one or more of three classes: substantial; insertional; or deletional variants.
- Insertions include amino and/or carboxyl terminal fusions as well as intrasequence insertions of single or multiple amino acid residues. Insertions ordinarily are smaller insertions than those of amino or carboxyl terminal fusions, for example, on the order of one to four residues.
- These variants ordinarily are prepared by site-specific mutagenesis of nucleotides in the DNA encoding the protein, thereby producing DNA encoding the variant, and thereafter expressing the DNA in recombinant cell culture. Techniques for making substitution mutations at predetermined sites in DNA having a known sequence are well known, for example Ml 3 primer mutagenesis and PCR mutagenesis. Amino acid substitutions are typically of single residues, but can occur at a number of different locations at once.
- substitutions, deletions, insertions or any combination thereof may be combined to arrive at a final derivative or analog.
- Substitutional variants are those in which at least one residue has been removed and a different residue inserted in its place. Such substitutions generally are made in accordance with Tables 1 1 and 12 and are referred to as conservative substitutions.
- substitutions that are less conservative than those in Table 11, i.e., selecting residues that differ more significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- substitutions which in general are expected to produce the greatest changes in the protein properties are those in which: (a) the hydrophilic residue, e.g.
- seryl or threonyl is substituted for (or by) a hydrophobic residue, e.g., leucyl, isoleucyl, phenylalanyl, valyl or alanyl; Tryptophan, Tyrosinyl (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, e.g., lysyl, arginyl, or hystidyl, is substituted for (or by) an electronegative residue, e.g.
- variants and derivatives of the disclosed proteins herein are to define them in terms of homology/identity to specific known sequences.
- variants of synthetic Apo E mimetics and other proteins or peptides herein disclosed which have at least, 70% or at least 75% or at least 80% or at least 85% or at least 90% or at least 95% homology to the synthetic Apo E mimetics specifically recited herein.
- Those of skill in the art readily understand how to determine the homology of two proteins.
- polypeptides can be modified by either natural processes, such as post- translational processing, or by chemical modification techniques which are well known in the art. Modifications can occur anywhere in the polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. The same type of modification can be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide can have many types of modifications.
- Modifications include, without limitation, acetylation, acylation, ADP-ribosylation, amidation, covalent cross-linking or cyclization, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of a phosphytidylinositol, disulfide bond formation, demethylation, formation of cysteine or pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, yristolyation, oxidation, pergylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, and transfer-RNA mediated addition of amino acids to protein such as arginylation.
- Variants can also include peptidomimetics.
- peptidomimetic means a mimetic of a function of a protein which includes some alteration of the normal peptide chemistry.
- Peptidomimetics typically are short sequences of amino acids that in biological properties, mimic one or more function(s) of a particular protein. Peptide analogs enhance some property of the original peptide, such as increases stability, increased efficacy, enhanced delivery, increased half-life, etc. Methods of making peptidomimetics based upon a known polypeptide sequence is described, for example, in U.S. Patent Nos. 5,631,280; 5,612,895; and 5,579,250.
- peptidomimetics can involve the incorporation of a non- amino acid residue with non-amide linkages at a given position.
- One embodiment of the present invention is a peptidomimetic wherein the compound has a bond, a peptide backbone or an amino acid component replaced with a suitable mimic.
- unnatural amino acids which may be suitable amino acid mimics include ⁇ -alanine, L-a- amino butyric acid, L-y-amino butyric acid, L-a-amino isobutyric acid, L-e-amino caproic acid, 7-amino heptanoic acid, L-aspartic acid, L-glutamic acid, ⁇ - ⁇ -Boc-N-a-CBZ-L-lysine, ⁇ - ⁇ -Boc-N-a-Fmoc-L-lysine, L-methionine sulfone, L-norleucine, L-norvaline, N-a-Boc-N- 5CBZ-L-ornithine, ⁇ - ⁇ -Boc-N-a-CBZ-L-ornithine, Boc-p-nitro-L-phenylalanine, Boc- hydroxyproline, and Boc-L-thioproline.
- nucleic acids that can encode those polypeptide sequences are also disclosed. This would include all degenerate sequences related to a specific polypeptide sequence, i.e. all nucleic acids having a sequence that encodes one particular polypeptide sequence as well as all nucleic acids, including degenerate nucleic acids, encoding the disclosed variants and derivatives of the protein sequences. Thus, while each particular nucleic acid sequence may not be written out herein, it is understood that each and every sequence is in fact disclosed and described herein through the disclosed polypeptide sequences.
- compositions described herein may be shown with no protecting groups, in certain embodiments (e.g., particularly for oral administration), they can bear one, two, three, four, or more protecting groups.
- the protecting groups can be coupled to the C- and/or N-terminus of the peptide(s) and/or to one or more internal residues comprising the peptide(s) (e.g., one or more R-groups on the constituent amino acids can be blocked).
- any of the peptides described herein can bear, e.g., an acetyl group protecting the amino terminus and/or an amide group protecting the carboxyl terminus.
- a “dual protected peptide” is Ac- LRKLRKRLLRDWLKAFYDKVAEKLKEAF-NH 2 (SEQ ID NO: l) with blocking groups), either or both of these protecting groups can be eliminated and/or substituted with another protecting group as described herein.
- blockage, particularly of the amino and/or carboxyl termini of the subject peptides of this invention can improve oral delivery and can also increase serum half-life.
- a wide number of protecting groups are suitable for this purpose.
- Such groups include, but are not limited to acetyl, amide, and alkyl groups with acetyl and alkyl groups being particularly preferred for N-terminal protection and amide groups being preferred for carboxyl terminal protection.
- the protecting groups can include, but are not limited to alkyl chains as in fatty acids, propeonyl, formyl, and others.
- Carboxyl protecting groups include amides, esters, and ether-forming protecting groups can also be used.
- an acetyl group can be used to protect the amino terminus and an amide group can be used to protect the carboxyl terminus.
- Additional blocking groups include alkyl groups of various lengths, e.g., groups having the formula: CH 3 (CH 2 ) n CO where n ranges from about 1 to about 20, preferably from about 1 to about 16 or 18, more preferably from about 3 to about 13, and most preferably from about 3 to about 10.
- the protecting groups include, but are not limited to alkyl chains as in fatty acids, propeonyl, formyl, and others.
- carboxyl protecting groups can include amides, esters, and ether-forming protecting groups. These blocking groups can enhance the helix-forming tendencies of the peptides.
- Blocking groups can include alkyl groups of various lengths, e.g., groups having the formula: CH 3 (CH 2 ) n CO where n ranges from about 3 to about 20, preferably from about 3 to about 16, more preferably from about 3 to about 13, and most preferably from about 3 to about 10.
- Other protecting groups include, but are not limited to Fmoc, t-butoxycarbonyl (t- BOC), 9-fluoreneacetyl group, 1-fluorenecarboxylic group, 9-florenecarboxylic group, 9- fluorenone-l-carboxylic group, benzyloxycarbonyl, Xanthyl (Xan), Trityl (Trt), 4- methyltrityl (Mtt), 4-methoxytrityl (Mmt), 4-methoxy-2,3,6-trimethyl-benzenesulphonyl (Mtr), Mesitylene-2-sulphonyl (Mts), 4,4-dimethoxybenzhydryl (Mbh),Tosyl (Tos),
- Protecting/blocking groups are well known to those of skill as are methods of coupling such groups to the appropriate residue(s) comprising the peptides of this invention (see, e.g., Greene et al., (1991) Protective Groups in Organic Synthesis, 2nd ed., John Wiley & Sons, Inc. Somerset, N.J.). For example, acetylation can be accomplished during the synthesis when the peptide is on the resin using acetic anhydride. Amide protection can be achieved by the selection of a proper resin for the synthesis.
- compositions disclosed herein can also comprise one or more D-form (dextro rather than levo) amino acids as described herein.
- D-form amino acids for example, at least two enantiomeric amino acids, at least 4 enantiomeric amino acids or at least 8 or 10 enantiomeric amino acids can be in the "D" form amino acids.
- every other, or even every amino acid (e.g., every enantiomeric amino acid) of the peptides described herein is a D-form amino acid.
- At least 50% of the enantiomeric amino acids can be "D" form, at least 80% of the enantiomeric amino acids are “D” form, at least 90%, or even all of the enantiomeric amino acids can be in the "D” form amino acids.
- Methods of treating atherosclerosis, peripheral or cerebral vascular disease by administering an effective amount of an Apo E mimetic for at least one treatment cycle followed by a rest phase are provided.
- the disclosed methods involve administering an Apo E mimetic using one or more of the disclosed dosing regimens.
- any of the disclosed treatment cycles or rest phases can be used in the disclosed methods.
- the methods disclosed herein can allow for prolonged therapeutic effects even in the absence of the therapeutic.
- the disclosed methods can include the administration of an effective amount of Apo E mimetic.
- the effective amount of an Apo E mimetic can be an amount that allows for sustained therapeutic effects after the Apo E mimetic has been withdrawn.
- administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase.
- administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, wherein the rest phase is at least four weeks.
- administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, further comprising a second treatment cycle after the rest phase.
- the second treatment cycle can be administered after a four week rest phase or one year from the beginning of the initial treatment cycle.
- the atherosclerosis therapeutic other than an Apo E mimetic can be a conventional lipid lowering therapy and the conventional lipid lowering therapy can be a statin.
- administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the Apo E mimetic consists of the amino acid sequence
- LRKLRKRLLRDWLKAFYDKVAEKLKEAF SEQ ID NO: l
- administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, wherein the treatment cycle comprises administration of an effective amount of an Apo E mimetic once a week for three months.
- Disclosed herein are methods of treating peripheral vascular disease comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase.
- Peripheral vascular disease can also refer to peripheral artery
- Peripheral vascular disease refers to the obstruction of large arteries not within the coronary, aortic arch vasculature, or brain. PVD can result
- PVD can cause either acute or chronic ischemia (lack of blood supply). PVD can also refer to atherosclerotic blockages found in the lower extremity
- Peripheral artery occlusive disease is commonly divided in the Fontaine stages, introduced by Rene Fontaine in 1954 for ischemia.
- the Fontain stages are provide below in the following Table 13.
- Peripheral artery occlusive disease can also refer to a classification designed by Rutherford which consists of three grades and six categories. The Rutherford stages are provide below in the following Table 14.
- Disclosed herein are methods of treating peripheral vascular disease comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, wherein the rest phase is at least four weeks.
- Disclosed herein are methods of treating peripheral vascular disease comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, further comprising a second treatment cycle after the rest phase.
- the second treatment cycle can be administered after a four week rest phase or one year from the beginning of the initial treatment cycle.
- Disclosed herein are methods of treating peripheral vascular disease comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, wherein a peripheral vascular disease therapeutic other than an Apo E mimetic is administered during the rest phase.
- the atherosclerosis therapeutic other than an Apo E mimetic can be a conventional lipid lowering therapy and the conventional lipid lowering therapy can be one or more of the following: a statin, an antiplatelet drus, aspirin, clopidogrel, Cilostazol, or pentoxifylline.
- the atherosclerosis therapeutic other than an Apo E mimetic can also include surgical intervention, smoking cessation, management of diabetes, management of hypertension management of cholesterol, exercise, Angioplasty (PTA or percutaneous transluminal angioplasty), plaque excision, bypass grafting, sympathectomy, amputation, or thrombolysis.
- [00161] Disclosed herein are methods of treating peripheral vascular disease comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the Apo E mimetic consists of the amino acid sequence
- LRKLRKRLLRDWLKAFYDKVAEKLKEAF SEQ ID NO: l
- [00162] Disclosed herein are methods of treating peripheral vascular disease comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, wherein the treatment cycle comprises administration of an effective amount of an Apo E mimetic once a week for three months.
- Disclosed herein are methods of treating critical limb ischemia comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase.
- CLI Critical limb ischemia
- Disclosed herein are methods of treating critical limb ischemia comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, wherein the rest phase is at least four weeks.
- Disclosed herein are methods of treating critical limb ischemia comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, further comprising a second treatment cycle after the rest phase.
- the second treatment cycle can be administered after a four week rest phase or one year from the beginning of the initial treatment cycle.
- Disclosed herein are methods of treating critical limb ischemia comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, wherein an peripheral vascular disease therapeutic other than an Apo E mimetic is administered during the rest phase.
- the critical limb ischemia therapeutic other than an Apo E mimetic can be a conventional lipid lowering therapy and the conventional lipid lowering therapy can be one or more of the following: a statin, an antiplatelet drus, aspirin, clopidogrel, Cilostazol, or pentoxifylline.
- the atherosclerosis therapeutic other than an Apo E mimetic can also include surgical intervention, smoking cessation, management of diabetes, management of hypertension management of cholesterol, exercise, Angioplasty (PTA or percutaneous transluminal angioplasty), plaque excision, bypass grafting, sympathectomy, amputation, or thrombolysis.
- Disclosed herein are methods of treating critical limb ischemia comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the Apo E mimetic consists of the amino acid sequence
- LRKLRKRLLRDWLKAFYDKVAEKLKEAF SEQ ID NO: l
- Disclosed herein are methods of treating critical limb ischemia comprising administering to a subject an effective amount of an Apo E mimetic for at least one treatment cycle, wherein the treatment cycle comprises administering an effective amount of an Apo E mimetic to allow for a sustained therapeutic effect after withdrawal of the Apo E mimetic, wherein the treatment cycle is followed by a rest phase, wherein Apo E mimetic is not administered during the rest phase, wherein the treatment cycle comprises administration of an effective amount of an Apo E mimetic once a week for three months.
- Any of the disclosed Apo E mimetics can be used in these methods.
- the Apo E mimetic can be hE18A (LRKLRKRLLRDWLKAFYDKVAEKLKEAF; SEQ ID NO: 1), in particular the Apo E mimetic can be the hEl 8A peptide that has an acetyl group on the amino terminus and an amide group at the carboxyl terminus.
- the disclosed methods of treating can occur at different times depending on the subject.
- treatment can occur in a subject considered to be of high, or high residual risk of a cardio- or cerebrovascular event.
- the treatment can be initiated after a subject is stabilized following an acute coronary event.
- the treatment can be initiated immediately after the acute coronary event, or 3, 6, 9, or 12 months after the acute coronary event.
- the treatment can be initiated following acute interventional cardiology procedures such as coronary artery bypass surgery (CABG), percutaneous coronary intervention (angioplasty, PCI), or implant of a stent into a coronary artery.
- CABG coronary artery bypass surgery
- PCI percutaneous coronary intervention
- implant of a stent into a coronary artery implant of a stent into a coronary artery.
- Subjects considered as high risk can be those individuals that have homozygous familial hypercholesterolemia (FH), severe refractory FH, diabetes or an individual following acute coronary syndrome (ACS). In high risk subjects, treatment can be extended.
- FH familial hypercholesterolemia
- ACS acute coronary syndrome
- the treatment cycle can vary in length of time.
- the treatment cycle can be at least four weeks but can last up to six months.
- the disclosed methods have a treatment cycle that involves the administration of an effective amount of an Apo E mimetic once a week for one month (four weeks), three months (12 weeks) or six months (24 weeks).
- a treatment cycle can include the administration of Apo E mimetic once, twice or three times a week.
- the Apo E mimetic can be administered daily.
- the Apo E mimetic can be administered once every two weeks or even once a month.
- the Apo E mimetic can be administered every two weeks for 4, 6, 8, 10, 12 , 14, 16, 18, 20, 22, or 24 weeks.
- Each treatment cycle can include an established length of time for administration as well as an established dosing schedule during that time frame.
- the methods can further include a second treatment cycle after the rest phase.
- the second treatment cycle can be administered after a four week rest phase.
- the second treatment cycle can be administered at least one year from the beginning of the initial treatment cycle. 2. Rest phase
- the rest phase as previously described with regards to the dosing regimen, can be at least four weeks but can last for several years. Apo E mimetic is not administered during the rest phase.
- the length of the rest phase is dependent on how long the sustained therapeutic effects of the Apo E mimetic administered during the treatment cycle last.
- the rest phase can be at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, or 12 months.
- the rest phase can be at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 years.
- the rest phase can be at least four weeks (one month).
- the rest phase can be decreased or extended depending on the dose of Apo E mimetic administered during the treatment cycle.
- the rest phase can be extended if the dose of Apo E mimetic during the treatment cycle is increased.
- the length of the rest phase can also vary based on the length of the treatment cycle. For instance, if a subject receives a certain dose of Apo E mimetic once a week for three months then the rest phase may be shorter than a subject that receives the same dose of Apo E mimetic once a week for six months.
- an atherosclerosis therapeutic other than an Apo E mimetic can be administered during the rest phase.
- the atherosclerosis therapeutic other than an Apo E mimetic can be a conventional lipid lowering therapy, such as a statin, or bile acid sequestrant, and/or a therapeutic such as a PCSK9 inhibitor, a VLDL synthesis inhibitor and/or a CETP inhibitor.
- the combination of LDL accumulation in a vessel wall and an inflammatory response to the LDL's is responsible for initiating atherosclerosis.
- the LDL within the vessel wall becomes oxidized which damages the vessel wall and triggers an immune response.
- Immune cells, such as macrophages are not able to process the oxidized-LDL and eventually rupture which leads to more oxidized cholesterol in the artery wall. This cycle continues which causes more and more damage to the vessel walls.
- the increase in cholesterol leads to plaques which ultimately results in hardening and narrowing of the vessel wall.
- the disclosed methods are useful for treating atherosclerosis. 4. Delivery
- administration or delivery of the Apo E mimetics can be via a variety of mechanisms.
- dosing regimens and methods of using those dosing regimens to treat atherosclerosis include compositions containing any one or more of the polypeptides or nucleic acids described herein that can also include a carrier such as a pharmaceutically acceptable carrier.
- a carrier such as a pharmaceutically acceptable carrier.
- pharmaceutical compositions comprising the Apo E mimetics disclosed herein, and a pharmaceutically acceptable carrier.
- the disclosed Apo E mimetics can be in solution or in suspension (for example, incorporated into microparticles, liposomes, or cells). These compositions can be targeted to a particular cell type via antibodies, receptors, or receptor ligands.
- a targeting agent can be a vehicle such as an antibody conjugated liposomes; receptor mediated targeting of DNA through cell specific ligands, and highly specific retroviral targeting of cells in vivo. Any such vehicles can be part of the compositions herein.
- targeting agents that direct the Apo E mimetic to the blood vessel walls can be included in the compositions.
- Suitable routes of administration can be used for the disclosed compositions.
- Suitable routes of administration can, for example, include topical, enteral, local, systemic, or parenteral.
- administration can be epicutaneous, inhalational, enema, conjunctival, eye drops, ear drops, alveolar, nasal, intranasal, enteral, oral, intraoral, transoral, intestinal, rectal, intrarectal, transrectal, injection, infusion, intravenous, intraarterial, intramuscular, intracerebral, intraventricular, intracerebroventricular, intracardiac, subcutaneous, intraosseous, intradermal, intrathecal, intraperitoneal, intravesical,
- compositions can be used in and with any other therapy.
- compositions described herein can comprise a pharmaceutically acceptable carrier.
- pharmaceutically acceptable is meant a material or carrier that would be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject, as would be well known to one of skill in the art.
- carriers include dimyristoylphosphatidyl (DMPC), phosphate buffered saline or a multivesicular liposome.
- DMPC dimyristoylphosphatidyl
- PG:PC:Cholesterol:peptide or PC:peptide can be used as carriers in this invention.
- Other suitable pharmaceutically acceptable carriers and their formulations are described in Remington: The Science and Practice of Pharmacy (19th ed.) ed. A.R. Gennaro, Mack Publishing Company, Easton, PA 1995.
- an appropriate amount of pharmaceutically-acceptable salt is used in the formulation to render the formulation isotonic.
- the pharmaceutically-acceptable carrier include, but are not limited to, saline, Ringer's solution and dextrose solution.
- the pH of the solution can be from about 5 to about 8, or from about 7 to about 7.5.
- Further carriers include sustained release preparations such as semi-permeable matrices of solid hydrophobic polymers containing the composition, which matrices are in the form of shaped articles, e.g., films, stents (which are implanted in vessels during an angioplasty procedure), liposomes or microparticles. It will be apparent to those persons skilled in the art that certain carriers may be more preferable depending upon, for instance, the route of administration and
- compositions being administered are typically administered. These most typically would be standard carriers for administration of drugs to humans, including solutions such as sterile water, saline, and buffered solutions at physiological pH.
- compositions may also include carriers, thickeners, diluents, buffers, preservatives and the like, as long as the intended activity of the polypeptide, peptide, nucleic acid, vector of the invention is not compromised.
- Pharmaceutical compositions may also include one or more active ingredients (in addition to the composition of the invention) such as antimicrobial agents, anti-inflammatory agents, anesthetics, and the like.
- active ingredients in addition to the composition of the invention
- the pharmaceutical composition may be administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated.
- Preparations of parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
- non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles include sodium choloride solution, Ringer's dextrose, dextrose and sodium choloride, lactated Ringer's, or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.
- compositions for oral administration include powders or granules, suspensions or solutions in water or non-aqueous media, capsules, sachets, or tablets. Thickeners, flavorings, diluents, emulsifiers, dispersing aids, or binders may be desirable.
- compositions may potentially be administered as a pharmaceutically acceptable acid- or base- addition salt, formed by reaction with inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid, and organic acids such as formic acid, acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, oxalic acid, malonic acid, succinic acid, maleic acid, and fumaric acid, or by reaction with an inorganic base such as sodium hydroxide, ammonium hydroxide, potassium hydroxide, and organic bases such as mon-, di-, trialkyl and aryl amines and substituted ethanolamines.
- inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid
- organic acids such as formic acid, acetic acid, propionic acid, glyco
- the peptides of this invention comprising D- form amino acids can be administered, even orally, without protection against proteolysis by stomach acid, etc. Nevertheless, in certain embodiments, peptide delivery can be enhanced by the use of protective excipients. This is typically accomplished either by complexing the polypeptide with a composition to render it resistant to acidic and enzymatic hydrolysis or by packaging the polypeptide in an appropriately resistant carrier such as a liposome. Means of protecting polypeptides for oral delivery are well known in the art (see, e.g., U.S. Pat. No. 5,391,377 describing lipid compositions for oral delivery of therapeutic agents).
- Elevated serum half-life can be maintained by the use of sustained-release protein "packaging" systems.
- sustained release systems are well known to those of skill in the art.
- the ProLease biodegradable microsphere delivery system for proteins and peptides (Tracy (1998) Biotechnol. Prog., 14: 108; Johnson et al. (1996) Nature Med. 2: 795; Herbert et al. (1998), Pharmaceut. Res. 15, 357) a dry powder composed of biodegradable polymeric microspheres containing the active agent in a polymer matrix that can be compounded as a dry formulation with or without other agents.
- the ProLease microsphere fabrication process was specifically designed to achieve a high encapsulation efficiency while maintaining integrity of the active agent.
- the process consists of (i) preparation of freeze-dried drug particles from bulk by spray freeze- drying the drug solution with stabilizing excipients, (ii) preparation of a drug-polymer suspension followed by sonication or homogenization to reduce the drug particle size, (iii) production of frozen drug-polymer microspheres by atomization into liquid nitrogen, (iv) extraction of the polymer solvent with ethanol, and (v) filtration and vacuum drying to produce the final dry-powder product.
- the resulting powder contains the solid form of the active agents, which is homogeneously and rigidly dispersed within porous polymer particles.
- the polymer most commonly used in the process poly(lactide-co-glycolide) (PLG), is both biocompatible and biodegradable.
- Encapsulation can be achieved at low temperatures (e.g., -40° C).
- the protein is maintained in the solid state in the absence of water, thus minimizing water- induced conformational mobility of the protein, preventing protein degradation reactions that include water as a reactant, and avoiding organic-aqueous interfaces where proteins may undergo denaturation.
- a preferred process uses solvents in which most proteins are insoluble, thus yielding high encapsulation efficiencies (e.g., greater than 95%).
- one or more components of the solution can be provided as a "concentrate”, e.g., in a storage container (e.g., in a premeasured volume) ready for dilution, or in a soluble capsule ready for addition to a volume of water.
- the Apo E mimetics can be administered alone or in combination with one or more additional therapeutic agents.
- the additional therapeutic agents are selected based on the disease or symptom to be treated. A description of the various classes of suitable pharmacological agents and drugs may be found in
- compositions containing Apo E mimetics can be administered in combination with one or more known therapeutic agents for treating atherosclerosis.
- therapeutic agents for treating atherosclerosis include, but are not limited to, cholesterol-lowering agents, blood pressure-lowering agents, blood thinning agents (i.e. medicines that prevent blood clots), anti-inflammatory agents, and antiatherogenic agents.
- cholesterol-lowering agents include, but are not limited to, a cholesterol absorption inhibitor, a bile acid sequestrant, a fibrate, a PCSK9 inhibitor, a microsomal triglyceride transfer protein inhibitor, an apolipoprotein B synthesis inhibitor, or a CETP inhibitor.
- the Apo E mimetics can be administered alone or in combination with one or more additional peripheral vascular disease therapeutic agents.
- pharmaceutical compositions containing Apo E mimetics can be administered in combination with one or more known therapeutic agents for treating peripheral vascular disease.
- Therapeutic agents for treating peripheral vascular disease include, but are not limited to, cholesterol-lowering agents, blood pressure-lowering agents, blood thinning agents (i.e. medicines that prevent blood clots), anti-inflammatory agents, and anti-atherogenic agents.
- cholesterol-lowering agents include, but are not limited to, a cholesterol absorption inhibitor, a bile acid sequestrant, a fibrate, a PCSK9 inhibitor, a microsomal triglyceride transfer protein inhibitor, an apolipoprotein B synthesis inhibitor, or a CETP inhibitor.
- the Apo E mimetics can be administered alone or in combination with one or more additional interventional therapies such as angioplasty, artherectomy or grafting.
- the Apo E mimetics can be administered alone or in combination with one or more additional critical limb ischemia therapeutic agents.
- pharmaceutical compositions containing Apo E mimetics can be administered in combination with one or more known therapeutic agents for treating critical limb ischemia.
- Therapeutic agents for treating critical limb ischemia include, but are not limited to, cholesterol-lowering agents, blood pressure-lowering agents, blood thinning agents (i.e. medicines that prevent blood clots), anti-inflammatory agents, and anti-atherogenic agents.
- cholesterol-lowering agents include, but are not limited to, a cholesterol absorption inhibitor, a bile acid sequestrant, a fibrate, a PCSK9 inhibitor, a microsomal triglyceride transfer protein inhibitor, an apolipoprotein B synthesis inhibitor, or a CETP inhibitor.
- the critical limb ischemia therapeutic other than an Apo E mimetic can be a conventional lipid lowering therapy and the conventional lipid lowering therapy can be one or more of the following: a statin, an antiplatelet drus, aspirin, clopidogrel, Cilostazol, or pentoxifylline.
- the atherosclerosis therapeutic other than an Apo E mimetic can also include surgical intervention, smoking cessation, management of diabetes, management of hypertension management of cholesterol, exercise, Angioplasty (PTA or percutaneous transluminal angioplasty), plaque excision, bypass grafting, sympathectomy, amputation, or thrombolysis.
- the Apo E mimetics can be administered in conjunction with or followed by any of the disclosed additional therapeutics.
- the treatments can be administered in conjunction with or followed by LDL apheresis.
- the combination therapies can include administering the Apo E mimetic and an additional therapeutic agent during the treatment cycle of a dosing regimen.
- the combination therapies can also include administering the Apo E mimetic during the treatment cycle and an additional therapeutic agent during the rest phase.
- Example 1 Study One - Prolonged effect of Apo E mimetics (a comparison of hE18A with mR18L, a single domain cationic peptide)
- Figure 1 shows the design of mR18L (Tytler et al. JBC, 268:221 12-221 18, 1993; Handattu et al. J. Lipid Res, 51 :3491-3499, 2010).
- the experimental protocol was performed in Apo E null mice as shown in Figure 2.
- the mice were fed a Western diet for 6 weeks to elevate cholesterol.
- the animals were then switched to a chow diet for two weeks after which they were treated with peptide or saline for 4 weeks. Treatment was then withdrawn for 4 weeks while the animals remained on a chow diet. After the 4 week post treatment phase, the mice were euthanized and tissue dissection and sample collection was performed.
- FIG. 3A shows a significant decrease in reactive oxygen species (ROS) in the hE18A treated mice compared to the saline treated mice. Because ROS have been implicated in the pathogenesis of atherosclerosis, the decrease in ROS by treatment with an Apo E mimetic is beneficial.
- ROS reactive oxygen species
- Figure 5B shows a significant increase in paraoxonase (PON) activity in hE18A treated mice compared to saline and mR18L treated mice.
- the PON gene family has anti- atherosclerotic effects, such as preventing oxidation of LDLs.
- the increase in PON activity in hE18A treated mice is beneficial in the atherosclerosis animal model.
- Figures 6A and 6B further shows the dramatic increase in PON-1 levels in HDL fractions in Apo E null mice treated with Ac-hE18A-NH 2.
- mice were euthanized at week 30, which is four weeks post treatment with Apo E mimetic.
- FIGs 7 and 8B show that cholesterol levels and ROS levels, respectively, were not significantly different four weeks after the end of treatment period.
- PON-1 activity was still increased in the hE18A treated mice over the saline and mR18L treated mice 4 weeks post treatment (Figure 8A).
- the atherosclerotic lesion area was significantly reduced in the hE18A treated mice compared to the saline or mR18L treated mice ( Figures 9A and 9B).
- Atherosclerotic lesion area in the aortic sinus was also significantly decreased by hE18A ( Figure 10), but not by mR18L.
- Figure 12 shows the study design used to treat Apo E -/- mice.
- the mice were fed a lard diet for seven weeks and then were switched to a chow diet for four weeks.
- the mice were treated two times a week for four weeks and then treatment was withdrawn for four weeks.
- Termination 1 represents the time point immediately following termination of the Apo E mimetic treatment.
- Termination 2 represents the time point immediately following the four weeks of treatment withdrawal.
- Lipids were analyzed in the plasma (cholesterol, triglycerides) and in the liver (cholesterol esters, unesterified cholesterol, triglycerides).
- a cardiovascular analysis was also performed and the different regions of the aorta that were analyzed are shown in Figure 15.
- PON-1 activity remained elevated in the Apo E mimetic treated animals.
- PON-1 is a major anti-atherosclerotic component of HDL, and thus improves HDL function. All of these sustained benefits indicate that a course of treatment with Ac-hE18A-NH2 reduces atherosclerotic burden, improves the health of the artery wall, and rejuvenates the artery wall, regressing atherosclerosis caused by chronic hypercholesterolemia and inflammation.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Marine Sciences & Fisheries (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Toxicology (AREA)
- Vascular Medicine (AREA)
- Urology & Nephrology (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NZ713291A NZ713291A (en) | 2013-03-14 | 2014-03-14 | Apolipoprotein mimetics and uses thereof |
| US14/770,270 US20160002315A1 (en) | 2013-03-14 | 2014-03-14 | Apolipoprotein mimetics and uses thereof |
| CA2903869A CA2903869A1 (en) | 2013-03-14 | 2014-03-14 | Apolipoprotein e dosing regimen for treating atherosclerosis |
| AU2014239186A AU2014239186B2 (en) | 2013-03-14 | 2014-03-14 | Apolipoprotein mimetics and uses thereof |
| ES14769489T ES2753381T3 (es) | 2013-03-14 | 2014-03-14 | Miméticos de apolipoproteína y usos de los mismos |
| MX2015012818A MX2015012818A (es) | 2013-03-14 | 2014-03-14 | Mimeticos de apolipoproteina y usos de los mismos. |
| DK14769489.7T DK2996706T3 (da) | 2013-03-14 | 2014-03-14 | Apolipoprotein-mimetika og anvendelser deraf |
| EP14769489.7A EP2996706B1 (en) | 2013-03-14 | 2014-03-14 | Apolipoprotein mimetics and uses thereof |
| JP2016502527A JP6570511B2 (ja) | 2013-03-14 | 2014-03-14 | アポリポタンパク質模倣体及びその使用 |
| BR112015022624A BR112015022624A2 (pt) | 2013-03-14 | 2014-03-14 | regime de dose, e, método para tratamento de aterosclerose |
| IL240787A IL240787B (en) | 2013-03-14 | 2015-08-24 | Mimetics of apoflavon and their uses |
| AU2017203911A AU2017203911B2 (en) | 2013-03-14 | 2017-06-09 | Apolipoprotein mimetics and uses thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361782956P | 2013-03-14 | 2013-03-14 | |
| US61/782,956 | 2013-03-14 | ||
| US201361834992P | 2013-06-14 | 2013-06-14 | |
| US61/834,992 | 2013-06-14 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014152776A1 true WO2014152776A1 (en) | 2014-09-25 |
Family
ID=51581312
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/027719 Ceased WO2014152776A1 (en) | 2013-03-14 | 2014-03-14 | Apolipoprotein mimetics and uses thereof |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US20160002315A1 (https=) |
| EP (1) | EP2996706B1 (https=) |
| JP (2) | JP6570511B2 (https=) |
| AU (2) | AU2014239186B2 (https=) |
| BR (1) | BR112015022624A2 (https=) |
| CA (1) | CA2903869A1 (https=) |
| DK (1) | DK2996706T3 (https=) |
| ES (1) | ES2753381T3 (https=) |
| IL (1) | IL240787B (https=) |
| MX (1) | MX2015012818A (https=) |
| NZ (1) | NZ713291A (https=) |
| WO (1) | WO2014152776A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017120568A1 (en) * | 2016-01-08 | 2017-07-13 | Lipimetix Development, Inc. | Apoe mimetic peptide compositions |
| JP2019509271A (ja) * | 2016-02-17 | 2019-04-04 | リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. | Angptl3の阻害剤を投与することによるアテローム性動脈硬化症の処置又は予防のための方法 |
| US10653747B2 (en) | 2014-07-31 | 2020-05-19 | Uab Research Foundation | ApoE mimetic peptides and higher potency to clear plasma cholesterol |
| US12281173B2 (en) | 2016-03-03 | 2025-04-22 | Regeneron Pharmaceuticals, Inc. | Methods for treating patients with hyperlipidemia by administering a PCSK9 inhibitor in combination with an ANGPTL3 inhibitor |
| EP4384199A4 (en) * | 2021-08-11 | 2025-07-02 | The Regents Of Univ Of California | PEPTIDES FOR MEMBRANES RETAINING A BARRIER FUNCTION |
| US12559551B2 (en) | 2019-05-24 | 2026-02-24 | Regeneron Pharmaceuticals, Inc. | Stabilized formulations containing anti-ANGPTL3 antibodies |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0045665A1 (en) | 1980-08-06 | 1982-02-10 | Aktiebolaget Hässle | Enzyme inhibitors |
| US5391377A (en) | 1990-10-19 | 1995-02-21 | Cortecs Limited | Biphasic release formations for lipophilic acids |
| US5579250A (en) | 1990-12-14 | 1996-11-26 | Balaji; Vitukudi N. | Method of rational drug design based on AB initio computer simulation of conformational features of peptides |
| US5631280A (en) | 1995-03-29 | 1997-05-20 | Merck & Co., Inc. | Inhibitors of farnesyl-protein transferase |
| WO2002015923A1 (en) | 2000-08-24 | 2002-02-28 | The Regents Of The University Of California | Orally administered peptides to ameliorate atherosclerosis |
| US6506880B2 (en) | 1998-03-17 | 2003-01-14 | The Uab Research Foundation | Synthetic peptides that enhance atherogenic lipoprotein uptake and lower plasma cholesterol |
| WO2004034977A2 (en) | 2002-10-16 | 2004-04-29 | The Regents Of The University Of California | Orally administered peptides synergize statin activity |
| US20100286025A1 (en) | 2007-08-28 | 2010-11-11 | Anantharamaiah Gattadahalli M | Synthetic apolipoprotein e mimicking polypeptides and methods of use |
| US20130005645A1 (en) * | 2010-01-06 | 2013-01-03 | Vitek Michael P | Apoe peptide dimers and uses thereof |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016018665A1 (en) * | 2014-07-31 | 2016-02-04 | Uab Research Foundation | Apoe mimetic peptides and higher potency to clear plasma cholesterol |
-
2014
- 2014-03-14 US US14/770,270 patent/US20160002315A1/en not_active Abandoned
- 2014-03-14 BR BR112015022624A patent/BR112015022624A2/pt not_active Application Discontinuation
- 2014-03-14 DK DK14769489.7T patent/DK2996706T3/da active
- 2014-03-14 EP EP14769489.7A patent/EP2996706B1/en active Active
- 2014-03-14 WO PCT/US2014/027719 patent/WO2014152776A1/en not_active Ceased
- 2014-03-14 AU AU2014239186A patent/AU2014239186B2/en not_active Ceased
- 2014-03-14 CA CA2903869A patent/CA2903869A1/en not_active Abandoned
- 2014-03-14 NZ NZ713291A patent/NZ713291A/en not_active IP Right Cessation
- 2014-03-14 ES ES14769489T patent/ES2753381T3/es active Active
- 2014-03-14 MX MX2015012818A patent/MX2015012818A/es active IP Right Grant
- 2014-03-14 JP JP2016502527A patent/JP6570511B2/ja not_active Expired - Fee Related
-
2015
- 2015-08-24 IL IL240787A patent/IL240787B/en active IP Right Grant
-
2017
- 2017-06-09 AU AU2017203911A patent/AU2017203911B2/en not_active Ceased
-
2019
- 2019-02-18 JP JP2019026743A patent/JP6772317B2/ja not_active Expired - Fee Related
Patent Citations (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0045665A1 (en) | 1980-08-06 | 1982-02-10 | Aktiebolaget Hässle | Enzyme inhibitors |
| US5391377A (en) | 1990-10-19 | 1995-02-21 | Cortecs Limited | Biphasic release formations for lipophilic acids |
| US5579250A (en) | 1990-12-14 | 1996-11-26 | Balaji; Vitukudi N. | Method of rational drug design based on AB initio computer simulation of conformational features of peptides |
| US5612895A (en) | 1990-12-14 | 1997-03-18 | Balaji; Vitukudi N. | Method of rational drug design based on ab initio computer simulation of conformational features of peptides |
| US5631280A (en) | 1995-03-29 | 1997-05-20 | Merck & Co., Inc. | Inhibitors of farnesyl-protein transferase |
| US6506880B2 (en) | 1998-03-17 | 2003-01-14 | The Uab Research Foundation | Synthetic peptides that enhance atherogenic lipoprotein uptake and lower plasma cholesterol |
| WO2002015923A1 (en) | 2000-08-24 | 2002-02-28 | The Regents Of The University Of California | Orally administered peptides to ameliorate atherosclerosis |
| US6664230B1 (en) | 2000-08-24 | 2003-12-16 | The Regents Of The University Of California | Orally administered peptides to ameliorate atherosclerosis |
| WO2004034977A2 (en) | 2002-10-16 | 2004-04-29 | The Regents Of The University Of California | Orally administered peptides synergize statin activity |
| US20100286025A1 (en) | 2007-08-28 | 2010-11-11 | Anantharamaiah Gattadahalli M | Synthetic apolipoprotein e mimicking polypeptides and methods of use |
| US20130005645A1 (en) * | 2010-01-06 | 2013-01-03 | Vitek Michael P | Apoe peptide dimers and uses thereof |
Non-Patent Citations (43)
| Title |
|---|
| A.R. GENNARO: "Remington: The Science and Practice of Pharmacy, 19th ed.", 1995, MACK PUBLISHING COMPANY |
| ALMQUIST ET AL., J MED. CHEM., vol. 23, 1980, pages 1392 - 1398 |
| ANANTHARAMAIAH, METH. ENZYMOL, vol. 128, 1986, pages 626 - 668 |
| B.C. JOHNSON: "Posttranslational Covalent Modification of Proteins", 1983, ACADEMIC PRESS, pages: 1 - 12 |
| BRADLEY, W. A. ET AL., J. LIPID RES., vol. 27, 1986, pages 40 - 48 |
| DYER, C. A. ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 15009 - 15015 |
| DYER, C. A. ET AL., J. BIOL. CHEM., vol. 296, 1991, pages 22803 - 22806 |
| GOLDSTEIN ET AL., ANN. REV. CELL BIOL., vol. 1, 1985, pages 1 - 39 |
| GOODMAN; GILMAN: "The Pharmacological Basis of Therapeutics, 11th ed", 2005, MCGRAW-HILL PUBLISHING CO. |
| GREENE ET AL.: "Protective Groups in Organic Synthesis, 2nd ed.", 1991, JOHN WILEY & SONS, INC. |
| HANDATTU ET AL., J. LIPID RES, vol. 51, 2010, pages 3491 - 3499 |
| HANN, J CHEMSOC PERKIN TRANS I, 1982, pages 307 - 314 |
| HEESCHEN ET AL., CIRCULATION, vol. 105, 2002, pages 1446 - 1452 |
| HERBERT ET AL., PHARMACEUT. RES, vol. 15, 1998, pages 357 |
| HOLLADAY ET AL., TETRAHEDRON LETT, vol. 24, 1983, pages 4401 - 4404 |
| HRUBY, LIFE SCI., vol. 31, 1982, pages 189 - 199 |
| HUDSON ET AL., INT J PEPTPROT RES, vol. 14, 1979, pages 177 - 185 |
| JENNINGS-WHITE ET AL., TETRAHEDRON LETT., vol. 23, 1982, pages 2533 |
| JOHNSON ET AL., NATURE MED., vol. 2, 1996, pages 795 |
| LALAZAR, A. ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 3542 - 2545 |
| MAHLEY, R. W., SCIENCE, vol. 240, 1988, pages 622 - 630 |
| MAHLEY, R.W. ET AL., J. LIPID RES., vol. 40, 1999, pages 622 - 630 |
| MORLEY, TRENDS PHARM SCI, 1980, pages 463 - 468 |
| NAVAB ET AL.: "A novel method for oral delivery of apolipoprotein mimetic peptides synthesized from all L-amino acids.", J LIPID RES., vol. 50, no. 8, 1 January 2009 (2009-01-01), pages 1538 - 1547, XP055056762, DOI: 10.1194/JLR.M800539-JLR2 * |
| ORAM; HEINECKE, PHYSIOL REV., vol. 85, 2005, pages 1343 - 1372 |
| PALGUNACHARI ET AL., ARTERIOSCLEROSIS, THROMBOSIS, & VASCULAR BIOL., vol. 16, 1996, pages 328 - 338 |
| RALL, S. C., JR. ET AL., PNAS USA, vol. 79, 1982, pages 4696 - 4700 |
| See also references of EP2996706A4 |
| SEGREST ET AL., J. LIPID RES., vol. 33, 1992, pages 141 - 166 |
| SEGREST ET AL., J. LIPID. RES., vol. 42, 2001, pages 1346 - 1367 |
| SHIMONO, H. N. ET AL., EUR. J. CLIN. INVEST., vol. 90, 1992, pages 2084 - 2991 |
| SPANGENBERG, J. ET AL., BIOCHEM. BIOPHYS. ACTA, vol. 1349, 1997, pages 109 - 121 |
| SPARROW ET AL., BIOCHEMISTRY, vol. 31, no. 4, 1992, pages 1065 - 8 |
| SPATOLA ET AL., LIFE SCI, vol. 38, 1986, pages 1243 - 1249 |
| SPATOLA: "Chemistry and Biochemistry of Amino Acids, Peptides, and Proteins", 1983, MARCEL DEKKER, pages: 267 |
| SPATOLA: "Peptide Backbone Modifications", VEGA DATA, vol. 1, no. 3, 1983 |
| T.E. CREIGHTON: "Proteins - Structure and Molecular Properties, 2nd ed.", 1993, W.H. FREEMAN AND COMPANY |
| TRACY, BIOTECHNOL. PROG., vol. 14, 1998, pages 108 |
| TYTLER ET AL., JBC, vol. 268, 1993, pages 22112 - 22118 |
| VAN VELZEN ET AL., HELLENIC J CARDIOL, vol. 50, 2009, pages 245 - 263 |
| WILSON, C. ET AL., SCIENCE, vol. 252, 1991, pages 1817 - 1822 |
| YAMADA ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 86, 1989, pages 665 - 669 |
| ZHANG, S. H. ET AL., SCIENCE, vol. 258, 1992, pages 468 - 471 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10653747B2 (en) | 2014-07-31 | 2020-05-19 | Uab Research Foundation | ApoE mimetic peptides and higher potency to clear plasma cholesterol |
| USRE50320E1 (en) | 2014-07-31 | 2025-03-04 | Uab Research Foundation | APOE mimetic peptides and higher potency to clear plasma cholesterol |
| WO2017120568A1 (en) * | 2016-01-08 | 2017-07-13 | Lipimetix Development, Inc. | Apoe mimetic peptide compositions |
| JP2019509271A (ja) * | 2016-02-17 | 2019-04-04 | リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. | Angptl3の阻害剤を投与することによるアテローム性動脈硬化症の処置又は予防のための方法 |
| JP2022177107A (ja) * | 2016-02-17 | 2022-11-30 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Angptl3の阻害剤を投与することによるアテローム性動脈硬化症の処置又は予防のための方法 |
| JP7648335B2 (ja) | 2016-02-17 | 2025-03-18 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | Angptl3の阻害剤を投与することによるアテローム性動脈硬化症の処置又は予防のための方法 |
| US12281173B2 (en) | 2016-03-03 | 2025-04-22 | Regeneron Pharmaceuticals, Inc. | Methods for treating patients with hyperlipidemia by administering a PCSK9 inhibitor in combination with an ANGPTL3 inhibitor |
| US12559551B2 (en) | 2019-05-24 | 2026-02-24 | Regeneron Pharmaceuticals, Inc. | Stabilized formulations containing anti-ANGPTL3 antibodies |
| EP4384199A4 (en) * | 2021-08-11 | 2025-07-02 | The Regents Of Univ Of California | PEPTIDES FOR MEMBRANES RETAINING A BARRIER FUNCTION |
Also Published As
| Publication number | Publication date |
|---|---|
| BR112015022624A2 (pt) | 2017-10-31 |
| JP2019089834A (ja) | 2019-06-13 |
| AU2017203911B2 (en) | 2019-03-07 |
| IL240787B (en) | 2019-07-31 |
| US20160002315A1 (en) | 2016-01-07 |
| JP2016515137A (ja) | 2016-05-26 |
| EP2996706A4 (en) | 2017-01-18 |
| CA2903869A1 (en) | 2014-09-25 |
| AU2017203911A1 (en) | 2017-06-29 |
| ES2753381T3 (es) | 2020-04-08 |
| AU2014239186B2 (en) | 2017-04-20 |
| IL240787A0 (en) | 2015-10-29 |
| JP6570511B2 (ja) | 2019-09-04 |
| MX2015012818A (es) | 2016-05-12 |
| JP6772317B2 (ja) | 2020-10-21 |
| NZ713291A (en) | 2017-04-28 |
| EP2996706A1 (en) | 2016-03-23 |
| AU2014239186A1 (en) | 2015-10-08 |
| EP2996706B1 (en) | 2019-07-31 |
| DK2996706T3 (da) | 2019-10-21 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10653747B2 (en) | ApoE mimetic peptides and higher potency to clear plasma cholesterol | |
| AU2017203911B2 (en) | Apolipoprotein mimetics and uses thereof | |
| US8048851B2 (en) | Peptides and peptide mimetics to treat pathologies characterized by an inflammatory response | |
| AU2006242651B2 (en) | Peptides and peptide mimetics to treat pathologies characterized by an inflammatory response | |
| IL185959A (en) | Radio link protocol enhancements to reduce setup time for data calls | |
| US20080293639A1 (en) | Peptides and peptide mimetics to treat pathologies characterized by an inflammatory response | |
| RU2448977C2 (ru) | Обладающий способностью облегчать по меньшей мере один симптом воспалительного состояния пептид, содержащая его фармацевтическая композиция и способ лечения атеросклероза с их помощью | |
| HK1242718A1 (en) | Apoe mimetic peptides and higher potency to clear plasma cholesterol | |
| HK1242718B (zh) | Apoe模拟肽及对清除血浆胆固醇的较高效力 | |
| HK1147696A (en) | Peptides and peptide mimetics to treat pathologies characterized by an inflammatory response |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14769489 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 240787 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2903869 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2016502527 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2015/012818 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2014239186 Country of ref document: AU Date of ref document: 20140314 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014769489 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015022624 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112015022624 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150911 |