WO2014144573A2 - Multimerization technologies - Google Patents
Multimerization technologies Download PDFInfo
- Publication number
- WO2014144573A2 WO2014144573A2 PCT/US2014/029041 US2014029041W WO2014144573A2 WO 2014144573 A2 WO2014144573 A2 WO 2014144573A2 US 2014029041 W US2014029041 W US 2014029041W WO 2014144573 A2 WO2014144573 A2 WO 2014144573A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- component
- binding agent
- cells
- dimerization
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3053—Skin, nerves, brain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3084—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated gangliosides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
- C07K2317/14—Specific host cells or culture conditions, e.g. components, pH or temperature
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
Definitions
- Bi- and multi-specific binding agents are currently being developed for a variety of therapeutic, diagnostic, and research applications. Many such agents are generated by associating antibody components that target different antigens to one another, for example as fusion proteins or by cross-linking of antibody components. Such approaches, among others, have included generating multispecific antibodies by fusion of cells (e.g., hybridomas) that each express a monospecific antibody, chemical conjugation of two or more
- the present invention provides, among other things, improved multi-specific binding agents that include a multimerization component. Such provided agents have improved functional characteristics as compared to parental binding agents that lack such multimerization components.
- provided agents are comprised of individual polypeptides, each of which includes at least one, and more commonly at least two or more binding moieties that specifically interact with a particular target.
- binding moieties are or comprise antibody components.
- the present invention provides polypeptides comprising an antibody component having an amino acid sequence comprising at least binding elements of antibody 5F1 1.
- such individual polypeptides within provided agents are engineered to include a multimerization component.
- such polypeptides include a dimerization component.
- the dimerization component is an element of human hepatocyte nuclear factor- 1 alpha.
- provided agents are comprised of bispecific antibody polypeptides engineered to contain a multimerization component.
- the present invention provides bispecific binding agents comprised of two fusion proteins, each of which comprises a first antibody component that binds a first antigen; a second antibody component that binds a second antigen, and a dimerization component comprising a human hepatocyte nuclear factor- 1 alpha (HNF-la) element.
- bispecific binding agents comprised of two fusion proteins, each of which comprises a first antibody component that binds a first antigen; a second antibody component that binds a second antigen, and a dimerization component comprising a human hepatocyte nuclear factor- 1 alpha (HNF-la) element.
- first and second antigens of the present invention are not the same.
- a first antigen of the present invention is a tumor antigen.
- a tumor antigen is associated with a B cell or a T cell.
- a tumor antigen of the present invention is GD2.
- a tumor antigen of the present invention is GD3.
- a second antigen of the present invention is present on a first antigen of the present invention.
- a second antigen of the present invention is CD3.
- a dimerization component of the present invention has a sequence at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to amino acid residues 1 -32 of human HNF- la (SEQ ID NO: 1).
- a dimerization domain of the present invention has a sequence that is substantially identical to amino acid residues 1 -32 of human HNF-la (SEQ ID NO:l).
- a dimerization domain of the present invention comprises amino acid residues 1 -32 of human HNF-la (SEQ ID NO:l).
- a dimerization domain of the present invention is amino acid residues 1 -32 of human HNF-la (SEQ ID NO:l).
- a bispecific binding agent of the present invention has a sequence at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, or SEQ ID NO:23.
- a bispecific binding agent of the present invention has a sequence that is substantially identical to SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO:16, SEQIDNO:17, SEQ IDNO:18, SEQIDNO:19, SEQIDNO:20, SEQ IDNO:21, SEQ ID NO:22, or SEQ ID NO:23.
- a bispecific binding agent of the present invention has a sequence that is identical to SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO:ll, SEQIDNO:12, SEQ IDNO:13, SEQIDNO:14, SEQIDNO:15, SEQ IDNO:16, SEQ IDNO:17, SEQIDNO:18, SEQ ID NO:19, SEQIDNO:20, SEQ ID NO:21, SEQ ID NO:22, or SEQIDNO:23.
- a bispecific binding agent of the present invention comprises a sequence that is selected from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO:16, SEQIDNO:17, SEQ IDNO:18, SEQIDNO:19, SEQIDNO:20, SEQ IDNO:21, SEQ ID NO:22, and SEQ ID NO:23.
- a pharmaceutical composition comprising a bispecific binding agent of the present invention and a pharmaceutically acceptable carrier is provided.
- a fusion protein comprising, from 5 '-3', a first antibody component, a second antibody component, and a dimerization component comprising a human hepatocyte nuclear factor- 1 alpha (HNF- ⁇ ) element.
- a human HNF- ⁇ element comprises amino acid residues 1-32 of human HNF-la.
- first and second antibody components of a fusion protein of the present invention are single chain variable fragments (scFvs).
- a first scFv of a fusion protein of the present invention binds to a tumor antigen. In some embodiments, a first scFv of a fusion protein of the present invention binds to a tumor antigen that is GD2. In some embodiments, a first scFv of a fusion protein of the present invention binds to a tumor antigen that is GD3.
- a second scFv of a fusion protein of the present invention binds to an antigen present on T cells. In some embodiments, a second scFv of a fusion protein of the present invention binds to an antigen present on T cells that is CD3.
- a fusion protein of the present invention has a sequence at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO:ll, SEQIDNO:12, SEQ IDNO:13, SEQIDNO:14, SEQIDNO:15, SEQ IDNO:16, SEQ IDNO:17, SEQIDNO:18, SEQ ID NO:19, SEQIDNO:20, SEQ ID NO:21, SEQ ID NO:22, or SEQ ID NO:23.
- a fusion protein of the present invention has a sequence that is substantially identical to SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO:ll, SEQIDNO:12, SEQ IDNO:13, SEQIDNO:14, SEQIDNO:15, SEQ IDNO:16, SEQ IDNO:17, SEQIDNO:18, SEQ ID NO:19, SEQIDNO:20, SEQ ID NO:21, SEQ ID NO:22, or SEQ ID NO:23.
- a fusion protein of the present invention has a sequence that is identical to SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO: 10, SEQ ID NO: 1 1, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, or SEQ ID NO:23.
- a fusion protein of the present invention comprises a sequence that is selected from SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: l l, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, and SEQ ID NO:23.
- a dimeric bispecific binding agent comprised of two fusion proteins of the present invention is provided.
- a pharmaceutical composition comprising a dimeric bispecific binding agent that is comprised of two fusion proteins of the present invention and a pharmaceutically acceptable carrier is provided.
- nucleic acid sequence encoding a fusion protein of the present invention is provided.
- a vector comprising a nucleic acid sequence of the present invention is provided.
- a host cell comprising a vector of the present invention.
- a host cell of the present invention is selected from the group consisting of a bacterial, yeast, insect, or mammalian cell.
- a host cell of the present invention is selected from the group consisting of E. coli, Pichia pastoris, Sf9, COS, HEK293 and a CHO cell.
- a method of producing a dimeric bispecific binding agent of the present invention comprising culturing a host cell containing a vector comprising a nucleic acid sequence that encodes a fusion protein of the present invention under conditions suitable for expression of the dimeric bispecific binding agent, and recovering the dimeric bispecific binding agent.
- an improvement in method of providing a high affinity bispecific antibody composition comprising a bispecific antibody agent that includes first and second antibody components, an improvement is provided, said improvement comprises providing at least one of such first and second antibody components as a fusion with a dimerization component comprised of a human HNF- ⁇ dimerization element, so that the antibody component - dimerization component fusion is capable of forming a homodimer.
- a dimerization component of the present invention comprises amino acid residues 1-32 of human HNF-la.
- a method of killing tumor cells comprising steps of contacting the tumor cells with a bispecific binding agent, comprised of two fusion proteins that each comprise, from 5' to 3', a first antibody component that binds to a tumor antigen, a second antibody component that binds to CD3 on T cells, and a dimerization component comprising a human HNF-la element, such that the bispecific binding agent is capable of dimerization to form a homodimer, the contacting being performed under conditions and for a time sufficient that T cells to which the homodimer has bound mediate killing of the tumor cells.
- a dimerization component of the present invention comprises amino acid residues 1-32 of human HNF-la.
- a first and second antibody component of a bispecific binding agent of the present invention are single chain variable fragments (scFvs).
- a tumor antigen of the present invention is GD2. In some embodiments, a tumor antigen of the present invention is GD3.
- a method of inhibiting tumor growth comprising steps of contacting a tumor with a bispecific binding agent, comprised of two fusion proteins that each comprise, from 5' to 3', a first antibody component that binds to a tumor antigen, a second antibody component that binds to CD3 on T cells, and a dimerization component comprising a human HNF-la element, such that the bispecific antibody is capable of dimerization to form a homodimer, the contacting being performed under conditions and for a time sufficient that T cells to which the homodimer has bound inhibit growth of a tumor.
- a dimerization domain of the present comprises amino acid residues 1-32 of human HNF- ⁇ .
- a first and second antibody component of a bispecific binding agent of the present invention are single chain variable fragments (scFvs).
- a tumor antigen of the present invention is GD2. In some embodiments, a tumor antigen of the present invention is GD3.
- a bispecific binding agent comprised of two fusion proteins that each comprise, from 5' to 3 ', a first antibody component that binds to a tumor antigen, a second antibody component that binds to CD3 on T cells, and a dimerization component comprising a human HNF- ⁇ element, such that the bispecific binding agent is capable of dimerization to form a homodimer; wherein the homodimer is characterized by a longer half-life as compared to an otherwise comparable bispecific binding agent that does not comprise the dimerization component.
- a dimerization component of the present invention comprises amino acid residues 1-32 of human HNF- ⁇ .
- a first and second antibody component of a bispecific binding agent of the present invention are single chain variable fragments (scFvs).
- a tumor antigen of the present invention is GD2.
- a tumor antigen of the present invention is GD3.
- FIG. 1 shows schematic illustrations, not to scale, of SCFV5FH-SCFVO T3
- FIG. 2A shows ELISA binding curves of GD2 binding (top) and CD3 binding on Jurkat cells (bottom) for GD2xCD3 and GD2xCD3-HDD bispecific binding agents.
- FIG. 2B shows CD3 binding on Jurkat cells for GD2xCD3 and GD2xCD3-
- FIG. 3A and 3B shows Biacore sensorgrams of GD2 binding for GD2xCD3 and GD2xCD3-HDD bispecific binding agents. Traces are shown at the following bispecific antibody concentrations: 62.5, 125, 250,500, 1000, 2000 nM.
- FIG. 4 shows the percentage of T-cell mediated killing of melanoma and neuroblastoma cell lines in vitro for GD2xCD3 and GD2xCD3-HDD bispecific binding agents.
- FIG. 5 shows the tumor volume (mm 3 ) of subcutaneous SKNLD tumors implanted into BALB/cA-Rag2KO/IL-2RyKO (DKO) mice in control (no treatment), GD2xCD3, and GD2xCD3-HDD treated groups of a xenograft study model.
- FIG. 6 shows the tumor volume (mm 3 ) of subcutaneous Ml 4 tumors implanted into BALB/cA-Rag2KO/IL-2RyKO (DKO) mice in control (no treatment), GD2xCD3, and GD2xCD3-HDD treated groups of a xenograft study model.
- FIG. 7 shows ELISA binding curves of GD2 binding for 3LHBT and 3LHBT-
- FIG. 8 shows ELISA binding curves of GD2 binding for GD2xCD3 bispecific binding agents with different dimerization domains.
- FIG. 9 shows the percentage of T-cell mediated killing of melanoma and neuroblastoma cell lines in vitro for GD2xCD3 bispecific binding agents with different dimerization domains.
- affinity matured refers to an antibody with one or more alterations in one or more CDRs thereof which result an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s).
- affinity matured antibodies will have nanomolar or even picomolar affinities for a target antigen.
- Affinity matured antibodies may be produced by any of a variety of procedures known in the art. Marks et al.
- Antibody has its art understood meaning and refers to an immunoglobulin (Ig) that binds specifically to a particular antigen.
- Ig immunoglobulin
- antibodies produced in nature are typically comprised of four polypeptide chains, two heavy (H) chains and two light (L) chains.
- Each heavy and light chain is comprised of a variable region (abbreviated herein as HCVR or VH and LCVR or VL, respectively) and a constant region.
- the constant region of a heavy chain comprises a CHI , CH2 and CH3 domain (and optionally a CH4 domain in the case of IgM and IgE).
- the constant region of a light chain is comprised of one domain, CL.
- VH and VL regions further contain regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- Immunoglobulin molecules can be of any type (e.g., IgM, IgD, IgG, IgA and IgE), class (e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi and IgA 2 ) or subclass.
- type e.g., IgM, IgD, IgG, IgA and IgE
- class e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi and IgA 2
- subclass e.g., IgM, IgD, IgG, IgA and IgE
- Antibody component refers to a polypeptide element (that may be a complete polypeptide, or a portion of a larger polypeptide, such as for example a fusion polypeptide as described herein) that specifically binds to an epitope or antigen and includes one or more immunoglobulin structural features.
- an antibody component is any polypeptide whose amino acid sequence includes elements characteristic of an antibody binding region (e.g., an antibody light chain or variable region or one or more complementarity determining regions (“CDRs") thereof, or an antibody heavy chain or variable region or one more CDRs thereof, optionally in presence of one or more framework regions).
- an antibody component is or comprises a full-length antibody.
- an antibody component is less than full-length but includes at least one binding site (comprising at least one, and preferably at least two sequences with structure of known antibody “variable regions”).
- the term “antibody component” encompasses any protein having a binding domain which is homologous or largely homologous to an immunoglobulin-binding domain.
- an included “antibody component” encompasses polypeptides having a binding domain that shows at least 99% identity with an immunoglobulin binding domain.
- an included “antibody component” is any polypeptide having a binding domain that shows at least 70%, 75%, 80%, 85%, 90%, 95% or 98% identity with an immunoglobulin binding domain, for example a reference immunoglobulin binding domain.
- An included “antibody component” may have an amino acid sequence identical to that of an antibody (or a portion thereof, e.g., an antigen-binding portion thereof) that is found in a natural source.
- An antibody component may be monospecific, bi-specific, or multi-specific.
- An antibody component may include structural elements characteristic of any immunoglobulin class, including any of the human classes: IgG, IgM, IgA, IgD, and IgE.
- an antibody can be performed by fragments of a full-length antibody. Such antibody embodiments may also be bispecific, dual specific, or multi-specific formats; specifically binding to two or more different antigens.
- binding fragments encompassed within the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VH, VL, CHI and CL domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VH and VL domains of a single arm of an antibody, (v) a dAb fragment (Ward et al, (1989) Nature 341 :544-546), which comprises a single variable domain; and (vi) an isolated complementarity determining region (
- an “antibody component”, as described herein, is or comprises such a single chain antibody. In some embodiments, an “antibody component” is or comprises a diabody.
- Diabodies are bivalent, bispecific antibodies in which V H and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2: 1 121-1 123).
- Such antibody binding portions are known in the art (Kontermann and Dubel eds., Antibody Engineering (2001) Springer-Verlag. New York. 790 pp. (ISBN 3-540-41354-5).
- an antibody component is or comprises a single chain "linear antibody” comprising a pair of tandem Fv segments (VH-CH1-VH-CH1) which, together with
- an antibody component may have structural elements characteristic of chimeric or humanized antibodies.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity.
- donor antibody a non-human species
- an antibody component may have structural elements characteristic of a human antibody.
- Bio activity refers to an observable biological effect or result achieved by an agent or entity of interest.
- a specific binding interaction is a biological activity.
- modulation (e.g., induction, enhancement, or inhibition) of a biological pathway or event is a biological activity.
- presence or extent of a biological activity is assessed through detection of a direct or indirect product produced by a biological pathway or event of interest.
- Bispecific antibody refers to a bispecific binding agent in which at least one, and typically both, of the binding moieties is or comprises an antibody component.
- a variety of different bi-specific antibody structures is known in the art.
- each binding moiety in a bispecific antibody that is or comprises an antibody component includes VH and/or VL regions; in some such embodiments, the VH and/or VL regions are those found in a particular monoclonal antibody.
- each includes VH and/or VL regions from different monoclonal antibodies.
- Bispecific binding agent refers to a polypeptide agent with two discrete binding moieties, each of which binds with a distinct target.
- a bispecific binding agent is a single polypeptide; in some embodiments, a bispecific binding agent is or comprises a plurality of peptides which, in some such embodiments may be covalently associated with one another, for example by cross-linking.
- the two binding moieties of a bispecific binding agent recognize different sites (e.g., epitopes) the same target (e.g., antigen); in some embodiments, they recognize different targets.
- a bispecific binding agent is capable of binding simultaneously to two targets which are of different structure.
- Carrier refers to a diluent, adjuvant, excipient, or vehicle with which a composition is administered.
- carriers can include sterile liquids, such as, for example, water and oils, including oils of petroleum, animal, vegetable or synthetic origin, such as, for example, peanut oil, soybean oil, mineral oil, sesame oil and the like.
- carriers are or include one or more solid components.
- CDR refers to a complementarity determining region within an antibody variable region. There are three CDRs in each of the variable regions of the heavy chain and the light chain, which are designated CDR1, CDR2 and CDR3, for each of the variable regions.
- a “set of CDRs” or “CDR set” refers to a group of three or six CDRs that occur in either a single variable region capable of binding the antigen or the CDRs of cognate heavy and light chain variable regions capable of binding the antigen. Boundaries of CDRs have been defined differently depending on the system, of which several are known in the art (e.g., Kabat, Chothia, etc.).
- CDR-grafted antibody refers to an antibody whose amino acid sequence comprises heavy and light chain variable region sequences from one species but in which the sequences of one or more of the CDR regions of VH and/or VL are replaced with CDR sequences of another species, such as antibodies having murine VH and VL regions in which one or more of the murine CDRs (e.g., CDR3) has been replaced with human CDR sequences.
- a “CDR-grafted antibody” may also refer to antibodies having human VH and VL regions in which one or more of the human CDRs (e.g., CDR3) has been replaced with mouse CDR sequences.
- Chimeric antibody refers to an antibody whose amino acid sequence includes VH and VL region sequences that are found in a first species and constant region sequences that are found in a second species, different from the first species.
- a chimeric antibody has murine VH and VL regions linked to human constant regions.
- an antibody with human VH and VL regions linked to non- human constant regions is referred to as a "reverse chimeric antibody”.
- Comparable refers to two or more agents, entities, situations, sets of conditions, etc. that may not be identical to one another but that are sufficiently similar to permit comparison there between so that conclusions may reasonably be drawn based on differences or similarities observed. Those of ordinary skill in the art will understand, in context, what degree of identity is required in any given circumstance for two or more such agents, entities, situations, sets of conditions, etc. to be considered comparable.
- “Dimerization component”, as used herein, refers to a polypeptide element that, when included in a polypeptide chain, mediates non-covalent association of that chain with one or more other polypeptides also containing the dimerization component into a higher-order complex. Where the interacting polypeptide chains have identical sequences, the resulting associated higher order complex is referred to as a "homodimer" (or
- a dimerization component is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more amino acids in length.
- a dimerization component may include a site for covalent association, for example, by disulfide bond formation.
- a dimerization component for use in accordance with the present invention is or comprises an element found in human HNF- 1 a that mediates dimerization when introduced into a polypeptide other than HNF- la.
- Epitopope includes any moiety that is specifically recognized by an immunoglobulin (e.g., antibody or receptor) binding component.
- immunoglobulin e.g., antibody or receptor
- an epitope is comprised of a plurality of chemical atoms or groups on an antigen.
- such chemical atoms or groups are surface-exposed when the antigen adopts a relevant three-dimensional conformation.
- such chemical atoms or groups are physically near to each other in space when the antigen adopts such a conformation.
- at least some such chemical atoms are groups are physically separated from one another when the antigen adopts an alternative
- Excipient refers to a non-therapeutic agent that may be included in a pharmaceutical composition, for example to provide or contribute to a desired consistency or stabilizing effect.
- suitable pharmaceutical excipients include, for example, starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
- Framework refers to the sequences of a variable region minus the CDRs. Because a CDR sequence can be determined by different systems, likewise a framework sequence is subject to correspondingly different interpretations.
- the six CDRs divide the framework regions on the heavy and light chains into four sub-regions (FRl, FR2, FR3 and FR4) on each chain, in which CDRl is positioned between FRl and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4.
- a framework region represents the combined FRs within the variable region of a single, naturally occurring immunoglobulin chain.
- a FR represents one of the four sub-regions, FR1, for example, represents the first framework region closest to the amino terminal end of the variable region and 5' with respect to CDR1, and FRs represents two or more of the sub-regions constituting a framework region.
- Host cell refers to a cell into which exogenous DNA
- host cells include prokaryotic and eukaryotic cells selected from any of the Kingdoms of life that are suitable for expressing an exogenous DNA (e.g., a recombinant nucleic acid sequence).
- Exemplary cells include those of prokaryotes and eukaryotes (single- cell or multiple-cell), bacterial cells (e.g., strains of E. coli, Bacillus spp., Streptomyces spp., etc.), mycobacteria cells, fungal cells, yeast cells (e.g., S. cerevisiae, S. pombe, P. pastoris, P. methanolica, etc.), plant cells, insect cells (e.g., SF-9, SF-21, baculovirus-infected insect cells, Trichoplusia ni, etc.), non-human animal cells, human cells, or cell fusions such as, for example, hybridomas or quadromas.
- bacterial cells e.g., strains of E. coli, Bacillus spp., Streptomyces spp., etc.
- mycobacteria cells e.g., fungal cells, yeast cells (e.g., S.
- the cell is a human, monkey, ape, hamster, rat, or mouse cell.
- the cell is eukaryotic and is selected from the following cells: CHO (e.g., CHO Kl, DXB-1 1 CHO, Veggie-CHO), COS (e.g., COS-7), retinal cell, Vero, CV1, kidney (e.g., HEK293, 293 EBNA, MSR 293, MDCK, HaK, BHK), HeLa, HepG2, WI38, MRC 5, Colo205, HB 8065, HL-60, (e.g., BHK21), Jurkat, Daudi, A431 (epidermal), CV-1, U937, 3T3, L cell, C127 cell, SP2/0, NS-0, MMT 060562, Sertoli cell, BRL 3 A cell, HT1080 cell, myeloma cell, tumor cell, and a cell line derived from an aforementioned cell.
- CHO e.g
- Human antibody is intended to include antibodies having variable and constant regions generated (or assembled) from human immunoglobulin sequences.
- antibodies (or antibody components) may be considered to be "human” even though their amino acid sequences include residues or elements not encoded by human germline immunoglobulin sequences (e.g., include sequence variations, for example that may (originally) have been introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in one or more CDRs and in particular CDR3.
- Humanized is commonly used to refer to antibodies (or antibody components) whose amino acid sequence includes VH and VL region sequences from a reference antibody raised in a non-human species (e.g., a mouse), but also includes modifications in those sequences relative to the reference antibody intended to render them more "human-like", i.e., more similar to human germline variable sequences.
- a “humanized” antibody (or antibody component) is one that immunospecifically binds to an antigen of interest and that has a framework (FR) region having substantially the amino acid sequence as that of a human antibody, and a
- a humanized antibody comprises substantially all of at least one, and typically two, variable domains (Fab, Fab', F(ab')2, FabC, Fv) in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin (i.e., donor immunoglobulin) and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence.
- a humanized antibody also comprises at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin constant region.
- a humanized antibody contains both the light chain as well as at least the variable domain of a heavy chain.
- the antibody also may include a CHI, hinge, CH2, CH3, and, optionally, a CH4 region of a heavy chain constant region.
- a humanized antibody only contains a humanized VL region.
- a humanized antibody only contains a humanized VH region.
- a humanized antibody contains humanized VH and VL regions.
- Isolated refers to a substance and/or entity that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature and/or in an experimental setting), and/or (2) designed, produced, prepared, and/or manufactured by the hand of man. Isolated substances and/or entities may be separated from about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% of the other components with which they were initially associated.
- isolated agents are about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
- a substance is "pure” if it is substantially free of other components.
- a substance may still be considered “isolated” or even “pure”, after having been combined with certain other components such as, for example, one or more carriers or excipients (e.g., buffer, solvent, water, etc.); in such embodiments, percent isolation or purity of the substance is calculated without including such carriers or excipients.
- a biological polymer such as a polypeptide or polynucleotide that occurs in nature is considered to be "isolated” when, a) by virtue of its origin or source of derivation is not associated with some or all of the components that accompany it in its native state in nature; b) it is substantially free of other polypeptides or nucleic acids of the same species from the species that produces it in nature; c) is expressed by or is otherwise in association with components from a cell or other expression system that is not of the species that produces it in nature.
- a polypeptide that is chemically synthesized or is synthesized in a cellular system different from that which produces it in nature is considered to be an "isolated” polypeptide.
- a polypeptide that has been subjected to one or more purification techniques may be considered to be an "isolated" polypeptide to the extent that it has been separated from other components a) with which it is associated in nature; and/or b) with which it was associated when initially produced.
- K D refers to the dissociation constant of a binding agent
- a complex with its partner e.g., the epitope to which the antibody or binding component thereof binds.
- Koff refers to the off rate constant for dissociation of a binding agent (e.g., an antibody or binding component thereof) from a complex with its partner (e.g., the epitope to which the antibody or binding component thereof binds).
- K on refers to the on rate constant for association of a binding agent (e.g., an antibody or binding component thereof) with its partner (e.g., the epitope to which the antibody or binding component thereof binds).
- Linker is used to refer to that portion of a multi-element polypeptide that connects different elements to one another.
- a polypeptide whose structure includes two or more functional or organizational domains often includes a stretch of amino acids between such domains that links them to one another.
- a polypeptide comprising a linker element has an overall structure of the general form S I - L - S2, wherein S I and S2 may be the same or different and represent two domains associated with one another by the linker.
- a linker is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more amino acids in length.
- a linker is characterized in that it tends not to adopt a rigid three-dimensional structure, but rather provides flexibility to the polypeptide.
- linker elements that can appropriately be used when engineering polypeptides (e.g., fusion polypeptides) known in the art (see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, R. J., et al. (1994) Structure 2: 1 121-1123).
- Multivalent binding agent refers a binding agent capable of binding to two or more antigens, which can be on the same molecule or on different molecules.
- Multivalent binding agents as described herein are, in some embodiments, engineered to have the three or more antigen binding sites, and are typically not naturally occurring proteins.
- Multivalent binding agents as described herein refer to binding agents capable of binding two or more related or unrelated targets.
- Multivalent binding agents may be composed of multiple copies of a single antibody component or multiple copies of different antibody components. Such binding agents are capable of binding to two or more antigens and are tetravalent or multivalent binding agents.
- Multivalent binding agents may additionally comprise a therapeutic agent, such as, for example., an immunomodulator, toxin or an RNase.
- Multivalent binding agents as described herein are, in some embodiments, capable of binding simultaneously to at least two targets that are of different structure, e.g., two different antigens, two different epitopes on the same antigen, or a hapten and/or an antigen or epitope.
- multivalent binding agents of the present invention are proteins engineered to have characteristics of multivalent binding agents as described herein.
- Multivalent binding agents of the present invention may be monospecific (capable of binding one antigen) or multispecific (capable of binding two or more antigens), and may be composed of two heavy chain polypeptides and two light chain polypeptides.
- Each binding site in some embodiments, is composed of a heavy chain variable domain and a light chain variable domain with a total of six CDRs involved in antigen binding per antigen binding site.
- nucleic acid refers to any compound and/or substance that is or can be incorporated into an oligonucleotide chain.
- a nucleic acid is a compound and/or substance that is or can be incorporated into an oligonucleotide chain via a phosphodiester linkage.
- nucleic acid refers to individual nucleic acid residues (e.g., nucleotides and/or nucleosides); in some embodiments, “nucleic acid” refers to an oligonucleotide chain comprising individual nucleic acid residues.
- a "nucleic acid” is or comprises R A; in some embodiments, a “nucleic acid” is or comprises DNA.
- a nucleic acid is, comprises, or consists of one or more natural nucleic acid residues.
- a nucleic acid is, comprises, or consists of one or more nucleic acid analogs.
- a nucleic acid analog differs from a nucleic acid in that it does not utilize a phosphodiester backbone.
- a nucleic acid is, comprises, or consists of one or more "peptide nucleic acids", which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention.
- a nucleic acid has one or more phosphorothioate and/or 5'-N-phosphoramidite linkages rather than phosphodiester bonds.
- a nucleic acid is, comprises, or consists of one or more natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxy guanos ine, and deoxycytidine).
- adenosine thymidine
- guanosine guanosine
- cytidine uridine
- deoxyadenosine deoxythymidine
- deoxy guanos ine deoxycytidine
- a nucleic acid is, comprises, or consists of one or more nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo- pyrimidine, 3 -methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl- uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5- propynyl-uridine, C5 -propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7- deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, 0(6)-methylguanine, 2-thiocytidine, methylated bases, intercal
- a nucleic acid comprises one or more modified sugars (e.g., 2'-fluororibose, ribose, 2'-deoxyribose, arabinose, and hexose) as compared with those in natural nucleic acids.
- a nucleic acid has a nucleotide sequence that encodes a functional gene product such as an RNA or protein.
- a nucleic acid includes one or more introns.
- nucleic acids are prepared by one or more of isolation from a natural source, enzymatic synthesis by polymerization based on a complementary template (in vivo or in vitro), reproduction in a recombinant cell or system, and chemical synthesis.
- a nucleic acid is at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 1 10, 120, 130, 140, 150, 160, 170, 180, 190, 20, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000 or more residues long.
- a nucleic acid is single stranded; in some embodiments, a nucleic acid is double stranded.
- a nucleic acid has a nucleotide sequence comprising at least one element that encodes, or is the complement of a sequence that encodes, a polypeptide. In some embodiments, a nucleic acid has enzymatic activity.
- Optrabfy linked refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner.
- a control sequence "operabfy linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
- "Operabfy linked” sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest.
- expression control sequence refers to polynucleotide sequences which are necessary to effect the expression and processing of coding sequences to which they are ligated.
- Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion.
- the nature of such control sequences differs depending upon the host organism. For example, in prokaryotes, such control sequences generally include promoter, ribosomal binding site, and transcription termination sequence, while in eukaryotes, typically, such control sequences include promoters and transcription termination sequence.
- control sequences is intended to include components whose presence is essential for expression and processing, and can also include additional components whose presence is advantageous, for example, leader sequences and fusion partner sequences.
- physiological conditions has its art-understood meaning referencing conditions under which cells or organisms live and/or reproduce.
- the term refers to conditions of the external or internal mileu that may occur in nature for an organism or cell system.
- physiological conditions are those conditions present within the body of a human or non-human animal, especially those conditions present at and/or within a surgical site.
- Physiological conditions typically include, e.g., a temperature range of 20 - 40°C, atmospheric pressure of 1, pH of 6 - 8, glucose concentration of 1 - 20 mM, oxygen concentration at atmospheric levels, and gravity as it is encountered on earth.
- conditions in a laboratory are manipulated and/or maintained at physiologic conditions.
- physiological conditions are encountered in an organism.
- Polypeptide refers to any polymeric chain of amino acids.
- a polypeptide has an amino acid sequence that occurs in nature. In some embodiments, a polypeptide has an amino acid sequence that does not occur in nature. In some embodiments, a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man. .
- Recombinant is intended to refer to polypeptides (e.g., antibodies or antibody components, or mutli-specific binding agents as described herein) that are designed, engineered, prepared, expressed, created or isolated by recombinant means, such as polypeptides expressed using a recombinant expression vector transfected into a host cell, polypeptides isolated from a recombinant, combinatorial human polypeptide library (Hoogenboom H. R., (1997) TIB Tech. 15:62-70; Azzazy H., and Highsmith W. E., (2002) Clin. Biochem. 35:425-445; Gavilondo J. V., and Larrick J. W. (2002) BioTechniques 29: 128-145; Hoogenboom H., and Chames P. (2000) Immunology Today 21 :371-378), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human
- immunoglobulin genes see e.g., Taylor, L. D., et al. (1992) Nucl. Acids Res. 20:6287-6295; Kellermann S-A., and Green L. L. (2002) Current Opinion in Biotechnology 13:593-597; Little M. et al (2000) Immunology Today 21 :364-370
- one or more of such selected sequence elements is found in nature.
- one or more of such selected sequence elements is designed in silico.
- one or more such selected sequence elements results from mutagenesis (e.g., in vivo or in vitro) of a known sequence element, e.g., from a natural or synthetic source.
- a recombinant antibody polypeptide is comprised of sequences found in the germline of a source organism of interest (e.g., human, mouse, etc.).
- a recombinant antibody has an amino acid sequence that resulted from mutagenesis (e.g., in vitro or in vivo, for example in a transgenic animal), so that the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while originating from and related to germline VH and VL sequences, may not naturally exist within the germline antibody repertoire in vivo.
- mutagenesis e.g., in vitro or in vivo, for example in a transgenic animal
- Recovering refers to the process of rendering an agent or entity substantially free of other previously-associated components, for example by isolation, e.g., using purification techniques known in the art.
- an agent or entity is recovered from a natural source and/or a source comprising cells.
- Specific binding refers to a binding agent's ability to discriminate between possible partners in the environment in which binding is to occur.
- a binding agent that interacts with one particular target when other potential targets are present is said to "bind specifically" to the target with which it interacts.
- specific binding is assessed by detecting or determining degree of association between the binding agent and its partner; in some embodiments, specific binding is assessed by detecting or determining degree of dissociation of a binding agent-partner complex; in some embodiments, specific binding is assessed by detecting or determining ability of the binding agent to compete an alternative interaction between its partner and another entity. In some embodiments, specific binding is assessed by performing such detections or determinations across a range of concentrations.
- Subject means any mammal, including humans. In certain embodiments of the present invention the subject is an adult, an adolescent or an infant. In some embodiments, terms “individual” or “patient” are used and are intended to be interchangeable with “subject”. Also contemplated by the present invention are the administration of the pharmaceutical compositions and/or performance of the methods of treatment in-utero.
- substantially refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
- One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- Substantial sequence homology The phrase "substantial homology” is used herein to refer to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be “substantially homologous” if they contain homologous residues in corresponding positions. Homologous residues may be identical residues. Alternatively, homologous residues may be non-identical residues will appropriately similar structural and/or functional characteristics.
- amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences.
- Exemplary such programs are described in Altschul, et al, Basic local alignment search tool, J. Mol. Biol, 215(3): 403-410, 1990; Altschul, et al, Methods in Enzymology; Altschul, et al, "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res.
- two sequences are considered to be substantially homologous if at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or more of their corresponding residues are homologous over a relevant stretch of residues.
- the relevant stretch is a complete sequence.
- the relevant stretch is at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55, at least 60, at least 65, at least 70, at least 75, at least 80, at least 85, at least 90, at least 95, at least 100, at least 125, at least 150, at least 175, at least 200, at least 225, at least 250, at least 275, at least 300, at least 325, at least 350, at least 375, at least 400, at least 425, at least 450, at least 475, at least 500 or more residues.
- substantially identical is used herein to refer to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be “substantially identical” if they contain identical residues in corresponding positions. As is well known in this art, amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul, et al, Basic local alignment search tool, J. Mol.
- two sequences are considered to be substantially identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their corresponding residues are identical over a relevant stretch of residues.
- the relevant stretch is a complete sequence. In some embodiments, the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 or more residues.
- reference to "substantial identity" typically refers to a CDR having an amino acid sequence at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to that of a reference CDR.
- “Surface plasmon resonance”, as used herein, refers to an optical phenomenon that allows for the analysis of specific binding interactions in real-time, for example through detection of alterations in protein concentrations within a biosensor matrix, such as by using a BIAcore system (Pharmacia Biosensor AB, Uppsala, Sweden and Piscataway, N.J.).
- BIAcore Phharmacia Biosensor AB, Uppsala, Sweden and Piscataway, N.J.
- “Therapeutically effective amount” is meant an amount that produces the desired effect for which it is administered. In some embodiments, the term refers to an amount that is sufficient, when administered to a population suffering from or susceptible to a disease, disorder, and/or condition in accordance with a therapeutic dosing regimen, to treat the disease, disorder, and/or condition. In some embodiments, a
- therapeutically effective amount is one that reduces the incidence and/or severity of, and/or delays onset of, one or more symptoms of the disease, disorder, and/or condition.
- therapeutically effective amount does not in fact require successful treatment be achieved in a particular individual. Rather, a therapeutically effective amount may be that amount that provides a particular desired pharmacological response in a significant number of subjects when administered to patients in need of such treatment.
- reference to a therapeutically effective amount may be a reference to an amount as measured in one or more specific tissues (e.g., a tissue affected by the disease, disorder or condition) or fluids (e.g., blood, saliva, serum, sweat, tears, urine, etc.).
- a therapeutically effective amount of a particular agent or therapy may be formulated and/or administered in a single dose.
- a therapeutically effective agent may be formulated and/or administered in a plurality of doses, for example, as part of a dosing regimen.
- Transformation refers to any process by which exogenous
- DNA is introduced into a host cell. Transformation may occur under natural or artificial conditions using various methods well known in the art. Transformation may rely on any known method for the insertion of foreign nucleic acid sequences into a prokaryotic or eukaryotic host cell. In some embodiments, a particular transformation methodology is selected based on the host cell being transformed and may include, but is not limited to, viral infection, electroporation, mating, lipofection. In some embodiments, a "transformed" cell is stably transformed in that the inserted DNA is capable of replication either as an
- Vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- Other vectors e.g., non- episomal mammalian vectors
- vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as " expression vectors.”
- Standard techniques may be used for recombinant DNA, oligonucleotide synthesis, and tissue culture and transformation (e.g., electroporation, lipofection).
- Enzymatic reactions and purification techniques may be performed according to
- a multivalent binding agent is a molecular entity or complex that includes binding components that bind specifically to two or more targets (e.g., epitopes).
- targets e.g., epitopes
- multivalent binding agents find a variety of uses in the art, including therapeutic uses.
- multivalent binding agents have been engineered to facilitate killing of tumor cells by directing (or recruiting) cytotoxic T cells to a tumor site.
- tumor antigens include, but are not limited to, alpha fetoprotein (AFP), CA15-3, CA27-29, CA19-9, CA-125, calretinin, carcinoembryonic antigen, CD34, CD99, CD1 17, chromogranin, cytokeratin, desmin, epithelial membrane protein (EMA), Factor VIII, CD31 FL1, glial fibrillary acidic protein (GFAP), gross cystic disease fluid protein (GCDFP-15), HMB-45, human chorionic gonadotropin (hCG), inhibin, keratin, CD45, a lymphocyte marker , MART-1 (Melan-A), Myo Dl, muscle-specific actin (MSA), neurofilament, neuron-specific enolase (NSE), placental alkaline phosphatase (PLAP), prostate-specific antigen, S100 protein, smooth muscle actin (SMA), synaptophysin, thyroglobulin, thyroid transcription factor- 1, tumor M
- T cells are the most potent effector cells in the immune system at killing aberrant cells and are not capable of Fc-mediated antibody dependent cellular cytotoxicity (ADCC).
- ADCC antibody dependent cellular cytotoxicity
- the mechanism by which such multivalent binding agents direct T cells to a tumor site is through binding of a tumor antigen on the surface of a tumor and a co-receptor on the surface of T cells, CD3.
- CD3 is a complex of three chains ( ⁇ , ⁇ , and ⁇ ) expressed on the surface of all mature T cells. Expression of CD3 is almost exclusively restricted to T cells.
- the anti-CD3 component of a bispecific binding agent can transform a previously unstimulated and uncomitted nonclonal T cell to become potent serial killer of tumor cells (Wolf et al, 2005, Drug Discov Today 10: 1237-1244). Binding agents of this type have demonstrated efficacy in animal xenograft studies of solid tumors expressing the epithelial cell adhesion molecule (EpCAM) antigens in addition to other targets (Bargou et al, supra; Brischwein et al, 2006, Mol Immunol 43 : 1129-1143; Baeuerle and Reinhardt, 2009, Cancer Res 69: 4941-4944).
- EpCAM epithelial cell adhesion molecule
- multivalent binding agents for use in accordance with the present invention are bispecific binding agents.
- such bispecific binding agents are capable of binding to T cells.
- such bispecific binding agents are capable of binding to CD3 on T cells.
- multivalent or bispecific binding agents for use in accordance with the present invention are or comprise antibody components.
- a variety of technologies are known in the art for designing, constructing, and/or producing multispecific or bispecific binding agents comprising antibody components.
- bispecific binding agents have been constructed that either utilize the full immunoglobulin framework (e.g., IgG), single chain variable fragment (scFv), or combinations thereof.
- Bispecific binding agents composed of two scFv units in tandem has been shown to be one of the most clinically successful bispecific antibody formats.
- bispecific binding agents that comprise two single chain variable fragments (scFvs) in tandem have been designed such that an scFv that binds a tumor antigen is linked with an scFv that engages T cells by binding CD3.
- T cells are recruited to a tumor site in the hope that they can mediate killing of the tumor cells making up the tumor by the cytotoxic properties that certain T cells have.
- An example of such a bispecific binding agent has been made that targets CD 19 and CD3 for lymphoma (termed Bispecific T cell Engaging, or BiTE; e.g., see Dreier et al, 2003, J Immunol 170: 4397-4402; Bargou et al, 2008, Science 321 : 974-977), which has been successful in preventing tumor growth in animal xenograft studies. In human studies, this bispecific binding agent demonstrated objective tumor response, including five partial and two complete remissions.
- Exemplary bispecific binding agents include those with a first antibody component specific for a tumor antigen and a second antibody component specific for a cytotoxic marker, e.g., an Fc receptor (e.g., FcyRI, FcyRII, FcyRIII, etc.) or a T cell marker (e.g., CD3, CD28, etc.).
- the second antibody component can be substituted with an antibody component having a different desired specificity.
- a bispecific binding agent with a first antibody component specific for a tumor antigen and a second antibody component specific for a toxin can be paired so as to deliver a toxin (e.g., saporin, vinca alkaloid, etc.) to a tumor cell.
- a toxin e.g., saporin, vinca alkaloid, etc.
- bispecific binding agents include those with a first antibody component specific for an activating receptor (e.g., B cell receptor, FcyRI, FcyRIIA, FcyRIIIA, FcyRI, T cell receptor, etc.) and a second antibody component specific for an inhibitory receptor (e.g., FcyRIIB, CD5, CD22, CD72, CD300a, etc.).
- a first antibody component specific for an activating receptor e.g., B cell receptor, FcyRI, FcyRIIA, FcyRIIIA, FcyRI, T cell receptor, etc.
- an inhibitory receptor e.g., FcyRIIB, CD5, CD22, CD72, CD300a, etc.
- Yet another example includes a second antibody component specific to a different antigen on the same cell type for which a first antibody component is specific, for example, CD20, CD 19, CD21, CD23, CD46, CD80, HLA-DR, CD74, MUC1, and CD22 on B
- bispecific binding agents can be constructed for therapeutic conditions associated with cell activation (e.g. allergy and asthma).
- Bispecific binding agents can be made, for example, by combining heavy chains and/or light chains that recognize different epitopes of the same or different antigen.
- a bispecific binding agent binds one antigen (or epitope) on one of its two binding arms (one VH/VL pair), and binds a different antigen (or epitope) on its second arm (a different VH/VL pair).
- a bispecific binding agent has two distinct antigen binding arms (in both specificity and CDR sequences), and is mono-valent for each antigen to which it binds.
- bispecific binding agents of the present invention are characterized by the ability to can bind simultaneously to two targets which are of different structure.
- bispecific binding agents of the present invention have at least one component that specifically binds to, for example, a B-cell, T-cell, myeloid, plasma, or a mast cell antigen or epitope and at least one other component that specifically binds to a targetable conjugate that bears a therapeutic or diagnostic agent.
- antibodies that bind to carbohydrate antigens are generally of low affinity.
- carbohydrate antigens such as GD2
- the use of stable non-immunogenic peptide sequences as described herein to induce homodimerization presents a unique approach to enhance T cell targeting for cancer immunotherapy.
- dimerization of bispecific binding proteins of the present invention which are composed of tandem antibody components (e.g., scFvs) that are about 50-55 kDa in monomeric form, substantially increases serum half-life and potential therapeutic efficacy regardless of tumor affinity.
- the tumor antigen GD2 is highly expressed in several metastatic cancer types, and there are currently no effective treatments. Anti-GD2 antibodies have proven safe and effective in randomized trials, however, complement mediated acute pain during antibody infusion has been reported as a major drawback (Yang et al, 2010, Drugs Future 35(8):665). Bispecific binding proteins as described herein are capable of bivalent binding without the presence of an Fc, a component of traditional antibodies. Such bivalency results from the use of a dimerization component that does not induce complement activation. As such, the strategy for dimerization of the bispecific binding proteins as described represents a unique approach for enhanced tumor killing, reduced adverse effects, and demonstrates a for a potent therapeutic for the treatment of several GD2-positive cancers.
- the present invention provides the insight that exemplary properties of multispecific binding agents (and particularly of bispecific binding agents such as bispecific antibodies) as described herein are particularly useful in, and/or provide particular advantages in certain in vivo applications when coupled with a dimerization component.
- the present invention encompasses the recognition that mutlispecific binding agents that are constructed to be capable of dimerization as described herein provide an increase in the functional affinity of the multispecific binding agent to its target(s).
- the various Examples presented herein demonstrate improved properties of a bispecific antibody dimer (comprised of two fusion polypeptides, each of which includes first and second antibody components and a dimerization component) as compared with its corresponding monomer polypeptides lacking the dimerization component.
- the particular exemplified bispecific antibody dimer targeted disialoganglioside GD2 and CD3; in some embodiments, as demonstrated, the dimer is characterized by an enhanced potency to elicit tumor cell destruction by T cells.
- the present invention encompasses the recognition, among other things, that use of a dimerization component in the context of a bispecific binding agent can induce bivalent binding of a bispecific binding agent to at least one of its targets.
- Full-length IgG antibodies utilize bivalent binding, which can enhance the avidity for antigens by orders of magnitude as compared to the monovalent binding characteristic of scFv fragments (Pluckthun and Pack, 1997, Immunotechnol. 3 :83-105).
- the present invention encompasses the recognition that similar, or even greater, avidity improvements can be achieved through introduction of a dimerization component into a bivalent binding agent polypeptide.
- the present invention encompasses the recognition, among other things, that a dimerization component as described herein is suitable to dimerize any engineered protein to which it is attached.
- an engineered protein includes antibody components, bispecific binding agents or multivalent binding agents.
- the present invention provides, among other things, a bispecific binding agent operably linked to a dimerization component, wherein such a dimeric bispecific binding agent is characterized by a greater avidity for at least one target as compared to a bispecific binding agent lacking the dimerization component. In some embodiments, greater avidity is achieved for a therapeutic target, e.g., a tumor antigen.
- a dimerization component as described herein is particularly useful in, and/or provide particular advantages in binding improvements in bispecific binding agents comprising an antibody component that binds disialoganglioside GD2.
- Exemplary antibody components include those assembled from previously characterized antibodies, such as, for example, 5F1 1 and 3F8.
- dimerization component sequences that can be used in accordance with the present invention are known in the art (see, for example, Pluckthun and Pack, supra; Cuesta et al, 2010, Trends Biotechnol. 28: 355-362).
- Some particular examples of such components include synthetic or yeast peptides that helix bundles or coiled-coils (Table 3).
- the present invention specifically encompasses the finding that a particularly useful dimerization component for incorporation into multivalent binding agents, and particularly into bivalent antibodies, is or comprises a dimerization element of human hepatocyte nuclear factor- 1 alpha (HNF-la).
- a particularly useful dimerization component for incorporation into multivalent binding agents, and particularly into bivalent antibodies is or comprises a dimerization element of human hepatocyte nuclear factor- 1 alpha (HNF-la).
- HNF-la is composed of four regions: an amino-terminal dimerization component, a flexible linker, a bipartite DNA-binding motif, and a carboxy -terminal transactivation component.
- the flexible linker connects the DNA-binding motif and the dimerization component.
- HNF-la is an important regulator of both renal and hepatic gene expression.
- Human HNF- 1 ⁇ - 32 MVSKLSQLQTELLAALLESGLSKEALIQALGE SEQ ID NO: 1
- a dimerization component may be designed or selected with reference to amino acid sequences proteins that are known to self-associate.
- dimerization components known in the art include helix bundles, coiled-coils (e.g., leucine zippers), synthetic peptides, and yeast proteins.
- the present invention provides the insight of bispecific binding agents that employ a dimerization component comprising an element of human hepatocyte nuclear factor- la, which has been reported to form a tightly wound four helix bundle (Narayana et al, 2001, J. Mol. Biol. 310:635-658).
- a dimerization component comprising an element of human HNF-la may have a sequence that is substantially identical to amino acid residues 1 -32 of human HNF-la (SEQ ID NO: 1).
- a dimerization component according to the present invention has a sequence at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) to amino acid residues 1 -32 of human HNF-la (SEQ ID NO: 1)..
- Table 4 Exemplary antibody variable regions of the present invention are underlined.
- An exemplary dimerization component of the present invention is shown in italics.
- 3LHBT (D32H) -HDD EIVMTQTPATLSVSAGERVTITCKASQSVSNHVTW (SEQ ID NO: 12) YOOKPGOAPRLLIYSASNRYSGVPARFSGSGYGTE
- EFTFTISSVQSEDFAVYFCQQDYSSFGQGTKLEIKR GGGGSGGGGSGGGGSQVQLVESGPGVVQPGRSL RLSCAVSGFSVTNYGVHWVRQPPGKGLEWLGVI WAIGITNY SSVKGRLTISKDNSKNTVYLQMNSL RAEDTAVYYCASRGGHYGYALDYWGQGTLVTV SSASTKGPGGGGSGGGGSGGGGSOVOLVOSGGG VVOPGRSLRLSCKASGYTFTRYTMHWVROAPGK GLEWIGYI PSRGYTNY OKFKDRFTISRDNSKNT AFLOMDSLRPEDTGVYFCARYYDDHYCLDYWGO GTPVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLS ASVGDRVTITCSASSSVSYMNWYQQTPGKAPKR WIYDTSKLASGVPSRFSGSGSGTDYTFTISSLQPED IATYYCQQWSSNPFTFGQGTK
- bispecific binding agents according to the present invention are composed of a first binding component and a second binding component and a dimerization component.
- first and second binding components of a bispecific binding agent as described herein are each composed of antibody components characterized by different specificities.
- antibody components are selected from Table 4.
- bispecific binding agents according to the present invention comprise a first binding component, a second binding component and a dimerization component that is connected to the second binding component. In various embodiments, bispecific binding agents according to the present invention comprise a first binding component, a second binding component and a dimerization component that is connected to connected to the first binding component. In various embodiments, bispecific binding agents according to the present invention comprise a first binding component, a second binding component and a dimerization component that is connected to both the first and second binding component (e.g., positioned between the first and second binding components).
- bispecific binding agents according to the present invention comprises, from 5' to 3 ', a first binding component, a second binding component and a dimerization component. In some certain embodiments, bispecific binding agents according to the present invention comprise, from 5' to 3 ', a dimerization component, a first binding component and a second binding component. In some certain embodiments, bispecific binding agents according to the present invention comprise, from 5' to 3', a first binding component, a dimerization component and a second binding component.
- first and/or second binding components as described herein comprise or are antibody components. In various embodiments, first and/or second binding components as described herein comprise a linker sequence.
- a bispecific binding agent of the present invention has a sequence at least about 50% (e.g., at least about 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to a sequence that appears in Table 4.
- a bispecific binding agent of the present invention has a sequence that is substantially identical to a sequence that appears in Table 4.
- a bispecific binding agent of the present invention has a sequence that is identical to a sequence that appears in Table 4.
- a bispecific binding agent of the present invention is selected from a sequence that appears in Table 4.
- a first binding component of a bispecific binding agent as described herein comprises an antibody component having a sequence at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to an antibody component that appears in Table 4.
- a first binding component of a bispecific binding agent as described herein comprises an antibody component having a sequence that is identical to an antibody component that appears in Table 4.
- a second binding component of a bispecific binding agent as described herein comprises an antibody component having a sequence at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to an antibody component that appears in Table 4.
- a second binding component of a bispecific binding agent as described herein comprises an antibody component having a sequence that is identical to an antibody component that appears in Table 4.
- a bispecific binding agent of the present invention has a sequence that is at least 50% (e.g., 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more) identical to a bispecific binding agent that appears in Table 4.
- a bispecific binding agent of the present invention has a sequence that is identical to a bispecific binding agent that appears in Table 4.
- the present invention encompasses the recognition that dimerization of multispecific binding agents, and particularly of bispecific binding agents such as bispecific antibodies, is particularly useful and/or effective to facilitate cell killing.
- the present demonstrates that activity of multivalent binding agents that bind specifically to both a target-cell-associated epitope and a lymphocyte-associated epitope can be dramatically increased by introduction of a dimerization domain.
- a multivalent binding agent binds specifically to a tumor-cell-associated epitope and a T-cell epitope.
- inclusion of a dimerization domain in the multivalent binding agent can facilitate binding of the agent to one or both of its target epitopes and/or can enhance killing of the target tumor cell as mediated by the target T cell.
- target cells to be killed include, for example, virus- infected cells (e.g., HCV-infected cells, HIV-infected CD4 + T cells, HPV-infected keratinocytes), cells infected with intracellular bacteria or protozoa, and cancer cells.
- virus- infected cells e.g., HCV-infected cells, HIV-infected CD4 + T cells, HPV-infected keratinocytes
- cells infected with intracellular bacteria or protozoa e.g., tumor necrosis, tumor necrosis, etc.
- lymphocyte cells that can mediate killing of target cells as described herein include T cells (e.g., CD8 + T cells), natural killer (NK) cells,
- cytotoxic cells macrophages, granulocytes and antibody-dependent cytotoxic cells.
- Those of ordinary skill in the art will be aware of appropriate target epitopes on such lymphocytes to which multivalent binding agents as described herein desirably bind.
- Representative such epitopes can be found on antigens such as, for example, Fc receptor of IgG (e.g., FcyRIIB), CD Id, CD3, CD4, CD7, CD8, CD13, CD14, CD16, CD31, CD38, CD56, CD68, MAC-l/MAC-3, IL-2Ra, OX40, Ly49, and CD94.
- Fc receptor of IgG e.g., FcyRIIB
- CD Id CD3, CD4, CD7, CD8, CD13, CD14, CD16, CD31, CD38, CD56, CD68, MAC-l/MAC-3, IL-2Ra, OX40, Ly49, and CD94.
- Multispecific binding agents including dimerization components as described herein may be produced from nucleic acid molecules using molecular biological methods known to the art.
- Nucleic acid molecules are inserted into a vector that is able to express the fusion proteins in when introduced into an appropriate host cell.
- Appropriate host cells include, but are not limited to, bacterial, yeast, insect, and mammalian cells. Any of the methods known to one skilled in the art for the insertion of DNA fragments into a vector may be used to construct expression vectors encoding the fusion proteins of the present invention under control of transcriptional/translational control signals. These methods may include in vitro recombinant DNA and synthetic techniques and in vivo recombination (See Sambrook et al. Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory; Current Protocols in Molecular Biology, Eds. Ausubel, et al, Greene Publ. Assoc., Wiley- Interscience, NY).
- Expression of nucleic acid molecules in accordance with the present invention may be regulated by a second nucleic acid sequence so that the molecule is expressed in a host transformed with the recombinant DNA molecule.
- expression of the nucleic acid molecules of the invention may be controlled by a promoter and/or enhancer element, which are known in the art.
- Nucleic acid constructs include regions which encode multispecific binding proteins generated from antibodies and/or antibody components. Typically, such
- multispecific binding proteins will be generated from VH and/or VL regions.
- variable regions of each antibody are isolated, amplified, cloned and sequenced. Modifications may be made to the VH and VL nucleotide sequences, including additions of nucleotide sequences encoding amino acids and/or carrying restriction sites, deletions of nucleotide sequences encoding amino acids, or substitutions of nucleotide sequences encoding amino acids.
- the antibodies and/or antibody components may be generated from human, humanized or chimeric antibodies.
- Nucleic acid constructs of the present invention are inserted into an expression vector or viral vector by methods known to the art, and nucleic acid molecules are operatively linked to an expression control sequence.
- An expression vector containing a nucleic acid molecule is transformed into a suitable host cell to allow for production of the protein encoded by the nucleic acid constructs.
- exemplary host cells include prokaryotes (e.g., E. coli) and eukaryotes (e.g., a COS or CHO cell).
- Host cells transformed with an expression vector are grown under conditions permitting production of a fusion protein of the present invention followed by recovery of a multispecific binding agent formed from the fusion proteins.
- Multispecific binding agents of the present invention may be purified by any technique, which allows for the subsequent formation of a stable dimer.
- multispecific binding agents may be recovered from cells either as soluble polypeptides or as inclusion bodies, from which they may be extracted quantitatively by 8M guanidinium hydrochloride and dialysis.
- conventional ion exchange In order to further purify multispecific binding agents of the present invention, conventional ion exchange
- Multispecific binding agents of the present invention may also be recovered from conditioned media following secretion from eukaryotic or prokaryotic cells.
- Multispecific binding agents of the present invention may also be used in in vitro or in vivo screening methods where it is desirable to detect and/or measure one or more activities of a cell or cells (e.g., apoptosis or cell growth). Screening methods are well known to the art and include cell-free, cell-based, and animal assays. In vitro assays can be either solid state or soluble target molecule detection may be achieved in a number of ways known to the art, including the use of a label or detectable group capable of identifying a multispecific binding agent which is bound to a target molecule (e.g., cell surface antigen). Detectable labels may be used in conjunction with assays using multispecific binding agents of the present invention.
- the ability of the multispecific binding agents of the present invention to exhibit high affinity binding for one of the target antigens makes them therapeutically useful for efficiently targeting cells expressing the target antigen.
- certain conditions may benefit from an increase in affinity to a tumor antigen but not to an antigen on the surface of a cell capable of mediating killing of the tumor (e.g., a T cell).
- the present invention provides a multispecific binding agent as described herein as a therapeutic for the treatment of patients having a tumor that expresses an antigen that is capable of being bound by such a multispecific binding agent.
- a multispecific binding agent as described herein as a therapeutic for the treatment of patients having a tumor that expresses an antigen that is capable of being bound by such a multispecific binding agent.
- Such multispecific binding agents may be used in a method of treatment of the human or animal body, or in a method of diagnosis.
- the present invention provides methods of administering an effective amount of a therapeutic active described herein (e.g., multispecific binding agent) to a subject in need of treatment.
- a therapeutic active described herein e.g., multispecific binding agent
- Multispecific binding agents as described herein may be administered through various methods known in the art for the therapeutic delivery of agents, such as proteins or nucleic acids can be used for the therapeutic delivery of an multispecific binding agent or a nucleic acid encoding a multispecific binding agent of the present invention for killing or inhibiting growth of target cells in a subject, e.g., cellular transfection, gene therapy, direct administration with a delivery vehicle or pharmaceutically acceptable carrier, indirect delivery by providing recombinant cells comprising a nucleic acid encoding a multispecific binding agent of the present invention.
- agents such as proteins or nucleic acids
- a multispecific binding agent of the present invention e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the compound, receptor-mediated endocytosis (see, e.g., Wu and Wu, 1987, J. Biol. Chem. 262:4429-4432), construction of a nucleic acid as part of a retroviral or other vector, etc.
- Routes of administration can be enteral or parenteral and include, but are not limited to, intravenous, subcutaneous, intramuscular, parenteral, transdermal, or transmucosal (e.g., oral or nasal).
- multispecific binding agent of the present invention are administered intravenously.
- multispecific binding agents of the present invention are administered subcutaneously.
- multispecific binding agents are administered together with other biologically active agents.
- the present invention further provides pharmaceutical compositions comprising multispecific binding agents of the present invention and a pharmaceutically acceptable carrier or excipient.
- the composition if desired, can also contain one or more additional therapeutically active substances.
- compositions are principally directed to pharmaceutical compositions which are suitable for ethical administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts. Modification of
- compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with merely ordinary, if any, experimentation.
- Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with a diluent or another excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
- a pharmaceutical composition in accordance with the present invention may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
- a "unit dose" is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
- the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
- compositions in accordance with the invention will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered.
- the composition may comprise between 0.1% and 100% (w/w) active ingredient.
- compositions may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
- a pharmaceutically acceptable excipient includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
- Remington's The Science and Practice of Pharmacy 21 st Edition, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, MD, 2006; incorporated herein by reference) discloses various excipients used in
- a pharmaceutically acceptable excipient is at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% pure.
- an excipient is approved for use in humans and for veterinary use.
- an excipient is approved by United States Food and Drug Administration.
- an excipient is pharmaceutical grade.
- an excipient meets the standards of the United States Pharmacopoeia (USP), the European Pharmacopoeia (EP), the British Pharmacopoeia, and/or the International Pharmacopoeia.
- compositions include, but are not limited to, inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Such excipients may optionally be included in pharmaceutical formulations. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and/or perfuming agents can be present in the composition, according to the judgment of the formulator.
- kits comprising one or more containers filled with at least one multispecific binding agent as described herein.
- Kits may be used in any applicable method, including, for example, diagnostically.
- Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of
- the present Example describes production of a multispecific binding agent that is specifically engineered to be capable of dimerization as a strategy to enhance its tumor killing potency. This strategy was tested on a bispecific binding protein that can mediate T cell killing of GD2 positive tumor cells. Disialoganglioside GD2 is highly expressed on tumors of both pediatric and adult cancers, including neuroblastoma, retinoblastoma, melanoma, brain tumors, sarcomas and small cell lung cancer (Modak et al, 2007, Cancer Invest. 25:67-77). The present Example specifically illustrates construction of a multispecific binding agent that is specifically engineered to be capable of dimerization as a strategy to enhance its tumor killing potency. This strategy was tested on a bispecific binding protein that can mediate T cell killing of GD2 positive tumor cells. Disialoganglioside GD2 is highly expressed on tumors of both pediatric and adult cancers, including neuroblastoma, retinoblastoma, melanom
- dimerization-capable fusion protein termed GD2xCD3-HDD, that is comprised of scFv polypeptides from anti-GD2 and anti-GD3 antibodies, linked to one another by an HNF-la dimerization component, and that targets GD2 and CD3.
- HNF-la was known to dimerize itself, it was not clear whether the dimerization component of HNF-la could be employed to dimerize other proteins to which it could be attached, in particular, antibodies or components thereof.
- the inventors have determined when attached to antibody components, human peptide hormone endotelin-1 (ET1), which is known to dimerize on its own, was unable to dimerize.
- Anti-GD2 x anti-CD3 tandem scFv (GD2xCD3) bispecific binding proteins were constructed from single polypeptide chains containing the scFv of anti-GD2 monoclonal antibody 5F1 1 (Hu et al, 2009, J. Immunol. 183 :5748-5755; Cheung et al, 2004, J. Nucl. Med. 45:867-877) and the humanized scFv of anti-CD3 OKT3 (Woodle et al, 1992, J.
- GD2xCD3 and GD2xCD3 -HDD HNF-la dimerization component
- the HDD component was placed distal to the anti-GD2 scFv, and proximal to the anti-CD3 ScFv. Without wishing to be bound by any particular theory, this placement was selected to maximize the potential enhancement of functional affinity to the distal antigen (GD2) and not the proximal antigen (CD3), which would be geometrically restricted. Enhancement of GD2 binding would presumably enhance tumor killing, whereas enhancement of CD3 binding could lead to enhanced cytokine storm, a known side effect of T cell engaging bispecific antibodies (Choi et al, 2011, Expert Opin. Biol.
- tandem scFv bispecific binding proteins MW -55-60 kDa
- dimerization of tandem scFv bispecific binding proteins have the potential to enhance the serum half-life since the homodimeric tandem scFv bispecific binding proteins could escape renal clearance pathway, to which proteins less than 60 kDa are subject
- variable regions of the anti-GD2 antibody 5F 11 and the humanized anti-CD3 OKT3 (derived from mouse OKT3 antibody) antibodies have been previously described.
- Single chain variable fragments (scFvs) of the 5F 11 and humanized OKT3 (hOKT3) antibodies were genetically assembled in different orientations using a 15 amino acid linker ((G 4 S) 3 ) and synthesized separately (Genescript, Piscataway, NJ).
- VHVL or VLVH orientations were constructed using the variable regions of the 5F11 antibody and a VHVL orientation was constructed using the variable regions of the anti-CD3 hOKT3 antibody.
- the specific identity of antibody components utilized in the present invention is not critical to the provided insight that adding a dimerization component improves activity of a multispecific binding agent comprised of antibody components targeting two antigens.
- GD2xCD3 bispecific binding proteins were constructed based on the humanized anti-GD2 antibody 3F8 (Cheung et al, 2012, Oncolmmunol. 1 :4, 477-486) and the humanized anti-CD3 OKT3 (Woodle et al., supra) with a FINF- ⁇ dimerization component; and anti-GD3 x anti- CD3 tandem scFv (GD3xCD3) bispecific binding proteins based on the monoclonal anti- GD3 antibody KM641 (Ohta et al., 1993, Cancer Immunol. Immunother.
- Expression constructs were made using the DNA of scFv5Fi i-(G4S)3-scFvho T3 fusion protein (Y-BT, SEQ ID NO: 10) both with (GD2xCD3 -HDD) and without (GD2xCD3) a dimerization component containing an element (amino acids 1-32) of HNF-la followed by a 6X histidine tag.
- DNA was transfected into DG44 CHO-S cells (Invitrogen) by
- This Example illustrates the effect of dimerization of single chain bispecific fusion proteins made in accordance with Example 1 on the functional affinity to their targets.
- bispecific monomers may bind to their targets for short periods of time (e.g., poor retention due to size).
- bispecific fusion proteins that are engineered to form homodimers demonstrate increased affinity for an antigen.
- GD2xCD3 (MW 55 kDa) had a hydrodymanic radius of 7.2 ⁇ 1.7 nm
- GD2xCD3-HDD (MW 59 kDa for monomer, 118 kDa for dimer) had a hydrodymanic radius of 13.6 ⁇ 0.7 nm (or 1 1.1 ⁇ 0.5).
- the increase in size as demonstrated by light scattering is indicative of a dimeric conformation for GD2xCD3-HDD.
- ELISA assays were performed using purified GD2 and whole Jurkat cells (cultured T cells containing CD3). Briefly, 96-well plates were coated overnight with GD2 at 1 ⁇ g/mL per well in 90% ethanol at room temperature. The following day, plates were blocked with 150 ⁇ /well of 0.5% BSA at room temperature for one hour. After washing, a dilution series of the bispecific antibodies were added to the plates and incubated at room temperature for two hours. The plate was subsequently washed four times with PBS and then incubated at room temperature for our hour with 100 ⁇ /well of a mouse-anti-His-tag antibody (AbD Serotec) at 1 : 1000 dilution in 0.5% BSA.
- AbD Serotec mouse-anti-His-tag antibody
- FIG. 2A (top panel) set forth exemplary GD2 binding of bispecific fusion proteins made according to Example 1.
- FIG. 2A (bottom) sets forth CD3/Jurkat cell binding of bispecific fusion proteins made according to Example 1.
- CM5 sensor chip and related reagents were purchased from Biacore USA.
- Gangliosides GM1 was purchased from ALEXIS Biochemicals (AXXORA L.L.C.), and GD2 from Advanced Immunochemical. Briefly, gangliosides were directly immobilized onto the CM5 sensor chip via hydrophobic interaction. Reference surface was immobilized with GM1. Active surface was immobilized with GD2 and GM1 in 1 : 1 ratio.
- a diluted mixture of GD2 and GM1 50 ⁇ g/ml was injected (300 ⁇ ) at a flow rate of 15 ⁇ /min over 20 minutes. Extensive washing was followed with 10 mM NaOH (typically five washes of 20 ⁇ at a flow rate of 5 ⁇ /min) until a stable baseline was obtained.
- Purified anti-GD2 monoclonal antibody (5F1 1) was diluted in HBS-E buffer containing 250 mM NaCl at varying concentrations (50 -1600 nM) prior to analysis.
- GD2 binding for GD2xCD3-HDD relative to GD2xCD3 bispecific binding proteins also see top panel of FIG. 2A and 2B. Binding to Jurkat cells was not significantly different (see bottom panel of FIG. 2A and 2B). Biacore analysis of GD2 binding (FIG. 3 A and 3B; and Tables 9 and 10) confirms the affinity enhancement to the tumor target GD2 by 3- to 6-fold.
- 3LHBT-HDD (SEQ ID NO: 1 1) was tested for GD2 binding as described above. The results are shown in Table 1 1 and FIG. 7. The results confirm that, as described herein, 3LHBT-HDD shows better activity based on GD2 binding. Specifically, 3LHBT-HDD demonstrated an about 2.5-fold lower EC5 0 than 3LHBT.
- Fusion protein _ sure , , T Fusion protein _ sure , T .
- This Example demonstrates the enhanced ability of bispecific homodimers to initiate tumor cell killing mediated through T cells.
- bispecific binding proteins that engage T cells are able to direct T cell to a tumor site for T cell mediated killing of the tumor.
- exemplary bispecific homodimers are shown to effectively mediate T cell killing of tumor cells more effectively as compared to bispecific single chain proteins.
- HTB63, H524, SKNJC2, SKMEL28, H69, H196 and H345) were cultured in RPMI1640 (Cellgro) supplemented with 10% FBS (Life Technologies) at 37°C in a 5% CO 2 humidified incubator.
- Neuroblastoma cell line LA 1 and melanoma M14 were obtained from
- SKNLD was developed at Memorial Sloan Kettering Cancer Center.
- SKLND cell line was derived from ATCC IMR-32. Verification was performed by short tandem repeat (STR) DNA sequencing.
- Adherent cells were harvested with lx EDTA. T cells were purified from human PBMC using a Pan T cell isolation kit according to manufacturer's specifications (Miltenyi Biotec). CD3/CD28 dynabeads (Invitrogen) were used to stimulate and expand T cells according to manufacturer's specifications. Expanded T cells were cultured and maintained in RPMI supplemented with FBS and 30 U/mL interleukin-2 (IL-2). T cell populations were identified and analyzed with anti-CD3-percep cy5.5, anti-CD4-FITC, anti- CD8-APC and anti-CD56-PE antibodies (BD Biosciences) by flow cytometry using a FACSARIATM.
- IL-2 interleukin-2
- Target tumor cells were labeled with sodium 51 Cr chromate (Amersham,
- GD2xCD3 and GD2xCD3-HDD bispecific fusion proteins were able to mediated T cell killing of selected GD2-positive tumor cell lines.
- GD2xCD3-HDD showed a significant enhancement in the ability to direct T cell mediated killing of tumor cells versus GD2xCD3 (12-27 fold increase, p ⁇ 0.001).
- Multispecific fusion proteins described in the prior Examples were tested for their in vivo efficacy.
- a breeder mouse strain BALB/cA-Rag2KO/IL-2RyKO was kindly provided by Dr. Mamoru Ito (Central Institute for Experimental Animals [CIEA], Miyamae, Kawasaki, Japan) and propagated at Memorial Sloan-Kettering Cancer Center . Animals were provided with Sulfatrim food. Care of all animals complied with the Canadian Council on Animal Care guidelines. In vivo experiments were performed when mice reached 6-week to 12-weeks of age.
- PBMC Peripheral blood mononuclear cells
- PBMC Erythrocytes were depleted by incubation for 30-60 seconds with ACK Lysing buffer (GIBCO, Life Technologies Corp).
- ACK Lysing buffer GEBCO, Life Technologies Corp.
- Purified PBMC were mixed with SKNLD cells (a fast-growing subcutaneous neuroblastoma) in a 1 : 1 ratio (50,000 PBMC: 50,000 SKNLD cells) in Matrigel (BD Biosciences).
- DKO mice were implanted with the PMBC/SKNLD mixed cells. At 4 days post-implantation, five mice per group were given no treatment, intravenous injections of GD2xCD3 (five times per week for two weeks), or intravenous injections of GD2xCD3-HDD (five times per week for two weeks).
- Tumor size was measured by calipers twice per week from day 14 to day 44. Blood was obtained from tail vein of DKO mice over eight hours after a bolus injection of 50 ⁇ g of bispecific fusion protein. Serum levels of bispecific fusion protein were measured by double sandwich ELISA where bispecific fusion protein was captured using solid phase rat anti-5Fl 1 -idiotypic antibody, and bound bispecific fusion protein detected using biotinylated mouse-anti-His-tag antibody (AbD Serotec) followed by strepavidin-HRP (Life Technologies, Invitrogen ). Exemplary measurements of tumor volume for each group is shown in FIG. 5. The area under the curve was calculated for each mouse, and the averages are shown in Table 15.
- Multispecific fusion proteins described in the prior Examples were tested to confirm that the dimerization tag (HDD, SEQ ID NO: 1) would not enhance the release of cytokines resulting from increased binding to CD3.
- PBMC peripheral blood mononuclear cells
- Human T cells were purified by Pan T cell isolation kit according to manufacturer specifications (Miltenyi Biotec). T cells (50,000/per well) were co-cultured with neuroblastoma SKNLD cells (10,000/ per well) in 96 well plate with BsAb at 37 C. Supernatants were harvested after 24 hours. Concentration of four different cytokines (IL-2, IL-10, IFN- ⁇ and TNF-a) was measured using an ELISA based cytokine assay kit (OptEIATM human cytokine set, BD Biosciences) according to
- cytokine release from human T cells in the presence of BsAb or parental humanized OKT3 antibody (units are in pg/mL).
- Table 19 sets forth exemplary cytokine release from human Tcells in the presence of BsAb and neuroblastoma SKNLD cells or parental humanized OKT3 antibody (units are in pg/mL).
- the present Example describes the further production of multispecific binding agents that are specifically engineered to be capable of dimerization by employing different dimerization components, for example, a synthetic helix-turn-helix domain ("dHLX", GELEELLKHLKELLKG-PRK-GELEELLKHLKELLK, SEQ ID NO:24; Pluckthun et al., 1997, Immunotechnology 3(2):83) and human IgGl Fc.
- dHLX like HDD, is composed of a helix-loop-helix domain that forms non-covalent dimers.
- dHLX is synthetic and may be immunogenic if injected into humans.
- GD2xCD3 bispecific binding agents were produced with either the HDD, dHLX domain or human IgGl Fc at their respective C-termini (as described in Example 1) and tested for GD2 binding (as described in Example 2) and in vitro T cell mediated killing of melanoma M14 and neuroblastoma LAN-1 tumor cell lines (as described in Example 3).
- Table 20 and FIG. 8 sets forth exemplary GD2 binding of GD2xCD3 bispecific binding agents with different dimerization domains.
- Table 21 and FIG. 9 sets forth exemplary in vitro T-cell mediated killing of melanoma Ml 4 and neuroblastoma LAN-1 tumor cell lines by GD2xCD3 bispecific binding agents with different dimerization domains.
- GD2xCD3-HDD and GD2xCD3-Fc dimeric bispecific fusion proteins (0.6 nM versus 0.3 nM), which dimers result from non-covalent and covalent interactions, respectively.
- the dimeric GD2xCD3-dHLX, as well as the monomeric GD2xCD3, demonstrated several fold lower binding avidity to GD2 (i.e., 2.9 nM and 5.0 nM, respectively).
- GD2xCD3-dHLX demonstrated significant aggregation (data not shown).
- GD2xCD3-HDD demonstrated the most efficient in vitro T-cell mediated killing of melanoma M14 and neuroblastoma LAN-1 tumor cell lines. Moreover, despite having slightly higher GD2 avidity, GD2xCD3-Fc
- GD2xCD3-dHLX demonstrated the lowest tumor cell killing, and noteably was lower than monomeric GD2xCD3.
- HDD can provide dimeric bispecific agents with enhanced tumor antigen binding avidity and similar to binding avidity achieved with covalent dimerization domains (e.g., a human IgGl Fc).
- HDD provided improved T cell mediated killing as compared to that observed with other dimerization domains, confirming that the present invention provides uniquely useful dimerization component, particularly for use in T cell-engaging bispecific binding agents.
- fusing a dimerization component from human HNF- 1 a to the carboxy -terminus of an GD2xCD3 tandem scFv promotes the formation of stable dimers and enhances the functional affinity of the distal anti-tumor antibody component of the bispecific dimer.
- tumors evade T cells by down regulating HLA and up regulating regulatory T cells, interfering with homing of cytolytic T cells (CTL) of generally low clonal frequency.
- CTL cytolytic T cells
- Bispecific dimers of the present invention possess enhanced functional affinity for tumor cells expressing GD2 and lead to a significant enhancement of tumor cell killing in in vitro assays of GD2-positive tumor cell lines using activated T cells as effectors.
- the dimerization component of the present invention does not significantly enhance T cell binding or cytokine release, which is known to be an adverse side effect of T cell engaging bispecific antibody immunotherapy.
- the Examples demonstrate that the HDD tag is particularly useful when applied to antibody components as exemplified in the GD2xCD3 bispecific antibody (BsAb).
- BsAb bispecific antibody
- the inventors have demonstrated a unique design for a BsAb (see FIG. 1) which can enhance avidity for a specific epitope of one binding arm of the BsAb (i.e., the distal anti- GD2 end and not the proximal anti-CD3 end).
- a major drawback in the development of T- cell engaging bispecific antibodies has been overstimulation of T cells resulting from CD3 engagement. Such engagement can lead to excessive release of cytokines (known as cytokine storm), which results in serious adverse effects in patients.
- GD2xCD3 BsAb enhances binding to GD2 and not to CD3 (see FIG. 2), without causing any significant difference in cytokine release (see Tables 18 and 19 comparing monomeric GD2xCD3 and dimeric GD2xCD3-HDD). Both the GD2xCD3 and GD2xCD3-HDD antibodies demonstrated several fold less cytokine release than the bivalent anti-CD3 IgG huOKT3.
- bispecific dimer entities of the present invention have enhanced affinity and killing efficiency as compared with their non-dimerized counterparts, and, when coupled with the increased serum half-life, led to significant tumor reduction in mouse xenograft model of neuroblastoma.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Marine Sciences & Fisheries (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Toxicology (AREA)
- Endocrinology (AREA)
- Neurology (AREA)
- Biomedical Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (11)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA2902561A CA2902561C (en) | 2013-03-15 | 2014-03-14 | Multimerization technologies |
| JP2016502968A JP6480907B2 (ja) | 2013-03-15 | 2014-03-14 | 多量体化技術 |
| EP14765530.2A EP2968547B1 (en) | 2013-03-15 | 2014-03-14 | Multimerization technologies |
| HK16104021.7A HK1216145B (en) | 2013-03-15 | 2014-03-14 | Multimerization technologies |
| CN201480028543.2A CN105530959B (zh) | 2013-03-15 | 2014-03-14 | 多聚化技术 |
| KR1020157029267A KR102090356B1 (ko) | 2013-03-15 | 2014-03-14 | 다량체화 기술 |
| US14/776,267 US9802995B2 (en) | 2013-03-15 | 2014-03-14 | Antibody multimerization technologies |
| RU2015143166A RU2714733C2 (ru) | 2013-03-15 | 2014-03-14 | Технологии мультимеризации |
| AU2014228962A AU2014228962B2 (en) | 2013-03-15 | 2014-03-14 | Multimerization technologies |
| BR112015022978A BR112015022978A8 (pt) | 2013-03-15 | 2014-03-14 | tecnologias de multimerização |
| US15/715,499 US20180251503A1 (en) | 2013-03-15 | 2017-09-26 | Multimerization technologies |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361791600P | 2013-03-15 | 2013-03-15 | |
| US61/791,600 | 2013-03-15 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/776,267 A-371-Of-International US9802995B2 (en) | 2013-03-15 | 2014-03-14 | Antibody multimerization technologies |
| US15/715,499 Continuation US20180251503A1 (en) | 2013-03-15 | 2017-09-26 | Multimerization technologies |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2014144573A2 true WO2014144573A2 (en) | 2014-09-18 |
| WO2014144573A3 WO2014144573A3 (en) | 2015-10-29 |
Family
ID=51538343
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/029041 Ceased WO2014144573A2 (en) | 2013-03-15 | 2014-03-14 | Multimerization technologies |
Country Status (10)
| Country | Link |
|---|---|
| US (2) | US9802995B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP2968547B1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP6480907B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR102090356B1 (cg-RX-API-DMAC7.html) |
| CN (1) | CN105530959B (cg-RX-API-DMAC7.html) |
| AU (1) | AU2014228962B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112015022978A8 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2902561C (cg-RX-API-DMAC7.html) |
| RU (1) | RU2714733C2 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2014144573A2 (cg-RX-API-DMAC7.html) |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016077526A1 (en) | 2014-11-12 | 2016-05-19 | Siamab Therapeutics, Inc. | Glycan-interacting compounds and methods of use |
| US9399676B2 (en) | 2013-05-06 | 2016-07-26 | Scholar Rock, Inc. | Compositions and methods for growth factor modulation |
| WO2017055385A1 (en) * | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xgd2 bispecific t cell activating antigen binding molecules |
| WO2017083582A1 (en) | 2015-11-12 | 2017-05-18 | Siamab Therapeutics, Inc. | Glycan-interacting compounds and methods of use |
| US9802995B2 (en) | 2013-03-15 | 2017-10-31 | Memorial Sloan-Kettering Cancer Center | Antibody multimerization technologies |
| US9879087B2 (en) | 2014-11-12 | 2018-01-30 | Siamab Therapeutics, Inc. | Glycan-interacting compounds and methods of use |
| WO2018071913A3 (en) * | 2016-10-14 | 2018-05-24 | Dana-Farber Cancer Institute, Inc. | Modular tetravalent bispecific antibody platform |
| EP3702495A1 (en) * | 2014-09-25 | 2020-09-02 | Idea Orchard, LLC | Antibody like protein |
| WO2020227515A1 (en) | 2019-05-07 | 2020-11-12 | Voyager Therapeutics, Inc. | Compositions and methods for the vectored augmentation of protein destruction, expression and/or regulation |
| EP3583133A4 (en) * | 2017-02-20 | 2021-04-14 | Dragonfly Therapeutics, Inc. | GD2, NKG2D AND CD16 BINDING PROTEINS |
| WO2022006564A1 (en) * | 2020-07-03 | 2022-01-06 | The Trustees Of Columbia University In The City Of New York | Polyfunctional orthogonal protein chimeras |
| US11253609B2 (en) | 2017-03-03 | 2022-02-22 | Seagen Inc. | Glycan-interacting compounds and methods of use |
| US11401330B2 (en) | 2016-11-17 | 2022-08-02 | Seagen Inc. | Glycan-interacting compounds and methods of use |
| EP3902834A4 (en) * | 2018-11-30 | 2022-08-24 | Memorial Sloan Kettering Cancer Center | HETERODIMERS TETRAVALENTS AND SPECIFIC ANTIBODY COMPOSITIONS AND USES THEREOF |
| WO2023023055A1 (en) | 2021-08-16 | 2023-02-23 | Renagade Therapeutics Management Inc. | Compositions and methods for optimizing tropism of delivery systems for rna |
| WO2023044333A1 (en) | 2021-09-14 | 2023-03-23 | Renagade Therapeutics Management Inc. | Cyclic lipids and methods of use thereof |
| WO2023044343A1 (en) | 2021-09-14 | 2023-03-23 | Renagade Therapeutics Management Inc. | Acyclic lipids and methods of use thereof |
| WO2023122752A1 (en) | 2021-12-23 | 2023-06-29 | Renagade Therapeutics Management Inc. | Constrained lipids and methods of use thereof |
| WO2023196931A1 (en) | 2022-04-07 | 2023-10-12 | Renagade Therapeutics Management Inc. | Cyclic lipids and lipid nanoparticles (lnp) for the delivery of nucleic acids or peptides for use in vaccinating against infectious agents |
Families Citing this family (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014144763A2 (en) * | 2013-03-15 | 2014-09-18 | Memorial Sloan Kettering Cancer Center | High affinity anti-gd2 antibodies |
| CN108264568B (zh) * | 2016-12-30 | 2021-11-16 | 博晟生医股份有限公司 | 重组多肽、核酸分子及其组合物以及制造、使用其的方法 |
| US11046768B2 (en) * | 2017-01-27 | 2021-06-29 | Memorial Sloan Kettering Cancer Center | Bispecific HER2 and CD3 binding molecules |
| CN108690138A (zh) * | 2017-04-12 | 2018-10-23 | 鸿运华宁(杭州)生物医药有限公司 | 一种能与人cd19或cd20和人cd3结合的双特异性抗体及其应用 |
| EP3731850A4 (en) * | 2017-12-29 | 2021-12-01 | Oncorus, Inc. | ONCOLYTIC VIRUS DELIVERY OF THERAPEUTIC POLYPEPTIDES |
| EP3862366A4 (en) * | 2018-10-05 | 2022-06-29 | Sapporo Medical University | Cancer-stem-cell-specific antibody |
| SG11202108924RA (en) * | 2019-02-20 | 2021-09-29 | Res Inst Nationwide Childrens Hospital | Cancer-targeted, virus-encoded, regulatable t (catvert) or nk cell (catvern) linkers |
| JOP20210298A1 (ar) | 2019-05-14 | 2023-01-30 | Provention Bio Inc | طرق وتركيبات للوقاية من مرض السكري من النوع الأول |
| KR20230092863A (ko) | 2020-06-11 | 2023-06-26 | 프로벤션 바이오, 인코포레이티드 | 제1형 당뇨병을 예방하기 위한 방법 및 조성물 |
| AU2023314619A1 (en) * | 2022-07-25 | 2025-02-27 | Research Institute At Nationwide Children's Hospital | Adeno-associated virus vectors and methods of their use for reducing the risk of, treating, and preventing metastasis |
| CU20230043A7 (es) * | 2023-09-08 | 2025-04-04 | Ct Inmunologia Molecular | Anticuerpos biespecíficos que unen cd3 y el gangliósido ngcgm3 |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE69909459T2 (de) * | 1998-04-21 | 2004-05-27 | Micromet Ag | Cd19xcd3 spezifische polypeptide und deren verwendung |
| GB0015119D0 (en) * | 2000-06-20 | 2000-08-09 | Angeletti P Ist Richerche Bio | Methods and means for regulation of gene expression |
| GB0230202D0 (en) * | 2002-12-27 | 2003-02-05 | Domantis Ltd | Ligand |
| DE60124912T2 (de) * | 2001-09-14 | 2007-06-14 | Affimed Therapeutics Ag | Multimerische, einzelkettige, Tandem-Fv-Antikörper |
| US20070298041A1 (en) | 2002-06-28 | 2007-12-27 | Tomlinson Ian M | Ligands That Enhance Endogenous Compounds |
| DK1517921T3 (da) * | 2002-06-28 | 2006-10-09 | Domantis Ltd | Immunglobulin-enkeltvariable antigen-bindende domæner og dobbeltspecifikke konstruktioner deraf |
| CA2568952C (en) * | 2004-06-18 | 2019-05-21 | Ambrx, Inc. | Novel antigen-binding polypeptides and their uses |
| AU2006232920B2 (en) * | 2005-04-06 | 2011-09-29 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
| AU2006232310B9 (en) * | 2005-04-06 | 2011-07-21 | Ibc Pharmaceuticals, Inc. | Improved stably tethered structures of defined compositions with multiple functions or binding specificities |
| EP2050764A1 (en) * | 2007-10-15 | 2009-04-22 | sanofi-aventis | Novel polyvalent bispecific antibody format and uses thereof |
| AU2011268110B2 (en) * | 2010-06-19 | 2016-05-19 | Memorial Sloan-Kettering Cancer Center | Anti-GD2 antibodies |
| BR112015022978A8 (pt) | 2013-03-15 | 2018-01-23 | Memorial Sloan Kettering Cancer Center | tecnologias de multimerização |
-
2014
- 2014-03-14 BR BR112015022978A patent/BR112015022978A8/pt active Search and Examination
- 2014-03-14 US US14/776,267 patent/US9802995B2/en active Active
- 2014-03-14 JP JP2016502968A patent/JP6480907B2/ja active Active
- 2014-03-14 EP EP14765530.2A patent/EP2968547B1/en active Active
- 2014-03-14 CA CA2902561A patent/CA2902561C/en active Active
- 2014-03-14 RU RU2015143166A patent/RU2714733C2/ru active
- 2014-03-14 AU AU2014228962A patent/AU2014228962B2/en active Active
- 2014-03-14 CN CN201480028543.2A patent/CN105530959B/zh active Active
- 2014-03-14 KR KR1020157029267A patent/KR102090356B1/ko active Active
- 2014-03-14 WO PCT/US2014/029041 patent/WO2014144573A2/en not_active Ceased
-
2017
- 2017-09-26 US US15/715,499 patent/US20180251503A1/en not_active Abandoned
Cited By (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9802995B2 (en) | 2013-03-15 | 2017-10-31 | Memorial Sloan-Kettering Cancer Center | Antibody multimerization technologies |
| US10597443B2 (en) | 2013-05-06 | 2020-03-24 | Scholar Rock, Inc. | Compositions and methods for growth factor modulation |
| US9573995B2 (en) | 2013-05-06 | 2017-02-21 | Scholar Rock, Inc. | Compositions and methods for growth factor modulation |
| US12454570B2 (en) | 2013-05-06 | 2025-10-28 | Scholar Rock, Inc. | Compositions and methods for growth factor modulation |
| US9758576B2 (en) | 2013-05-06 | 2017-09-12 | Scholar Rock, Inc. | Compositions and methods for growth factor modulation |
| US9399676B2 (en) | 2013-05-06 | 2016-07-26 | Scholar Rock, Inc. | Compositions and methods for growth factor modulation |
| US11827698B2 (en) | 2013-05-06 | 2023-11-28 | Scholar Rock, Inc. | Compositions and methods for growth factor modulation |
| US10981981B2 (en) | 2013-05-06 | 2021-04-20 | Scholar Rock, Inc. | Compositions and methods for growth factor modulation |
| EP3702495A1 (en) * | 2014-09-25 | 2020-09-02 | Idea Orchard, LLC | Antibody like protein |
| US9879087B2 (en) | 2014-11-12 | 2018-01-30 | Siamab Therapeutics, Inc. | Glycan-interacting compounds and methods of use |
| WO2016077526A1 (en) | 2014-11-12 | 2016-05-19 | Siamab Therapeutics, Inc. | Glycan-interacting compounds and methods of use |
| EP4183806A2 (en) | 2014-11-12 | 2023-05-24 | Seagen Inc. | Glycan-interacting compounds and methods of use |
| USRE49435E1 (en) | 2014-11-12 | 2023-02-28 | Seagen Inc. | Glycan-interacting compounds and methods of use |
| WO2017055385A1 (en) * | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xgd2 bispecific t cell activating antigen binding molecules |
| US11028181B2 (en) | 2015-11-12 | 2021-06-08 | Seagen Inc. | Glycan-interacting compounds and methods of use |
| WO2017083582A1 (en) | 2015-11-12 | 2017-05-18 | Siamab Therapeutics, Inc. | Glycan-interacting compounds and methods of use |
| WO2018071913A3 (en) * | 2016-10-14 | 2018-05-24 | Dana-Farber Cancer Institute, Inc. | Modular tetravalent bispecific antibody platform |
| US11401330B2 (en) | 2016-11-17 | 2022-08-02 | Seagen Inc. | Glycan-interacting compounds and methods of use |
| EP3583133A4 (en) * | 2017-02-20 | 2021-04-14 | Dragonfly Therapeutics, Inc. | GD2, NKG2D AND CD16 BINDING PROTEINS |
| US11253609B2 (en) | 2017-03-03 | 2022-02-22 | Seagen Inc. | Glycan-interacting compounds and methods of use |
| EP3902834A4 (en) * | 2018-11-30 | 2022-08-24 | Memorial Sloan Kettering Cancer Center | HETERODIMERS TETRAVALENTS AND SPECIFIC ANTIBODY COMPOSITIONS AND USES THEREOF |
| WO2020227515A1 (en) | 2019-05-07 | 2020-11-12 | Voyager Therapeutics, Inc. | Compositions and methods for the vectored augmentation of protein destruction, expression and/or regulation |
| WO2022006564A1 (en) * | 2020-07-03 | 2022-01-06 | The Trustees Of Columbia University In The City Of New York | Polyfunctional orthogonal protein chimeras |
| EP4175656A4 (en) * | 2020-07-03 | 2024-10-16 | The Trustees of Columbia University in the City of New York | POLYFUNCTIONAL ORTHOGONAL PROTEIN CHIMERA |
| WO2023023055A1 (en) | 2021-08-16 | 2023-02-23 | Renagade Therapeutics Management Inc. | Compositions and methods for optimizing tropism of delivery systems for rna |
| WO2023044333A1 (en) | 2021-09-14 | 2023-03-23 | Renagade Therapeutics Management Inc. | Cyclic lipids and methods of use thereof |
| WO2023044343A1 (en) | 2021-09-14 | 2023-03-23 | Renagade Therapeutics Management Inc. | Acyclic lipids and methods of use thereof |
| WO2023122752A1 (en) | 2021-12-23 | 2023-06-29 | Renagade Therapeutics Management Inc. | Constrained lipids and methods of use thereof |
| WO2023196931A1 (en) | 2022-04-07 | 2023-10-12 | Renagade Therapeutics Management Inc. | Cyclic lipids and lipid nanoparticles (lnp) for the delivery of nucleic acids or peptides for use in vaccinating against infectious agents |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2902561C (en) | 2022-08-02 |
| HK1216145A1 (en) | 2016-10-21 |
| US9802995B2 (en) | 2017-10-31 |
| JP2016516049A (ja) | 2016-06-02 |
| JP6480907B2 (ja) | 2019-03-13 |
| EP2968547A4 (en) | 2016-11-09 |
| US20160168211A1 (en) | 2016-06-16 |
| WO2014144573A3 (en) | 2015-10-29 |
| BR112015022978A8 (pt) | 2018-01-23 |
| CN105530959A (zh) | 2016-04-27 |
| AU2014228962B2 (en) | 2019-03-14 |
| EP2968547A2 (en) | 2016-01-20 |
| US20180251503A1 (en) | 2018-09-06 |
| RU2015143166A (ru) | 2017-04-20 |
| EP2968547B1 (en) | 2019-08-07 |
| CA2902561A1 (en) | 2014-09-18 |
| RU2714733C2 (ru) | 2020-02-19 |
| KR20150132420A (ko) | 2015-11-25 |
| KR102090356B1 (ko) | 2020-03-18 |
| CN105530959B (zh) | 2021-09-17 |
| BR112015022978A2 (pt) | 2017-11-14 |
| AU2014228962A1 (en) | 2015-09-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2014228962B2 (en) | Multimerization technologies | |
| JP7465833B2 (ja) | Cd3反応性に基づくt細胞リクルートポリペプチド | |
| KR102629403B1 (ko) | Vista 항원 결합 분자 | |
| JP6879998B2 (ja) | Cd70及びcd3に対する抗体構築物 | |
| JP6907124B2 (ja) | Cdh3及びcd3に対する二重特異性抗体構築物 | |
| AU2018274919A1 (en) | Bispecific heterodimeric diabodies and uses thereof | |
| TWI855236B (zh) | 抗cd47/抗pd-l1抗體及其應用 | |
| KR20190052677A (ko) | 항-ctla4 및 항-pd-1 이작용성 항체, 이의 약제학적 조성물 및 이의 용도 | |
| US11091547B2 (en) | Anti-chondroitin sulfate proteoglycan 4 antibodies and uses thereof | |
| CN107921122A (zh) | 与cd38结合的抗体治疗剂 | |
| EP4245317A1 (en) | Bispecific antibody for claudin 18a2 and cd3 and application of bispecific antibody | |
| AU2021350342A1 (en) | Novel human antibodies binding to human CD3 epsilon | |
| US10626183B2 (en) | IFN-γ-inducible regulatory T cell convertible anti-cancer (IRTCA) antibody and uses thereof | |
| HK1216145B (en) | Multimerization technologies | |
| CN121159699A (zh) | 抗Trop2/CD3的双特异性抗体及其应用 | |
| HK40077958B (zh) | 基於cd3反应性的t细胞募集多肽 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201480028543.2 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14765530 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2902561 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2016502968 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2014228962 Country of ref document: AU Date of ref document: 20140314 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14776267 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014765530 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 20157029267 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2015143166 Country of ref document: RU Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015022978 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112015022978 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150912 |