WO2014121221A1 - Administration of an anti-activin-a compound to a subject - Google Patents
Administration of an anti-activin-a compound to a subject Download PDFInfo
- Publication number
- WO2014121221A1 WO2014121221A1 PCT/US2014/014490 US2014014490W WO2014121221A1 WO 2014121221 A1 WO2014121221 A1 WO 2014121221A1 US 2014014490 W US2014014490 W US 2014014490W WO 2014121221 A1 WO2014121221 A1 WO 2014121221A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- residue
- activin
- sequence
- polypeptide
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7028—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages
- A61K31/7034—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin
- A61K31/704—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7042—Compounds having saccharide radicals and heterocyclic rings
- A61K31/7052—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
- A61K31/706—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom
- A61K31/7064—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines
- A61K31/7068—Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides containing six-membered rings with nitrogen as a ring hetero atom containing condensed or non-condensed pyrimidines having oxo groups directly attached to the pyrimidine ring, e.g. cytidine, cytidylic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1796—Receptors; Cell surface antigens; Cell surface determinants for hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the method comprises administering a therapeutically effective amount of an anti-activin-A compound to a subject.
- the anti-activin-A compound is formulated with a pharmaceutically-acceptable carrier.
- a light chain CDR3 comprising a sequence selected from the group consisting of: i. a light chain CDR3 sequence that differs by no more than a total of two amino acid additions, substitutions, and/or deletions from a CDR3 sequence selected from the group consisting of the light chain CDR3 sequences disclosed herein, and; ii. X73Q 74 75 76 77 78 79 80 (SEQ ID NO: 132);
- a heavy chain CDR3 comprising a sequence selected from the group consisting of: i. a heavy chain CDR3 sequence that differs by no more than a total of three amino acid additions, substitutions, and/or deletions from a CDR3 sequence selected from the group consisting of the heavy chain CDR3 sequences disclosed herein;
- X 8 7 is a valine residue or no residue
- Xss is a glutamine residue or no residue
- Xs9 is an aspartate residue
- X90 is a serine residue, a leucine residue, or no residue
- X 9 1 is an isoleucine residue, a glutamate residue, or a glutamine residue
- X92 is an alanine residue, a leucine residue, or a glycine residue
- X93 is an alanine residue or a leucine residue
- X94 is a proline residue, a tyrosine residue, or a glycine residue
- X95 is an aspartate residue or no residue
- X96 is a glutamine residue or no residue
- X 9 7 is an aspartate residue or an alanine residue
- X98 is a tyrosine residue or a glycine residue
- X99 is
- the anti-activin-A compound comprises:
- a heavy chain variable domain comprising: i. a heavy chain CDR1 sequence disclosed herein; ii. a heavy chain CDR2 sequence disclosed herein; and iii. a heavy chain CDR3 sequence disclosed herein; or
- a heavy chain variable domain sequence selected from the group consisting of: i. a sequence of amino acids at least 80% identical to a heavy chain variable domain sequence of HI -HI 4 of a heavy chain variable domain sequence disclosed herein; ii. a sequence of amino acids encoded by a polynucleotide sequence that is at least 80% identical to a polynucleotide sequence encoding a heavy chain variable domain sequence of H1-H14 of a heavy chain variable domain sequence disclosed herein; and iii.
- the anti-activin-A compound comprises:
- the anti-activin-A compound comprises a stabilized activin IIB receptor polypeptide (svActRIIB), wherein said polypeptide is selected from the group consisting of:
- variant sequence comprises an amino acid substitution at position 28, and an amino acid substitution at position 44, wherein the substitution at position 28 is selected from the group consisting of W and Y, and the substitution at position 44 is T;
- variant sequence comprises an amino acid substitution at position 28, and an amino acid substitution at position 44, wherein the substitution at position 28 is selected from the group consisting of W and Y, and the substitution at position 44 is T;
- said variant sequence comprises an amino acid substitution at position 28, and an amino acid substitution at position 44, wherein the substitution at position 28 is selected from the group consisting of W and Y, and the substitution at position 44 is T;
- polypeptide having at least 80% sequence identity to any one of (a) through (d), wherein the sequence comprises an amino acid substitution at position 28, and an amino acid substitution at position 44, wherein the substitution at position 28 is selected from the group consisting of W and Y, and the substitution at position 44 is T, wherein the polypeptide is capable of binding myostatin, activin-A, or GDF-1 1.
- the anti-activin-A compound comprises a stabilized activin IIB receptor polypeptide (svActRIIB), wherein said polypeptide is selected from the group consisting of:
- the polypeptide is operably linked to at least one heterologous polypeptide.
- the polypeptide comprises an alanine residue at position 64.
- the heterologous polypeptide comprises an IgG Fc domain.
- the heterologous polypeptide is operably linked to the anti-activin-A compound by a linker sequence.
- the linker is selected from the group consisting of: SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 38, SEQ ID NO: 40, SEQ ID NO: 42, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 48, SEQ ID NO: 49 and SEQ ID NO: 50.
- the anti-activin-A compound comprises a polypeptide selected from the group consisting of:
- polypeptide consisting of the sequence set forth in the group consisting of SEQ ID NO: 8, 10, 16 and 18; (b) a polypeptide having at least 90% sequence identity to (a), wherein the polypeptide has a W or a Y at position 28 and a T at position 44, wherein the polypeptide is capable of binding myostatin, activin-A, or GDF- 11 , and
- a method of treating ovarian cancer in a subject comprises administering a therapeutically effective amount of at least two compounds: a first compound and a second compound, wherein the first compound is an anti-activin-A compound, and wherein the second compound is a chemotherapeutic compound.
- the chemotherapeutic compound can be capecitabine, or a doxorubicin lipid complex.
- one or more of the at least two compounds is formulated with a pharmaceutically-acceptable carrier.
- the second compound is administered after the first compound is administered.
- the first compound is administered after the second compound is administered.
- the first compound and the second compound are administered simultaneously.
- the subject is identified by detecting elevated levels of biomarker CA-125 and/or activin-A in the subject compared to a control.
- the subject is identified by a method comprising: evaluating the subject's expression levels of biomarker CA-125 and/or activin-A; comparing the subject's expression levels of biomarker CA-125 and/or activin-A to expression levels of biomarker CA-125 and/or activin-A in a negative control sample; and determining that the expression levels of biomarker CA-125 and/or activin-A factors in the subject exceed the expression levels of biomarker CA-125 and/or activin-A in the negative control sample.
- the subject is identified by a method comprising: evaluating the subject's expression levels of biomarker CA-125 and/or activin-A; comparing the subject's expression levels of biomarker CA-125 and/or activin-A to expression levels of biomarker CA-125 and/or activin-A in a positive control sample; and determining that the expression levels of biomarker CA-125 and/or activin-A factors in the subject meet or exceed the expression levels of biomarker CA- 125 and/or activin-A in the positive control sample.
- the subject is identified by detecting elevated levels of activin-A, VEGF, and/or Ang-1 factors in the subject compared to a control.
- the subject is identified by a method comprising: evaluating the subject's expression levels of activin-A, VEGF, and/or Ang-1 factors; comparing the subject's expression levels of activin-A, VEGF, and/or Ang-1 factors to expression levels of activin-A, VEGF, and/or Ang-1 factors in a negative control sample; and determining that the expression levels of activin-A, VEGF, and/or Ang-1 factors in the subject exceed the expression levels of activin-A, VEGF, and/or Ang-1 factors in the negative control sample.
- the subject is identified by a method comprising: evaluating the subject's expression levels of activin-A, VEGF, and/or Ang-1 factors; comparing the subject's expression levels of activin-A, VEGF, and/or Ang-1 factors to expression levels of activin-A, VEGF, and/or Ang-1 factors in a positive control sample; and determining that the expression levels of activin-A, VEGF, and/or Ang-1 factors in the subject meet or exceed the expression levels of activin-A, VEGF, and/or Ang-1 factors in the positive control sample.
- the anti-activin-A compound is administered to a subject subcutaneous ly, intravenously, or intraperitoneally. In a further embodiment, the anti-activin- A compound is administered to a subject once a week at a dosage of at least 0.5 mg/kg. In another embodiment, the capecitabine is administered to a subject subcutaneously, intravenously, intraperitoneally. In a further embodiment, the capecitabine is administered to a subject orally. In a further embodiment, the capecitabine is administered to a subject twice daily for two weeks at a dosage of 1250 mg/m 2 . In some embodiments, there is a one week rest period after the capecitabine is administered for two weeks.
- the doxorubicin lipid complex is administered to a subject subcutaneously, intravenously, or intraperitoneally. In another embodiment, the doxorubicin lipid complex is administered to a subject once every four weeks at a dosage of 40 mg/m 2 IV.
- FIG. 2B is a bar graph showing the effects of sActRIIB treatment on serum activin-A levels in inh-KO mice over time. In each group of 3 bars, the left bar is wild-type, the middle bar is KO plus PBS, and the right bar is KO plus sActRIIB.
- FIG. 4A is a graph showing the effects of sActRIIB treatment on the testicular tumor mass in inh-KO mice over time.
- the left bar is wild-type
- the middle bar is KO plus PBS
- the right bar is KO plus sActRIIB.
- FIG. 8B shows representative images of immunostaining depicting the effects of sActRIIB treatment on VEGF and Ang-1 immunoreactivities in ovarian (top) and testicular (bottom) tumor sections in inh-KO mice.
- Scale bar 100 ⁇ . **p ⁇ 0.01 ; student's t-test.
- the bar graphs show the quantitative analyses of the VEGF and Ang-1 immunoreactivities.
- FIG. 8C shows Northern blot analyses of Ang-2 mRNA expression levels in the ovarian or testicular tumors of inh-KO mice after sActRIIB treatment.
- FIG. 8D shows Western blot analyses of endoglin, osteopontin, IGFBP-1 and IGFBP-2 proteins in the ovarian tumors of inh-KO mice after sActRIIB treatment.
- FIG. 14 is a graph showing the effects of sActRIIB and activin-A antibody on TOV-21G cell growth.
- FIG. 15A shows representative images of immunostaining depicting the effects of sActRIIB treatment on VEGF, Ang-1, and osteopontin in TOV-21G xenograft tumors in mice.
- the bar graphs show the quantitative analyses of the VEGF, Ang-1, and osteopontin immunoreactivities. *p ⁇ 0.05; **p ⁇ 0.01; ***p ⁇ 0.001.
- FIG. 15C shows representative images of immunostaining depicting the effects of sActRIIB treatment on caspase-3 activation and cell apoptosis in TOV-21G xenograft tumors in mice.
- the bar graphs show the quantitative analysis of caspase-3 immunoreactivity and immunoreactivity changes due to apoptosis. *p ⁇ 0.05; **p ⁇ 0.01 ; ***p ⁇ 0.001.
- FIG. 17B shows graphs of Ang-1 levels in MRC-5 and CCD-Lu cell cultures after treatment with recombinant activin-A and sActRIIB. *p ⁇ 0.05; **p ⁇ 0.01 ; ***p ⁇ 0.001;
- FIG. 19 shows the effects of sActRIIB treatment on the growth of human G361 melanoma xenografts in nude mice, and the effects of activin-A antibody on the growth of 5637 bladder carcinoma xenografts in nude mice. *p ⁇ 0.05; **p ⁇ 0.01.
- FIG. 21 shows the effect of sActRIIB single dose, withdrawal, and re-dose on body weight in female Inha KO mice and wild-type littermate control mice.
- Body weights for female Inha KO mice were plotted as the mean ⁇ SEM; *** p ⁇ 0.001 for Inha KO groups treated with sActRIIB vs. PBS. & p ⁇ 0.05 and && p ⁇ 0.01 for sActRIIB treated Inha KO group vs. WT group. *** p ⁇ 0.001 for PBS-treated Inha KO group vs. WT group.
- FIG. 24 shows a bar graph depicting ovary tumor weights in female Inha KO mice and wild-type littermate control mice at week 8 after a single dose of sActRIIB and at week 12 after re-administration (at week 8) of a single dose of sActRIIB. Data were plotted as mean ⁇ SEM; ***p ⁇ 0.001.
- FIG. 28 shows a bar graph illustrating the effect of activin-A antibody on serum activin A levels in female Inha KO mice and wild-type littermate control mice.
- FIG. 29 shows the effect of activin-A antibody treatment on body weight in female Inha KO mice and wild-type littermate control mice. Measurements of body weight in female Inha KO mice were plotted as the mean ⁇ SEM; ** p ⁇ 0.01 and *** p ⁇ 0.001 for Inha KO groups treated with activin-A antibody vs PBS. & p ⁇ 0.05 and && p ⁇ 0.01 for activin-A antibody treated Inha KO group vs PBS treated WT group, p ⁇ 0.05 for PBS treated Inha KO group vs PBS treated WT group.
- FIG. 30 shows the effect of activin-A antibody treatment on lean body mass and fat mass in female Inha KO mice and wild-type littermate control mice. Measurements of lean mass (upper panel) and fat mass (lower panel) in female Inha KO mouse were plotted as the mean ⁇ SEM; *** p ⁇ 0.001 and ** p ⁇ 0.01 for Inha KO groups treated with activin-A antibody vs PBS. &&& p ⁇ 0.001 for activin-A antibody treated Inha KO group vs PBS treated WT group. p ⁇ 0.001 for PBS treated Inha KO group vs PBS treated WT group.
- FIG. 32A shows the effect of activin-A antibody treatment on ovary weight in female Inha KO mice and wild-type littermate control mice. Data was plotted as mean ⁇ SEM; ***p ⁇ 0.001, **p ⁇ 0.01.
- FIG. 32B shows the effect of activin-A antibody treatment on uterus weight in female Inha KO mice and wild-type littermate control mice. Data was plotted as mean ⁇ SEM; ***p ⁇ 0.001, **p ⁇ 0.01.
- FIG. 33 shows a bar graph illustrating the effect of activin-A antibody treatment on serum VEGF levels in female Inha KO mice and wild-type littermate control mice.
- FIG. 34 shows the effect of activin-A antibody treatment on VEGF and angiopoietin-1 protein expression levels in ovarian tumor tissues of Inha KO mice and wild- type littermate control mice.
- Upper panel Representative images of VEGF and Ang- 1 immunostaining (grayish blue) on ovarian tissue sections. Nuclei were counter stained with Fast Red.
- FIG. 38 shows the effect of activin-A antibody in combination with doxorubicin on muscle mass in TOV-21 G tumor-bearing mice.
- the present invention relates to the effects of blocking activin-A.
- Blocking activin-A in vivo reduces several tumor angiogenesis factors and prevents tumor
- the invention provides methods for identifying ovarian cancer in a subject by evaluating the subject's expression levels of various factors. In some aspects, the invention also provides methods of treating ovarian cancer, including serous ovarian cancer, by administering anti-activin-A compounds, including anti-activin-A antibodies and activin receptors, to a subject.
- the invention further provides methods of treating ovarian cancer, including serous ovarian cancer, clear cell ovarian cancer, Granulosa cell ovarian cancer, Leydig cell tumors, and sex cord stromal testicular tumors, by administering at least an anti-activin-A compound and a chemotherapeutic compound to a subject.
- Activin-A is the homodimer of the polypeptide chains ⁇ (see GenBank
- Activins A, B, and AB are the homodimers and heterodimer respectively of two polypeptide chains, ⁇ and ⁇ .
- the term "activin” refers to activin-A, - B, and -AB, as well as variants and species homologs of that protein.
- the present invention provides compositions, kits, and methods relating to molecules that bind to activin-A, including molecules and antigen-binding proteins that agonize or antagonize activin-A, such as activin IIB receptor polypeptides (svActRIIB), svActRIIB fragments, svActRIIB derivatives, anti-activin-A antibodies, antibody fragments, and antibody derivatives, e.g., antagonistic anti-activin-A antibodies, antibody fragments, or antibody derivatives. Also provided are compositions, kits, and methods relating to molecules that specifically bind to a portion of activin-A, such as amino acids R13-Y39, or amino acids V82- 107 of activin-A.
- Such molecules can include antibodies, antibody fragments, and antibody derivatives.
- nucleic acids, and derivatives and fragments thereof comprising a sequence of nucleotides that encodes all or a portion of a polypeptide that binds to activin-A, e.g. , a nucleic acid encoding all or part of an activin IIB receptor, svActRIIB fragment, svActRIIB derivative, anti-activin-A antibody, antibody fragment, antibody variant, or antibody derivative, plasmids and vectors comprising such nucleic acids, and cells or cell lines comprising such nucleic acids and/or vectors and plasmids.
- the provided methods include, for example, methods of making, identifying, or isolating molecules that bind to activin-A, such as activin IIB receptors, anti-activin-A antibodies, methods of determining whether a molecule binds to activin-A, methods of making compositions, such as pharmaceutical compositions, comprising a molecule that binds to activin-A, and methods for administering a molecule that binds activin-A to a subject, for example, methods for treating a condition mediated by activin-A, and for modulating a biological activity of activin-A in vivo or in vitro.
- the present invention relates to regions of the human activin-A that contain cysteine knot domains recognized by antibodies that also bind to full-length activin-A, and/or a region of activin-A that overlaps or encompasses a cysteine knot region of activin-A, and methods of making and using these cysteine knot domains.
- the invention also provides antigen binding agents, including antibodies, that specifically bind to activin-A or portions of activin-A, and methods for using such binding agents.
- the binding agents are useful to block or impair binding of human activin-A to one or more ligand.
- Activins can interact with two structurally related classes of serine/threonine kinase receptors (type I and type II). Inhibin antagonizes activin by binding to the proteoglycan, betaglycan, and forming a stable complex with and thereby sequestering type II activin receptors while excluding type I receptors.
- Activin-A was overexpressed in stage IV colorectal cancer (Wildi, S. et al, Gut 49:409-417, 2001). A role of activin-A in ovarian cancer was reported (Steller, M.D. et al, Mol. Cancer Res. 3 :50-61, 2005).
- Serum activin-A levels in heart failure patients increased according to disease severity (Yndestal et al, Circulation 109: 1379-1385, 2004).
- serum activin-A elevated immediately after myocardial infarct and persisted for six months, and activin-A immunostaining was localized solely to cardiomyocytes (Yndestad et al., 2004).
- Elevated levels of activin-A were reported in heart failure (Yndestad, A. et al. 3 Circulation 709: 1379-1385, 2004).
- hybridization described herein are those well known and commonly used in the art.
- the methods and techniques of the present invention are generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification unless otherwise indicated. See, e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989) and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates (1992), and Harlow and Lane Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1990), which are incorporated herein by reference. Enzymatic reactions and purification techniques are performed according to manufacturer's
- isolated molecule (where the molecule is, for example, a polypeptide, a polynucleotide, or an antibody) is a molecule that by virtue of its origin or source of derivation (1) is not associated with at least one naturally associated component that accompany it in its native state, (2) is substantially free of other molecules from the same species (3) is expressed by a cell from a different species, or (4) does not occur in nature.
- a molecule that is chemically synthesized, or synthesized in a cellular system different from the cell from which it naturally originates will be “isolated” from its naturally associated components.
- a molecule also may be rendered substantially free of naturally associated components by isolation, using purification techniques well known in the art.
- Molecule purity or homogeneity may be assayed by a number of means well known in the art.
- the purity of a polypeptide sample may be assayed using polyacrylamide gel electrophoresis and staining of the gel to visualize the polypeptide using techniques well known in the art.
- higher resolution may be provided by using HPLC or other means well known in the art for purification.
- anti-activin-A compound a molecule that detectably inhibits at least one function of activin-A.
- an "activin-A agonist” is a molecule that detectably increases at least one function of activin-A.
- the inhibition caused by an activin-A inhibitor need not be complete so long as it is detectable using an assay. Any assay of a function of activin-A can be used, examples of which are provided herein. Examples of functions of activin-A that can be inhibited by an activin-A inhibitor, or increased by an activin-A agonist, include binding to activin-A.
- activin-A inhibitors and activin-A agonists include, but are not limited to, activin-A binding polypeptides such as antigen binding proteins (e.g., activin-A inhibiting antigen binding proteins), activin IIB receptors (svActRIIB), svActRIIB fragments, svActRIIB derivatives, antibodies, antibody fragments, and antibody derivatives.
- activin-A binding polypeptides such as antigen binding proteins (e.g., activin-A inhibiting antigen binding proteins), activin IIB receptors (svActRIIB), svActRIIB fragments, svActRIIB derivatives, antibodies, antibody fragments, and antibody derivatives.
- peptide refers to a molecule comprising two or more amino acid residues joined to each other by peptide bonds. These terms encompass, e.g., native and artificial proteins, protein fragments and polypeptide analogs (such as muteins, variants, and fusion proteins) of a protein sequence as well as post- trans lationally, or otherwise covalently or non-covalently, modified proteins.
- a peptide, polypeptide, or protein may be monomeric or polymeric. Polynucleotide and polypeptide sequences are indicated using standard one- or three-letter abbreviations.
- polypeptide sequences have their amino termini at the left and their carboxy termini at the right, and single-stranded nucleic acid sequences, and the top strand of double- stranded nucleic acid sequences, have their 5' termini at the left and their 3' termini at the right.
- a particular polypeptide or polynucleotide sequence also can be described by explaining how it differs from a reference sequence. Unless otherwise indicated, it is understood that polynucleotide and polypeptide sequences include each nucleic acid or amino acid listed, respectively, as well as the intervening nucleic acids or amino acids.
- the polypeptide sequence R13-Y39 sets forth a polypeptide sequence that includes the amino acids R13, and Y39, as well as the amino acids found between R13 and Y39 in the polypeptide sequence.
- the polynucleotide sequence CI— T5 sets forth a polynucleotide sequence that includes nucleic acids CI, and T5, as well as nucleic acids at positions 2, 3, and 4 of the sequence.
- designations of SEQ ID NO: 1-5 likewise designates the inclusive group of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, and SEQ ID NO: 5.
- amino acid groupings are also intended to be inclusive, unless otherwise designated.
- the phrase "amino acids 1-5 of SEQ ID NO: 28" includes amino acids at positions 1, 2, 3, 4, and 5 of SEQ ID NO: 28.
- Polypeptides of the invention include polypeptides that have been modified in any way and for any reason, for example, to: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinities, and (4) confer or modify other physicochemical or functional properties.
- Analogs include muteins of a polypeptide. For example, single or multiple amino acid substitutions (e.g., conservative amino acid substitutions) may be made in the naturally occurring sequence (e.g., in the portion of the polypeptide outside the domain(s) forming intermolecular contacts).
- a “conservative amino acid substitution” is one that does not substantially change the structural characteristics of the parent sequence (e.g., a replacement amino acid should not tend to break a helix that occurs in the parent sequence, or disrupt other types of secondary structure that characterize the parent sequence or are necessary for its functionality). Examples of art-recognized polypeptide secondary and tertiary structures are described in Proteins, Structures and Molecular Principles (Creighton, Ed., W. H.
- polypeptide fragment refers to a polypeptide that has an amino-terminal and/or carboxy -terminal deletion as compared to a corresponding full-length protein. Fragments can be, for example, at least 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 20, 50, 70, 80, 90, 100, 150 or 200 amino acids in length. Fragments can also be, for example, at most 1,000, 750, 500, 250, 200, 175, 150, 125, 100, 90, 80, 70, 60, 50, 40, 30, 20, 15, 14, 13, 12, 11, or 10 amino acids in length.
- a fragment can further comprise, at either or both of its ends, one or more additional amino acids, for example, a sequence of amino acids from a different naturally-occurring protein (e.g. , an Fc or leucine zipper domain) or an artificial amino acid sequence (e.g., an artificial linker sequence).
- additional amino acids for example, a sequence of amino acids from a different naturally-occurring protein (e.g. , an Fc or leucine zipper domain) or an artificial amino acid sequence (e.g., an artificial linker sequence).
- Variants of the invention include fragments, analogs, recombinant polypeptides, synthetic polypeptides, and/or fusion proteins.
- a "derivative" of a polypeptide is a polypeptide (e.g., an antibody) that has been chemically modified, e.g., via conjugation to another chemical moiety such as, for example, polyethylene glycol, albumin (e.g., human serum albumin), phosphorylation, and glycosylation.
- the term “antibody” includes, in addition to antibodies comprising two full-length heavy chains and two full- length light chains, derivatives, variants, fragments, and muteins thereof, examples of which are described below.
- percent "identity,” in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, determined by comparing the sequences using the GAP computer program (a part of the GCG Wisconsin Package, version 10.3 (Accelrys, San Diego, CA)) using its default parameters. Depending on the application, the percent “identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
- Two single-stranded polynucleotides are "the complement" of each other if their sequences can be aligned in an anti-parallel orientation such that every nucleotide in one polynucleotide is opposite its complementary nucleotide in the other polynucleotide, without the introduction of gaps, and without unpaired nucleotides at the 5' or the 3 ' end of either sequence.
- a polynucleotide is "complementary" to another polynucleotide if the two polynucleotides can hybridize to one another under moderately stringent conditions.
- a polynucleotide can be complementary to another polynucleotide without being its complement.
- vectors e.g., non-episomal mammalian vectors
- An "expression vector” is a type of vector that can direct the expression of a chosen polynucleotide.
- a nucleotide sequence is "operably linked" to a regulatory sequence if the regulatory sequence affects the expression (e.g., the level, timing, or location of expression) of the nucleotide sequence.
- a "regulatory sequence” is a nucleic acid that affects the expression (e.g., the level, timing, or location of expression) of a nucleic acid to which it is operably linked.
- the regulatory sequence can, for example, exert its effects directly on the regulated nucleic acid, or through the action of one or more other molecules (e.g., polypeptides that bind to the regulatory sequence and/or the nucleic acid).
- regulatory sequences include promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Further examples of regulatory sequences are described in, for example, Goeddel, 1990, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA and Baron et ah, 1995, Nucleic Acids Res. 23 :3605-06.
- a "host cell” is a cell that can be used to express a nucleic acid, e.g., a nucleic acid of the invention.
- a host cell can be a prokaryote, for example, E. coli, or it can be a eukaryote, for example, a single-celled eukaryote (e.g., a yeast or other fungus), a plant cell (e.g. , a tobacco or tomato plant cell), an animal cell (e.g. , a human cell, a monkey cell, a hamster cell, a rat cell, a mouse cell, or an insect cell) or a hybridoma.
- a host cell also can be a cell that comprises the nucleic acid but does not express it at a desired level unless a regulatory sequence is introduced into the host cell such that it becomes operably linked with the nucleic acid. It is understood that the term host cell refers not only to the particular subject cell but to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to, e.g., mutation or environmental influence, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
- the present invention provides isolated nucleic acid molecules.
- the nucleic acids comprise, for example, polynucleotides that encode all or part of an antigen binding protein, for example, one or both chains of an antibody of the invention, or a fragment, derivative, mutein, or variant thereof, polynucleotides sufficient for use as hybridization probes, PCR primers or sequencing primers for identifying, analyzing, mutating or amplifying a polynucleotide encoding a polypeptide, anti-sense nucleic acids for inhibiting expression of a polynucleotide, and complementary sequences of the foregoing.
- the nucleic acids can be any length.
- nucleic acids can be single-stranded or double-stranded and can comprise RNA and/or DNA nucleotides, and artificial variants thereof (e.g., peptide nucleic acids).
- Nucleic acids encoding antibody polypeptides can be isolated from B-cells of mice that have been immunized with activin-A.
- the nucleic acid can be isolated by conventional procedures such as polymerase chain reaction (PCR).
- nucleic acid sequences encoding the variable regions of the heavy and light chain variable regions are shown herein.
- the skilled artisan will appreciate that, due to the degeneracy of the genetic code, each of the polypeptide sequences disclosed herein is encoded by a large number of other nucleic acid sequences.
- the present invention provides each degenerate nucleotide sequence encoding each antigen binding protein of the invention.
- the invention further provides nucleic acids that hybridize to other nucleic acids (e.g., nucleic acids comprising a nucleotide sequence of any of A 1 -A 14) under particular hybridization conditions.
- nucleic acids e.g., nucleic acids comprising a nucleotide sequence of any of A 1 -A 14
- Methods for hybridizing nucleic acids are well-known in the art. See, e.g., Curr. Prot. in Mol. Biol, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6.
- a moderately stringent hybridization condition uses a prewashing solution containing 5X sodium chloride/sodium citrate (SSC), 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization buffer of about 50% formamide, 6X SSC, and a hybridization temperature of 55° C (or other similar hybridization solutions, such as one containing about 50% formamide, with a hybridization temperature of 42° C), and washing conditions of 60° C, in 0.5X SSC, 0.1% SDS.
- a stringent hybridization condition hybridizes in 6X SSC at 45° C, followed by one or more washes in 0.1X SSC, 0.2% SDS at 68° C.
- Changes can be introduced by mutation into a nucleic acid, thereby leading to changes in the amino acid sequence of a polypeptide (e.g., an antigen binding protein) that it encodes. Mutations can be introduced using any technique known in the art. In one embodiment, one or more particular amino acid residues are changed using, for example, a site-directed mutagenesis protocol. In another embodiment, one or more randomly selected residues are changed using, for example, a random mutagenesis protocol. However it is made, a mutant polypeptide can be expressed and screened for a desired property (e.g., binding to activin-A).
- a desired property e.g., binding to activin-A
- Mutations can be introduced into a nucleic acid without significantly altering the biological activity of a polypeptide that it encodes. For example, one can make nucleotide substitutions leading to amino acid substitutions at non-essential amino acid residues.
- a nucleotide sequence provided herein for A 1 -A 14, or a desired fragment, variant, or derivative thereof is mutated such that it encodes an amino acid sequence comprising one or more deletions or substitutions of amino acid residues that are shown herein for A 1 -A 14 to be residues where two or more sequences differ.
- A1-A14 refers to 14 sequences, Al, and A14, as well as the 12 intervening amino acid residues.
- the mutagenesis inserts an amino acid adjacent to one or more amino acid residues shown herein for A 1 -A 14 to be residues where two or more sequences differ.
- one or more mutations can be introduced into a nucleic acid that selectively change the biological activity (e.g., binding of activin-A) of a polypeptide that it encodes.
- the mutation can quantitatively or qualitatively change the biological activity. Examples of quantitative changes include increasing, reducing or eliminating the activity. Examples of qualitative changes include changing the antigen specificity of an antigen binding protein.
- the present invention provides nucleic acid molecules that are suitable for use as primers or hybridization probes for the detection of nucleic acid sequences of the invention.
- a nucleic acid molecule of the invention can comprise only a portion of a nucleic acid sequence encoding a full-length polypeptide of the invention, for example, a fragment that can be used as a probe or primer or a fragment encoding an active portion (e.g., an activin-A binding portion) of a polypeptide of the invention.
- Probes based on the sequence of a nucleic acid of the invention can be used to detect the nucleic acid or similar nucleic acids, for example, transcripts encoding a polypeptide of the invention.
- the probe can comprise a label group, e.g., a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used to identify a cell that expresses the polypeptide.
- the present invention provides vectors comprising a nucleic acid encoding a polypeptide of the invention or a portion thereof.
- vectors include, but are not limited to, plasmids, viral vectors, non-episomal mammalian vectors and expression vectors, for example, recombinant expression vectors.
- An expression vector comprises a transcriptional unit comprising an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, promoters or enhancers, (2) a sequence that encodes polypeptides and proteins to be transcribed into mRNA and translated into protein, and (3) appropriate transcription initiation and termination sequences. These sequences may further include a selection marker.
- Vectors suitable for expression in host cells are readily available and the nucleic acid molecules are inserted into the vectors using standard recombinant DNA techniques. Such vectors can include promoters which function in specific tissues, and viral vectors for the expression of polypeptides in targeted human or animal cells.
- the recombinant expression vectors of the invention can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell.
- the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, which is operably linked to the nucleic acid sequence to be expressed.
- Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells (e.g., SV40 early gene enhancer, Rous sarcoma virus promoter and cytomegalovirus promoter), those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences, see Voss et al, 1986, Trends Biochem. Sci.
- the expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein.
- the invention further provides methods of making polypeptides.
- a variety of other expression/host systems may be utilized.
- Vector DNA can be introduced into prokaryotic or eukaryotic systems via conventional transformation or transfection techniques. These systems include but are not limited to microorganisms such as bacteria (for example, E.
- coli transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transfected with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with bacterial expression vectors (e.g., Ti or pBR322 plasmid); or animal cell systems.
- virus expression vectors e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV
- bacterial expression vectors e.g., Ti or pBR322 plasmid
- Mammalian cells useful in recombinant protein production include but are not limited to VERO cells, HeLa cells, Chinese hamster ovary (CHO) cell lines, or their derivatives such as Veggie CHO and related cell lines which grow in serum-free media (see Rasmussen et al, 1998, Cytotechnology 28:31) or CHO strain DX-B 11, which is deficient in DHFR (see Urlaub et al, 1980, Proc. Natl. Acad. Sci.
- COS cells such as the COS-7 line of monkey kidney cells (ATCC CRL 1651) (see Gluzman et al, 1981, Cell 23 : 175), W138, BHK, HepG2, 3T3 (ATCC CCL 163), RTN, MDCK, A549, PC12, K562, L cells, C127 cells, BHK (ATCC CRL 10) cell lines, the CVl/EBNA cell line derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) (see McMahan et al, 1991, EMBO J.
- human embryonic kidney cells such as 293, 293 EBNA or MSR 293, human epidermal A431 cells, human Colo205 cells, other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL-60, U937, HaK or Jurkat cells.
- Mammalian expression allows for the production of secreted or soluble polypeptides which may be recovered from the growth medium.
- selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate.
- Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die), among other methods.
- the expressed polypeptides of this invention may need to be "refolded” and oxidized into a proper tertiary structure and disulfide linkages generated in order to be biologically active.
- Refolding can be accomplished using a number of procedures well known in the art. Such methods include, for example, exposing the solubilized polypeptide to a pH usually above 7 in the presence of a chaotropic agent. The selection of chaotrope is similar to the choices used for inclusion body solubilization; however a chaotrope is typically used at a lower concentration.
- Exemplary chaotropic agents are guanidine and urea.
- the refolding/oxidation solution will also contain a reducing agent plus its oxidized form in a specific ratio to generate a particular redox potential which allows for disulfide shuffling to occur for the formation of cysteine bridges.
- Some commonly used redox couples include
- a co-solvent may be used to increase the efficiency of the refolding.
- cosolvents include glycerol, polyethylene glycol of various molecular weights, and arginine.
- the polypeptides can be synthesized in solution or on a solid support in accordance with conventional techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols.
- polypeptides and proteins of the present invention can be purified according to protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the proteinaceous and non- proteinaceous fractions. Having separated the peptide polypeptides from other proteins, the peptide or polypeptide of interest can be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity).
- purified polypeptide as used herein, is intended to refer to a composition, isolatable from other components, wherein the polypeptide is purified to any degree relative to its naturally-obtainable state. A purified polypeptide therefore also refers to a polypeptide that is free from the environment in which it may naturally occur.
- purified will refer to a polypeptide composition that has been subjected to fractionation to remove various other components, and which composition substantially retains its expressed biological activity. Where the term “substantially purified” is used, this designation will refer to a peptide or polypeptide composition in which the polypeptide or peptide forms the major component of the composition, such as constituting about 50 %, about 60 %, about 70 %, about 80 %, about 85 %, or about 90 % or more of the proteins in the composition.
- Activin-A can be purified from host cells that have been transfected by a gene encoding activin-A by elution of filtered supernatant of host cell culture fluid using a Heparin HP column, using a salt gradient.
- a Fab fragment is a monovalent fragment having the VL, VH, CL and CHI domains; a F(ab')2 fragment is a bivalent fragment having two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment has the VH and CHI domains; an Fv fragment has the VL and VH domains of a single arm of an antibody; and a dAb fragment has a VH domain, a VL domain, or an antigen-binding fragment of a VH or VL domain (US Pat. No. 6,846,634, 6,696,245, US App. Pub. No. 05/0202512, 04/0202995, 04/0038291, 04/0009507, 03/0039958, Ward et al, Nature 341 :544-546, 1989).
- Antibodies comprising a light chain and heavy chain are designated by combining the name of the light chain and the name of the heavy chain variable domains.
- L4H7 indicates an antibody comprising the light chain variable domain of L4 and the heavy chain variable domain of H7.
- Kappa light chain constant sequences are shown in SEQ ID NO: 84, 100 and 108, and heavy chain constant sequence are shown in SEQ ID NOs: 214, 215 and 221.
- an antibody may comprise a specific heavy or light chain, while the complementary light or heavy chain variable domain remains unspecified.
- certain embodiments herein include antibodies that bind a specific antigen (such as activin-A) by way of a specific light or heavy chain, such that the complementary heavy or light chain may be promiscuous, or even irrelevant, but may be determined by, for example, screening combinatorial libraries.
- Naturally occurring immunoglobulin chains exhibit the same general structure of relatively conserved framework regions (FR) joined by three hypervariable regions, also called complementarity determining regions or CDRs. From N-terminus to C-terminus, both light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The assignment of amino acids to each domain is in accordance with the definitions of Kabat et al. in Sequences of Proteins of Immunological Interest, 5 th Ed., US Dept. of Health and Human Services, PHS, NIH, NIH Publication no. 91-3242, 1991.
- human antibody also referred to as “fully human antibody,” includes all antibodies that have one or more variable and constant regions derived from human immunoglobulin sequences. In one embodiment, all of the variable and constant domains are derived from human immunoglobulin sequences (a fully human antibody). These antibodies may be prepared in a variety of ways, examples of which are described below, including through the immunization with an antigen of interest of a mouse that is genetically modified to express antibodies derived from human heavy and/or light chain-encoding genes.
- a humanized antibody has a sequence that differs from the sequence of an antibody derived from a non-human species by one or more amino acid substitutions, deletions, and/or additions, such that the humanized antibody is less likely to induce an immune response, and/or induces a less severe immune response, as compared to the non- human species antibody, when it is administered to a human subject.
- certain amino acids in the framework and constant domains of the heavy and/or light chains of the non-human species antibody are mutated to produce the humanized antibody.
- the constant domain(s) from a human antibody are fused to the variable domain(s) of a non-human species.
- one or more amino acid residues in one or more CDR sequences of a non-human antibody are changed to reduce the likely immunogenicity of the non-human antibody when it is administered to a human subject, wherein the changed amino acid residues either are not critical for immunospecific binding of the antibody to its antigen, or the changes to the amino acid sequence that are made are conservative changes, such that the binding of the humanized antibody to the antigen is not significantly worse than the binding of the non-human antibody to the antigen. Examples of how to make humanized antibodies may be found in U.S. Pat. Nos. 6,054,297, 5,886, 152 and 5,877,293.
- chimeric antibody refers to an antibody that contains one or more regions from one antibody and one or more regions from one or more other antibodies.
- one or more of the CDRs are derived from a human anti-activin-A antibody.
- all of the CDRs are derived from a human anti-activin-A antibody.
- the CDRs from more than one human anti-activin-A antibodies are mixed and matched in a chimeric antibody.
- a chimeric antibody may comprise a CDRl from the light chain of a first human anti-activin-A antibody, a CDR2 and a CDR3 from the light chain of a second human anti-activin-A antibody, and the CDRs from the heavy chain from a third anti-activin-A antibody.
- the framework regions may be derived from one of the same anti-activin-A antibodies, from one or more different antibodies, such as a human antibody, or from a humanized antibody.
- a portion of the heavy and/or light chain is identical with, homologous to, or derived from an antibody from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is/are identical with, homologous to, or derived from an antibody (-ies) from another species or belonging to another antibody class or subclass.
- fragments of such antibodies that exhibit the desired biological activity (i.e., the ability to specifically bind activin-A).
- fragments or analogs of antibodies can be readily prepared by those of ordinary skill in the art following the teachings of this specification and using techniques well-known in the art. Preferred amino- and carboxy-termini of fragments or analogs occur near boundaries of functional domains. Structural and functional domains can be identified by comparison of the nucleotide and/or amino acid sequence data to public or proprietary sequence databases. Computerized comparison methods can be used to identify sequence motifs or predicted protein conformation domains that occur in other proteins of known structure and/or function. Methods to identify protein sequences that fold into a known three-dimensional structure are known. See, e.g., Bowie et ah, 1991, Science 253 : 164.
- Antigen binding fragments derived from an antibody can be obtained, for example, by proteolytic hydrolysis of the antibody, for example, pepsin or papain digestion of whole antibodies according to conventional methods.
- antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment termed F(ab')2. This fragment can be further cleaved using a thiol reducing agent to produce 3.5S Fab' monovalent fragments.
- the cleavage reaction can be performed using a blocking group for the sulfhydryl groups that result from cleavage of disulfide linkages.
- antibody fragment may also be any synthetic or genetically engineered protein.
- antibody fragments include isolated fragments consisting of the light chain variable region, "Fv" fragments consisting of the variable regions of the heavy and light chains, recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker (scFv proteins).
- CDRs complementarity determining regions
- CDRs can be incorporated into a molecule either covalently or noncovalently to make it an antigen binding protein.
- CDRs can be obtained by constructing polynucleotides that encode the CDR of interest.
- Such polynucleotides are prepared, for example, by using the polymerase chain reaction to synthesize the variable region using mRNA of antibody -producing cells as a template (see, for example, Larrick et al, Methods: A Companion to Methods in Enzymology 2: 106, 1991 ; Courtenay-Luck, "Genetic Manipulation of Monoclonal Antibodies,” in Monoclonal Antibodies: Production, Engineering and Clinical Application, Ritter et al.
- the binding agent comprises at least one CDR as described herein.
- the binding agent may comprise at least two, three, four, five or six CDR's as described herein.
- the binding agent further may comprise at least one variable region domain of an antibody described herein.
- the variable region domain may be of any size or amino acid composition and will generally comprise at least one CDR sequence responsible for binding to human activin-A, for example CDR-H1, CDR-H2, CDR-H3 and/or the light chain CDRs specifically described herein and which is adjacent to or in frame with one or more framework sequences.
- the variable (V) region domain may be any suitable arrangement of immunoglobulin heavy (VH) and/or light (VL) chain variable domains.
- variable region domain may be any naturally occurring variable domain or an engineered version thereof.
- engineered version is meant a variable region domain that has been created using recombinant DNA engineering techniques.
- engineered versions include those created, for example, from a specific antibody variable region by insertions, deletions, or changes in or to the amino acid sequences of the specific antibody.
- Particular examples include engineered variable region domains containing at least one CDR and optionally one or more framework amino acids from a first antibody and the remainder of the variable region domain from a second antibody.
- variable region domain may be covalently attached at a C-terminal amino acid to at least one other antibody domain or a fragment thereof.
- a VH domain that is present in the variable region domain may be linked to an immunoglobulin CHI domain, or a fragment thereof.
- a VL domain may be linked to a C domain or a fragment thereof.
- the antibody may be a Fab fragment wherein the antigen binding domain contains associated VH and VL domains covalently linked at their C-termini to a CHI and C domain, respectively.
- the CHI domain may be extended with further amino acids, for example to provide a hinge region or a portion of a hinge region domain as found in a Fab' fragment, or to provide further domains, such as antibody CH2 and CH3 domains.
- antibodies comprise at least one of these CDRs.
- one or more CDR may be incorporated into known antibody framework regions (IgGl, IgG2, etc.), or conjugated to a suitable vehicle to enhance the half-life thereof.
- suitable vehicles include, but are not limited to Fc, polyethylene glycol (PEG), albumin, transferrin, and the like. These and other suitable vehicles are known in the art.
- conjugated CDR peptides may be in monomeric, dimeric, tetrameric, or other form.
- one or more water-soluble polymer is bonded at one or more specific position, for example at the amino terminus, of a binding agent.
- Antigen specific (i.e. activin-A specific) antibodies can be produced by methods known in the art by using a specific VL or VH domain to screen a library of the
- complementary variable domain Such methods of producing antibodies are known in the art. For example, antibody fragments fused to another protein, such as a minor coat protein, can be used to enrich phage with antigen. Then, using a random combinatorial library of rearragned heavy (VH) and light (VL) chains from mice immune to the antigen (e.g. activin- A), diverse libraries of antibody fragments are displayed on the surface of the phage. These libraries can be screened for complementary variable domains, and the domains purified by, for example, affinity column. See Clackson et al, Nature, V. 352 pp. 624-628 (1991).
- VL or VH chains from an antibody can be used to search for other VH or VL chains that could form antigen-binding fragments (or Fab), with the same specificity.
- an antibody i.e. activin-A antibody
- VH and VL chain Ig genes can be expresses as antigen-binding fragments in a bacteriophage library (such as fd or lambda phage).
- a combinatorial library may be generated by utilizing the parent VL or VH chain library combined with antigen-binding specific VL or VH chain libraries, respectively.
- the combinatorial libraries may then be screened by conventional techniques, for example by using radioactively labeled probe (such as radioactively labeled activin-A). See, for example, Portolano et al, J. Immunol. V. 150 (3) pp. 880-887 (1993).
- a "CDR grafted antibody” is an antibody comprising one or more CDRs derived from an antibody of a particular species or isotype and the framework of another antibody of the same or different species or isotype.
- an "antigen binding domain,” “antigen binding region,” or “antigen binding site” is a portion of an antigen binding protein that contains amino acid residues (or other moieties) that interact with an antigen and contribute to the antigen binding protein's specificity and affinity for the antigen. For an antibody that specifically binds to its antigen, this will include at least part of at least one of its CDR domains.
- the present invention provides antigen binding proteins (e.g., antibodies, antibody fragments, antibody derivatives, antibody muteins, and antibody variants), that bind to activin-A, e.g. , human activin-A.
- antigen binding proteins e.g., antibodies, antibody fragments, antibody derivatives, antibody muteins, and antibody variants
- activin-A e.g. , human activin-A.
- an "antigen binding protein” is a protein comprising a portion that binds to an antigen and, optionally, a scaffold or framework portion that allows the antigen binding portion to adopt a conformation that promotes binding of the antigen binding protein to the antigen.
- antigen binding proteins include antibodies, antibody fragments (e.g., an antigen binding portion of an antibody), antibody derivatives, and antibody analogs.
- the antigen binding protein can comprise, for example, an alternative protein scaffold or artificial scaffold with grafted CDRs or CDR derivatives.
- Such scaffolds include, but are not limited to, antibody-derived scaffolds comprising mutations introduced to, for example, stabilize the three-dimensional structure of the antigen binding protein as well as wholly synthetic scaffolds comprising, for example, a biocompatible polymer. See, for example, Korndorfer et al, 2003, Proteins: Structure, Function, and Bioinformatics , Volume 53, Issue 1 : 121-129; Roque et al, 2004, Biotechnol. Prog. 20:639-654.
- PAMs peptide antibody mimetics
- scaffolds based on antibody mimetics utilizing fibronection components as a scaffold.
- An antigen binding protein can have, for example, the structure of a naturally occurring immunoglobulin.
- An "immunoglobulin” is a tetrameric molecule. In a naturally occurring immunoglobulin, each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy" chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 1 10 or more amino acids primarily responsible for antigen recognition.
- the carboxy -terminal portion of each chain defines a constant region primarily responsible for effector function. Human light chains are classified as kappa and lambda light chains.
- Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its entirety for all purposes).
- the variable regions of each light/heavy chain pair form the antibody binding site such that an intact immunoglobulin has two binding sites.
- Antigen binding proteins in accordance with the present invention include antigen binding proteins that inhibit a biological activity of activin-A.
- antigen binding proteins may attenuate cachexia, and this activity can be present when the antigen binding protein is fully human, such as a fully human antibody.
- Different antigen binding proteins may bind to different domains or cysteine knot domains of activin-A or act by different mechanisms of action. Examples include but are not limited to antigen binding proteins that specifically bind one or more particular cysteine knot domains, or regions interspersed between disulfide bonds, including regions spanning from about amino acids 4-12, amino acids 1 1-81, amino acids 11-33, amino acids 13-39, amino acids 40-1 13, amino acids 44-1 15, amino acids 81-11 1, and/or amino acids 82-107 of the following sequence: tcctatgagg tgactcaggc accctcagtg tccgtgtccc caggacagac agccagcatc acctgctctg gagataaatt gggggataaa tatgcttgtt ggtatcagca gaagccaggc cagtcccctg tgctggtcat ctatcaagat agcaa
- the domain region are designated such as to be inclusive of the group, unless otherwise indicated.
- amino acids 4-12 refers to nine amino acids: amino acids at positions 4, and 12, as well as the seven intervening amino acids in the sequence.
- Other examples include antigen binding proteins that inhibit binding of activin-A to its receptor.
- An antigen binding protein need not completely inhibit an activin-A-induced activity to find use in the present invention; rather, antigen binding proteins that reduce a particular activity of activin-A are contemplated for use as well. (Discussions herein of particular mechanisms of action for activin-A-binding antigen binding proteins in treating particular diseases are illustrative only, and the methods presented herein are not bound thereby.)
- the present invention provides antigen binding proteins that comprise a light chain variable region selected from the group consisting of A 1 -A 14 or a heavy chain variable region selected from the group consisting of A 1 -A 14, and fragments, derivatives, muteins, and variants thereof.
- Such an antigen binding protein can be denoted using the nomenclature "LxHy", wherein "x” corresponds to the number of the light chain variable region and "y” corresponds to the number of the heavy chain variable region as they are labeled in the sequences below. That is to say, for example, that "A1HC” denotes the heavy chain variable region of antibody Al ; “A1LC” denotes the light chain variable region of antibody Al, and so forth.
- CDRs underlined
- FRs Framework Regions
- CDR 1-3 three CDRs
- FR 1-4 four FRs
- the CDR regions of each light and heavy chain also are grouped by antibody type (Al, A2, A3, etc.).
- Antigen binding proteins of the invention include, for example, antigen binding proteins having a combination of light chain and heavy chain variable domains selected from the group of combinations consisting of L1H1 (antibody Al), L2H2 (antibody A2), L3H3 (antibody A3), L4H4 (antibody A4), L5H5 (antibody A5), L6H6 (antibody A6), L7H7 (antibody A7), L8H8 (antibody A8), L9H9 (antibody A9), LI OH 10 (antibody A 10), LI 1H1 1 (antibody Al l), L12H12 (antibody A 12), L13H13 (antibody A 13), and L14H14 (antibody A 14).
- L1H1 antibody Al
- L2H2 antibody A2
- L3H3 antibody A3
- L4H4 antibody A4
- L5H5 antibody A5
- L6H6 antibody A6
- L7H7 antibody A7
- Antibodies A1-A14 heavy and light chain variable region polynucleotides also referred to herein as HI -HI 4 and LI -LI 4).
- Antibodies A1-A14 amino acid sequences, light chain variable regions. CDR regions are underlined; the intervening segments or regions are referred to as framework (FR) herein.
- DIOMTOSPSSLSASVGDRVTITCRASOGIR LGWYQO PG AP RLIYAASSLQSGV PSRFSGSGSGTEFTLTISSLOPEDFTTYYCLOHNSYPWTFGOGTKVEIK (SEQ ID NO: 137)
- Antibodies A1-A14 amino acid sequences of heavy chain variable regions. CDR regions are shaded and underlined; the other regions are referred to as framework (FR) herein.
- OVOLOESGPGLVKPSETLSLTCTVSGGSINSFYWSWIROPPGKGLEWIGYIYYSGSTN YNPSLKRRVTISVDTSKTQFSLKLSSVTAADTAVYYCARDSIAAPFDYWGQGTLVTV SS (SEQ ID NO: 122)
- Table 1 Light chain CDR1 consensus sequences for Antibodies A1-A14.
- Xi is an arginine residue or a lysine residue
- X2 is a leucine residue or a isoleucine residue
- X 3 is a histidine residue or a tyrosine residue
- X 4 is a threonine residue or a serine residue
- X5 is a glycine residue or an asparagine residue
- Xe is a tyrosine residue or an asparagine residue
- X 7 is an asparagine residue or a lysine residue
- Xs is a lysine residue or no residue
- X 9 is an aspartate residue or a valine residue
- Xio is a serine residue or a glycine residue
- Xii is a serine residue or a glycine residue
- X 12 is a serine residue or an arginine residue
- Xi 3 is a tyrosine residue, an aspartate residue, or an asparagine residue
- Xi4 is an aspartate residue, a valine residue, or a glycine residue
- Xi5 is a glutamate residue or an aspartate residue
- Xi 6 is a tryptophan residue or a leucine residue
- Xi7 is a glutamate residue or an aspartate residue
- Xi 8 is a tyrosine residue or a phenylalanine residue
- Xi 9 is an alanine residue or a valine residue
- Table 2 Light chain CDR2 consensus sequences for Antibodies A1-A14.
- X41 is a threonine residue, an alanine residue, or a glycine residue
- X42 is a serine residue, a methionine residue, or a phenylalanine residue
- X4 3 is a leucine residue or an arginine residue
- X44 is a glutamine residue, a glutamate residue, or an alanine residue
- X45 is a glutamine residue, a leucine resic ue, or a histidine residue,
- X4 6 is a threonine residue, an asparagine residue, or a serine residue
- Table 3 Light chain CDR3 consensus sequences for Antibodies A1-A14.
- Xs 3 is a phenylalanine residue or a tryptophan residue
- X7 3 is a methionine residue, a glutamine residue, or an arginine residue
- X74 is an alanine residue, a tyrosine residue, a glutamine residue, or a serine residue,
- X75 is a leucine residue, a tyrosine residue, or an asparagine residue
- X7 6 is a glutamine residue, a serine residue, or a threonine residue
- X77 is a threonine residue, a tyrosine residue, or an isoleucine residue
- X78 is a proline residue or a serine residue
- X7 9 is a cysteine residue, a tryptophan residue, a leucine residue, or a proline residue
- Xso is a serine residue or a threonine residue
- X22 is an asparagine residue or a serine residue
- X2 3 is a serine residue or an alanine residue
- X24 is a glycine residue or no residue
- X25 is a glycine residue or no residue
- X2 6 is a phenylalanine residue or a tyrosine residue
- X27 is a tyrosine residue or a phenylalanine residue
- X28 is a threonine residue or a serine residue
- X29 is a threonine residue, a serine residue, or an isoleucine residue
- X30 is a glycine residue or a serine residue
- X31 is a tyrosine residue, a glycine residue, or a tryptophan residue
- X32 is an isoleucine residue or a methionine residue
- X33 is a histidine residue or a glycine residue
- X35 is a threonine residue or a serine residue
- X36 is a serine residue or an alanine residue
- X37 is a glycine residue or a tryptophan residue
- X38 is a leucine residue, a methionine residue, or an isoleucine residue
- X39 is a serine residue or a histidine residue
- Table 5 Heavy chain CDR2 consensus sequences for Antibodies A1-A14.
- X47 is a tyrosine residue or a glutamate residue
- X 4 8 is a serine residue, a tyrosine residue, or an asparagine residue
- X49 is a tyrosine residue or a histidine residue
- X50 is a serine residue or a glycine residue
- X51 is a tyrosine residue or an asparagine residue
- X52 is a serine residue or an arginine residue
- X54 is a tryptophan residue or a lysine residue
- X55 is a tyrosine residue or a glutamine residue
- X57 is a lysine residue or a glutamate residue
- X58 is a histidine residue or a tyrosine residue
- X59 is an alanine residue or a valine residue
- X60 is a tryptophan residue or an isoleucine residue
- ⁇ is an asparagine residue, an isoleucine residue, a serine residue, or a tyrosine residue
- X62 is a proline residue or an alanine residue
- ⁇ 3 is an asparagine residue, a tyrosine residue, or a glycine residue
- ⁇ 4 is a serine residue, an asparagine residue, or an aspartate residue
- ⁇ 65 is a glycine residue or a serine residue
- ⁇ 6 is a glycine residue, an asparagine residue, or an aspartate residue
- ⁇ 7 is an asparagine residue or an arginine residue
- ⁇ 8 is a tyrosine residue or a serine residue
- ⁇ 9 is an alanine residue or a serine residue
- ⁇ 70 is a glutamine residue or a proline residue
- ⁇ 7 1 is a lysine residue or a serine residue
- ⁇ 72 is a phenylalanine residue or a leucine residue
- Xs7 is a valine residue or no residue
- Xs 8 is a glutamine residue or no residue
- Xs 9 is an aspartate residue, a tryptophan residue, or no residue
- X91 is an isoleucine residue, a glutamate residue, or a glutamine residue
- X 92 is an alanine residue, a leucine residue, or a glycine residue
- X93 is an alanine residue or a leucine residue
- X94 is a proline residue, a tyrosine residue, or a glycine residue
- X 95 is an aspartate residue or no residue
- X 96 is a glutamine residue or no residue
- X 9 7 is an aspartate residue or an alanine residue
- X 98 is a tyrosine residue or a glycine residue
- X 99 is a serine residue or a tyrosine residue
- X100 is a serine residue or an arginine residue
- X1 0 1 is a phenylalanine residue or no residue
- X102 is a glycine residue or an aspartate residue
- X1 03 is a histidine residue or a proline residue
- X1 0 4 is a glycine residue or no residue
- X105 is a serine residue, a glutamate residue, or no residue
- X106 is an arginine residue, a serine residue, or no residue
- X1 0 7 is an aspartate residue, an asparagine residue, a serine residue, or a glutamine resiude X1 08 is a serine residue, an arginine residue, or a tryptophan residue,
- X1 09 is a glycine residue, an aspartate residue, an asparagine residue, a tyrosine residue, or a leucine residue,
- X11 0 is a serine residue, a glycine residue, an aspartate residue, or no residue,
- X111 is a serine residue, a valine residue, an asparagine residue, or a tyrosine residue
- X112 is a serine residue, an asparagine residue, a tyrosine residue, or a histidine residue
- X11 3 is a tryptophan residue, a tyrosine residue, or a glutamine residue,
- X114 is a histidine residue, an aspartate residue, a tyrosine residue, or no residue,
- X115 is a phenylalanine residue, an alanine residue, or a glycine residue, Xii 6 an aspartate residue, a phenylalanine residue, a leucine residue, or a methionine residue
- Xii 8 is an isoleucine residue, a valine residue, or no residue
- the light chain variable domain comprises a sequence of amino acids that is encoded by a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, or 99% identical to a nucleotide sequence that encodes a light chain variable domain selected from the group consisting of L1-L14 (which includes LI, L2, L3, L4, L5, L6, L7, L8, L9, L10, LI 1, L12, L13, and L14).
- L1-L14 which includes LI, L2, L3, L4, L5, L6, L7, L8, L9, L10, LI 1, L12, L13, and L14.
- the light chain variable domain comprises a sequence of amino acids that is encoded by a polynucleotide that hybridizes under moderately stringent conditions to the complement of a polynucleotide that encodes a light chain variable domain selected from the group consisting of L1-L14.
- the light chain variable domain comprises a sequence of amino acids that is encoded by a polynucleotide that hybridizes under moderately stringent conditions to the complement of a polynucleotide that encodes a light chain variable domain selected from the group consisting of L1-L14.
- the light chain variable domain comprises a sequence of amino acids that is encoded by a polynucleotide that hybridizes under moderately stringent conditions to a complement of a light chain polynucleotide of Ll- L14.
- the present invention provides an antigen binding protein comprising a heavy chain variable domain comprising a sequence of amino acids that differs from the sequence of a heavy chain variable domain selected from the group consisting of H1-H14 only at 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 residue(s), wherein each such sequence difference is independently either a deletion, insertion, or substitution of one amino acid residue.
- the heavy chain variable domain comprises a sequence of amino acids that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, or 99% identical to the sequence of a heavy chain variable domain selected from the group consisting of HI -HI 4.
- the heavy chain variable domain comprises a sequence of amino acids that is encoded by a nucleotide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, or 99% identical to a nucleotide sequence that encodes a heavy chain variable domain selected from the group consisting of H1-H14.
- the heavy chain variable domain comprises a sequence of amino acids that is encoded by a polynucleotide that hybridizes under moderately stringent conditions to the complement of a polynucleotide that encodes a heavy chain variable domain selected from the group consisting of HI -HI 4.
- the heavy chain variable domain comprises a sequence of amino acids that is encoded by a polynucleotide that hybridizes under moderately stringent conditions to the complement of a polynucleotide that encodes a heavy chain variable domain selected from the group consisting of H1-H14.
- the heavy chain variable domain comprises a sequence of amino acids that is encoded by a polynucleotide that hybridizes under moderately stringent conditions to a complement of a heavy chain polynucleotide disclosed herein.
- antigen binding proteins of the present invention comprise one or more amino acid sequences that are identical to the amino acid sequences of one or more of the CDRs and/or FRs referenced herein.
- the antigen binding protein comprises a light chain CDR1 sequence illustrated above.
- the antigen binding protein comprises a light chain CDR2 sequence illustrated above.
- the antigen binding protein comprises a light chain CDR3 sequence illustrated above.
- the antigen binding protein comprises a heavy chain CDR1 sequence illustrated above.
- the antigen binding protein comprises a heavy chain CDR2 sequence illustrated above.
- antigen binding protein comprises a heavy chain CDR3 sequence illustrated above.
- the antigen binding protein comprises a light chain FR1 sequence illustrated above. In another embodiment, the antigen binding protein comprises a light chain FR2 sequence illustrated above. In another embodiment, the antigen binding protein comprises a light chain FR3 sequence illustrated above. In another embodiment, the antigen binding protein comprises a light chain FR4 sequence illustrated above. In another embodiment, the antigen binding protein comprises a heavy chain FR1 sequence illustrated above. In another embodiment, the antigen binding protein comprises a heavy chain FR2 sequence illustrated above. In another embodiment, the antigen binding protein comprises a heavy chain FR3 sequence illustrated above. In another embodiment, the antigen binding protein comprises a heavy chain FR4 sequence illustrated above.
- the present invention provides an antigen binding protein that comprises one or more CDR sequences that differ from a CDR sequence shown above by no more than 5, 4, 3, 2, or 1 amino acid residues.
- At least one of the antigen binding protein's CDR3 sequences is a CDR3 sequence from A 1 -A 14, as shown in Table 7 or Table 8.
- the antigen binding protein's light chain CDR3 sequence is a light chain CDR3 sequence from A 1 -A 14 as shown in Table 7 and the antigen binding protein's heavy chain CDR3 sequence is a heavy chain sequence from A1-A14 as shown in Table 8.
- RASQGIRNNLG SEQ ID AASSLQS (SEQ ID NO: LQHNSYPWT (SEQ NO: 281) 283) ID NO: 141)
- A12 RASQGIRNDLG SEQ ID AASSLQS (SEQ ID NO: LQHNSYTWT (SEQ NO: 282) 283) ID NO: 189)
- SGDKLGDKYAF SEQ HDTKRPS (SEQ ID NO: QAWDSSTV (SEQ ID NO: 219) 220) ID NO: 205)
- A8 GGSI SFYWS (SEQ YIYYSGSTNYNP SLKR DSIAAPFDY (SEQ ID NO: 126) (SEQ ID NO: 127) NO: 80)
- A12 GFTFSAYGMH (SEQ VIWYDGSNKYYADSV SRN WNYD S YQYGL
- anti-activin-A antibodies within the scope of this invention include covalent or aggregative conjugates of anti-activin-A antibodies, or fragments thereof, with other proteins or polypeptides, such as by expression of recombinant fusion proteins comprising heterologous polypeptides fused to the N-terminus or C-terminus of an anti- activin-A antibody polypeptide.
- the conjugated peptide may be a heterologous signal (or leader) polypeptide, e.g., the yeast alpha-factor leader, or a peptide such as an epitope tag.
- Antigen binding protein-containing fusion proteins can comprise peptides added to facilitate purification or identification of antigen binding protein (e.g., poly -His).
- An antigen binding protein also can be linked to the FLAG peptide Asp-Tyr-Lys-Asp-Asp-Asp- Asp-Lys (DYKDDDDK) (SEQ ID NO: 226) as described in Hopp et al, Bio/Technology 6: 1204, 1988, and U.S. Patent 5,01 1,912.
- the FLAG peptide is highly antigenic and provides an epitope reversibly bound by a specific monoclonal antibody (mAb), enabling rapid assay and facile purification of expressed recombinant protein.
- Reagents useful for preparing fusion proteins in which the FLAG peptide is fused to a given polypeptide are commercially available (Sigma, St. Louis, MO).
- Fc polypeptide as used herein includes native and mutein forms of polypeptides derived from the Fc region of an antibody. Truncated forms of such
- polypeptides containing the hinge region that promotes dimerization also are included.
- Fusion proteins comprising Fc moieties (and oligomers formed therefrom) offer the advantage of facile purification by affinity chromatography over Protein A or Protein G columns.
- Fc polypeptide is a single chain polypeptide extending from the N-terminal hinge region to the native C-terminus of the Fc region of a human IgGl antibody.
- Another useful Fc polypeptide is the Fc mutein described in U.S. Patent 5,457,035 and in Baum et al, 1994, EMBO J. 13 :3992-4001. The amino acid sequence of this mutein is identical to that of the native Fc sequence presented in WO 93/10151, except that amino acid 19 has been changed from Leu to Ala, amino acid 20 has been changed from Leu to Glu, and amino acid 22 has been changed from Gly to Ala. The mutein exhibits reduced affinity for Fc receptors.
- variable portion of the heavy and/or light chains of an anti-activin-A antibody may be substituted for the variable portion of an antibody heavy and/or light chain.
- Oligomers that contain one or more antigen binding proteins may be employed as activin-A antagonists. Oligomers may be in the form of covalently-linked or non-covalently- linked dimers, trimers, or higher oligomers. Oligomers comprising two or more antigen binding protein are contemplated for use, with one example being a homodimer. Other oligomers include heterodimers, homotrimers, heterotrimers, homotetramers, heterotetramers, etc. [00163] One embodiment is directed to oligomers comprising multiple antigen binding proteins joined via covalent or non-covalent interactions between peptide moieties fused to the antigen binding proteins.
- Such peptides may be peptide linkers (spacers), or peptides that have the property of promoting oligomerization.
- Leucine zippers and certain polypeptides derived from antibodies are among the peptides that can promote oligomerization of antigen binding proteins attached thereto, as described in more detail below.
- an oligomer is prepared using polypeptides derived from immunoglobulins. Preparation of fusion proteins comprising certain heterologous polypeptides fused to various portions of antibody-derived polypeptides (including the Fc domain) has been described, e.g., by Ashkenazi et al, 1991, PNAS USA 88: 10535; Byrn et al, 1990, Nature 344:677; and Hollenbaugh et al, 1992 Curr. Prot.s in Immunol, Suppl. 4, pages 10.19.1 - 10.19.11.
- One embodiment of the present invention is directed to a dimer comprising two fusion proteins created by fusing an activin-A binding fragment of an anti-activin-A antibody to the Fc region of an antibody.
- the dimer can be made by, for example, inserting a gene fusion encoding the fusion protein into an appropriate expression vector, expressing the gene fusion in host cells transformed with the recombinant expression vector, and allowing the expressed fusion protein to assemble much like antibody molecules, whereupon interchain disulfide bonds form between the Fc moieties to yield the dimer.
- the oligomer is a fusion protein comprising multiple antigen binding proteins, with or without peptide linkers (spacer peptides).
- suitable peptide linkers are those described in U.S. Patents 4,751, 180 and 4,935,233.
- leucine zipper domains suitable for producing soluble oligomeric proteins are described in PCT application WO 94/10308, and the leucine zipper derived from lung surfactant protein D (SPD) described in Hoppe et ah, 1994, FEBS Letters 344: 191, hereby incorporated by reference.
- SPD lung surfactant protein D
- the use of a modified leucine zipper that allows for stable trimerization of a heterologous protein fused thereto is described in Fanslow et ah, 1994, Semin. Immunol. 6:267-78.
- recombinant fusion proteins comprising an anti-activin-A antibody fragment or derivative fused to a leucine zipper peptide are expressed in suitable host cells, and the soluble oligomeric anti-activin-A antibody fragments or derivatives that form are recovered from the culture supernatant.
- the present invention provides antigen binding proteins that interfere with the binding of activin-A to an activin-A receptor.
- antigen binding proteins can be made against activin-A, or a fragment, variant or derivative thereof, and screened in conventional assays for the ability to interfere with binding of activin-A to activin-A receptor.
- suitable assays are assays that test the antigen binding proteins for the ability to inhibit binding of activin-A to cells expressing activin-A receptor, or that test antigen binding proteins for the ability to reduce a biological or cellular response that results from the binding of activin-A to cell surface activin-A receptors.
- antibodies can be screened according to their ability to bind to immobilized antibody surfaces (activin-A and/or activin B).
- Antigen binding proteins that block the binding of activin-A to an activin-A receptor can be employed in treating any activin-A-related condition, including but not limited to cachexia.
- a human anti-activin-A monoclonal antibody generated by procedures involving immunization of transgenic mice is employed in treating such conditions.
- Antigen-binding fragments of antigen binding proteins of the invention can be produced by conventional techniques. Examples of such fragments include, but are not limited to, Fab and F(ab') 2 fragments. Antibody fragments and derivatives produced by genetic engineering techniques also are contemplated.
- Additional embodiments include chimeric antibodies, e.g., humanized versions of non-human (e.g., murine) monoclonal antibodies.
- humanized antibodies may be prepared by known techniques, and offer the advantage of reduced immunogenicity when the antibodies are administered to humans.
- a humanized monoclonal antibody comprises the variable domain of a murine antibody (or all or part of the antigen binding site thereof) and a constant domain derived from a human antibody.
- a humanized antibody fragment may comprise the antigen binding site of a murine monoclonal antibody and a variable domain fragment (lacking the antigen-binding site) derived from a human antibody.
- chimeric and further engineered monoclonal antibodies include those described in Riechmann et al, 1988, Nature 332:323, Liu et al, 1987, Proc. Nat. Acad. Sci. USA 84:3439, Larrick et al, 1989, Bio/Technology 7:934, and Winter et al, 1993, TIPS 14: 139.
- the chimeric antibody is a CDR grafted antibody.
- Techniques for humanizing antibodies are discussed in, e.g., U.S. Pat. No.s 5,869,619, 5,225,539, 5,821,337, 5,859,205, 6,881,557, Padlan et al, 1995, FASEB J. 9: 133-39, and Tamura et al, 2000, J. Immunol. 164: 1432-41.
- Procedures have been developed for generating human or partially human antibodies in non-human animals. For example, mice in which one or more endogenous immunoglobulin genes have been inactivated by various means have been prepared. Human immunoglobulin genes have been introduced into the mice to replace the inactivated mouse genes. Antibodies produced in the animal incorporate human immunoglobulin polypeptide chains encoded by the human genetic material introduced into the animal. In one
- a non-human animal such as a transgenic mouse
- an activin- A polypeptide such that antibodies directed against the activin-A polypeptide are generated in the animal.
- a suitable immunogen is a soluble human activin-A, such as a polypeptide comprising the extracellular domain of the protein having the following sequence: Gly Leu Glu Cys Asp Gly Lys Val Asn He Cys Cys Lys Lys Gin Phe Phe Val Ser Phe Lys Asp He Gly Trp Asn Asp Trp He He Ala Pro Ser Gly Tyr His Ala Asn Tyr Cys Glu Gly Glu Cys Pro Ser His He Ala Gly Thr Ser Gly Ser Ser Leu Ser Phe His Ser Thr Val He Asn His Tyr Arg Met Arg Gly His Ser Pro Phe Ala Asn Leu Lys Ser Cys Cys Val Pro Thr Lys Leu Arg Pro Met Ser Met Leu Tyr Tyr Asp Asp Gly Gin Asn He He Lys Lys Asp He Gin Asn Met He Val Glu Glu Glu Cys Gly Cys Ser (SEQ ID NO: 225)), or other immunogenic fragment of the protein.
- the present invention provides monoclonal antibodies that bind to activin-A.
- Monoclonal antibodies of the invention may be generated using a variety of known techniques. In general, monoclonal antibodies that bind to specific antigens may be obtained by methods known to those skilled in the art (see, for example, Kohler et al, Nature 256:495, 1975; Coligan et al. (eds.), Current Protocols in Immunology, 1 :2.5.12.6.7 (John Wiley & Sons 1991); U.S. Patent Nos.
- Antibody fragments may be derived therefrom using any suitable standard technique such as proteolytic digestion, or optionally, by proteolytic digestion (for example, using papain or pepsin) followed by mild reduction of disulfide bonds and alkylation.
- fragments may also be generated by recombinant genetic engineering techniques as described herein.
- Monoclonal antibodies can be obtained by injecting an animal, for example, a rat, hamster, a rabbit, or preferably a mouse, including for example a transgenic or a knock-out, as known in the art, with an immunogen comprising human activin-A (caggtgcagc tgcaggagtc gggcccagga ctggtgaagc cttcggagac cctgtccctc acctgcactg tctctggtgg ctccatcaat agtttctact ggagctggat ccggcagccc ccagggaagg gactggagtg gattgggtat atctattaca gtgggagcac caactacaat cctcctca agagtcgagt caccatatca gtagacacgt ccaagaccca gt
- the presence of specific antibody production may be monitored after the initial injection and/or after a booster injection by obtaining a serum sample and detecting the presence of an antibody that binds to human activin-A or peptide using any one of several immunodetection methods known in the art and described herein. From animals producing the desired antibodies, lymphoid cells, most commonly cells from the spleen or lymph node, are removed to obtain B -lymphocytes. The B lymphocytes are then fused with a
- drug-sensitized myeloma cell fusion partner preferably one that is syngeneic with the immunized animal and that optionally has other desirable properties (e.g., inability to express endogenous Ig gene products, e.g., P3X63 - Ag 8.653 (ATCC No. CRL 1580); NSO, SP20) to produce hybridomas, which are immortal eukaryotic cell lines.
- the lymphoid (e.g., spleen) cells and the myeloma cells may be combined for a few minutes with a membrane fusion-promoting agent, such as polyethylene glycol or a nonionic detergent, and then plated at low density on a selective medium that supports the growth of hybridoma cells but not unfused myeloma cells.
- a preferred selection media is HAT (hypoxanthine, aminopterin, thymidine). After a sufficient time, usually about one to two weeks, colonies of cells are observed. Single colonies are isolated, and antibodies produced by the cells may be tested for binding activity to human activin-A, using any one of a variety of immunoassays known in the art and described herein.
- the hybridomas are cloned (e.g., by limited dilution cloning or by soft agar plaque isolation) and positive clones that produce an antibody specific to activin-A are selected and cultured.
- the monoclonal antibodies from the hybridoma cultures may be isolated from the supernatants of hybridoma cultures.
- An alternative method for production of a murine monoclonal antibody is to inject the hybridoma cells into the peritoneal cavity of a syngeneic mouse, for example, a mouse that has been treated (e.g. , pristane-primed) to promote formation of ascites fluid containing the monoclonal antibody.
- Monoclonal antibodies can be isolated and purified by a variety of well-established techniques.
- Such isolation techniques include affinity chromatography with Protein-A Sepharose, size-exclusion chromatography, and ion-exchange chromatography (see, for example, Coligan at pages 2.7.1-2.7.12 and pages 2.9.1-2.9.3; Baines et ah, "Purification of Immunoglobulin G (IgG),” in Methods in Molecular Biology, Vol. 10, pages 79-104 (The Humana Press, Inc. 1992)).
- Monoclonal antibodies may be purified by affinity chromatography using an appropriate ligand selected based on particular properties of the antibody (e.g., heavy or light chain isotype, binding specificity, etc.).
- a suitable ligand immobilized on a solid support, include Protein A, Protein G, an anticonstant region (light chain or heavy chain) antibody, an anti-idiotype antibody, and a TGF-beta binding protein, or fragment or variant thereof.
- Hybridoma cell lines are identified that produce an antibody that binds an activin-A polypeptide. Such hybridoma cell lines, and anti-activin-A monoclonal antibodies produced by them, are encompassed by the present invention.
- Myeloma cells for use in hybridoma- producing fusion procedures preferably are non-antibody -producing, have high fusion efficiency, and enzyme deficiencies that render them incapable of growing in certain selective media which support the growth of only the desired fused cells (hybridomas).
- Examples of suitable cell lines for use in mouse fusions include Sp-20, P3-X63/Ag8, P3- X63-Ag8.653, NSl/l .Ag 4 1, Sp210-Agl4, FO, NSO/U, MPC-11, MPC 11 -X45-GTG 1.7 and S194/5XX0 Bui; examples of cell lines used in rat fusions include R210.RCY3, Y3-Ag 1.2.3, IR983F and 4B210.
- Other cell lines useful for cell fusions are U-266, GM1500-GRG2, LICR-LON-HMy2 and UC729-6.
- Hybridomas or mAbs may be further screened to identify mAbs with particular properties, such as the ability to block an activin-A-induced activity.
- An antibody of the present invention may also be a fully human monoclonal antibody.
- An isolated fully human antibody is provided that specifically binds to the cysteine knot region (amino acids CI 1-S33 and/or amino acids C81-E11 1) of activin-A, wherein the antigen binding protein possesses at least one in vivo biological activity of a human anti- activin-A antibody.
- the biological activity may be attenuation of cachexia, for example cachexia in colon cancer, such as in a mouse model of colon cancer described herein.
- the cachexia amenable to such treatment is associated with loss of body weight, loss of muscle mass, and/or loss of fat mass.
- the cachexia may be associated with rheumatoid arthritis, such as in a collagen-induced animal model of rheumatoid arthritis.
- Treatment with a fully human antibody described herein ameliorates the loss of body weight, the loss of muscle mass, and/or the loss of fat mass in vivo in a collagen-induced animal model of rheumatoid arthritis.
- a fully human antibody described herein ameliorates the loss of body weight in a AAV-activin-A transfected animal model.
- Methods for detecting single B-cells that are producing an antibody with the desired specificity are well known in the art, for example, by plaque formation, fluorescence-activated cell sorting, in vitro stimulation followed by detection of specific antibody, and the like.
- Methods for selection of specific antibody-producing B-cells include, for example, preparing a single cell suspension of B-cells in soft agar that contains human activin-A. Binding of the specific antibody produced by the B-cell to the antigen results in the formation of a complex, which may be visible as an immunoprecipitate.
- the specific antibody genes may be cloned by isolating and amplifying DNA or mRNA according to methods known in the art and described herein.
- An additional method for obtaining antibodies of the invention is by phage display. See, e.g., Winter et al, 1994 Annu. Rev. Immunol. 12:433-55; Burton et al, 1994 Adv. Immunol. 57: 191-280.
- Human or murine immunoglobulin variable region gene combinatorial libraries may be created in phage vectors that can be screened to select Ig fragments (Fab, Fv, sFv, or multimers thereof) that bind specifically to TGF-beta binding protein or variant or fragment thereof. See, e.g., U.S. Patent No. 5,223,409; Huse et al, 1989 Science 246: 1275-81; Sastry et al, Proc. Natl. Acad. Sci. USA 86:5728-32 (1989);
- a library containing a plurality of polynucleotide sequences encoding Ig variable region fragments may be inserted into the genome of a filamentous bacteriophage, such as Ml 3 or a variant thereof, in frame with the sequence encoding a phage coat protein.
- a fusion protein may be a fusion of the coat protein with the light chain variable region domain and/or with the heavy chain variable region domain.
- immunoglobulin Fab fragments may also be displayed on a phage particle (see, e.g., U.S. Patent No.
- the specific antibody genes may be cloned by isolating and amplifying DNA or mRNA therefrom according to standard procedures as described herein.
- the antibodies produced therefrom may be sequenced and the CDRs identified and the DNA coding for the CDRs may be manipulated as described previously to generate other antibodies according to the invention.
- Activin-A binding agents of the present invention preferably modulate activin-A function in the cell-based assay described herein and/or the in vivo assay described herein and/or bind to one or more of the cysteine knot domains described herein and/or cross-block the binding of one of the antibodies described in this application and/or are cross-blocked from binding activin-A by one of the antibodies described in this application. Accordingly such binding agents can be identified using the assays described herein.
- antibodies are generated by first identifying antibodies that bind to one more of the cysteine knot domains provided herein and/or neutralize in the cell-based and/or in vivo assays described herein and/or cross-block the antibodies described in this application and/or are cross-blocked from binding activin-A by one of the antibodies described in this application.
- the CDR regions from these antibodies are then used to insert into appropriate biocompatible frameworks to generate activin-A binding agents.
- the non- CDR portion of the binding agent may be composed of amino acids, or may be a non-protein molecule.
- the assays described herein allow the characterization of binding agents.
- binding agents of the present invention are antibodies as defined herein.
- Antigen binding proteins e.g., antibodies, antibody fragments, and antibody derivatives
- the light chain constant region can be, for example, a kappa- or lambda-type light chain constant region, e.g., a human kappa- or lambda-type light chain constant region.
- the heavy chain constant region can be, for example, an alpha-, delta-, epsilon-, gamma-, or mu-type heavy chain constant regions, e.g., a human alpha-, delta-, epsilon-, gamma-, or mu-type heavy chain constant region.
- the light or heavy chain constant region is a fragment, derivative, variant, or mutein of a naturally occurring constant region.
- IgG antibodies may be derived from an IgM antibody, for example, and vice versa.
- Such techniques allow the preparation of new antibodies that possess the antigen-binding properties of a given antibody (the parent antibody), but also exhibit biological properties associated with an antibody isotype or subclass different from that of the parent antibody.
- Recombinant DNA techniques may be employed. Cloned DNA encoding particular antibody polypeptides may be employed in such procedures, e.g., DNA encoding the constant domain of an antibody of the desired isotype. See also Lantto et ah, 2002, Methods Mol. Biol. 178:303-16.
- an antigen binding protein of the invention comprises the IgGl heavy chain domain of any of A 1 -A 14 (HI -HI 4) or a fragment of the IgGl heavy chain domain of any of A1-A14 (H1-H14).
- an antigen binding protein of the invention comprises the kappa light chain constant chain region of A1-A14 (L1-L14), or a fragment of the kappa light chain constant region of A1-A14 (L1-L14).
- the antigen binding protein has a K c ff of lxlO 4 s "1 or lower.
- the K 0 ff is 5xl0 ⁇ 5 s "1 or lower.
- the K 0 ff is substantially the same as an antibody having a combination of light chain and heavy chain variable domain sequences selected from the group of combinations consisting of L1H1 , L2H2, L3H3, L4H4, L5H5, L6H6, L7H7, L8H8, L9H9, L10H10, LI 1H1 1, L12H12, L13H13, and L14H14.
- the antigen binding protein binds to activin- A with substantially the same K c ff as an antibody that comprises one or more CDRs from an antibody having a combination of light chain and heavy chain variable domain sequences selected from the group of combinations consisting of L1H1 , L2H2, L3H3, L4H4, L5H5, L6H6, L7H7, L8H8, L9H9, L10H10, LI 1H1 1, L12H12, L13H13, and L14H14.
- the antigen binding protein binds to activin-A with substantially the same K 0 ff as an antibody that comprises one of the amino acid sequences illustrated above.
- the antigen binding protein binds to activin-A with substantially the same K c ff as an antibody that comprises one or more CDRs from an antibody that comprises one of the amino acid sequences illustrated above.
- non-human antibodies of the invention can be, for example, derived from any antibody-producing animal, such as mouse, rat, rabbit, goat, donkey, or non-human primate (such as monkey (e.g. , cynomologous or rhesus monkey) or ape (e.g. , chimpanzee)).
- non-human primate such as monkey (e.g. , cynomologous or rhesus monkey) or ape (e.g. , chimpanzee)).
- An antibody from a particular species can be made by, for example, immunizing an animal of that species with the desired immunogen (e.g., a soluble activin-A polypeptide) or using an artificial system for generating antibodies of that species (e.g., a bacterial or phage display-based system for generating antibodies of a particular species), or by converting an antibody from one species into an antibody from another species by replacing, e.g. , the constant region of the antibody with a constant region from the other species, or by replacing one or more amino acid residues of the antibody so that it more closely resembles the sequence of an antibody from the other species.
- the antibody is a chimeric antibody comprising amino acid sequences derived from antibodies from two or more different species.
- Antigen binding proteins may be prepared, and screened for desired properties, by any of a number of conventional techniques. Certain of the techniques involve isolating a nucleic acid encoding a polypeptide chain (or portion thereof) of an antigen binding protein of interest (e.g., an anti-activin-A antibody), and manipulating the nucleic acid through recombinant DNA technology.
- the nucleic acid may be fused to another nucleic acid of interest, or altered (e.g., by mutagenesis or other conventional techniques) to add, delete, or substitute one or more amino acid residues, for example.
- the antigen binding proteins may be purified from cells that naturally express them (e.g. , an antibody can be purified from a hybridoma that produces it), or produced in recombinant expression systems, using any technique known in the art. See, for example, Monoclonal Antibodies,
- Hybridomas A New Dimension in Biological Analyses, Kennet et al. (eds.), Plenum Press, New York (1980); and Antibodies: A Laboratory Manual, Harlow and Land (eds.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, (1988).
- Any expression system known in the art can be used to make the recombinant polypeptides of the invention.
- Expression systems are detailed comprehensively above.
- host cells are transformed with a recombinant expression vector that comprises DNA encoding a desired polypeptide.
- the host cells that may be employed are prokaryotes, yeast or higher eukaryotic cells.
- Prokaryotes include gram negative or gram positive organisms, for example E. coli or Bacilli.
- Higher eukaryotic cells include insect cells and established cell lines of mammalian origin.
- suitable mammalian host cell lines include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al, 1981, Cell 23: 175), L cells, 293 cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, HeLa cells, BHK (ATCC CRL 10) cell lines, and the CVI/EBNA cell line derived from the African green monkey kidney cell line CVI (ATCC CCL 70) as described by McMahan et al, 1991, EMBO J. 10: 2821.
- Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, New York, 1985).
- the transformed cells can be cultured under conditions that promote expression of the polypeptide, and the polypeptide recovered by conventional protein purification procedures (as defined above).
- One such purification procedure includes the use of affinity chromatography, e.g., over a matrix having all or a portion (e.g., the extracellular domain) of activin-A bound thereto.
- Polypeptides contemplated for use herein include substantially homogeneous recombinant mammalian anti-activin-A antibody polypeptides substantially free of contaminating endogenous materials.
- the present invention provides antigen-binding fragments of an anti- activin-A antibody of the invention.
- Such fragments can consist entirely of antibody-derived sequences or can comprise additional sequences.
- antigen-binding fragments include Fab, F(ab')2, single chain antibodies, diabodies, triabodies, tetrabodies, and domain antibodies. Other examples are provided in Lunde et al., 2002, Biochem. Soc. Trans. 30:500- 06.
- Single chain antibodies may be formed by linking heavy and light chain variable domain (Fv region) fragments via an amino acid bridge (short peptide linker, e.g., a synthetic sequence of amino acid residues), resulting in a single polypeptide chain.
- amino acid bridge short peptide linker, e.g., a synthetic sequence of amino acid residues
- Such single-chain Fvs have been prepared by fusing DNA encoding a peptide linker between DNAs encoding the two variable domain polypeptides (VL and VH).
- the resulting polypeptides can fold back on themselves to form antigen-binding monomers, or they can form multimers (e.g.
- Single chain antibodies derived from antibodies provided herein include, but are not limited to, scFvs comprising the variable domain combinations LlHl, L2H2, L3H3, L4H4, L5H5, L6H6, L7H7, L8H8, L9H9, LIOHIO, Ll lHl l, L12H12, L13H13, and L14H14 are encompassed by the present invention.
- Diabodies are bivalent antibodies comprising two polypeptide chains, wherein each polypeptide chain comprises VH and VL domains joined by a linker that is too short to allow for pairing between two domains on the same chain, thus allowing each domain to pair with a complementary domain on another polypeptide chain (see, e.g., Holliger et ah, 1993, Proc. Natl. Acad. Sci. USA 90:6444-48, and Poljak et ah, 1994, Structure 2: 1 121-23). If the two polypeptide chains of a diabody are identical, then a diabody resulting from their pairing will have two identical antigen binding sites.
- Polypeptide chains having different sequences can be used to make a diabody with two different antigen binding sites.
- tribodies and tetrabodies are antibodies comprising three and four polypeptide chains, respectively, and forming three and four antigen binding sites, respectively, which can be the same or different.
- Antibody polypeptides are also disclosed in U. S. Patent No. 6,703,199, including fibronectin polypeptide monobodies.
- Other antibody polypeptides are disclosed in U.S. Patent Publication 2005/0238646, which are single-chain polypeptides.
- an antibody comprises one or more water soluble polymer attachments, including, but not limited to, polyethylene glycol,
- polyoxyethylene glycol or polypropylene glycol. See, e.g., U.S. Pat. Nos. 4,640,835, 4,496,689, 4,301,144, 4,670,417, 4,791, 192 and 4,179,337.
- a derivative binding agent comprises one or more of monomethoxy -polyethylene glycol, dextran, cellulose, or other carbohydrate based polymers, poly-(N-vinyl pyrrolidone)- polyethylene glycol, propylene glycol homopolymers, a polypropylene oxide/ethylene oxide co-polymer, polyoxyethylated polyols (e.g., glycerol) and polyvinyl alcohol, as well as mixtures of such polymers.
- one or more water-soluble polymer is randomly attached to one or more side chains.
- PEG can act to improve the therapeutic capacity for a binding agent, such as an antibody. Certain such methods are discussed, for example, in U.S. Pat. No. 6, 133,426, which is hereby incorporated by reference for any purpose.
- an antibody of the present invention may have at least one amino acid substitution, providing that the antibody retains binding specificity.
- modifications to the antibody structures are encompassed within the scope of the invention. These may include amino acid substitutions, which may be conservative or non- conservative, that do not destroy the activin-A binding capability of an antibody.
- a skilled artisan will be able to determine suitable variants of the polypeptide as set forth herein using well-known techniques.
- one skilled in the art may identify suitable areas of the molecule that may be changed without destroying activity by targeting regions not believed to be important for activity.
- even areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without destroying the biological activity or without adversely affecting the polypeptide structure.
- One method of predicting secondary structure is based upon homology modeling. For example, two polypeptides or proteins which have a sequence identity of greater than 30%, or similarity greater than 40% often have similar structural topologies.
- the recent growth of the protein structural database (PDB) has provided enhanced predictability of secondary structure, including the potential number of folds within a polypeptide's or protein's structure. See Holm et ah, Nucl. Acid. Res., 27(l):244-247 (1999). It has been suggested (Brenner et ah, Curr. Op. Struct. Biol., 7(3):369-376 (1997)) that there are a limited number of folds in a given polypeptide or protein and that once a critical number of structures have been resolved, structural prediction will become dramatically more accurate.
- Additional methods of predicting secondary structure include “threading” (Jones, D., Curr. Opin. Struct. Biol., 7(3):377-87 (1997); Sippl et ah, Structure, 4(1): 15-19 (1996)), “profile analysis” (Bowie et ah, Science, 253: 164-170 (1991); Gribskov et ah, Meth. Enzym., 183 : 146-159 (1990); Gribskov et ah, Proc. Nat. Acad. Sci., 84(13):4355-4358 (1987)), and “evolutionary linkage” (See Holm, supra (1999), and Brenner, supra (1997)).
- variants of antibodies include glycosylation variants wherein the number and/or type of glycosylation site has been altered compared to the amino acid sequences of a parent polypeptide.
- variants comprise a greater or a lesser number of N-linked glycosylation sites than the native protein.
- An N-linked glycosylation site is characterized by the sequence: Asn-X-Ser or Asn-X-Thr, wherein the amino acid residue designated as X may be any amino acid residue except proline.
- the substitution of amino acid residues to create this sequence provides a potential new site for the addition of an N-linked carbohydrate chain. Alternatively, substitutions which eliminate this sequence will remove an existing N-linked carbohydrate chain.
- N-linked carbohydrate chains wherein one or more N-linked glycosylation sites (typically those that are naturally occurring) are eliminated and one or more new N- linked sites are created.
- Additional preferred antibody variants include cysteine variants wherein one or more cysteine residues are deleted from or substituted for another amino acid (e.g., serine) as compared to the parent amino acid sequence. Cysteine variants may be useful when antibodies must be refolded into a biologically active conformation such as after the isolation of insoluble inclusion bodies. Cysteine variants generally have fewer cysteine residues than the native protein, and typically have an even number to minimize interactions resulting from unpaired cysteines.
- amino acid substitutions can be determined by those skilled in the art at the time such substitutions are desired.
- amino acid substitutions can be used to identify important residues of antibodies to activin-A, or to increase or decrease the affinity of the antibodies to activin-A described herein.
- preferred amino acid substitutions are those which: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation, (3) alter binding affinity for forming protein complexes, (4) alter binding affinities, and/or (4) confer or modify other physiochemical or functional properties on such polypeptides.
- single or multiple amino acid substitutions may be made in the naturally-occurring sequence (in certain embodiments, in the portion of the polypeptide outside the domain(s) forming intermolecular contacts).
- a conservative amino acid substitution typically may not substantially change the structural characteristics of the parent sequence (e.g.
- the binding agents may comprise at least one of the CDRs described herein incorporated into a biocompatible framework structure.
- the biocompatible framework structure comprises a polypeptide or portion thereof that is sufficient to form a conformationally stable structural support, or framework, or scaffold, which is able to display one or more sequences of amino acids that bind to an antigen (e.g., CDRs, a variable region, etc.) in a localized surface region.
- an antigen e.g., CDRs, a variable region, etc.
- Such structures can be a naturally occurring polypeptide or polypeptide "fold" (a structural motif), or can have one or more modifications, such as additions, deletions or substitutions of amino acids, relative to a naturally occurring polypeptide or fold.
- These scaffolds can be derived from a polypeptide of any species (or of more than one species), such as a human, other mammal, other vertebrate, invertebrate, plant, bacteria or virus.
- the biocompatible framework structures are based on protein scaffolds or skeletons other than immunoglobulin domains.
- protein scaffolds or skeletons other than immunoglobulin domains.
- those based on fibronectin, ankyrin, lipocalin, neocarzinostain, cytochrome b, CP1 zinc finger, PST1, coiled coil, LACI- Dl, Z domain and tendamistat domains may be used (See e.g., Nygren and Uhlen, 1997, Curr. Opin. in Struct. Biol, 7, 463-469).
- the antibodies of the invention include the humanized antibodies described herein.
- Humanized antibodies such as those described herein can be produced using techniques known to those skilled in the art (Zhang, W., et ah, Molecular Immunology. 42(12): UA5- 5 ⁇ , 2005; Hwang W. et al, Methods. 36(l):35-42, 2005;
- suitable binding agents include portions of these antibodies, such as one or more of CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2 and CDR-L3 as specifically disclosed herein. At least one of the regions of CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2 and CDR-L3 may have at least one amino acid substitution, provided that the antibody retains the binding specificity of the non- substituted CDR.
- the non-CDR portion of the antibody may be a non-protein molecule, wherein the binding agent cross-blocks the binding of an antibody disclosed herein to activin- A and/or neutralizes activin-A.
- the non-CDR portion of the antibody may be a non-protein molecule in which the antibody exhibits a similar binding pattern to human activin-A peptides in a competition binding assay as that exhibited by at least one of antibodies Al- A14, and/or neutralizes activin-A.
- the non-CDR portion of the antibody may be composed of amino acids, wherein the antibody is a recombinant binding protein or a synthetic peptide, and the recombinant binding protein cross-blocks the binding of an antibody disclosed herein to activin-A and/or neutralizes activin-A.
- the non-CDR portion of the antibody may be composed of amino acids, wherein the antibody is a recombinant antibody, and the recombinant antibody exhibits a similar binding pattern to human activin-A peptides in the human activin-A peptide epitope competition binding assay (described hereinbelow) as that exhibited by at least one of the antibodies A1-A14, and/or neutralizes activin-A.
- an antibody comprises one or more of CDR-H1, CDR-H2, CDR-H3, CDR-Ll, CDR-L2 and CDR-L3 as described above, it may be obtained by expression from a host cell containing DNA coding for these sequences.
- a DNA coding for each CDR sequence may be determined on the basis of the amino acid sequence of the CDR and synthesized together with any desired antibody variable region framework and constant region DNA sequences using oligonucleotide synthesis techniques, site-directed mutagenesis and polymerase chain reaction (PCR) techniques as appropriate.
- DNA coding for variable region frameworks and constant regions is widely available to those skilled in the art from genetic sequences databases such as GenBank®.
- expression of the antibody or a fragment thereof may be preferred in a eukaryotic host cell, including yeast (e.g., Saccharomyces cerevisiae, Schizosaccharomyces pombe, and Pichia pastoris), animal cells (including mammalian cells) or plant cells.
- yeast e.g., Saccharomyces cerevisiae, Schizosaccharomyces pombe, and Pichia pastoris
- animal cells including mammalian cells
- suitable animal cells include, but are not limited to, myeloma (such as a mouse NSO line), COS, CHO, or hybridoma cells.
- plant cells include tobacco, corn, soybean, and rice cells.
- the present invention discloses an isolated protein comprising a stabilized human activin IIB receptor (svActRIIB) polypeptide.
- the protein and polypeptide of the invention are characterized by their ability to bind to at least one of three TGF- ⁇ proteins, myostatin (GDF-8), activin-A, or GDF-1 1, to inhibit the activities of at least one of these proteins, and to have improved manufacturability properties compared with other ActRIIB soluble receptors.
- the stabilized human activin IIB receptor polypeptide is characterized by amino acid substitutions at both positions E28 and S44 with reference to the extracellular domain of ActRIIB, as set forth in the following sequence: Met Thr Ala Pro Trp Val Ala Leu Ala Leu Leu Trp Gly Ser Leu Cys Ala Gly Ser Gly Arg Gly Glu Ala Glu Thr Arg Glu Cys He Tyr Tyr Asn Ala Asn Trp Glu Leu Glu Arg Thr Asn Gin Ser Gly Leu Glu Arg Cys Glu Gly Glu Gin Asp Lys Arg Leu His Cys Tyr Ala Ser Trp Arg Asn Ser Ser Gly Thr He Glu Leu Val Lys Lys Gly Cys Trp Leu Asp Asp Phe Asn Cys Tyr Asp Arg Gin Glu Cys Val Ala Thr Glu Glu Asn Pro Gin Val Tyr Phe Cys Cys Cys Glu Gly Asn Phe Cys Asn Glu Arg Phe Thr His Le
- GDF-11 refers to the BMP (bone morphogenic protein) having Swissprot accession number 095390, as well as variants and species homologs of that protein.
- GDF-1 1 is involved in the regulation of anterior/posterior patterning of the axial skeleton (McPherron et al, Nature Genet. 22 (93): 260-264 (1999); Gamer et al, Dev. Biol. 208 (1), 222-232 (1999)) but postnatal functions are unknown.
- the present invention provides an isolated protein comprising a stabilized ActllB receptor polypeptide (referred herein as "svActRIIB polypeptide").
- a "sv ActRIIB protein” is a protein comprising a stabilized ActRIIB polypeptide.
- isolated refers to a protein or polypeptide molecule purified to some degree from endogenous material. These polypeptides and proteins are characterized as having the ability to bind and inhibit the activity of any one of activin-A, myostatin, or GDF-1 1, in addition to having improved manufacturability characteristics.
- the stabilized ActRIIB polypeptide is characterized by having an amino acid substitution at both position 28 and 44 with respect to SEQ ID NO: 2.
- amino acid positions on the stabilized ActRIIB polypeptides and proteins are always referred to with respect to the positions in SEQ ID NO: 2, regardless of whether the polypeptide is mature or truncated.
- the term “mature” refers to a polypeptide or peptide without its signal sequence.
- truncated refers to polypeptides having N terminal amino acids or C terminal amino acids removed.
- the isolated stabilized activin IIB receptor polypeptide has the polypeptide sequence set forth in SEQ ID NO: 2, except for a single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T.
- the polypeptide has the sequence set forth in amino acids 19 through 134 of SEQ ID NO: 2, except for a single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T.
- the polypeptide has the sequence set forth in amino acids 23 through 134 of SEQ ID NO: 2, except for a single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T.
- the polypeptide has the sequence set forth in amino acids 25 through 134 of SEQ ID NO: 2, except for a single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T.
- the protein comprises a stabilized activin IIB receptor polypeptide, wherein the polypeptide is selected from the group consisting of polypeptides having the sequence set forth in the group consisting of SEQ ID NO: 4, 6, 12 and 14. These polypeptides represent amino acids 25 to 134 of SEQ ID NO: 2, wherein the polypeptide has single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T, and wherein the polypeptide is capable of binding myostatin, activin-A, or GDF-1 1, with and without a signal sequence different from that shown in SEQ ID NO: 2.
- the protein comprises a polypeptide having at least 80 %, 85 %, 90 %, 95 %, 96 %, 97 %, 98 %, or 99 % sequence identity to SEQ ID NO: 4, 6, 12 or 14, wherein the polypeptide has a W or Y at position 28 and a T at position 44, and wherein the polypeptide is capable of binding myostatin, activin-A, or GDF-11.
- the substitution at position 28 is W and the substitution at position 44 is T, wherein the polypeptide is capable of binding myostatin, activin-A or GDF- 11.
- the protein comprises a polypeptide having at least 80 %, 85 %, 90 %, 95 %, 96 %, 97 %, 98 %, or 99 % sequence identity to SEQ ID NO: 8, 10, 16 or 18, wherein the polypeptide has a W or Y at position 28 and a T at position 44, and wherein the polypeptide is capable of binding myostatin, activin-A, or GDF-11.
- the substitution at position 28 is W and the substitution at position 44 is T, wherein the polypeptide is capable of binding myostatin, activin-A or GDF- 11.
- the protein comprises the any one of the polypeptides described above, wherein the amino acid residue at position 64 is alanine.
- svActRIIB polypeptide and protein encompasses proteins comprising fragments of SEQ ID NO: 2, 4, 6, 12 and 14, including N and C terminal truncations, wherein position 28 is W or Y, and position 44 is T, and wherein the polypeptide is capable of binding myostatin, activin-A or GDF-1 1.
- the term "derivative" of the svActRIIB polypeptide refers to the attachment of at least one additional chemical moiety, or at least one additional polypeptide to form covalent or aggregate conjugates such as glycosyl groups, lipids, acetyl groups, or C-terminal or N- terminal fusion polypeptides, conjugation to PEG molecules, and other modifications which are described more fully below.
- Stabilized ActRIIB receptor polypeptides can also include additional modifications and derivatives, including modifications to the C and N termini which arise from processing due to expression in various cell types such as mammalian cells, E. coli, yeasts and other recombinant host cells.
- Heterologous polypeptides include but are not limited to Fc polypeptides, his tags, and leucine zipper domains to promote oligomerization and further stabilization of the stabilized ActRIIB polypeptides as described in, for example, WO 00/29581, which is herein incorporated by reference.
- the heterologous polypeptide is an Fc polypeptide or domain.
- the Fc domain is selected from a human IgGl Fc (SEQ ID NO: 23), modified IgGl Fc (SEQ ID NO: 47), IgG2 Fc (SEQ ID NO: 22), and IgG4 Fc (SEQ ID NO: 24) domain.
- the svActRIIB protein can further comprise all or a portion of the hinge sequence of the IgGl (SEQ ID NO: 29), IgG2 (SEQ ID NO: 28), or IgG4 (SEQ ID NO: 30).
- Exemplary svActRIIB polypeptides are selected from polypeptides consisting of the sequences as set forth in SEQ ID NO: 8, 10, 16 and 18, as well as those polypeptides having substantial similarity to these sequences, wherein the substitutions at positions 28 and 44 are retained.
- the 1 to 20 amino acids may be selected from glycine, alanine, proline, asparagine, glutamine, and lysine.
- a linker is made up of a majority of amino acids that are sterically unhindered, such as glycine and alanine.
- Exemplary linkers are polyglycines (particularly (Gly) 5 (SEQ ID NO: 289), (Gly) 8 (SEQ ID NO: 290), poly(Gly-Ala), and polyalanines.
- One exemplary suitable linker as shown in the Examples below is (Gly) 4 Ser (SEQ ID NO: 25).
- svActRIIB can comprise a "hinge linker", that is a linker sequence provided adjacent to a hinge region or a partial hinge region of an IgG, as exemplified in SEQ ID NO: 27.
- Hinge sequences include IgG2Fc (SEQ ID NO: 28), IgGlFc (SEQ ID NO: 29), and IgG4Fc (SEQ ID NO: 30).
- Hinge linker sequences may also be designed to improve manufacturability and stability of the svActRIIB-Fc proteins.
- the hinge linkers of SEQ ID NO: 27, 38, 40, 42, 44, 45, and 46 are designed to improve manufacturability with the IgG2 Fc (SEQ ID NO: 22) when attached to svActRIIB polypeptides.
- Linkers may also be non-peptide linkers.
- These alkyl linkers may further be substituted by any non-sterically hindering group such as lower alkyl (e.g., Ci-C6) lower acyl, halogen (e.g., CI, Br), CN, NH 2 , phenyl, etc.
- the svActRIIB polypeptides disclosed herein can also be attached to a non- polypeptide molecule for the purpose of conferring desired properties such as reducing degradation and/or increasing half-life, reducing toxicity, reducing immunogenicity, and/or increasing the biological activity of the svActRIIB polypeptides.
- exemplary molecules include but are not limited to linear polymers such as polyethylene glycol (PEG), polylysine, a dextran; a lipid; a cholesterol group (such as a steroid); a carbohydrate, or an
- the svActRIIB proteins and polypeptides have improved manufacturability properties when compared to other ActRIIB soluble polypeptides.
- the term "manufacturability" refers to the stability of a particular protein during recombinant expression and purification of that protein. Manufacturability is believed to be due to the intrinsic properties of the molecule under conditions of expression and purification.
- Activities of the svActRIIB polypeptides include, but are not limited to, the ability to bind to myostatin or activin-A or GDF- 11 , and the ability to inhibit or neutralize an activity of myostatin or activin-A or GDF-11.
- the term "capable of binding" to myostatin, activin-A, or GDF- 11 refers to binding measured by methods known in the art. In vitro inhibition of myostatin, activin-A, or GDF-1 1 can be measured using, for example, the pMARE C2C12 cell-based assay. In vivo activity, is demonstrated by increased lean muscle mass in mouse models. In vivo activities of the svActRIIB polypeptides and proteins include but are not limited to increasing body weight, increasing lean muscle mass, and increasing the ratio of lean muscle to fat mass. Therapeutic activities further include reducing or preventing cachexia caused by certain types of tumors, preventing the growth of certain types of tumors, and increasing survival of certain animal models. Further discussion of the svActRIIB protein and polypeptide activities is provided below.
- the present invention provides an isolated nucleic acid molecule comprising a polynucleotide encoding an svActRIIB polypeptide of the present invention.
- isolated refers to nucleic acid molecules purified to some degree from endogenous material.
- the polynucleotide encodes a polypeptide having the sequence set forth in SEQ ID NO: 2, except for a single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T.
- the polynucleotide encodes a polypeptide having the sequence set forth in amino acids 19 through 134 of SEQ ID NO: 2, except for a single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T.
- the polynucleotide encodes a polypeptide having the sequence set forth in amino acids 23 through 134 of SEQ ID NO: 2, except for a single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T.
- the polynucleotide encodes a polypeptide having the sequence set forth in amino acids 25 through 134 of SEQ ID NO: 2, except for a single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T.
- the polynucleotide encodes the a polypeptide having an amino acid sequence at least 80 %, 85 %, 90 %, 95 %, 98 % or 99 % identity to any one of the polypeptides above, wherein the polypeptide has single amino acid substitution at position 28, and a single amino acid substitution at position 44, wherein the substitution at position 28 is selected from W or Y, and the substitution at position 44 is T, and wherein the polypeptide is capable of binding myostatin, activin-A, or GDF-11.
- the polynucleotide of the above embodiments encodes a polypeptide wherein the substitution at position 28 is W and the substitution at position 44 is T.
- the isolated nucleic acid molecule of the present invention comprises a polynucleotide encoding a polypeptide having the sequence set forth in the group consisting of SEQ ID NO: 4, 6, 12, and 14.
- the nucleic acid comprises a polynucleotide encoding a polypeptide having at least 80 %, 90 %, 95 %, 96 %, 97 %, 98 %, 99 % sequence identity to SEQ ID NO: 4, 6, 12 or 14, wherein the polypeptide has a W or Y at position 28 and a T at position 44, and wherein the polypeptide is capable of binding activin-A, GDF-11, or myostatin.
- the polynucleotide of the above embodiments encodes a polypeptide wherein the substitution at position 28 is W and the substitution at position 44 is T, and wherein the polypeptide is capable of binding activin- A, GDF-1 1 or myostatin.
- the isolated nucleic acid molecule further comprises a polynucleotide encoding at least one heterologous protein.
- the heterologous protein is an Fc domain, in a further embodiment, the Fc domain is a human IgG Fc domain.
- the nucleic acid molecule further comprises polynucleotides encoding the linkers and hinge linkers set forth in SEQ ID NO: 25, 27, 38, 40, 42, 44, 45, 46, 48, 49 or 50. In a further embodiment, such polynucleotides have sequences selected from the group consisting of SEQ ID NO: 26, 37, 39, 41, and 43.
- the nucleic acid molecule comprises a polynucleotide encoding a polypeptide consisting of the sequence set forth in the group consisting of SEQ ID NO: 8, 10, 16 and 18.
- the nucleic acid comprises a polynucleotide encoding a polypeptide having at least 80 %, 90 %, 95 %, 96 %, 97 %, 98 %, 99 % sequence identity to the group consisting of SEQ ID NO: 8, 10, 16 and 18, wherein the polypeptide has a W or Y at position 28 and a T at position 44, and wherein the polypeptide is capable of binding activin-A, GDF-11, or myostatin.
- the polynucleotide of the above embodiments encodes a polypeptide wherein the substitution at position 28 is W and the substitution at position 44 is T, and wherein the polypeptide is capable of binding myostatin, activin-A or GDF- 1 1.
- the isolated nucleic acid molecule comprises a polynucleotide having the sequence selected from the group consisting of SEQ ID NO: 3, 5, 11 or 13, or its complement. In another embodiment, the isolated nucleic acid molecule comprises a polynucleotide having the sequence selected from the group consisting of the sequence SEQ ID NO: 7, 9, 15 and 17, or its complement.
- the isolated nucleic acid molecule hybridizes under stringent or moderate conditions with SEQ ID NO: 3, 5, 7, 9, 11, 13, 15 or 17 wherein the encoded polypeptide is substantially similar to SEQ ID NO: 4, 6, 8, 10, 12, 14, 16, or 18, wherein the polypeptide comprises an amino acid sequence having W or Y at position 28, and T at position 44, and wherein the encoded polypeptide is capable of binding or inhibiting activin-A, myostatin or GDF-1 1.
- Nucleic acid molecules of the invention include DNA in both single-stranded and double-stranded form, as well as the RNA complement thereof.
- DNA includes, for example, cDNA, genomic DNA, synthetic DNA, DNA amplified by PCR, and combinations thereof.
- Genomic DNA may be isolated by conventional techniques, such as by using the DNA of SEQ ID NO: 3, 5, 11 or 13, or a suitable fragment thereof, as a probe.
- Genomic DNA encoding ActRIIB polypeptides is obtained from genomic libraries which are available for a number of species.
- Synthetic DNA is available from chemical synthesis of overlapping oligonucleotide fragments followed by assembly of the fragments to reconstitute part or all of the coding regions and flanking sequences.
- RNA may be obtained from procaryotic expression vectors which direct high-level synthesis of mRNA, such as vectors using T7 promoters and RNA polymerase.
- cDNA is obtained from libraries prepared from mRNA isolated from various tissues that express ActRIIB.
- the DNA molecules of the invention include full length genes as well as polynucleotides and fragments thereof.
- the full length gene may also include sequences encoding the N-terminal signal sequence.
- the invention further provides the nucleic acid molecule described above, wherein the polynucleotide is operably linked to a transcriptional or translational regulatory sequence.
- Stabilized activin type IIB polypeptides bind to ligands that activate muscle- degradation cascades.
- svActRIIB polypeptides capable of binding and inhibiting the activity of the ligands activin-A, myostatin, and/or GDF-1 1, and have the ability to treat diseases that involve muscle atrophy, as well as the treatment of certain cancers, and other diseases.
- the present invention provides methods of treating a subject.
- the method can, for example, have a generally beneficial effect on the subject's health, e.g., it can increase the subject's expected longevity.
- the method can, for example, treat, prevent, cure, relieve, or ameliorate ("treat") a disease, disorder, condition, or illness ("a condition").
- a condition a disease, disorder, condition, or illness
- the conditions to be treated in accordance with the present invention are conditions characterized by inappropriate expression or activity of activin-A. In some such conditions, the expression or activity level is too high, and the treatment comprises administering an activin-A antagonist as described herein.
- the term "subject" refers to any animal, such as mammals including humans.
- the present invention provides compositions and methods for treating a cancerous condition.
- the cancerous condition is a gonadal cancer, including tumors of the ovary and testis.
- Activin-A is known for its action in stimulating FSH biosynthesis and secretion in the pituitary gland, and has a physiological role in the regulation of gonadal function. Activin-A has been associated with many types of human cancers and in particular with tumors of the reproductive system. Specifically,
- the cancerous condition can be any cancerous condition that can be treated using the compositions comprised herein, for example, anti-activin-A compounds such as activin IIB receptor polypeptides (svActRIIB), and activin-A antigen binding proteins such as anti- activin-A antibodies, antibody fragments, or antibody derivatives.
- anti-activin-A compounds such as activin IIB receptor polypeptides (svActRIIB)
- activin-A antigen binding proteins such as anti- activin-A antibodies, antibody fragments, or antibody derivatives.
- cancerous conditions include, for example, acute lymphoblastic leukemia, adrenocortical carcinoma, AIDS-related cancers, AIDS-related lymphoma, anal cancer, childhood cerebellar astrocytoma, childhood cerebral astrocytoma, basal cell carcinoma, extrahepatic bile duct cancer, bladder cancer, osteosarcoma/malignant fibrous histiocytoma bone cancer, brain tumors (e.g., brain stem glioma, cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, ependymoma, medulloblastoma, supratentorial primitive neuroectodermal tumors, visual pathway and hypothalamic glioma), breast cancer, bronchial adenomas/carcinoids, Burkitt's Lymphoma, carcinoid tumor, gastrointestinal carcinoid tumor, carcinoma of unknown primary, primary central nervous system, cerebellar astrocyto
- lymphoma e.g., AIDS-related, Burkitt's, cutaneous t-cell, Hodgkin's, non-Hodgkin's, and primary central nervous system
- Waldenstrom's AIDS-related, Burkitt's, cutaneous t-cell, Hodgkin's, non-Hodgkin's, and primary central nervous system
- Macroglobulinemia malignant fibrous histiocytoma of bone/osteosarcoma, medulloblastoma, melanoma, intraocular (eye) melanoma, Merkel cell carcinoma, mesothelioma, metastatic squamous neck cancer with occult primary, multiple endocrine neoplasia syndrome, multiple myeloma/plasma cell neoplasm, mycosis fungoides, myelodysplasia; syndromes,
- myelodysplastic/myeloproliferative diseases myelogenous leukemia, chronic myeloid leukemia, multiple myeloma, chronic myeloproliferative disorders, nasal cavity and paranasal sinus cancer, nasopharyngeal cancer, neuroblastoma, oral cancer, oropharyngeal cancer, osteosarcoma/malignant fibrous histiocytoma of bone, ovarian cancer, ovarian epithelial cancer, ovarian germ cell tumor, ovarian low malignant potential tumor, pancreatic cancer, islet cell pancreatic cancer, paranasal sinus and nasal cavity cancer, parathyroid cancer, penile cancer, pheochromocytoma, pineoblastoma, pituitary tumor, plasma cell
- Certain methods provided herein comprise administering an activin-A binding protein to a subject, thereby reducing an activin-A-induced biological response that plays a role in a particular condition.
- methods of the invention involve contacting endogenous activin-A with an activin-A binding protein, e.g., via administration to a subject or in an ex vivo procedure.
- treatment encompasses alleviation or prevention of at least one symptom or other aspect of a disorder, or reduction of disease severity, and the like.
- treatment further relates to administering a therapeutic agent described herein for preventing or alleviating at least one symptom or other aspect of a disorder in a subject in need thereof.
- An antigen binding protein need not affect a complete cure, or eradicate every symptom or manifestation of a disease, to constitute a viable therapeutic agent.
- drugs employed as therapeutic agents may reduce the severity of a given disease state, but need not abolish every manifestation of the disease to be regarded as useful therapeutic agents.
- a prophylactically administered treatment need not be completely effective in preventing the onset of a condition in order to constitute a viable prophylactic agent.
- Simply reducing the impact of a disease for example, by reducing the number or severity of its symptoms, or by increasing the effectiveness of another treatment, or by producing another beneficial effect), or reducing the likelihood that the disease will occur or worsen in a subject, is sufficient.
- One embodiment of the invention is directed to a method comprising administering to a patient an activin-A antagonist in an amount and for a time sufficient to induce a sustained improvement over baseline of an indicator that reflects the severity of the particular disorder.
- antigen binding proteins in ex vivo procedures also is contemplated.
- a patient's blood or other bodily fluid may be contacted with a protein that binds full-length activin-A, one or more activin-A isoform, or other partial length activin-A ex vivo.
- the antigen binding protein may be bound to a suitable insoluble matrix or solid support material.
- a subject's levels of biomarker CA-125 and/or activin-A can be monitored to identify a subject in need of treatment for ovarian cancer, including serous ovarian cancer (ovarian neoplasms, including surface epithelial-stromal tumors). For example, levels of biomarker CA-125 and/or activin-A can be detected in the subject and compared to a control. First, the subject's expression levels of CA-125 and/or activin A are evaluated. Next, the subject's expression levels of CA-125 and/or activin-A are compared to expression levels in a negative control sample or a positive control sample.
- CA-125 and/or activin-A in the subject exceed the expression levels in the negative control sample, or if the expression levels meet or exceed the expression levels in the positive control sample, the subject is identified as one needing ovarian cancer treatment. In some aspects, if the expression levels exceed the expression levels of the subject taken at a previous time, in particular when the tumor was in its early stages, the subject can be identified as one needing ovarian cancer treatment.
- Known techniques can be employed for measuring CA-125 and/or activin-A levels, e.g., in a subject's serum.
- CA-125 and/or activin-A levels in blood samples can be measured using any suitable technique, for example, ELISA or RT-PCR.
- a subject's levels of activin-A, VEGF, and/or Ang-1 factors can be monitored to identify a subject in need of treatment for ovarian cancer, including clear cell ovarian cancer (epithelial ovarian neoplasm arising from embryonic mesonephros), Granulosa cell ovarian cancer (neoplasms from sex-cord stromal cells), Leydig cell tumors (testicular tumor derived from Leydig cells), and sex cord stromal testicular tumors (derived from testicular and ovarian stroma).
- Levels of activin-A, VEGF, and/or Ang-1 factors can be detected in the subject and compared to a control.
- the subject's expression levels of activin-A, VEGF, and/or Ang-1 are evaluated.
- the subject's expression levels of activin-A, VEGF, and/or Ang-1 are compared to expression levels in a negative control sample or a positive control sample. If the expression levels of activin-A, VEGF, and/or Ang-1 in the subject exceed the expression levels in the negative control sample, or if the expression levels meet or exceed the expression levels of the respective factors in the positive control sample, the subject is identified as one needing ovarian cancer treatment.
- activin-A levels in a subject are three times the activin-A levels in the average person of the same age, or if activin-A levels in a subject exceed 3200 pg/mL, it can predict that the particular subject should begin receiving treatment.
- Known techniques can be employed for measuring activin- A, VEGF, and/or Ang-1 levels, e.g., in a subject's serum.
- Activin-A, VEGF, and/or Ang-1 levels in blood samples can be measured using any suitable technique, for example, ELISA.
- the subject has a mutated activin gene or a mutated activin counterregulator gene, such as inhibin.
- the mutation is an
- compositions containing the proteins and polypeptides of the present invention are also provided.
- Such compositions comprise a therapeutically or prophylactically effective amount of the polypeptide or protein in admixture with
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Endocrinology (AREA)
- Biomedical Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Zoology (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Oncology (AREA)
- Neurology (AREA)
- Reproductive Health (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Dermatology (AREA)
- Pathology (AREA)
- Analytical Chemistry (AREA)
- Wood Science & Technology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (17)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EA201591423A EA201591423A1 (ru) | 2013-02-01 | 2014-02-03 | Введение антитела к активину-а пациентам |
| HK16106466.4A HK1218553A1 (zh) | 2013-02-01 | 2014-02-03 | 抗激活素a化合物对受试者的施用 |
| AU2014212014A AU2014212014A1 (en) | 2013-02-01 | 2014-02-03 | Administration of an anti-activin-A compound to a subject |
| EP14746114.9A EP2951205B1 (en) | 2013-02-01 | 2014-02-03 | Anti-activin-a compounds for the treatment of ovarian cancer |
| MX2015009901A MX2015009901A (es) | 2013-02-01 | 2014-02-03 | Administración de un compuesto de antiactivina a a un sujeto. |
| CA2899889A CA2899889A1 (en) | 2013-02-01 | 2014-02-03 | Administration of an anti-activin-a compound to a subject |
| US14/764,288 US20150359850A1 (en) | 2009-11-25 | 2014-02-03 | Administration of an anti-activin-a compound to a subject |
| JP2015556210A JP2016508504A (ja) | 2013-02-01 | 2014-02-03 | 対象に対する抗アクチビン−a化合物の投与 |
| CN201480020307.6A CN105431455A (zh) | 2013-02-01 | 2014-02-03 | 抗激活素a化合物对受试者的施用 |
| EP21190424.8A EP3985024B1 (en) | 2013-02-01 | 2014-02-03 | Anti-activin-a antibody and chemotherapy combination for the treatment of ovarian cancer |
| KR1020157023772A KR20150136061A (ko) | 2013-02-01 | 2014-02-03 | 대상에 항-액티빈-a 화합물의 투여 |
| SG11201505960VA SG11201505960VA (en) | 2013-02-01 | 2014-02-03 | Administration of an anti-activin-a compound to a subject |
| IL240139A IL240139A0 (en) | 2013-02-01 | 2015-07-23 | Administration of an anti-activin a compound to a subject |
| CL2015002116A CL2015002116A1 (es) | 2013-02-01 | 2015-07-29 | Administración de compuesto anti-activin-a a un sujeto |
| PH12015501709A PH12015501709A1 (en) | 2013-02-01 | 2015-07-31 | Administration of an-activin-a compound to a subject |
| US16/714,407 US11541070B2 (en) | 2013-02-01 | 2019-12-13 | Administration of an anti-activin-A compound to a subject |
| US18/087,345 US12383572B2 (en) | 2013-02-01 | 2022-12-22 | Administration of an anti-activin-a compound to a subject |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361759961P | 2013-02-01 | 2013-02-01 | |
| US61/759,961 | 2013-02-01 | ||
| US201361815220P | 2013-04-23 | 2013-04-23 | |
| US61/815,220 | 2013-04-23 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/764,288 A-371-Of-International US20150359850A1 (en) | 2009-11-25 | 2014-02-03 | Administration of an anti-activin-a compound to a subject |
| US16/714,407 Division US11541070B2 (en) | 2013-02-01 | 2019-12-13 | Administration of an anti-activin-A compound to a subject |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2014121221A1 true WO2014121221A1 (en) | 2014-08-07 |
| WO2014121221A8 WO2014121221A8 (en) | 2015-12-23 |
Family
ID=51263035
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/014490 Ceased WO2014121221A1 (en) | 2009-11-25 | 2014-02-03 | Administration of an anti-activin-a compound to a subject |
Country Status (15)
| Country | Link |
|---|---|
| US (3) | US20150359850A1 (https=) |
| EP (2) | EP3985024B1 (https=) |
| JP (1) | JP2016508504A (https=) |
| KR (1) | KR20150136061A (https=) |
| CN (1) | CN105431455A (https=) |
| AU (1) | AU2014212014A1 (https=) |
| CA (1) | CA2899889A1 (https=) |
| CL (1) | CL2015002116A1 (https=) |
| EA (1) | EA201591423A1 (https=) |
| HK (1) | HK1218553A1 (https=) |
| IL (1) | IL240139A0 (https=) |
| MX (1) | MX2015009901A (https=) |
| PH (1) | PH12015501709A1 (https=) |
| SG (2) | SG10201706148WA (https=) |
| WO (1) | WO2014121221A1 (https=) |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017081624A1 (en) * | 2015-11-11 | 2017-05-18 | Novartis Ag | Uses of myostatin antagonists, combinations containing them and uses thereof |
| US10526403B2 (en) | 2013-07-30 | 2020-01-07 | Regeneron Pharmaceuticals, Inc. | Anti-activin A antibodies and uses thereof |
| AU2016251640B2 (en) * | 2015-04-22 | 2020-07-16 | Alivegen Inc. | Novel hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US11248044B2 (en) | 2018-03-01 | 2022-02-15 | Regeneron Pharmaceuticals, Inc. | Methods for altering body composition by administering a GDF8 inhibitor and an Activin A inhibitor |
| RU2781401C2 (ru) * | 2015-11-11 | 2022-10-11 | Новартис Аг | Применение антагонистов миостатина, содержащие их комбинации и их применение |
| US11541070B2 (en) | 2013-02-01 | 2023-01-03 | Atara Biotherapeutics, Inc. | Administration of an anti-activin-A compound to a subject |
| US11655291B2 (en) | 2011-11-14 | 2023-05-23 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for increasing muscle mass and muscle strength by specifically antagonizing GDF8 and or activin A |
| US11939380B2 (en) | 2017-04-05 | 2024-03-26 | Les Laboratoires Servier | Combination therapies targeting PD-1, TIM-3, and LAG-3 |
| US12029788B2 (en) | 2015-04-15 | 2024-07-09 | Regeneron Pharmaceuticals, Inc. | Methods for increasing lean body mass with an exercise regimen and a GDF8 inhibitor that is an anti-GDF8 antibody |
| US12187783B2 (en) | 2016-10-20 | 2025-01-07 | Alivegen Inc | Methods for treating muscle wasting and bone disease using novel hybrid ActRIIB ligand trap proteins |
| US12577302B2 (en) | 2016-04-12 | 2026-03-17 | Les Laboratoires Servier | Anti-TIM-3 antibodies and compositions |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PE20170471A1 (es) * | 2014-06-13 | 2017-05-14 | Santa Maria Biotherapeutics Inc | Polipeptidos receptores formulados y metodos relacionados |
| MA45811A (fr) | 2016-07-27 | 2019-06-05 | Acceleron Pharma Inc | Méthodes et compositions de traitement de maladie. |
| US12186370B1 (en) * | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
| WO2024108158A1 (en) * | 2022-11-18 | 2024-05-23 | Byomass Inc. | Anti-activin a/b antibodies and uses thereof |
| CN116948028B (zh) * | 2023-09-20 | 2023-11-28 | 北京合源汇丰医药科技有限公司 | 一种抗抑制素抗体及其应用 |
Citations (70)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| US4411993A (en) | 1981-04-29 | 1983-10-25 | Steven Gillis | Hybridoma antibody which inhibits interleukin 2 activity |
| US4464456A (en) | 1982-01-06 | 1984-08-07 | Toray Industries, Inc. | Photosensitive polymer compositions comprising polyether-ester amides |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| US4518584A (en) | 1983-04-15 | 1985-05-21 | Cetus Corporation | Human recombinant interleukin-2 muteins |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4543439A (en) | 1982-12-13 | 1985-09-24 | Massachusetts Institute Of Technology | Production and use of monoclonal antibodies to phosphotyrosine-containing proteins |
| USRE32011E (en) | 1981-12-14 | 1985-10-22 | Scripps Clinic And Research Foundation | Ultrapurification of factor VIII using monoclonal antibodies |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| US4737462A (en) | 1982-10-19 | 1988-04-12 | Cetus Corporation | Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β |
| US4751180A (en) | 1985-03-28 | 1988-06-14 | Chiron Corporation | Expression using fused genes providing for protein product |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US4902614A (en) | 1984-12-03 | 1990-02-20 | Teijin Limited | Monoclonal antibody to human protein C |
| US4935233A (en) | 1985-12-02 | 1990-06-19 | G. D. Searle And Company | Covalently linked polypeptide cell modulators |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1990014363A1 (en) | 1989-05-19 | 1990-11-29 | Amgen Inc. | Metalloproteinase inhibitor |
| US5011912A (en) | 1986-12-19 | 1991-04-30 | Immunex Corporation | Hybridoma and monoclonal antibody for use in an immunoaffinity purification system |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| US5145684A (en) | 1991-01-25 | 1992-09-08 | Sterling Drug Inc. | Surface modified drug nanoparticles |
| WO1993010151A1 (en) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Receptor for oncostatin m and leukemia inhibitory factor |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1994010308A1 (en) | 1992-10-23 | 1994-05-11 | Immunex Corporation | Methods of preparing soluble, oligomeric proteins |
| US5399363A (en) | 1991-01-25 | 1995-03-21 | Eastman Kodak Company | Surface modified anticancer nanoparticles |
| US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5552157A (en) | 1990-08-27 | 1996-09-03 | Kabushiki Kaisha Vitamin Kenkyusya | Liposome for entrapping gene, liposomal preparation and process for the manufacture of the preparation |
| US5565213A (en) | 1990-07-26 | 1996-10-15 | Taisho Pharmaceutical Co., Ltd. | Stable liposome aqueous suspension |
| US5567434A (en) | 1989-03-31 | 1996-10-22 | The Regents Of The University Of California | Preparation of liposome and lipid complex compositions |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5641515A (en) | 1995-04-04 | 1997-06-24 | Elan Corporation, Plc | Controlled release biodegradable nanoparticles containing insulin |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5738868A (en) | 1995-07-18 | 1998-04-14 | Lipogenics Ltd. | Liposome compositions and kits therefor |
| US5795587A (en) | 1995-01-23 | 1998-08-18 | University Of Pittsburgh | Stable lipid-comprising drug delivery complexes and methods for their production |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5869619A (en) | 1991-12-13 | 1999-02-09 | Xoma Corporation | Modified antibody variable domains |
| US5877293A (en) | 1990-07-05 | 1999-03-02 | Celltech Therapeutics Limited | CDR grafted anti-CEA antibodies and their production |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5886152A (en) | 1991-12-06 | 1999-03-23 | Sumitomo Pharmaceuticals Company, Limited | Humanized B-B10 |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| WO2000029581A1 (en) | 1998-11-13 | 2000-05-25 | Immunex Corporation | Human tslp dna and polypeptides |
| US6133426A (en) | 1997-02-21 | 2000-10-17 | Genentech, Inc. | Humanized anti-IL-8 monoclonal antibodies |
| US20030039958A1 (en) | 1999-12-03 | 2003-02-27 | Domantis Limited | Direct screening method |
| US20040009507A1 (en) | 2000-10-13 | 2004-01-15 | Domantis, Ltd. | Concatenated nucleic acid sequence |
| US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| US20040146888A1 (en) | 2000-06-01 | 2004-07-29 | Paszty Christopher J. | Cystine-knot polypeptides: cloaked-2 molecules and uses thereof |
| US20040202995A1 (en) | 2003-04-09 | 2004-10-14 | Domantis | Nucleic acids, proteins, and screening methods |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| US20050238646A1 (en) | 2001-01-17 | 2005-10-27 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
| US20050272637A1 (en) | 2004-04-22 | 2005-12-08 | Oregon Health & Science University | Compositions and methods for modulating signaling mediated by IGF-1 receptor and erbB receptors |
| WO2008031061A2 (en) | 2006-09-08 | 2008-03-13 | Amgen Inc. | Anti-activin a antibodies and uses thereof |
| WO2008109167A2 (en) | 2007-03-06 | 2008-09-12 | Amgen Inc. | Variant activin receptor polypeptides and uses thereof |
| US20090118188A1 (en) * | 2007-09-18 | 2009-05-07 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for decreasing or inhibiting FSH secretion |
| WO2010062383A2 (en) | 2008-11-26 | 2010-06-03 | Amgen Inc. | Stabilized receptor polypeptides and uses thereof |
| US20110243933A1 (en) * | 2010-03-31 | 2011-10-06 | Keryx Biopharmaceuticals, Inc. | Perifosine and Capecitabine as a Combined Treatment for Cancer |
| US20120295814A1 (en) * | 2010-01-08 | 2012-11-22 | The Brigham And Women's Hospital, Inc. | CA-125 Immune Complexes as Biomarkers of Ovarian Cancer |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| US9401875B2 (en) | 2012-06-01 | 2016-07-26 | Nippon Telegraph And Telephone Corporation | Packet transfer processing method and packet transfer processing device |
Family Cites Families (73)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US646A (en) | 1838-03-21 | Improvement in furnaces for smelting iron with anthracite | ||
| US7947A (en) | 1851-02-25 | Bellows fob musical instruments | ||
| JPS5349966A (en) | 1976-10-18 | 1978-05-06 | Hitachi Ltd | Manufacture of semiconductor integrated circuit |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5618920A (en) | 1985-11-01 | 1997-04-08 | Xoma Corporation | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US4973577A (en) | 1986-04-04 | 1990-11-27 | The Salk Institute For Biological Studies | FSH-releasing peptides |
| JPH01171495A (ja) | 1987-12-25 | 1989-07-06 | Ajinomoto Co Inc | モノクローナル抗体及びそれを用いる定量法 |
| US5567584A (en) | 1988-01-22 | 1996-10-22 | Zymogenetics, Inc. | Methods of using biologically active dimerized polypeptide fusions to detect PDGF |
| US5750375A (en) | 1988-01-22 | 1998-05-12 | Zymogenetics, Inc. | Methods of producing secreted receptor analogs and biologically active dimerized polypeptide fusions |
| US6300129B1 (en) | 1990-08-29 | 2001-10-09 | Genpharm International | Transgenic non-human animals for producing heterologous antibodies |
| US6565841B1 (en) | 1991-03-15 | 2003-05-20 | Amgen, Inc. | Pulmonary administration of granulocyte colony stimulating factor |
| US20050186593A1 (en) | 1991-05-10 | 2005-08-25 | The Salk Institute For Biological Studies | Cloning and recombinant production of CRF receptor(s) |
| US5885794A (en) | 1991-05-10 | 1999-03-23 | The Salk Institute For Biological Studies | Recombinant production of vertebrate activin receptor polypeptides and identification of receptor DNAs in the activin/TGF-β superfamily |
| US6162896A (en) | 1991-05-10 | 2000-12-19 | The Salk Institute For Biological Studies | Recombinant vertebrate activin receptors |
| US5470582A (en) | 1992-02-07 | 1995-11-28 | Syntex (U.S.A.) Inc. | Controlled delivery of pharmaceuticals from preformed porous polymeric microparticles |
| US6153407A (en) | 1992-07-28 | 2000-11-28 | Beth Israel Deaconess Medical Center | Erythropoietin DNA having modified 5' and 3' sequences and its use to prepare EPO therapeutics |
| EP0627932B1 (en) | 1992-11-04 | 2002-05-08 | City Of Hope | Antibody construct |
| GB9223377D0 (en) | 1992-11-04 | 1992-12-23 | Medarex Inc | Humanized antibodies to fc receptors for immunoglobulin on human mononuclear phagocytes |
| DK0690873T3 (da) | 1993-03-19 | 2003-09-29 | Univ Johns Hopkins Med | Vækstdifferentieringsfaktor-8 |
| US6607884B1 (en) | 1993-03-19 | 2003-08-19 | The Johns Hopkins University School Of Medicine | Methods of detecting growth differentiation factor-8 |
| US6465239B1 (en) | 1993-03-19 | 2002-10-15 | The John Hopkins University School Of Medicine | Growth differentiation factor-8 nucleic acid and polypeptides from aquatic species and non-human transgenic aquatic species |
| US5994618A (en) | 1997-02-05 | 1999-11-30 | Johns Hopkins University School Of Medicine | Growth differentiation factor-8 transgenic mice |
| EP0756628B1 (en) | 1994-04-29 | 2007-11-14 | Curis, Inc. | Morphogenic protein-specific cell surface receptors and uses therefor |
| US5545616A (en) | 1994-09-22 | 1996-08-13 | Genentech, Inc. | Method for predicting and/or preventing preterm labor |
| US6656475B1 (en) | 1997-08-01 | 2003-12-02 | The Johns Hopkins University School Of Medicine | Growth differentiation factor receptors, agonists and antagonists thereof, and methods of using same |
| US6891082B2 (en) | 1997-08-01 | 2005-05-10 | The Johns Hopkins University School Of Medicine | Transgenic non-human animals expressing a truncated activintype II receptor |
| JP3897068B2 (ja) | 1997-08-28 | 2007-03-22 | 日本ゼオン株式会社 | アクリルゴム組成物 |
| US6472179B2 (en) | 1998-09-25 | 2002-10-29 | Regeneron Pharmaceuticals, Inc. | Receptor based antagonists and methods of making and using |
| US6660843B1 (en) | 1998-10-23 | 2003-12-09 | Amgen Inc. | Modified peptides as therapeutic agents |
| MXPA01007366A (es) | 1999-01-21 | 2002-06-04 | Metamorphix Inc | Inhibidores de factores de crecimiento y diferenciacion y usos de los mismos. |
| JP4487376B2 (ja) | 2000-03-31 | 2010-06-23 | 味の素株式会社 | 腎疾患治療剤 |
| US6812339B1 (en) | 2000-09-08 | 2004-11-02 | Applera Corporation | Polymorphisms in known genes associated with human disease, methods of detection and uses thereof |
| AUPR638101A0 (en) | 2001-07-13 | 2001-08-09 | Bioa Pty Limited | Composition and method for treatment of disease |
| US7507412B2 (en) | 2001-07-18 | 2009-03-24 | Merck Patent Gmbh | Glycoprotein VI fusion proteins |
| GB0209896D0 (en) | 2002-04-30 | 2002-06-05 | Molmed Spa | Conjugate |
| US20040223966A1 (en) | 2002-10-25 | 2004-11-11 | Wolfman Neil M. | ActRIIB fusion polypeptides and uses therefor |
| BR0317538A (pt) | 2002-12-20 | 2005-11-29 | Amgen Inc | Agente ligante, sequência de polinucleotìdeo, vetor de expressão, célula hospedeira, composição farmacêutica, e, métodos de inibir a atividade de miostatina, de aumentar a massa muscular magra e a razão de massa muscular magra para gordura, de tratar uma doença de emaciação muscular e um distúrbio metabólico relacionado com miostatina em um indivìduo, de detectar e medir miostatina em uma amostra, e, de diagnosticar um distúrbio relacionado com miostatina em um indivìduo |
| RU2322261C2 (ru) | 2003-06-02 | 2008-04-20 | Уайт | Применение ингибиторов миостатика (gdf8) в сочетании с кортикостероидами для лечения нервно-мышечных заболеваний |
| PT3395338T (pt) | 2003-09-12 | 2019-07-23 | Amgen Inc | Formulação de dissolução rápida de cinacalcet hcl |
| US8110665B2 (en) | 2003-11-13 | 2012-02-07 | Hanmi Holdings Co., Ltd. | Pharmaceutical composition comprising an immunoglobulin FC region as a carrier |
| ES2383300T3 (es) | 2003-11-13 | 2012-06-20 | Hanmi Holdings Co., Ltd | Fragmento Fc de IgG para un vehículo de fármacos y procedimiento para su preparación |
| US7514534B2 (en) | 2003-11-19 | 2009-04-07 | Dyax Corp. | Metalloproteinase-binding proteins |
| EP1750683B1 (en) | 2004-04-23 | 2013-01-09 | Amgen Inc. | Sustained release formulations |
| EP1740609A2 (en) | 2004-04-27 | 2007-01-10 | Research Development Foundation | Antagonism of tgf-beta superfamily receptor signaling |
| JP2008507288A (ja) | 2004-07-23 | 2008-03-13 | アクセルロン ファーマ インコーポレーテッド | ActRII受容体ポリペプチド、方法、および組成物 |
| AU2005272646A1 (en) | 2004-08-12 | 2006-02-23 | Wyeth | Combination therapy for diabetes, obesity, and cardiovascular diseases using GDF-8 inhibitors |
| WO2006036834A2 (en) | 2004-09-24 | 2006-04-06 | Amgen Inc. | MODIFIED Fc MOLECULES |
| EP1824886B1 (en) | 2004-11-17 | 2010-12-22 | Amgen Inc. | Fully human monoclonal antibodies to il-13 |
| EP2361933A3 (en) | 2005-01-26 | 2012-05-02 | Amgen Fremont Inc. | Antibodies against interleukin-1 beta |
| ES2569409T3 (es) | 2005-03-08 | 2016-05-10 | Pfizer Products Inc. | Composiciones de anticuerpo anti-CTLA-4 |
| KR100754667B1 (ko) | 2005-04-08 | 2007-09-03 | 한미약품 주식회사 | 비펩타이드성 중합체로 개질된 면역글로불린 Fc 단편 및이를 포함하는 약제학적 조성물 |
| EP1877075A4 (en) | 2005-04-25 | 2008-07-30 | Pfizer | ANTIBODY TO MYOSTATIN |
| NZ566774A (en) * | 2005-09-07 | 2011-11-25 | Pfizer | Human monoclonal antibodies to activin receptor-like kinase-1 |
| US8067562B2 (en) | 2005-11-01 | 2011-11-29 | Amgen Inc. | Isolated nucleic acid molecule comprising the amino acid sequence of SEQ ID NO:1 |
| US8128933B2 (en) | 2005-11-23 | 2012-03-06 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin B antibody |
| CN104524548A (zh) | 2006-12-18 | 2015-04-22 | 阿塞勒隆制药公司 | 活化素-actrii拮抗剂及在提高红细胞水平中的用途 |
| TW201803890A (zh) | 2007-02-02 | 2018-02-01 | 艾瑟勒朗法瑪公司 | 衍生自ActRIIB的變體與其用途 |
| US8501678B2 (en) * | 2007-03-06 | 2013-08-06 | Atara Biotherapeutics, Inc. | Variant activin receptor polypeptides and uses thereof |
| ES2449753T3 (es) | 2007-03-19 | 2014-03-21 | National Research Council Of Canada | Proteínas de fusión que comprenden dos dominios de unión tgf-beta |
| CN102131822A (zh) | 2008-06-26 | 2011-07-20 | 阿塞勒隆制药公司 | 进行激活素-ActRIIa拮抗剂给药和监测受治疗患者的方法 |
| US8216997B2 (en) | 2008-08-14 | 2012-07-10 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators |
| TW201803586A (zh) | 2008-08-14 | 2018-02-01 | 艾瑟勒朗法瑪公司 | 使用gdf阱以增加紅血球水平 |
| AU2010204985A1 (en) | 2009-01-13 | 2011-08-04 | Acceleron Pharma Inc. | Methods for increasing adiponectin |
| PE20120532A1 (es) | 2009-04-27 | 2012-05-18 | Novartis Ag | ANTICUERPOS ANTI-ActRIIB |
| KR20120049214A (ko) | 2009-06-08 | 2012-05-16 | 악셀레론 파마 인코포레이티드 | 발열성 지방세포를 증가시키는 방법 |
| EP3202459B1 (en) | 2009-09-09 | 2021-04-14 | Acceleron Pharma Inc. | Actriib antagonists and dosing and uses thereof for treating obesity or type 2 diabetes by regulating body fat content |
| AU2011326586A1 (en) * | 2010-11-08 | 2013-05-30 | Acceleron Pharma, Inc. | ActRIIA binding agents and uses thereof |
| HK1203384A1 (en) * | 2011-12-19 | 2015-12-11 | Amgen Inc. | Variant activin receptor polypeptides, alone or in combination with chemotherapy, and uses thereof |
| WO2013106715A1 (en) * | 2012-01-13 | 2013-07-18 | Allergan, Inc. | Crosslinked hyaluronic acid-collagen gels for improving tissue graft viability and soft tissue augmentation |
| AU2014212014A1 (en) | 2013-02-01 | 2015-08-27 | Amgen Inc. | Administration of an anti-activin-A compound to a subject |
| US20140220033A1 (en) | 2013-02-01 | 2014-08-07 | Santa Maria Biotherapeutics, Inc. | Administration of an Anti-Activin-A Compound to a Subject |
| US20160333418A1 (en) | 2014-01-14 | 2016-11-17 | Santa Maria Biotherapeutics, Inc. | Activin Inhibitor Response Prediction and Uses for Treatment |
| PE20170471A1 (es) | 2014-06-13 | 2017-05-14 | Santa Maria Biotherapeutics Inc | Polipeptidos receptores formulados y metodos relacionados |
-
2014
- 2014-02-03 AU AU2014212014A patent/AU2014212014A1/en not_active Abandoned
- 2014-02-03 EP EP21190424.8A patent/EP3985024B1/en active Active
- 2014-02-03 SG SG10201706148WA patent/SG10201706148WA/en unknown
- 2014-02-03 EA EA201591423A patent/EA201591423A1/ru unknown
- 2014-02-03 EP EP14746114.9A patent/EP2951205B1/en active Active
- 2014-02-03 CA CA2899889A patent/CA2899889A1/en not_active Abandoned
- 2014-02-03 JP JP2015556210A patent/JP2016508504A/ja active Pending
- 2014-02-03 MX MX2015009901A patent/MX2015009901A/es unknown
- 2014-02-03 CN CN201480020307.6A patent/CN105431455A/zh active Pending
- 2014-02-03 HK HK16106466.4A patent/HK1218553A1/zh unknown
- 2014-02-03 US US14/764,288 patent/US20150359850A1/en not_active Abandoned
- 2014-02-03 SG SG11201505960VA patent/SG11201505960VA/en unknown
- 2014-02-03 WO PCT/US2014/014490 patent/WO2014121221A1/en not_active Ceased
- 2014-02-03 KR KR1020157023772A patent/KR20150136061A/ko not_active Withdrawn
-
2015
- 2015-07-23 IL IL240139A patent/IL240139A0/en unknown
- 2015-07-29 CL CL2015002116A patent/CL2015002116A1/es unknown
- 2015-07-31 PH PH12015501709A patent/PH12015501709A1/en unknown
-
2019
- 2019-12-13 US US16/714,407 patent/US11541070B2/en active Active
-
2022
- 2022-12-22 US US18/087,345 patent/US12383572B2/en active Active
Patent Citations (76)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4331647A (en) | 1980-03-03 | 1982-05-25 | Goldenberg Milton David | Tumor localization and therapy with labeled antibody fragments specific to tumor-associated markers |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| US4411993A (en) | 1981-04-29 | 1983-10-25 | Steven Gillis | Hybridoma antibody which inhibits interleukin 2 activity |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| USRE32011E (en) | 1981-12-14 | 1985-10-22 | Scripps Clinic And Research Foundation | Ultrapurification of factor VIII using monoclonal antibodies |
| US4464456A (en) | 1982-01-06 | 1984-08-07 | Toray Industries, Inc. | Photosensitive polymer compositions comprising polyether-ester amides |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| US4737462A (en) | 1982-10-19 | 1988-04-12 | Cetus Corporation | Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β |
| US4543439A (en) | 1982-12-13 | 1985-09-24 | Massachusetts Institute Of Technology | Production and use of monoclonal antibodies to phosphotyrosine-containing proteins |
| US4518584A (en) | 1983-04-15 | 1985-05-21 | Cetus Corporation | Human recombinant interleukin-2 muteins |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| US4902614A (en) | 1984-12-03 | 1990-02-20 | Teijin Limited | Monoclonal antibody to human protein C |
| US4751180A (en) | 1985-03-28 | 1988-06-14 | Chiron Corporation | Expression using fused genes providing for protein product |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| US4935233A (en) | 1985-12-02 | 1990-06-19 | G. D. Searle And Company | Covalently linked polypeptide cell modulators |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US5011912A (en) | 1986-12-19 | 1991-04-30 | Immunex Corporation | Hybridoma and monoclonal antibody for use in an immunoaffinity purification system |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5567434A (en) | 1989-03-31 | 1996-10-22 | The Regents Of The University Of California | Preparation of liposome and lipid complex compositions |
| WO1990014363A1 (en) | 1989-05-19 | 1990-11-29 | Amgen Inc. | Metalloproteinase inhibitor |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5877293A (en) | 1990-07-05 | 1999-03-02 | Celltech Therapeutics Limited | CDR grafted anti-CEA antibodies and their production |
| US5565213A (en) | 1990-07-26 | 1996-10-15 | Taisho Pharmaceutical Co., Ltd. | Stable liposome aqueous suspension |
| US5627052A (en) | 1990-08-02 | 1997-05-06 | B.R. Centre, Ltd. | Methods for the production of proteins with a desired function |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| US5552157A (en) | 1990-08-27 | 1996-09-03 | Kabushiki Kaisha Vitamin Kenkyusya | Liposome for entrapping gene, liposomal preparation and process for the manufacture of the preparation |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5145684A (en) | 1991-01-25 | 1992-09-08 | Sterling Drug Inc. | Surface modified drug nanoparticles |
| US5399363A (en) | 1991-01-25 | 1995-03-21 | Eastman Kodak Company | Surface modified anticancer nanoparticles |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1993010151A1 (en) | 1991-11-22 | 1993-05-27 | Immunex Corporation | Receptor for oncostatin m and leukemia inhibitory factor |
| US5886152A (en) | 1991-12-06 | 1999-03-23 | Sumitomo Pharmaceuticals Company, Limited | Humanized B-B10 |
| US5869619A (en) | 1991-12-13 | 1999-02-09 | Xoma Corporation | Modified antibody variable domains |
| WO1994010308A1 (en) | 1992-10-23 | 1994-05-11 | Immunex Corporation | Methods of preparing soluble, oligomeric proteins |
| US5457035A (en) | 1993-07-23 | 1995-10-10 | Immunex Corporation | Cytokine which is a ligand for OX40 |
| US5543158A (en) | 1993-07-23 | 1996-08-06 | Massachusetts Institute Of Technology | Biodegradable injectable nanoparticles |
| US5795587A (en) | 1995-01-23 | 1998-08-18 | University Of Pittsburgh | Stable lipid-comprising drug delivery complexes and methods for their production |
| US5641515A (en) | 1995-04-04 | 1997-06-24 | Elan Corporation, Plc | Controlled release biodegradable nanoparticles containing insulin |
| US5738868A (en) | 1995-07-18 | 1998-04-14 | Lipogenics Ltd. | Liposome compositions and kits therefor |
| US6133426A (en) | 1997-02-21 | 2000-10-17 | Genentech, Inc. | Humanized anti-IL-8 monoclonal antibodies |
| US6703199B1 (en) | 1997-06-12 | 2004-03-09 | Research Corporation Technologies, Inc. | Artificial antibody polypeptides |
| US20050202512A1 (en) | 1997-10-20 | 2005-09-15 | Domantis Limited | Method to screen phage display libraries with different ligands |
| US6846634B1 (en) | 1997-10-20 | 2005-01-25 | Domantis Limited | Method to screen phage display libraries with different ligands |
| US6696245B2 (en) | 1997-10-20 | 2004-02-24 | Domantis Limited | Methods for selecting functional polypeptides |
| US20040038291A2 (en) | 1997-10-20 | 2004-02-26 | Domantis Limited | Method to screen phage display libraries with different ligands |
| WO2000029581A1 (en) | 1998-11-13 | 2000-05-25 | Immunex Corporation | Human tslp dna and polypeptides |
| US20030039958A1 (en) | 1999-12-03 | 2003-02-27 | Domantis Limited | Direct screening method |
| US20040146888A1 (en) | 2000-06-01 | 2004-07-29 | Paszty Christopher J. | Cystine-knot polypeptides: cloaked-2 molecules and uses thereof |
| US20040009507A1 (en) | 2000-10-13 | 2004-01-15 | Domantis, Ltd. | Concatenated nucleic acid sequence |
| US20050238646A1 (en) | 2001-01-17 | 2005-10-27 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| US20040202995A1 (en) | 2003-04-09 | 2004-10-14 | Domantis | Nucleic acids, proteins, and screening methods |
| US20050272637A1 (en) | 2004-04-22 | 2005-12-08 | Oregon Health & Science University | Compositions and methods for modulating signaling mediated by IGF-1 receptor and erbB receptors |
| US8309082B2 (en) | 2006-09-08 | 2012-11-13 | Amgen Inc. | Anti-activin A antibodies and uses thereof |
| WO2008031061A2 (en) | 2006-09-08 | 2008-03-13 | Amgen Inc. | Anti-activin a antibodies and uses thereof |
| US20130030159A1 (en) * | 2006-09-08 | 2013-01-31 | Amgen Inc. | Anti-activin a antibodies and uses thereof |
| WO2008109167A2 (en) | 2007-03-06 | 2008-09-12 | Amgen Inc. | Variant activin receptor polypeptides and uses thereof |
| US20090118188A1 (en) * | 2007-09-18 | 2009-05-07 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for decreasing or inhibiting FSH secretion |
| WO2010062383A2 (en) | 2008-11-26 | 2010-06-03 | Amgen Inc. | Stabilized receptor polypeptides and uses thereof |
| US20120295814A1 (en) * | 2010-01-08 | 2012-11-22 | The Brigham And Women's Hospital, Inc. | CA-125 Immune Complexes as Biomarkers of Ovarian Cancer |
| US20110243933A1 (en) * | 2010-03-31 | 2011-10-06 | Keryx Biopharmaceuticals, Inc. | Perifosine and Capecitabine as a Combined Treatment for Cancer |
| US9401875B2 (en) | 2012-06-01 | 2016-07-26 | Nippon Telegraph And Telephone Corporation | Packet transfer processing method and packet transfer processing device |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
Non-Patent Citations (272)
| Title |
|---|
| "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| "Curr. Prot. in Mol. Biol.", 1989, JOHN WILEY & SONS, pages: 6.3.1 - 6.3.6 |
| "Curr. Prot. in Mol. Biol.", 1995, JOHN WILEY & SONS, INC. |
| "Current Protocols in Immunology", vol. 1, 1991, JOHN WILEY & SONS |
| "Current Protocols in Molecular Biology", 1999, WILEY INTERSCIENCE |
| "Fundamental Immunology", 1989, RAVEN PRESS |
| "GenBank Accession", Database accession no. AAB86694 |
| "GenBank", Database accession no. MIM #147290 |
| "GenBank", Database accession no. NM 002191.3 |
| "GenBank", Database accession no. NM 002192.2 |
| "GenBank", Database accession no. NM_002192.2 |
| "Introduction to Protein Structure", 1991, GARLAND PUBLISHING |
| "Methods in Cell Biology", vol. 37, 1993, ACADEMIC PRESS, INC., article "Antibodies in Cell Biology" |
| "Methods In Enzymology", ACADEMIC PRESS, INC. |
| "Methods of Enzymology", vol. 185, 1990, ACADEMIC PRESS |
| "Monoclonal Antibodies", 1980, PLENUM PRESS, article "Hybridomas: A New Dimension in Biological Analyses" |
| "Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses", 1980, PLENUM PRESS |
| "Proteins, Structures and Molecular Principles", 1984, W. H. FREEMAN AND COMPANY |
| "Remington's Pharmaceutical Sciences", 1980 |
| "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY |
| "REMINGTON'S PHARMACEUTICAL SCIENCES", 2000, MACK PUBLISHING COMPANY |
| "Remington's Pharmaceutical Sciences", pages: 1035 - 1038,1570-1580 |
| A.L. LEHNINGER: "Biochemistry", WORTH PUBLISHERS, INC. |
| AKERSTROM, J IMMUNOL, vol. 135, 1985, pages 2589 |
| ALIBHAI; SMH; GOGOV S; ALLIBHAI Z: "Long-term side effects of androgen deprivation therapy in men with non-metastatic prostate cancer: a systematic literature review", CRIT REV ONCOL/HEMATOL, vol. 60, 2006, pages 201 - 15, XP024907259, DOI: doi:10.1016/j.critrevonc.2006.06.006 |
| ALTING-MEES ET AL., STRATEGIES IN MOLECULAR BIOLOGY, vol. 3, 1990, pages 1 - 9 |
| ANDREWS, S.M.; TITUS, J.A. ET AL.: "Current Protocols in Immunology", 2003, JOHN WILEY & SONS |
| ARBONES ET AL., IMMUNITY., vol. 1, 1994, pages 247 - 260 |
| ASHKENAZI ET AL., PNAS USA, vol. 88, 1991, pages 10535 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1992, GREENE PUBLISHING ASSOCIATES |
| BABCOOK ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 7843 - 7848 |
| BAINES ET AL.: "Methods in Molecular Biology", vol. 10, 1992, THE HUMANA PRESS, INC., article "Purification of Immunoglobulin G (IgG", pages: 79 - 104 |
| BARANY ET AL., INT J PEP PROTEIN RES, vol. 30, 1987, pages 705 - 739 |
| BARANY; MERRIFIELD: "The Peptides", ACADEMIC PRESS, pages: 1 - 284 |
| BARON ET AL., NUCLEIC ACIDS RES., vol. 23, 1995, pages 3605 - 3606 |
| BAUER ET AL., GENE, vol. 37, 1985, pages 73 |
| BAUM ET AL., EMBO J., vol. 13, 1994, pages 3992 - 4001 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BIRD, SCIENCE, vol. 242, 1988, pages 423 |
| BLOOM ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 407 |
| BOERNER ET AL., J. IMMUNOL., vol. 147, 1991, pages 86 - 95 |
| BOWIE ET AL., SCIENCE, vol. 253, 1991, pages 164 |
| BOWIE ET AL., SCIENCE, vol. 253, 1991, pages 164 - 170 |
| BRENNER ET AL., CURR. OP. STRUCT. BIOL., vol. 7, no. 3, 1997, pages 369 - 376 |
| BRUGGEMANN ET AL., CURR. OPIN. BIOTECHNOL., vol. 8, 1997, pages 455 - 458 |
| BURTON ET AL., ADV. IMMUNOL., vol. 57, 1994, pages 191 - 280 |
| BYRN ET AL., NATURE, vol. 344, 1990, pages 677 |
| CAREY; SUNDBERG: "Advanced Organic Chemistry", vol. A, B, 1992, PLENUM PRESS |
| CHANDRAN ET AL., INDIAN J. EXP. BIOL., vol. 35, no. 8, 1997, pages 801 - 809 |
| CHANG KP; KAO HK; LIANG Y ET AL.: "Overexpression of activin A in oral squamous cell carcinoma: association with poor prognosis and tumor progression", ANN SURG ONCOL., vol. 17, 2010, pages 1945 - 1956, XP019811502 |
| CHAUBERT, MOD PATHOL, vol. 10, 1997, pages 585 |
| CHEN, J.; M. TROUNSTINE; F. W. ALT; F. YOUNG; C. KURAHARA; J. LORING; D. HUSZAR, INTER'L IMMUNOL., vol. 5, 1993, pages 647 - 656 |
| CHOI ET AL., NATURE GENETICS, vol. 4, 1993, pages 117 - 123 |
| CHOI KC ET AL., MOLECULAR & CELLULAR ENDOCRINOLOGY, vol. 174, no. 1-2, 2001, pages 99 - 110 |
| CHOU ET AL., ADV. ENZYMOL. RELAT. AREAS MOL. BIOL., vol. 47, 1978, pages 45 - 148 |
| CHOU ET AL., ANN. REV. BIOCHEM., vol. 47, pages 251 - 276 |
| CHOU ET AL., BIOCHEM., vol. 113, no. 2, 1974, pages 211 - 222 |
| CHOU ET AL., BIOCHEM., vol. 13, no. 2, 1974, pages 222 - 245 |
| CHOU ET AL., BIOPHYS. J., vol. 26, 1979, pages 367 - 384 |
| CIPRANO ET AL., ENDOCRINOL, vol. 141, no. 7, 2000, pages 2319 - 27 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CLARK, M., IMMUNOLOGY TODAY., vol. 21, no. 8, 2000, pages 397 - 402 |
| COBELLIS L; REIS FM; LUISI S ET AL.: "High concentrations of activin A in the peritoneal fluid of women with epithelial ovarian cancer", JSOC GYNECOL INVESTIG, vol. 11, 2004, pages 203 - 206 |
| COERVER ET AL., MOL ENDOCRINOL, vol. 10, no. 5, 1996, pages 534 - 43 |
| CORBELLIS L. ET AL., JOURNAL OF THE SOCIETY FOR GYNECOLOGIC INVESTIGATION, vol. ll, no. 4, 2004, pages 203 - 206 |
| COURTENAY-LUCK ET AL.: "Monoclonal Antibodies: Production, Engineering and Clinical Application", 1995, CAMBRIDGE UNIVERSITY PRESS, article "Genetic Manipulation of Monoclonal Antibodies", pages: 166 |
| COUVREUR ET AL., CRIT. REV. THER. DRUG CARRIER SYST., vol. 5, no. 1, 1988, pages 1 - 20 |
| CRAIK, BIOTECHNIQUES, January 1985 (1985-01-01), pages 12 - 19 |
| CRAMERI ET AL., NATURE, vol. 391, 1998, pages 288 - 291 |
| DALL'ACQUA WF ET AL., METHODS, vol. 36, no. 1, 2005, pages 43 - 60 |
| DATABASE PROTEIN [O] retrieved from GenBank Database accession no. NM_002192 |
| DAVIS ET AL., CANCER METASTASIS REV., vol. 18, 1999, pages 421 - 425 |
| DAVIS ET AL.: "Antibody Engineering: Methods and Protocols", 2003, HUMANA PRESS, article "Production of human antibodies from transgenic mice", pages: 191 - 200 |
| DE GRAAF ET AL., METHODS MOL BIOL., vol. 178, 2002, pages 379 - 387 |
| DE KRETSER DM; HEDGER MP; PHILLIPS DJ: "Activin A and follistatin: their role in the acute phase reaction and inflammation", JOURNAL OF ENDOCRINOLOGY, vol. 161, 1999, pages 195 - 198, XP002994084, DOI: doi:10.1677/joe.0.1610195 |
| DO TV; KUBBA LA; ANTENOS M; RADEMAKER AW; STURGIS CD; WOODRUFF TK: "The role of activin A and Akt/GSK signaling in ovarian tumor biology", ENDOCRINOLOGY, vol. 149, 2008, pages 3809 - 16, XP002760057, DOI: doi:10.1210/en.2007-1584 |
| DOHERTY TJ. AGING; SARCOPENIA, JAPPL PHYSIOL., vol. 95, 2003, pages 1717 - 27 |
| EDELMAN ET AL.: "Methods in Enzymology", vol. 1, 1967, ACADEMIC PRESS, pages: 422 |
| EPPSTEIN ET AL., PNAS (USA, vol. 82, 1985, pages 3688 |
| FANSLOW ET AL., SEMIN. IMMUNOL., vol. 6, 1994, pages 267 - 278 |
| FISHWILD ET AL., NATURE BIOTECH., vol. 14, 1996, pages 845 - 851 |
| FUJII, Y. ET AL., AM. J. PHYS. ENDOCRIN. METAB., vol. 286, 2004, pages E927 - E931 |
| GABIZON A; MARTIN F: "Polyethylene glycol-coated (pegylated) liposomal doxorubicin: rationale for use in solid tumours", DRUGS, vol. 54, no. 4, 1997, pages 15 - 21 |
| GAEDEKE, J. ET AL., NEPH. DIAL. TRANSPL., vol. 20, 2005, pages 319 - 328 |
| GALLO ET AL., EUR J IMMUN., vol. 30, 2000, pages 534 - 540 |
| GAMER ET AL., DEV. BIOL., vol. 208, no. 1, 1999, pages 222 - 232 |
| GLASKY ET AL., HYBRIDOMA, vol. 8, 1989, pages 377 - 389 |
| GLUZMAN ET AL., CELL, vol. 23, 1981, pages 175 |
| GOEDDEL: "Gene Expression Technology: Methods in Enzymology", vol. 185, 1990, ACADEMIC PRESS |
| GONZALEZ-CADAVID ET AL., PNAS USA, vol. 95, 1998, pages 14938 - 14943 |
| GREEN ET AL., J EXP MED., vol. 188, 1998, pages 483 - 495 |
| GREEN ET AL., NAT GENET., vol. 7, 1994, pages 13 - 21 |
| GREEN ET AL., NATURE GENET, vol. 7, 1994, pages 13 |
| GREEN, J IMMUNOL METHODS., vol. 231, 1999, pages 11 - 23 |
| GRIBSKOV ET AL., METH. ENZYM., vol. 183, 1990, pages 146 - 159 |
| GRIBSKOV ET AL., PROC. NAT. ACAD. SCI., vol. 84, no. 13, 1987, pages 4355 - 4358 |
| HAMRICK ET AL., CALCIF TISSUE INT, vol. 71, no. 1, 2002, pages 63 - 8 |
| HARADA K. ET AL., JOURNAL OF CLINICAL ENDOCRINOLOGY & METABOLISM, vol. 81, no. 6, 1996, pages 2125 - 2130 |
| HARADA K; SHINTANI Y; SAKAMOTO Y; WAKATSUKI M; SHITSUKAWA K; SAITO S: "Serum immunoreactive activin A levels in normal subjects and patients with various diseases", J CLIN ENDOCRINOL METAB., vol. 81, 1996, pages 2125 - 2130 |
| HARADA, K. ET AL., J. AM. SOC. NEPHROL., vol. 15, 2004, pages 91 - 101 |
| HARADA, K. ET AL., J. CLIN. ENDOCRIN. AND METAB., vol. 81, 1996, pages 2125 - 2130 |
| HARDING ET AL., ANNALS OF THE NEW YORK ACADEMY OF SCIENCES, 1995 |
| HARLOW; LANE: "Antibodies: A Laboratory Manual", 1990, COLD SPRING HARBOR LABORATORY PRESS |
| HARRIS, R.J., JOURNAL OF CHROMATOGRAPHY, vol. 705, 1995, pages 129 - 134 |
| HOLLENBAUGH ET AL., CURR. PROT.S IN IMMUNOL., 1992, pages 10.19.1 - 10.19.11 |
| HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOLLINGER; HUDSON, NATURE BIOTECH., vol. 23, no. 9, 2005, pages 1126 - 1136 |
| HOLM ET AL., NUCL. ACID. RES., vol. 27, no. 1, 1999, pages 244 - 247 |
| HOOGENBOOM ET AL., J. MOLEC. BIOL., vol. 227, 1992, pages 381 - 388 |
| HOPP ET AL., BIO/TECHNOLOGY, vol. 6, 1988, pages 1204 |
| HOPPE ET AL., FEBS LETTERS, vol. 344, 1994, pages 191 |
| HUBNER G; ALZHEIMER C; WERNER S: "Activin: a novel player in tissue repair processes", HISTOLOGY & HISTOPATHOLOGY, vol. 14, 1999, pages 295 - 304 |
| HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| HWANG W. ET AL., METHODS, vol. 36, no. I, 2005, pages 35 - 42 |
| ITO ET AL., BRITISH J CANCER, vol. 82, no. 8, 2000, pages 1415 - 20 |
| JAKOBOVITS A, EXP. OPIN. INVEST. DRUGS., vol. 7, 1998, pages 607 - 614 |
| JAKOBOVITS ET AL., ANN. N. Y. ACAD. SCI., vol. 764, 1995, pages 525 - 535 |
| JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258 |
| JAKOBOVITS ET AL., PROC NATL ACAD SCI USA., vol. 90, 1993, pages 2551 - 2555 |
| JAKOBOVITS, ADVANCED DRUG DELIVERY REVIEWS, vol. 31, 1998, pages 33 - 42 |
| JAKOBOVITS, CURR BIOL., vol. 4, 1994, pages 761 - 763 |
| JONES KL; DE KRETSER DM; PATELLA S; PHILLIPS,DJ.: "Activin A and follistatin in systemic inflammation", MOLECULAR & CELLULAR ENDOCRINOLOGY, vol. 225, 2004, pages 119 - 125, XP004586245, DOI: doi:10.1016/j.mce.2004.07.010 |
| JONES, D., CURR. OPIN. STRUCT. BIOL., vol. 7, no. 3, 1997, pages 377 - 387 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, US DEPT. OF HEALTH AND HUMAN SERVICES, PHS, NIH |
| KANG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 4363 - 4366 |
| KELLERMANN ET AL., CURR OPIN BIOTECHNOL., vol. 13, 2002, pages 593 - 597 |
| KINGSLEY ET AL., GENES DEV., vol. 8, 1994, pages 133 - 146 |
| KOHLER ET AL.: "Nature", vol. 256, 1975, pages: 495 |
| KORNDORFER ET AL., PROTEINS: STRUCTURE, FUNCTION, AND BIOINFORMATICS, vol. 53, no. 1, 2003, pages 121 - 129 |
| KORTT ET AL., BIOMOL. ENG., vol. 18, 2001, pages 95 - 108 |
| KORTT ET AL., PROT. ENG., vol. 10, 1997, pages 423 |
| KRAMER ET AL., NUCLEIC ACIDS RES., vol. 12, 1984, pages 9441 |
| KRIANGKUM ET AL., BIOMOL. ENG., vol. 18, 2001, pages 31 - 40 |
| KUNKEL ET AL., METHODS IN ENZYMOL., vol. 154, 1987, pages 367 - 382 |
| KUNKEL, PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 488 - 492 |
| LALANI ET AL., J.ENDOCRIN, vol. 167, no. 3, 2000, pages 417 - 428 |
| LAMBERT-MESSERLIAN ET AL., GYNECOLOGIC ONCOLOGY, vol. 74, 1999, pages 93 - 7 |
| LAMBERT-MESSERLIAN GM ET AL., GYNECOLOGIC ONCOLOGY, vol. 74, no. l, 1999, pages 93 - 97 |
| LAMBERT-MESSERLIAN GM; DEPASQUALE SE; MAYBRUCK WM; STEINHOFF MM; GAJEWSKI WH.: "Secretion of activin A in recurrent epithelial ovarian carcinoma", GYNECOL ONCOL., vol. 74, 1999, pages 93 - 97 |
| LANDSCHULZ ET AL., SCIENCE, vol. 240, 1988, pages 1759 |
| LANG ET AL., FASEB J, vol. 15, 2001, pages 1807 - 1809 |
| LANGER ET AL., CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
| LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
| LANTTO ET AL., METHODS MOL. BIOL., vol. 178, 2002, pages 303 - 316 |
| LARRICK ET AL., BIO/TECHNOLOGY, vol. 7, 1989, pages 934 |
| LARRICK ET AL., METHODS: A COMPANION TO METHODS IN ENZYMOLOGY, vol. 2, 1991, pages 106 |
| LASIC, TRENDS BIOTECHNOL., vol. 16, no. 7, 1998, pages 307 - 321 |
| LEE ET AL., PNAS, vol. 98, 2001, pages 9306 |
| LEE SJ; MCPHERRON AC: "Regulation of myostatin activity and muscle growth", PROC NATL. ACAD. SCI., USA, vol. 98, 2001, pages 9306 - 9311, XP002957299, DOI: doi:10.1073/pnas.151270098 |
| LEE SJ; REED LA; DAVIES MV ET AL.: "Regulation of muscle growth by multiple ligands signaling through activin type II receptors", PROC NATL ACAD SCI USA., vol. 102, 2005, pages 18117 - 22 |
| LIU ET AL., PROC. NAT. ACAD. SCI. USA, vol. 84, 1987, pages 3439 |
| LONBERG ET AL., INTERNAL REVIEW OF IMMUNOLOGY, vol. 13, 1995, pages 65 - 93 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| LONBERG: "Transgenic Approaches to Human Monoclonal Antibodies in Handbook of Experimental Pharmacology", vol. 113, 1994, pages: 49 - 101 |
| LOW ET AL., J. MOL. BIOL., vol. 250, 1996, pages 350 - 368 |
| LUISI S; FLORIO P; REIS FM; PETRAGLIA F: "Expression and secretion of activin A: possible physiological and clinical implications", EUROPEAN JOURNAL OF ENDOCRINOLOGY, vol. 145, 2001, pages 225 - 236 |
| LUNDE ET AL., BIOCHEM. SOC. TRANS., vol. 30, 2002, pages 500 - 506 |
| MACDONALD N; EASSON AM; MAZURAK VC; DUNN, GP; BARACOS VE: "Understanding and managing cancer cachexia", JAM COLL SURG., vol. 197, 2003, pages 143 - 61, XP008128756, DOI: doi:10.1016/s1072-7515(03)00382-X |
| MANIATIS ET AL., SCIENCE, vol. 236, 1987, pages 1237 |
| MANIATIS ET AL.: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY |
| MARGALIT, CRIT. REV. THER. DRUG CARRIER SYST., vol. 12, no. 2-3, 1995, pages 233 - 261 |
| MARKS ET AL., BIOLTECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MATZUK ET AL., BAYLOR COLLEGE OF MEDICINE, 1992 |
| MATZUK MM; FINEGOLD MJ; MATHER JP; KRUMMEN L; LU H; BRADLEY A: "Development of cancer cachexia-like syndrome and adrenal tumors in inhibin-deficient mice", PROC, NATL ACAD SCI USA, vol. 91, 1994, pages 8817 - 21 |
| MATZUK MM; FINEGOLD MJ; SU JGJ; HSUEH AJW; BRADLEY A: "a-inhibin is a tumour-suppressor gene with gonadal specificity in mice", NATURE, vol. 360, 1992, pages 313 - 19, XP001145972, DOI: doi:10.1038/360313a0 |
| MCMAHAN ET AL., EMBO J., vol. 10, 1991, pages 2821 |
| MCPHERRON ET AL., NATURE GENET, vol. 22, no. 93, 1999, pages 260 - 264 |
| MCPHERRON ET AL., PNAS USA, vol. 94, 1997, pages 12457 - 12461 |
| MCPHERRON ET AL.: "Growth factors and cytokines in health and disease", vol. IB, JAI PRESS INC., pages: 357 - 393 |
| MENDEZ ET AL., NAT GENET., vol. 15, 1997, pages 146 - 156 |
| MENON U ET AL., BJOG: AN INTERNATIONAL JOURNAL OF OBSTETRICS & GYNAECOLOGY, vol. 107, no. 9, 2000, pages 1069 - 1074 |
| MERRIFIELD, SCIENCE, vol. 232, 1986, pages 341 - 347 |
| MORLEY JE; THOMAS DR; WILSON M-MG: "Cachexia: pathophysiology and clinical relevance", AM J CLIN NUTR., vol. 83, 2006, pages 735 - 43, XP007913220 |
| MOULT J., CURR. OP. IN BIOTECH., vol. 7, no. 4, 1996, pages 422 - 427 |
| MOUNTAIN A; ADAIR, J R: "Biotechnology and Genetic Engineering Reviews", vol. 10, 1992, INTERCEPT |
| MUHLEN ET AL., EUR. J. PHARM. BIOPHARM., vol. 45, no. 2, 1998, pages 149 - 155 |
| MUSCARITOLI M; BOSSOLA M; AVERSA Z; BELLANTONE R; FANELLI FR: "Prevention and treatment of cancer cachexia: new insights into an old problem", EUR J CANCER., vol. 42, 2006, pages 31 - 41, XP025104361, DOI: doi:10.1016/j.ejca.2005.07.026 |
| NEUBERGER, NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 826 |
| NISONOFF ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 89, 1960, pages 230 |
| NYGREN; UHLEN, CURR. OPIN. IN STRUCT. BIOL., vol. 7, 1997, pages 463 - 469 |
| OTANI, T, GYNECOLOGIC ONCOLOGY, vol. 83, no. 1, 2001, pages 31 - 38 |
| PADLAN ET AL., FASEB J., vol. 9, 1995, pages 133 - 139 |
| PATTEN ET AL., CURR. OPIN. BIOTECHNOL., vol. 8, 1997, pages 724 - 733 |
| PETRAGLIA, F. ET AL., JOUR. CLIN. ENDOCRIN. METAB., vol. 83, 1998, pages 1194 - 1200 |
| PICKSLEY ET AL.: "DNA Cloning 2: Expression Systems", 1995, OXFORD UNIVERSITY PRESS, article "Production of monoclonal antibodies against proteins expressed in E. coli", pages: 93 |
| PLUCKTHUN ET AL., METHODS ENZYMOL., vol. 178, 1989, pages 497 - 515 |
| POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 1123 |
| PORTER, BIOCHEM. J., vol. 73, 1959, pages 119 |
| PORTOLANO ET AL., J. IMMUNOL., vol. 150, no. 3, 1993, pages 880 - 887 |
| POUWELS ET AL.: "Cloning Vectors: A Laboratory Manual", 1985, ELSEVIER |
| PROVENCHER DM; LOUNIS H; CHAMPOUX L ET AL.: "Characterization of four novel epithelial ovarian cancer cell lines", IN VITRO CELLULAR & DEVELOPMENTAL BIOLOGY ANIMAL., vol. 36, 2000, pages 357 - 361 |
| QUINTANAR-GUERRERO ET AL., DRUG DEV. IND. PHARM., vol. 24, no. 12, 1998, pages 1113 - 1128 |
| RASMUSSEN ET AL., CYTOTECHNOLOGY, vol. 28, 1998, pages 31 |
| REIS, F. M. ET AL., J. CLIN. ENDOCRIN., vol. 87, 2005, pages 2277 - 2282 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 |
| RISBRIDGER GP ET AL., MOLECULAR & CELLULAR ENDOCRINOLOGY, vol. 180, no. 1-2, 2001, pages 149 - 153 |
| ROBERTSON ET AL.: "Inhibin/activin and ovarian cancer.", ENDOCR RELAT CANCER MARCH, vol. 11, 1 January 2004 (2004-01-01), pages 35 - 49, XP008075338, DOI: 10.1677/ERC.0.0110035 * |
| ROQUE ET AL., BIOTECHNOL. PROG., vol. 20, 2004, pages 639 - 654 |
| ROTH SM; WALSH S: "Myostatin: A therapeutic target for skeletal muscle wasting", CURR OPIN CLIN NUTRMETAB CARE, vol. 7, 2004, pages 259 - 63, XP009037120, DOI: doi:10.1097/00075197-200405000-00004 |
| ROUBENOFF R: "Origins and clinical relevance of sarcopenia", CAN JAPPL PHYS., vol. 26, 2001, pages 78 - 89 |
| ROUBENOFF R; HEYMSFIELD SB; KEHAYIAS JJ; CANNON JG; ROSENBERG IH: "Standardization of nomenclature of body composition in weight loss", AM J CLIN NUTR., vol. 66, 1997, pages 192 - 96 |
| RUSSEL ET AL., INFECT IMMUN., vol. 68, 2000, pages 1820 - 1826 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK; FRITSCH; MANIATIS: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SANGER ET AL., PNAS, vol. 74, 1977, pages 5463 |
| SASTRY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 5728 - 5732 |
| SCATCHARD ET AL., ANN. N. Y. ACAD. SCI., vol. 51, 1949, pages 660 - 672 |
| SCHIER ET AL., J. MOL. BIOL., vol. 263, 1996, pages 551 |
| SCHLEBUSCH ET AL., HYBRIDOMA, vol. 16, 1997, pages 47 - 52 |
| See also references of EP2951205A4 |
| SHARMA ET AL., J CELL PHYSIOL., vol. 180, no. 1, 1999, pages 1 - 9 |
| SHOU ET AL., ENDOCRINOL, vol. 138, no. 11, 1997, pages 5000 - 5 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 556 |
| SIPPL ET AL., STRUCTURE, vol. 4, no. 1, 1996, pages 15 - 19 |
| SMITH ET AL.: "Genetic Engineering: Principles and Methods", 1981, PLENUM PRESS |
| STELLER MD ET AL., MOLECULAR CANCER RESEARCH: MCR, vol. 3, no. 1, 2005, pages 50 - 61 |
| STELLER, M.D. ET AL., MOL. CANCER RES., vol. 3, 2005, pages 50 - 61 |
| STEWART; YOUNG: "Solid Phase Peptide Synthesis", 1984, PIERCE CHEMICAL CO. |
| T.E. CREIGHTON: "Proteins: Structures and Molecular Properties", 1993, W.H. FREEMAN AND COMPANY |
| TAKAKURA, NIPPON RINSHO, vol. 56, no. 3, 1998, pages 691 - 695 |
| TAM ET AL., J AM CHEM SOC, vol. 105, 1983, pages 6442 |
| TAMURA ET AL., J. IMMUNOL., vol. 164, 2000, pages 1432 - 1441 |
| TANAKA T ET AL., INTERNATIONAL JOURNAL OF ONCOLOGY, vol. 23, no. 3, 2003, pages 657 - 663 |
| TAYLOR ET AL., INT. IMMUN., vol. 6, 1994, pages 579 |
| TAYLOR ET AL., INTER'L IMMUNOL., vol. 6, 1994, pages 579 - 591 |
| TAYLOR ET AL., NUCLEIC ACIDS RES., vol. 20, 1992, pages 6287 - 6295 |
| THOMAS TZ ET AL., JOURNAL OF CLINICAL ENDOCRINOLOGY & METABOLISM, vol. 82, no. 11, 1997, pages 3851 - 3858 |
| THOMPSON ET AL., J. MOL. BIOL., vol. 256, 1996, pages 7 - 88 |
| THORNTON ET AL., NATURE, vol. 354, 1991, pages 105 |
| THORNTON ET AL.: "Nature", vol. 354, 1991, pages: 105 |
| TOMAYKO M; REYNOLDS CP: "Determination of subcutaneous tumor size in athymic (nude) mice", CANCER CHEMOTHER PHARMACOL., vol. 24, 1989, pages 148 - 154 |
| TOMIZUKA ET AL., NATURE GENETICS, vol. 16, 1997, pages 133 - 143 |
| TOMIZUKA ET AL., PRO. NAT'LACAD. SCI. USA, vol. 97, 2000, pages 722 - 727 |
| TOUMIER ET AL., HUM. MUTAT., vol. 0, 2013, pages 1 - 4 |
| TOURNIER ET AL.: "Germline Mutations of Inhibins in Early-Onset Ovarian Epithelial Tumors.", HUMAN MUTATION EPUB, vol. 35, no. 3, 1 January 2014 (2014-01-01), pages 294 - 297, XP055266701, DOI: 10.1002/humu.22489 * |
| TSUDA ET AL., GENOMICS, vol. 42, 1997, pages 413 - 421 |
| TUAILLON ET AL., J.IMMUNOL., vol. 152, 1994, pages 2912 - 2920 |
| TUAILLON ET AL., PRO.NAT'LACAD.SCI. USA, vol. 90, 1993, pages 3720 - 3724 |
| URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220 |
| VALE ET AL., RECENT PROG HORM RES V., vol. 44, 1988, pages 1 - 34 |
| VAUGHAN ET AL., NATURE BIOTECH., vol. 16, 1998, pages 535 - 539 |
| VOSS ET AL., TRENDS BIOCHEM. SCI., vol. 11, 1986, pages 287 |
| WALDER ET AL., GENE, vol. 42, 1986, pages 133 |
| WARD ET AL., NATURE, vol. 334, 1989, pages 544 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WARD ET AL.: "Monoclonal Antibodies: Principles and Applications", 1995, WILEY-LISS, INC., article "Genetic Manipulation and Expression of Antibodies", pages: 137 |
| WELT CK ET AL., JOURNAL OF CLINICAL ENDOCRINOLOGY & METABOLISM, vol. 82, no. 11, 1997, pages 3720 - 3727 |
| WILDI ET AL.: "Overexpression of activin A in stage IV colorectal cancer", GUT, vol. 49, no. 3, 1 January 2001 (2001-01-01), pages 409 - 417, XP008075384, DOI: 10.1136/gut.49.3.409 * |
| WILDI S; KLEEFF J; MARUYAMA H; MAURER CA; BUCHLER MW; KORC M: "Overexpression of activin A in stage IV colorectal cancer", GUT, vol. 49, 2001, pages 409 - 417, XP008075384, DOI: doi:10.1136/gut.49.3.409 |
| WILDI, S. ET AL., GUT, vol. 49, 2001, pages 409 - 417 |
| WINTER ET AL., ANNU. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455 |
| WINTER ET AL., TIPS, vol. 14, 1993, pages 139 |
| WOLFF ET AL., CANCER RES., vol. 53, 1993, pages 2560 - 2565 |
| YAMASHITA, S. ET AL., J. AM. SOC. NEPHROL., vol. 15, 2004, pages 91 - 101 |
| YANG ET AL., J. MOL. BIOL., vol. 254, 1995, pages 392 - 403 |
| YARASHESKI ET AL., J NUTR AGING, vol. 6, no. 5, 2002, pages 343 - 348 |
| YEN ET AL., FASEB J., vol. 5, 1994, pages 479 |
| YNDESTAD, A. ET AL., CIRCULATION, vol. 109, 2004, pages 1379 - 1385 |
| YNDESTAL ET AL., CIRCULATION, vol. 109, 2004, pages 1379 - 1385 |
| YOSHINAGA K; MIMORI K; YAMASHITA K; UTSUNOMIYA T; INOUE H; MORI M.: "Clinical significance of the expression of activin A in esophageal carcinoma", INT J ONCOL, vol. 22, 2003, pages 75 - 80, XP008075386 |
| ZACHWIEJA ET AL., J GRAVIT PHYSIOL., vol. 6, no. 2, 1999, pages 11 |
| ZAMBAUX ET AL., J. CONTROLLED RELEASE, vol. 50, no. 1-3, 1998, pages 31 - 40 |
| ZHANG, W. ET AL., MOLECULAR IMMUNOLOGY., vol. 42, no. 12, 2005, pages 1445 - 1451 |
| ZHANG, Z ET AL., BIOCHEMICAL & BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 234, no. 2, 1997, pages 362 - 365 |
| ZHENG W ET AL., AMERICAN JOURNAL OF REPRODUCTIVE IMMUNOLOGY, vol. 44, no. 2, 2000, pages 104 - 113 |
| ZHOU X; WANG JL; LU J ET AL.: "Reversal of cancer cachexia and muscle wasting by ActRIIB antagonism leads to prolonged survival", CELL, vol. 142, 2010, pages 531 - 543, XP028931172, DOI: doi:10.1016/j.cell.2010.07.011 |
| ZIMMERS ET AL., SCIENCE, vol. 296, 2002, pages 1486 |
| ZIMMERS TA; DAVIES MV; KONIARIS LG ET AL.: "Induction of cachexia in mice by systemically administered myostatin", SCIENCE, vol. 296, 2002, pages 1486 - 88, XP009102899, DOI: doi:10.1126/science.1069525 |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11655291B2 (en) | 2011-11-14 | 2023-05-23 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for increasing muscle mass and muscle strength by specifically antagonizing GDF8 and or activin A |
| US11541070B2 (en) | 2013-02-01 | 2023-01-03 | Atara Biotherapeutics, Inc. | Administration of an anti-activin-A compound to a subject |
| US12383572B2 (en) | 2013-02-01 | 2025-08-12 | Amgen Inc. | Administration of an anti-activin-a compound to a subject |
| US10526403B2 (en) | 2013-07-30 | 2020-01-07 | Regeneron Pharmaceuticals, Inc. | Anti-activin A antibodies and uses thereof |
| US12029788B2 (en) | 2015-04-15 | 2024-07-09 | Regeneron Pharmaceuticals, Inc. | Methods for increasing lean body mass with an exercise regimen and a GDF8 inhibitor that is an anti-GDF8 antibody |
| AU2016251640B2 (en) * | 2015-04-22 | 2020-07-16 | Alivegen Inc. | Novel hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US10913782B2 (en) | 2015-04-22 | 2021-02-09 | Biogen Ma Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US11932677B2 (en) | 2015-04-22 | 2024-03-19 | Alivegen Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US11292826B2 (en) | 2015-04-22 | 2022-04-05 | Biogen Ma Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| AU2020250216B2 (en) * | 2015-04-22 | 2022-07-14 | Alivegen Inc. | Novel hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| IL258574B1 (en) * | 2015-11-11 | 2024-09-01 | Novartis Ag | Uses of myostatin antagonists, combinations containing them and uses thereof |
| CN109069467A (zh) * | 2015-11-11 | 2018-12-21 | 诺华股份有限公司 | 肌生成抑制蛋白拮抗剂的用途、含有它们的组合及其用途 |
| RU2781401C2 (ru) * | 2015-11-11 | 2022-10-11 | Новартис Аг | Применение антагонистов миостатина, содержащие их комбинации и их применение |
| AU2021202757B2 (en) * | 2015-11-11 | 2023-05-04 | Novartis Ag | Uses of myostatin antagonists, combinations containing them and uses thereof |
| US11357851B2 (en) | 2015-11-11 | 2022-06-14 | Novartis Ag | Uses of myostatin antagonists, combinations containing them and uses thereof |
| JP7841838B2 (ja) | 2015-11-11 | 2026-04-07 | ノバルティス アーゲー | ミオスタチンアンタゴニストの使用、それを含有する組合せ物およびその使用 |
| JP2018537447A (ja) * | 2015-11-11 | 2018-12-20 | ノバルティス アーゲー | ミオスタチンアンタゴニストの使用、それを含有する組合せ物およびその使用 |
| CN109069467B (zh) * | 2015-11-11 | 2022-11-04 | 诺华股份有限公司 | 肌生成抑制蛋白拮抗剂的用途、含有它们的组合及其用途 |
| WO2017081624A1 (en) * | 2015-11-11 | 2017-05-18 | Novartis Ag | Uses of myostatin antagonists, combinations containing them and uses thereof |
| IL258574B2 (en) * | 2015-11-11 | 2025-01-01 | Novartis Ag | Uses of myostatin antagonists, combinations containing them and their uses |
| AU2023210543B2 (en) * | 2015-11-11 | 2025-04-10 | Novartis Ag | Uses of myostatin antagonists, combinations containing them and uses thereof |
| US12577302B2 (en) | 2016-04-12 | 2026-03-17 | Les Laboratoires Servier | Anti-TIM-3 antibodies and compositions |
| US12187783B2 (en) | 2016-10-20 | 2025-01-07 | Alivegen Inc | Methods for treating muscle wasting and bone disease using novel hybrid ActRIIB ligand trap proteins |
| US11939380B2 (en) | 2017-04-05 | 2024-03-26 | Les Laboratoires Servier | Combination therapies targeting PD-1, TIM-3, and LAG-3 |
| US11248044B2 (en) | 2018-03-01 | 2022-02-15 | Regeneron Pharmaceuticals, Inc. | Methods for altering body composition by administering a GDF8 inhibitor and an Activin A inhibitor |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3985024A1 (en) | 2022-04-20 |
| EP2951205A1 (en) | 2015-12-09 |
| JP2016508504A (ja) | 2016-03-22 |
| HK1218553A1 (zh) | 2017-02-24 |
| WO2014121221A8 (en) | 2015-12-23 |
| US12383572B2 (en) | 2025-08-12 |
| IL240139A0 (en) | 2015-09-24 |
| US20150359850A1 (en) | 2015-12-17 |
| US11541070B2 (en) | 2023-01-03 |
| PH12015501709A1 (en) | 2015-10-19 |
| US20230201231A1 (en) | 2023-06-29 |
| SG11201505960VA (en) | 2015-08-28 |
| CN105431455A (zh) | 2016-03-23 |
| CA2899889A1 (en) | 2014-08-07 |
| SG10201706148WA (en) | 2017-08-30 |
| EP2951205A4 (en) | 2016-09-07 |
| US20200108085A1 (en) | 2020-04-09 |
| EA201591423A1 (ru) | 2016-01-29 |
| MX2015009901A (es) | 2016-04-06 |
| EP2951205B1 (en) | 2021-08-11 |
| KR20150136061A (ko) | 2015-12-04 |
| EP3985024B1 (en) | 2026-05-06 |
| CL2015002116A1 (es) | 2016-05-27 |
| AU2014212014A1 (en) | 2015-08-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12383572B2 (en) | Administration of an anti-activin-a compound to a subject | |
| US20140220033A1 (en) | Administration of an Anti-Activin-A Compound to a Subject | |
| US11542325B2 (en) | Anti-activin A antibodies and uses thereof | |
| JP2010502740A5 (https=) | ||
| AU2012265564B2 (en) | Anti-activin A antibodies and uses thereof | |
| AU2018201242B2 (en) | Anti-activin A antibodies and uses thereof | |
| HK1182398B (en) | Anti-activin a antibodies and uses thereof | |
| HK1234425A1 (en) | Anti-activin a antibodies and uses thereof | |
| HK1182398A (en) | Anti-activin a antibodies and uses thereof | |
| HK1234425B (en) | Anti-activin a antibodies and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201480020307.6 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14746114 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 240139 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2899889 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2015/009901 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2015556210 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: IDP00201505025 Country of ref document: ID |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014746114 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2014212014 Country of ref document: AU Date of ref document: 20140203 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201591423 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 20157023772 Country of ref document: KR Kind code of ref document: A |