WO2014044873A1 - Amino acid derivatives - Google Patents

Amino acid derivatives Download PDF

Info

Publication number
WO2014044873A1
WO2014044873A1 PCT/EP2013/069888 EP2013069888W WO2014044873A1 WO 2014044873 A1 WO2014044873 A1 WO 2014044873A1 EP 2013069888 W EP2013069888 W EP 2013069888W WO 2014044873 A1 WO2014044873 A1 WO 2014044873A1
Authority
WO
WIPO (PCT)
Prior art keywords
formula
antibody
amino acid
pyrrolysine
natural amino
Prior art date
Application number
PCT/EP2013/069888
Other languages
French (fr)
Inventor
Kenneth H. Grabstein
Michael Van Brunt
Marcello Marelli
Original Assignee
Allozyne, Inc
Teuten, Andrew
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Allozyne, Inc, Teuten, Andrew filed Critical Allozyne, Inc
Priority to EP13766526.1A priority Critical patent/EP2897935B1/en
Priority to US14/430,412 priority patent/US9670521B2/en
Priority to JP2015532458A priority patent/JP6321658B2/en
Priority to CN201380060971.9A priority patent/CN104812734B/en
Publication of WO2014044873A1 publication Critical patent/WO2014044873A1/en
Priority to HK15112515.4A priority patent/HK1211569A1/en
Priority to US15/610,931 priority patent/US10214761B2/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00—Preparation of peptides or proteins
    • C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C233/00—Carboxylic acid amides
    • C07C233/01—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C233/45—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups
    • C07C233/46—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom
    • C07C233/49—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having the nitrogen atom of at least one of the carboxamide groups bound to a carbon atom of a hydrocarbon radical substituted by carboxyl groups with the substituted hydrocarbon radical bound to the nitrogen atom of the carboxamide group by an acyclic carbon atom having the carbon atom of the carboxamide group bound to a carbon atom of an acyclic unsaturated carbon skeleton
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C233/00—Carboxylic acid amides
    • C07C233/01—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C233/56—Carboxylic acid amides having carbon atoms of carboxamide groups bound to hydrogen atoms or to acyclic carbon atoms having carbon atoms of carboxamide groups bound to carbon atoms of carboxyl groups, e.g. oxamides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C235/00—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms
    • C07C235/70—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups and doubly-bound oxygen atoms bound to the same carbon skeleton
    • C07C235/72—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups and doubly-bound oxygen atoms bound to the same carbon skeleton with the carbon atoms of the carboxamide groups bound to acyclic carbon atoms
    • C07C235/74—Carboxylic acid amides, the carbon skeleton of the acid part being further substituted by oxygen atoms having carbon atoms of carboxamide groups and doubly-bound oxygen atoms bound to the same carbon skeleton with the carbon atoms of the carboxamide groups bound to acyclic carbon atoms of a saturated carbon skeleton
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C247/00—Compounds containing azido groups
    • C07C247/02—Compounds containing azido groups with azido groups bound to acyclic carbon atoms of a carbon skeleton
    • C07C247/04—Compounds containing azido groups with azido groups bound to acyclic carbon atoms of a carbon skeleton being saturated
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C271/00—Derivatives of carbamic acids, i.e. compounds containing any of the groups, the nitrogen atom not being part of nitro or nitroso groups
    • C07C271/06—Esters of carbamic acids
    • C07C271/08—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms
    • C07C271/10—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C271/12—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms to hydrogen atoms or to carbon atoms of unsubstituted hydrocarbon radicals
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C271/00—Derivatives of carbamic acids, i.e. compounds containing any of the groups, the nitrogen atom not being part of nitro or nitroso groups
    • C07C271/06—Esters of carbamic acids
    • C07C271/08—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms
    • C07C271/10—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C271/20—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms to carbon atoms of hydrocarbon radicals substituted by nitrogen atoms not being part of nitro or nitroso groups
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
    • C07C271/00—Derivatives of carbamic acids, i.e. compounds containing any of the groups, the nitrogen atom not being part of nitro or nitroso groups
    • C07C271/06—Esters of carbamic acids
    • C07C271/08—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms
    • C07C271/10—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms
    • C07C271/22—Esters of carbamic acids having oxygen atoms of carbamate groups bound to acyclic carbon atoms with the nitrogen atoms of the carbamate groups bound to hydrogen atoms or to acyclic carbon atoms to carbon atoms of hydrocarbon radicals substituted by carboxyl groups
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43595—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from coelenteratae, e.g. medusae
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244—Interleukins [IL]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244—Interleukins [IL]
    • C07K16/248—IL-6
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/46—Hybrid immunoglobulins
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K17/00—Carrier-bound or immobilised peptides; Preparation thereof
    • C07K17/02—Peptides being immobilised on, or in, an organic carrier
    • C07K17/08—Peptides being immobilised on, or in, an organic carrier the carrier being a synthetic polymer
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/93—Ligases (6)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/14—Specific host cells or culture conditions, e.g. components, pH or temperature
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y301/00—Hydrolases acting on ester bonds (3.1)
    • C12Y301/01—Carboxylic ester hydrolases (3.1.1)
    • C12Y301/01025—1,4-Lactonase (3.1.1.25)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y601/00—Ligases forming carbon-oxygen bonds (6.1)
    • C12Y601/01—Ligases forming aminoacyl-tRNA and related compounds (6.1.1)

Definitions

  • the invention relates to amino acid derivatives for use in bioconjugation processes.
  • Pyrrolysine is a natural amino acid, the only one that is authentically specified by an amber codon. It uses a 21st aminoacyl-tRNA synthetase (PylRS), naturally evolved to be orthogonal to all other amino acids and tRNAs. Blight et AL, 2004 showed that PylRS and its counterpart tRNA (tRNApyl) can incorporate pyrrolysine at amber codons in E. coli. They also showed that the wt PylRS is naturally promiscuous and can incorporate analogs of lysine.
  • PylRS 21st aminoacyl-tRNA synthetase
  • Yokoyama et al demonstrated that the PylRS/tRNApyl system is orthogonal in eukaryotic cells and showed the incorporation of several non natural amino acids (nnAAs) into a target proteins encoded by amber codons in bacterial cells. These authors also identified key amino acid residues in pylRS that form the amino acid binding pocket and function in selecting pyrrolysine over other canonical amino acids. M utations at this site generated mutants able the recognize and aminoacylate the tRNApyl with AzZ-lys (Yanagisawa 2008).
  • This orthogonality extends to bacteria and eukaryotic cells.
  • PylRS is a naturally promiscuous synthetase that has naturally evolved to exclude lysine, but will incorporate lysine analogs without mutation, including azides, alkynes and alkenes, (Yanagisawa et a I, 2008; Neumann et al. 2008; Mukai et al., 2008; Nguyen et al., 2009).
  • the basis of this specificity is dependent on hydrophobic interactions between amino acid residues of the pylRS binding pocket with the pyrrole ring of pyrrolysine that stabilizes and correctly positions the amino acid in the active site of the synthetase (Kavran et al., 2007).
  • This RS/tRNA pair has been introduced via transient transfection into bacterial, yeast and mammalian cells and shown to be effective for incorporation of a number of non-natural amino acids into target proteins.
  • EP 1911840 demonstrates incorporation of ⁇ - ⁇ -boc-Lysine into a target protein in E. coli cells.
  • Pyrrolysine analogs defined as amino acid derivatives recognized by either native or genetically evolved PylRS and incorporated into proteins at a mber codon sites, have been disclosed in the past few years and reviewed, for instance, by Feckner et. al (Fekner, Li, & Chan, 2010) and Liu et al. Analogs bearing functional groups or post translational modifications have been site- specifically incorporated into proteins using pylRS-tRNApyl systems. Several studies, see e.g.
  • Yanagisawa et al focused on mutations within the PylRS enzyme in order to accommodate analogs in which the N6 substituent were an aromatic ring within the binding pocket pyrrolysine.
  • Others for instance Nguyen et al (also in WO2010/139948) , and Li et al (also in WO2011/044255) focused on identification of pyrrolysine analogs which do not carry a bulky N6 substituent, with the result of obtaining simpler analogs which would be simple to synthesize and interact with native pylRS/tRNApyl pairs.
  • Chin et al developed two analogs with terminal alkyne and azide groups, amenable to use for protein labeling via copper catalyzed click chemistry (CUAAC).
  • mutant protein containing as non-natural amino acid one or more (e.g. one) pyrrolysine analogues of formulae V and VII as described herein.
  • an antibody containing as non-natural amino acid one or more (e.g. one) pyrrolysine analogues of formulae V and VII as described herein in each heavy and/or light chain.
  • mutant protein or antibody as aforesaid which is conjugated via the one or more (e.g. one) non-natural amino acids to one or more (e.g. one) moieties selected from proteins, cytotoxic agents, drugs and polymers.
  • a pyrrolysine analogue as aforesaid in the manufacture of a mutant protein e.g. antibody containing one or more non-natural amino acids.
  • Amino acid analogs described in the present invention are new and useful and have the merit of being straightforward to prepare, in being readily incorporated into proteins (typically without loss of bioactivity when used appropriately) and in providing useful means for bioconjugation.
  • FIG. 1 PEGylation of azide containing monoclonal antibodies.
  • Lane 1 Untreated Antibody
  • Lane 2 Antibody with pyrrolysine analog Formula V.l incorporated into heavy chain and subjected to PEGylation conditions
  • Lane 3 Antibody with pyrrolysine analog Formula VI.1 incorporated into heavy chain and subjected to PEGylation conditions.
  • FIG. 1 HIC chromatogram of a 4D5-Auristatin F antibody drug conjugate with the antibody originally containing the pyrrolysine analog Formula VI.1, incorporated into the heavy chain.
  • SEQ ID No 2 PylRS Methanosarcina mazei W ⁇ amino acid sequence
  • SEQ ID No 3 PylRS Methanosarcina mazei, Y384F mutant nucleotide sequence
  • SEQ ID No 12 anti-Her2 (4D5) gamma nucleotide sequence
  • alkyl refers to an aliphatic linkage or substituent, typically containing 1-6 e.g. 1-4 carbon atoms and can be straight chain or branched. Examples include methyl, ethyl, n-propyl, i- propyl, n-butyl and t-butyl.
  • alkoxy refers to the group -O-alkyl.
  • An alkenyl group may be optionally substituted e.g. by one or more (e.g. 1) substituents such as halogen (e.g. CI) or an ether group (e.g. -0-Ci_ 6 alkyl) although suitably it is not substituted.
  • alkynyl refers to an aliphatic linkage or substituent, typically containing 2-6 e.g. 2-4 carbon atoms and can be straight chain or branched and which is unsaturated in respect of containing at least one C ⁇ C moiety. Examples include -C ⁇ CH and -C ⁇ C-CH 3 .
  • An alkynyl group may be optionally substituted e.g. by one or more (e.g. 1) substituents such as halogen (e.g. CI) or an ether group (e.g. -0-Ci_ 6 alkyl) although suitably it is not substituted.
  • cycloalkyi refers to a n alicyclic and unsaturated compound typically containing 3 to 8 cyclic carbon atoms. Cycloalkyi groups may containing branching. The total number of carbon atoms will typically be 3 to 10. Exemplary groups include cyclopropyl, cyclobutyl, cyclopentyl, 3- methyl-cyclopropyl and cyclohexyl.
  • heterocyclyl refers to a cycloalkyi or cycloalkenyl moiety in which the ring contains one or more (e.g. one, two or three, such as one or two, especially one) heteroatom selected from O, N and S.
  • heteroatom selected from O, N and S. Examples include azetidine, pyrrolidine, piperidine, piperazine, N-methylpiperazine, morpholine and thiomorpholine.
  • aryl refers to an aromatic ring structure that can be part of a linkage or part of a substituent.
  • Aryl moieties may contain one ring (e.g. phenyl) or two rings (e.g. naphthyl).
  • Aryl groups may be substituted e.g. by one or more (e.g. one or two, such as one) substituent selected from alkyl, alkenyl, alkynyl, fluoroalkyl, halogen, alkoxy, nitro and cyano.
  • An exemplary aryl is phenyl.
  • heteroaryl refers to a heteroaromatic ring structure that can be part of a linkage or part of a substituent.
  • the heteroaromatic ring may contain 1-4 (more usually 1-3 e.g. one or two) heteroatoms selected from O, N and S.
  • Heteroaryl moieties may contain one ring or two rings.
  • Example groups containing one 6 membered ring include pyridine and pyrimidine.
  • Example groups containing one 5 membered ring include pyrrole, furan, thiophene, oxazole, thiazole, diazole, thiadiazole and tetrazole.
  • Heteroaryl moieties that contain two rings may contain heteroatoms in one or both rings. Examples include quinoline and isoquinoline.
  • Heteroaryl groups may be substituted e.g. by one or more (e.g. one or two, such as one) substituent selected from alkyl, alkenyl, alkynyl, fluoroalkyl, halogen, alkoxy, nitro and cyano.
  • aromatic halide refers to an aromatic ring (typically phenyl) which is substituted by at least one (e.g. one) halo group such as fluorine, chloride, bromide or iodine. Said aromatic ring may contain further substituents e.g. those mentioned for a ryl.
  • cycloalkyne refers to a cyclic arrangement of carbon atoms (typically 6-9 membered, especially 8-9 membered) which includes a carbon-carbon triple bond captured in the ring structure. Examples include cyclooctyne and cyclononyne. A further example is benzyne.
  • Cycloalkyne groups may containing branching.
  • the total number of carbon atoms will typically be 6 to 12 e.g. 6 to 10.
  • pyrrolysine analog means an amino acid derivative recognized by either native or genetically evolved PylRS and incorporated into proteins at an amber codon site.
  • the side chain of one of the 20 natural amino acids refers to the group R in the formula HOOC-CHR-NH 2 relating to the 20 natural amino acids known by their single letter codes A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y. Either L or S stereochemistry (or a mixture thereof) is intended, although L stereochemistry is preferred.
  • the present invention discloses pyrrolysine analogs.
  • Z bond, CH 2 , CH-NH 2 , CH-OH, NH, O, S or CH-NH 2 ;
  • b is 0 or an integer 1-7;
  • FG azide, alkene, alkyne, ketone, ester, aryl or cycloalkyne.
  • an example is aromatic halide e.g. 4-halo phenyl such as 4- iodo phenyl.
  • Moiety Z(CH 2 ) b FG may, for example, represent CO-aryl e.g. CO-phenyl or -COalkyl e.g. - COMe.
  • Exemplary compounds of formula V are the following:
  • Z CH 2 , CH-NH 2 , CH-OH, NH, 0 or S;
  • FG azide, alkene, alkyne, ketone, ester, aryl or cycloalkyne
  • an example is aromatic halide e.g.4-halo phenyl such as 4-iodo phenyl.
  • Suitbly Z represents NH. In another embodiment it represents CH.
  • b may, for example, represent 1 or 2.
  • Exemplary compounds of Formula VI are:
  • FG represents alkyne
  • it suitably represents -C ⁇ CH or - C ⁇ C-CH 3 , preferably -C ⁇ CH.
  • FG represents ketone
  • FG represents ester
  • FG represents aromatic halide
  • FG suitably represents phenyl substituted by halogen, especially iodine (e.g. 4-iodo-phenyl).
  • FG represents cycloalkyne
  • FG suitably represents cyclooctyne, e.g. cyclooct-4,5-yne.
  • the nnAAs of formulas V and VI of the present invention have been shown to have good incorporation as demonstrated by GFP assay.
  • Formula VI.1 had a similar level of translational compentency to Formula V.l in the GFP assay incorporation assay.
  • Both the Formula V and VI are easily modified to incorporate a variety of useful functional groups which can be used for site selective post translational modification. Alkynes and alkenes are readily incorporated.
  • the pyrrolysine analogs disclosed herein can be made using various methods. The reaction conditions can generally be determined by one of the ordinary skill in the art.
  • Formula V analogs are readily prepared by the addition of an activated carbonyl group, such as a chloroformate, activated carboxylic acid ester, isocyanate, activated carbonate or sulfonyl halide to a mono-protected diamino substrate of type 1, in which the a-amino group is protected by a protecting group ("PG") such as a Boc, Cbz, TFA, Acetyl or Fmoc group (see Scheme 1).
  • PG protecting group
  • the coupled product 3 can undergo further modifications, such as the displacement of halides with an azido nucleophile to install the desired functionality. Otherwise, the intermediate 3 is deprotected to remove the a-amino acid masking group to afford the desired Formula V analog.
  • Formula VI analogs were prepared by conjugation of hydroxyl amino acids 9 to substrates with activated carbonyls such as carboxylic acid ester, isocyanate, acid chlorides, activated carbonates or sulfonyl halides.
  • the coupled product 11 can undergo further modifications, such as the installation of the azide functional group by displacement of leaving groups such as halides or activated alcohols.
  • the desired amino acid analog 12 is obtained by final deprotection to remove the a-amino acid masking group.
  • Protecting groups may be used as per Scheme 1. See Scheme 2
  • the pyrrolysine analogs disclosed herein can be incorporated into recombinant proteins.
  • site specific incorporation of the analog into a recombinant protein can be achieved through amber suppression, wherein a nonsense (amber) codon is inserted within the nucleotide sequence encoding the recombinant protein, at a site where the pyrrolysine analog is to be inserted.
  • the mutated nucleotide sequence, along with one or more plasmids encoding the PylRS and tRNApyl are inserted into a cell of a cell free expression system.
  • the host cell may be a eukaryotic cell line which is transformed with a vector comprising a DNA construct as aforesaid.
  • a cell-free expression system wherein a synthesis reaction lysate obtained from a host cell comprises at least one component required for the synthesis of polypeptides.
  • the synthesis reaction lysate is obtained from bacterial or eukaryotic cells.
  • the synthesis reaction lysate is obtained from eukaryotic cells, more preferably, from rabbit reticulocytes or wheat germ.
  • the cell-free expression system is capable of expressing WT PylRS and tRNApyl of the present invention, wherein tRNApyl is introduced into the cells used to obtain the synthesis reaction lysate with DNA constructs of the invention.
  • nnAA and the tRNApyl are bound by the pylRS and the tRNApyl is subsequently aminoacylated with the nnAA.
  • This tRNApyl containing an amber anticodon is released into the cytosol where in response to an amber stop codon can interact with the ribosome and the nnAA released to form a peptide bond with the growing polypeptide chain.
  • Recombinant proteins modified to incorporate a pyrroiysine analog of the invention include all recombinant proteins amenable to site specific post translational modifications, e.g. therapeutic proteins, for instance cytokines, antibodies and antibody derivatives (such as Fab fragments, or single chain antibodies, e.g. single chain variable fragments (scfvs)), peptides, enzymes, fusion proteins, decoy receptors, protein vaccines, protein hormones, e.g. insulin, growth factors,( e.g. human growth hormone, hGH, hGCSF, hFSH, hHCG).
  • Further proteins modifiable with pyrroiysine analogs of the invention include diagnostic labels, imaging reagents.
  • proteins may be modified site specifically to incorporate one or more than one nnAA (pyrroiysine analog) of the invention.
  • nnAA polypeptide derived from a polypeptide having a nnAA sequence.
  • an antibody may incorporate a nnAA of the invention at the heavy chain, or at the light chain, or at both light and heavy chain.
  • Proteins having incorporated pyrroiysine analogs of the present invention may be used for the preparation of functionalized protein conjugates.
  • Molecules that may be conjugated to proteins having incorporated non-natural amino acids include (i) other proteins, e.g. antibodies especially monoclonal antibodies; (ii) polymers e.g. PEG groups or other groups that may cause half life extension in the system; (iv) cytotoxic agents e.g. Auristatin F; and (v) drug moieties e.g.
  • doxorubicin and moieties containing radioactive isotopes.
  • these modified proteins can be conjugated to drugs or nucleotides for targeted delivery of these potent compounds.
  • Pyrroiysine analogs may conveniently contain a unique chemical group permitting conjugation in a targeted fashion without risk of side reaction with other amino acids.
  • non-natural amino acids may contain azide or alkyne groups permitting reaction with a molecule to be conjugated which contains a corresponding alkyne or azide group using the Huisgen 1,3-dipolar cycloaddition reaction.
  • Preferred conjugation chemistries of the invention include reactions which are orthogonal to the natural twenty amino acids. Such reactions do not interact or cause side reactions with the native 20 amino acids, they are specific to the functional groups associated with the reaction. Suitably the necessary functional groups are incorporated into the target protein via the pyrroiysine analogs of the present invention. Further, said reactions proceed under conditions which are not destructive to the protein, for instance aqueous solvents, with a pH range which is acceptable to the protein and maintains its solubility, at a temperature which does not lead to deleterious effects upon the protein.
  • Increasing the stability of the attachment moiety between the protein and the linker can be advantageous.
  • Conventional methods conjugate to the thiol groups of cysteine by reaction with a maleimide forming a thiol ether.
  • the thiol ether can undergo the reverse reaction releasing the linker drug derivative from the antibody.
  • the conjugation chemistry employed between an azide and an alkyne results in an aromatic triazole which is significantly more stable, and not as prone to reversibility.
  • the product of the reaction ought to be stable, equal to or greater than the stability associated with conventional linkages (amide, thiol ether).
  • linkages amide, thiol ether
  • Preferred chemical conjugations for production of conjugates of the invention include : a 3+2 alkyne-azide cycloaddition, 3+2 dipolar cycloaddition, Husigen 3+2 cycloaddition, Copper promoted azide-alkyne cycloaddition (CuAAC), Ruthenium promoted azide alkyne cycloaddition (RAAC), metal promoted azide alkyne cycloaddition (MAAC), and strain promoted azide alkyne cycloaddition (SPAAC), palladium based couplings including the Heck reaction, Sonogashira reaction Suzuki reaction Sti lie coupling Hiyama/Denmark reaction olefin metathesis Diels-alder reaction carbonyl condensation with hydrazine, hydrazide, alkoxy amine or hydroxyl amine; strain promoted cycloadditions with nitriles and nitrile oxides,; electron promoted cycloaddition;
  • the incorporated amino acid contains an azide or an alkyne group and the process of chemical modification comprises reacting said azide or alkyne group with a reagent comprising an alkyne or azide group.
  • the envisaged reaction is a Huisgen 1,3-dipolar cycloaddition reaction which leads to production of a triazole linkage.
  • the reagent comprising an alkyne or azide group may be a protein (e.g. an antibody) or a cytotoxic agent or a drug or a substance suitable for half life extension (e.g. a PEG group) which carries an alkyne or azide group optionally via a linker.
  • the Huisgen 1,3-dipolar cycloaddition reaction can be performed in the presence of Cu(l) catalysis.
  • copper catalyzed cycloaddition reactions are carried at room temperature, in acqueous solution in presence of cysteine and tris[(l-benzyl-lH-l,2,3-triazol-4-yl)methyl]amine (TBTA).
  • the copper catalyzed cycloaddition reactions are carried out from 4°C to 50°C in aqueous solution in the presence of sodium ascorbate and tris(3- hydroxypropyltriazolylmethyl)amine (THPTA).
  • the reactions can also be carried out in mixed aqueous/organic solution with the organic component consisting of DMSO, DMF, methanol, ethanol, i-butanol, trifluoroethanol, propylene glycol, ethylene glycol and hexylene glycol.
  • organic component consisting of DMSO, DMF, methanol, ethanol, i-butanol, trifluoroethanol, propylene glycol, ethylene glycol and hexylene glycol.
  • the incorporated amino acid contains an azide or an alkene group and the process of chemical modification comprises reacting said azide or alkene group with a reagent comprising an alkene or azide group.
  • the reagent comprising an alkene or azide group may be a protein (eg an antibody) or a toxin or a substance suitable for half life extension (eg a PEG group) which carries an alkyne or alkene group optionally via a linker.
  • the site specific conjugations between the incorporated nnAA and the target payioad can be done with fully folded proteins such as antibodies, antibody fragments, and cytokines.
  • the conjugation can be done on denatured proteins in the presence of denaturants such as sodium dodecylsulfate and urea.
  • denaturants such as sodium dodecylsulfate and urea.
  • the copper catalyzed azide alkyne addition can be done in the presence of denaturants and reducing agents such as dithiothreitol and 2-mercaptoethanol.
  • the chemical modification may be the same or different.
  • a target protein e.g. an antibody
  • the chemical modification may be the same or different.
  • two nnAAs are incorporated, one may be modified to be conjugated to a drug moiety and one may be modified to be conjugated to a PEG moiety.
  • nnAA of the invention bearing different but complementary reactive groups
  • said nnAAs can react with each other to generate an
  • conjugation chemistry of the invention is used for preparing an antibody drug conjugate.
  • the conjugation chemistry may also be used to assemble antibody-protein conjugates, protein protein conjugates such as bispecifics composed of antibody fragments.
  • the conjugation chemistry may also be used to conjugate polymer bond drug conjugates to targeting agents such antibodies and antibody fragments.
  • the conjugation chemistry can also be used to attach polymers such as PEG to proteins to manipulate pharmacokinetic properties.
  • Target proteins may be conjugated to PEG moieties.
  • PEG moieties may be incorporated into antibody drug conjugates.
  • the PEG moiety may typically have a molecular weight ranging between 0.5 kDa and 40 kDa e.g. 5kDa and 40 kDa. More preferably, the PEG moiety may have a molecular weight of around 20 kDa.
  • the PEG moieties can have a molecular weight range from 100 - 2000 Da.
  • PEG moieties may be straight chain or branched or multi armed
  • the PEG moieties can be functionalized with terminal alkynes, azides, cyanides, cycloalkynes, alkenes, aryl halides.
  • the PEG can be functionalized in such as way as to be monofunctional, homobifunctional, heterobifunctional, and multi-homofunctional.
  • ADCs Antibody Drug Conjugates
  • Pyrrolysine analogs according to the invention are particularly useful for production of Antibody Drug Conjugates (recombinant antibody covalently bound by a synthetic linker to a given drug, typically a cytotoxic drug, or else a protein or a PEG group) which are homogeneous nature, in which the number of drugs (or other conjugated molecule) per antibody and position of those drugs upon the antibody are explicitly controlled, whereby monoclonal antibodies containing incorporated non-natural amino acids are obtained and site specifically conjugated to a linker carrying a drug moiety (or other conjugated molecule) through orthogonal chemistry.
  • Antibody Drug Conjugates synthetic antibody covalently bound by a synthetic linker to a given drug, typically a cytotoxic drug, or else a protein or a PEG group
  • ADCs obtained with pyrrolysine analogs of the present invention may be manufactured following methods including the following steps:
  • the present invention also provides ADCs whereby the antibody component has been modified to incorporate non natural amino acids bearing a unique reactive functional group at desired positions, whereby such functional group allows conjugation to a drug moiety (or protein or PEG group).
  • the present invention provides an antibody conjugate comprising an anti-Her-2 antibody which is conjugated to one or more moieties (e.g. one, two, three or four, preferably one or two, especially one) selected from protein, drug and PEG moieties via linkers comprising a triazole moiety.
  • moieties e.g. one, two, three or four, preferably one or two, especially one
  • the triazole moiety may be formed by reaction of an azide or alkyne moiety in the side chain of a non-natural amino acid incorporated into the sequence of the anti-Her-2 antibody and an alkyne or azide moiety attached to the protein, drug or PEG moiety.
  • the triazole moiety is formed by reaction of an azide or alkyne moiety in the side chain of a non-natural amino acid incorporated into the sequence of the anti-Her-2 antibody and an alkyne or azide moiety attached to the protein, drug or PEG moiety under conditions of Cu(l) catalysis.
  • Cu(l) catalysis is accomplished by using either a native Cu(l) source such as copper iodide, copper bromide, copper chloride, copper thiolate, copper cyanide.
  • the Cu(l) species can also be generated in situ by using a copper (II) source and a reducing agent.
  • the copper (II) source can be copper sulfate, copper (II) chloride, or copper acetate.
  • the reducing agent can be sodium ascorbate, dithiothreitol, TCEP, b-mercaptoethanol, hydrazine, hydroxylamine, sodium bisulfite, cystamine and cysteine.
  • Cu(l) catalyzed cycloaddition are carried out in presence of ligands to stabilize the Cu(l) species present at the start of the reaction or generated in situ by reduction of a Cu(ll) source such as sodium sulfate with sodium ascorbate, including TBTA, THPTA, phenanthroline derivatives, pyridylmethanimine derivatives, diethylenetriamine, bipyridine derivatives, TMEDA, N,N-bis(2- pyridylmethyl)amine (BPMA) derivatives,N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (TPEN) derivatives, trialkylamines such as triethylamine, diisopropyl ethylamine, HEPES and MES.
  • a Cu(ll) source such as sodium sulfate with sodium ascorbate, including TBTA, THPTA, phenanthroline derivatives, pyridylme
  • a copper azide alkyne cycloaddition is used for the conjugation.
  • the reaction utilizes a a cytotoxic agent such as auristatin, amanitin, taxol or doxorubicin bearing a terminal alkyne.
  • the reaction employs a copper source such as copper sulfate, copper acetate, copper iodide or copper bromide; a reducing agents such as sodium ascorbate, hydrazine, hydroxylamine, sodium bisulfite, dithiothreitol, cysteine, b-mercaptoethanol; a copper chelating ligand such as Tris[(l-benzyl-lH-l,2,3-triazol-4-yl)methyl]amine (TBTA) or Tris(3- hydroxypropyltriazolylmethyl)amine (THPTA).
  • the reaction may be performed at 4 - 50°C.
  • the reaction time ranges from 0.5 to 48 hrs.
  • a strain promoted azide alkyne cycloaddition is used for conjugation.
  • the reaction utilizes a dye, a PEG polymer, or cytotoxic agent such as auristatin bearing a cycloocytne group.
  • the reaction is allowed to incubate at room temperature for 0.5 - 48h.
  • Drug moieties of the present invention include small molecules, natural products, synthetically derived drugs, proteins such as immunotoxins, and radionuclides.
  • the drug moiety is an auristatin moiety eg auristatin or a derivative thereof such as monomethyl auristatin E (MMAE)(Vedotin) or monomethyl auristatin F (MMAF),
  • auristatin moiety eg auristatin or a derivative thereof such as monomethyl auristatin E (MMAE)(Vedotin) or monomethyl auristatin F (MMAF)
  • Auristatin F (AF)
  • amanitin amanitin
  • Paclitaxel amanitin
  • doxorubicin doxorubicin
  • drug moieties include maytansine, paclitaxel, doxorubicin and immunotoxins such as exotoxin or bouganin as well as radionuclides such as lodine-131, Yttrium-90,Samarium-135, and Strontium-89 which may also be incorporated into organic molecules.
  • MMAE Senter, PE, et. a I, BLOOD, 102, 1458-1465.
  • MMAF Senter, PE, et. al., Bioconj. Chem. 2006, 17, 114-124. Maytansine : Lewis-Phillips GD, Cancer Res., 63, 9280-9290, 2008.
  • Bouganin MacDonald GC, et. al, J. lmmunotherapy,32 574-84, 2009.
  • the drug moiety is a moiety selected from a doxorubicin, paclitaxel and auristatin moiety.
  • Pyrrolysine analogues described herein may optionally be employed in the form of a salt. Any such salts form an aspect of the invention.
  • Salts of carboxylic acids may include salts formed with Group 1 and Group 2 metals, especially soluble salts such as sodium and potassium salts.
  • Salts of amines may include salts formed with weak and strong acids, such as HCI, HBr or acetic acid.
  • N-Boc-Lysine 500mg, 2.0mmol suspended in dioxane (lOmL).
  • 1M K 2 C0 3 was added (5mL) and the solution was cooled to OC.
  • 4-pentenoyl chloride 224uL, 2.0mmol in dioxane (2mL) was added slowly.
  • the solution was allowed to stir at OC for lh and then at room temperature for 4h.
  • the solution was transferred to a extraction funnel and partitioned between water and ether.
  • the aqueous layer was extracted with ethyl acetate (3x50mL), the organic layers combined and dried over sodium sulfate, filtered and concentrated. The resulting residue was carried forward into the next step.
  • Triethyl amine (8.8mL, 63.6mmol) was added after addition of the activated ester, and the mixture was stirred overnight. The mixture was partitioned between ethyl acetate and citric acid. The layers were separated and the aqueous layer was extracted 4 times with ethyl acetate. The organic layers were combined, dried over sodium sulfate and concentrated. The resulting residue was further purified by flash chromatography to afford the final N-Boc lysine derivative as an oil. In a lOOmL roundbottomed flask was placed the keto-N-Boc lysine derivative (4g, 10.6mmol) in acetonitrile (50mL).
  • N-Boc-Lysine 500mg, 2.0mmol suspended in dioxane (5mL).
  • Saturated NaHC0 3 was added (2mL) and the solution was cooled to 0°C.
  • Bromoacetyl chloride (169uL, 2.0mmol) in dioxane (2mL) was added slowly.
  • the solution was allowed to stir at 0C for lh and then at room temperature for 4h.
  • the solution was transferred to a extraction funnel and partitioned between water and ether.
  • the aqueous layer was extracted with ethyl acetate (3x50mL), the organic layers combined and dried over sodium sulfate, filtered and concentrated. The resulting residue was carried forward into the next step.
  • 2-N-Boc-ethylbromide (lg, 4.4mmol) in 25mL of dioxane.
  • a solution of sodium azide (1M, 22.2mmol).
  • the solution was stirred at 60C overnight.
  • the mixture was partitioned between water and ethyl acetate.
  • the ethyl acetate layer was retained and the aqueous layer was extracted with ethyl acetate three additional times.
  • the organic layers were combined, dried over sodium sulfate and concentrated to an oil.
  • Boc-protected amino acid was taken up in acetontirile (15mL) and treated with HCI in dioxane (4M, 5mL). The mixture was stirred for two hours and concentrated under vacuum.
  • the aqueous layer was extracted with ethyl acetate two additional times.
  • the organic layers combined, washed with 5% lithium chloride, dried with sodium sulfate, filtered and concentrated.
  • the product was identified by mass spectrometry and taken forward into the next step directly.
  • Step 2 In a 4mL vial with magnetic stirrer was placed the crude chloro derivative from above and DMSO (ImL). Sodium azide (130mg, 5eq) and pyridine (32.3uL, 2 eq) were added to the mixture and the vial was capped. The mixture was stirred overnight at 60°C. The mixture was transferred to an extraction funnel and diluted with lOOmM citric acid and ethyl acetate. The mixture was shaken and the layers separated. The aqueous layer was extracted with ethyl acetate two additional times. The organic layers combined, washed with 5% lithium chloride, dried with sodium sulfate, filtered and concentrated. The product was carried on to the next step.
  • Boc-N-6-hydroxynorleucine 50mg, leq
  • DMF 1.5mL
  • allyl isocyanate 18.0uL, l.Oeq
  • pyridine 32.3uL, 2 eq
  • the vial was capped and allowed to stir for 4h.
  • the solution was transferred to an extraction funnel, diluted with ethylacetate and lOOmM citric acid. The mixture shaken and the layers separated. The aqueous layer was extracted with ethyl acetate two additional times. The organic layers were combined, washed with 5% lithium chloride, dried with sodium sulfate, filtered and concentrated.
  • Example 2 Translational testing of novel pyrrolysine analogs as nnAAs with a GFP assay.
  • HEK293 cells stably expressing pylRS (3H7) were transiently transfected with plasmids for the expression of tRNApyl and a reporter construct encoding GFPY40 (containing amber codon in place of tyrosine at amino acid residue number 40 (where 1 is the initiator methionine)) using standard transfection protocols.
  • Transfected cells were incubated with nnAAs at 2mM for 2-3 days GFP production was analyzed qualitatively by visual inspection under the microcope.
  • the GFP fluorescence was quantified by flow cytometry using an Accuri flow cytometer and the geometric mean of the fluorescent cells determined.
  • nnAAs that are readily utilized by the PylRS/tRNApyl pair support the translation of the nnAA into the amber site of GFP and allow read-through of the gene producing full length GFP (fluorescent protein).
  • the fluorescence intensity of the cells depends on the efficiency of nnAA incorporation. Thus, nnAAs that are poorly utilized produce weakly fluorescent or non-fluorescing cells.
  • Analog Formulae VI.1 and VI.3 and of the present invention were found by the inventors to be incorporated in the GFP reporter gene and yield green cells under the experimental conditions used.
  • the analog of Formula VI.1 supported high levels of GFP expression (MFI 904206) and represents an analogue that is efficiently utilized by the pylRS/tRNA pair under the experimental conditions tested (see Table 2).
  • a full length anti-Her2 antibody containing two non natural amino acids (one in each heavy chain)
  • variable regions of both the heavy and light chains of the mouse antibody 4D5 were generated by cloning the variable regions of both the heavy and light chains of the mouse antibody 4D5 into vectors containing genes encoding human IgG.
  • the variable regions of 4D5 were generated by gene synthesis using overlapping oligomers and cloned into the human IgGl frameworks encoded by pFUSE-CHIg-hGl (IgGl heavy chain;gamma) and pFUSE-CHLIg-hK (light chain; kappa; Invivogen) to generate a mouse-human hybrid.
  • Amber codons were introduced into the heavy chain (gamma) at positions K274 by site directed mutagenesis. Clones containing the amber codon were identified by DNA sequencing.
  • the promoters and ORF for the heavy chain was amplified by PCR and cloned by restriction enzyme digestion and ligation into pOptivec (Life Technologies).
  • the light chain and a single copy of the tRNA were joined by two step PCR method using overlapping oligomers and cloned into available sites into the pOptivec plasmid containing the heavy chain.
  • the construct was then transfected into a CHO cell line containing the pylRS/tRNA pair and stably transfected cell lines showing high expression of the IgG selected.
  • This cell line was utilized to generate IgG containing the nnAAs described above. The cells were grown to a density of 1-2 x 10 6 cells/mL in Excel DHFR- medium (Sigma-Aldrich) and nnAA added to culture to a final concentration of 1 mM. Cells were incubated for 5 days and IgG purified from the growth medium. Supernatants were harvested and subjected to centrifugation to collect suspended cells and other debris.
  • the supernatant was then filtered through a 0.22um filter to remove any particulate material prior to application to a chromatography column.
  • the filtered supernatant was applied to a lmL -5mL prepacked HiTrap protein A Sepharose at 1-5 mL/min flow rate using an AKTA chromatography system.
  • the bound material and resin were washed with PBS to remove loosely bound proteins and the bound material eluted with lOOmM glycine (pH 3.0) at a flow rate of 1 mL/min. Peak fractions containing the target protein were neutralized with 0.1 fraction volumes of 1M Tris-HCI (pH8.0).
  • a solution of 4D5- 2AzAb-HC274-(2S)-2-amino-6- ⁇ [(2-azidoethyl)carbamoyl]oxy ⁇ hexanoic acid (Formula VI.1). (IOUL, 0.55 mg/mL) was added followed by a solution of 20KPEG cyclooctyne (3.3, 60mg/mL). The solution was mixed vigorously on a vortexer. The mixture was allowed to stand overnight. The mixture was diluted to 200uL and applied to Protein-A magnetic beads. The mixture was vortexed and allowed to rotate to mix the beads for 90min.
  • the beads were immobilized and the run through material disposed.
  • the beads were washed with PBS (2X) and then suspended in reducing gel buffer. Vortexed and then heated to 95C for 3min.
  • the suspension was loaded directly onto an SDS-PAGE gel. Commassie staining of the SDS-PAGE gel indicated the selective PEGylation of the Heavy chain ( Figure 1, Lane 3).
  • a solution of 4D5- 2AzAb-HC274-(2S)-2-amino-6- ⁇ [(2-azidoethyl)carbamoyl]oxy ⁇ hexanoic acid (30uL, 0.55 mg/mL) was added followed by a solution DMCO-Fluor 488 cyclooctyne (5.4, 5mM in DMSO, click chemistry tools).
  • the solution was mixed vigorously on a vortexer. The mixture was allowed to stand for 24h.

Abstract

There are provided amino acid derivatives of formula V and VI as defined herein which are pyrrolysine analogs for use in bioconjugation processes.

Description

Amino acid derivatives
The invention relates to amino acid derivatives for use in bioconjugation processes.
I NTRODUCTION
Pyrrolysine is a natural amino acid, the only one that is authentically specified by an amber codon. It uses a 21st aminoacyl-tRNA synthetase (PylRS), naturally evolved to be orthogonal to all other amino acids and tRNAs. Blight et AL, 2004 showed that PylRS and its counterpart tRNA (tRNApyl) can incorporate pyrrolysine at amber codons in E. coli. They also showed that the wt PylRS is naturally promiscuous and can incorporate analogs of lysine.
Yokoyama et al (EP1911840) demonstrated that the PylRS/tRNApyl system is orthogonal in eukaryotic cells and showed the incorporation of several non natural amino acids (nnAAs) into a target proteins encoded by amber codons in bacterial cells. These authors also identified key amino acid residues in pylRS that form the amino acid binding pocket and function in selecting pyrrolysine over other canonical amino acids. M utations at this site generated mutants able the recognize and aminoacylate the tRNApyl with AzZ-lys (Yanagisawa 2008).
This orthogonality extends to bacteria and eukaryotic cells.
PylRS is a naturally promiscuous synthetase that has naturally evolved to exclude lysine, but will incorporate lysine analogs without mutation, including azides, alkynes and alkenes, (Yanagisawa et a I, 2008; Neumann et al. 2008; Mukai et al., 2008; Nguyen et al., 2009). The basis of this specificity is dependent on hydrophobic interactions between amino acid residues of the pylRS binding pocket with the pyrrole ring of pyrrolysine that stabilizes and correctly positions the amino acid in the active site of the synthetase (Kavran et al., 2007). This RS/tRNA pair has been introduced via transient transfection into bacterial, yeast and mammalian cells and shown to be effective for incorporation of a number of non-natural amino acids into target proteins.
For instance, EP 1911840 demonstrates incorporation of Ν-ε-boc-Lysine into a target protein in E. coli cells.
Pyrrolysine analogs, defined as amino acid derivatives recognized by either native or genetically evolved PylRS and incorporated into proteins at a mber codon sites, have been disclosed in the past few years and reviewed, for instance, by Feckner et. al (Fekner, Li, & Chan, 2010) and Liu et al. Analogs bearing functional groups or post translational modifications have been site- specifically incorporated into proteins using pylRS-tRNApyl systems. Several studies, see e.g.
Yanagisawa et al , focused on mutations within the PylRS enzyme in order to accommodate analogs in which the N6 substituent were an aromatic ring within the binding pocket pyrrolysine. Others, for instance Nguyen et al (also in WO2010/139948) , and Li et al (also in WO2011/044255) focused on identification of pyrrolysine analogs which do not carry a bulky N6 substituent, with the result of obtaining simpler analogs which would be simple to synthesize and interact with native pylRS/tRNApyl pairs. Furthermore, Chin et al developed two analogs with terminal alkyne and azide groups, amenable to use for protein labeling via copper catalyzed click chemistry (CUAAC).
There remains a need to develop further pyrrolysine analogs. Whilst pyrrolysine analogs made thus far have been restricted to those evolved from a lysine backbone, the present inventors have generated pyrrolysine analogs successfully incorporated into proteins with native pylRS/tRNApyl pairs starting from a variety of amino acid structures.
SUMMARY OF THE INVENTION :
According to the invention there are provided pyrrolysine analogues of formulae V and VII as described herein.
There is also provided a mutant protein containing as non-natural amino acid one or more (e.g. one) pyrrolysine analogues of formulae V and VII as described herein.
There is also provided an antibody containing as non-natural amino acid one or more (e.g. one) pyrrolysine analogues of formulae V and VII as described herein in each heavy and/or light chain.
There is also provided a mutant protein or antibody as aforesaid which is conjugated via the one or more (e.g. one) non-natural amino acids to one or more (e.g. one) moieties selected from proteins, cytotoxic agents, drugs and polymers.
There is also provided use of a pyrrolysine analogue as aforesaid in the manufacture of a mutant protein e.g. antibody containing one or more non-natural amino acids.
Amino acid analogs described in the present invention are new and useful and have the merit of being straightforward to prepare, in being readily incorporated into proteins (typically without loss of bioactivity when used appropriately) and in providing useful means for bioconjugation.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1. PEGylation of azide containing monoclonal antibodies. Lane 1: Untreated Antibody, Lane 2: Antibody with pyrrolysine analog Formula V.l incorporated into heavy chain and subjected to PEGylation conditions; Lane 3: Antibody with pyrrolysine analog Formula VI.1 incorporated into heavy chain and subjected to PEGylation conditions.
Figure 2. HIC chromatogram of a 4D5-Auristatin F antibody drug conjugate with the antibody originally containing the pyrrolysine analog Formula VI.1, incorporated into the heavy chain.
BRIEF DESCRIPTION OF THE SEQUENCES OF THE SEQUENCE LISTING
SEQ ID No l:PylRS Methanosarcina mazei WT nucleotide sequence
SEQ ID No 2: PylRS Methanosarcina mazei W\ amino acid sequence SEQ ID No 3: PylRS Methanosarcina mazei, Y384F mutant nucleotide sequence
SEQ ID No 4: PylRS Methanosarcina mazei, Y384F mutant amino acid sequence
SEQ. ID No 5: tRNApyl Methanosarcina mazei
SEQ. ID No 6: U6 snRNA Promoter
SEQ ID No 7: U6-tRNApyl construct
SEQ ID No 8: GFP nucleotide sequence
SEQ ID No 9: GFP amino acid sequence
SEQ ID No 10: GFPY40 nucleotide sequence
SEQ ID No 11: GFPY40 amino acid sequence
SEQ ID No 12: anti-Her2 (4D5) gamma nucleotide sequence
SEQ ID No 13: anti-Her2 (4D5) gamma amino acid sequence
SEQ ID No 14: anti-Her2 (4D5) gamma_K274amber nucleotide sequence
SEQ ID No 15: anti-Her2 (4D5) gamma_K274amber amino acid sequence
SEQ ID No 16: anti-Her2 (4D5)Kappa nucleotide sequence
SEQ ID No 17: anti-Her2 (4D5)Kappa amino acid sequence
DETAILED DESCRIPTION OF THE INVENTION
Definitions
The term "amide" refers to a -C(=0)-NH- linkage.
The term "carbamate" refers to a -0-C(=0)-NH- linkage.
The term "ester" refers to a -C-C(=0)-0-C linkage
The term "alkyl" refers to an aliphatic linkage or substituent, typically containing 1-6 e.g. 1-4 carbon atoms and can be straight chain or branched. Examples include methyl, ethyl, n-propyl, i- propyl, n-butyl and t-butyl.
The term "alkoxy" refers to the group -O-alkyl.
The term "alkenyl", "alkene" or "olefin" refers to an aliphatic linkage or substituent, typically containing 2-6 e.g. 2-4 carbon atoms and can be straight chain or branched and which is unsaturated in respect of containing at least one C=C moiety. Examples include ethenyl, propen- 1-yl, propen-2-yl, and 2-methyl-propen-2-yl. An alkenyl group may be optionally substituted e.g. by one or more (e.g. 1) substituents such as halogen (e.g. CI) or an ether group (e.g. -0-Ci_6alkyl) although suitably it is not substituted. The term "alkynyl" or "alkyne" refers to an aliphatic linkage or substituent, typically containing 2-6 e.g. 2-4 carbon atoms and can be straight chain or branched and which is unsaturated in respect of containing at least one C≡C moiety. Examples include -C≡CH and -C≡C-CH3. An alkynyl group may be optionally substituted e.g. by one or more (e.g. 1) substituents such as halogen (e.g. CI) or an ether group (e.g. -0-Ci_6alkyl) although suitably it is not substituted.
The term "cycloalkyi" refers to a n alicyclic and unsaturated compound typically containing 3 to 8 cyclic carbon atoms. Cycloalkyi groups may containing branching. The total number of carbon atoms will typically be 3 to 10. Exemplary groups include cyclopropyl, cyclobutyl, cyclopentyl, 3- methyl-cyclopropyl and cyclohexyl.
The term "cycloalkenyl" refers to an alicyclic compound typically containing 5 to 8 cyclic carbon atoms and containing at last one C=C moiety. Cycloalkenyl groups may containing branching. The total number of carbon atoms will typically be 5 to 10. Exemplary groups include cyclopentenyl, 3-methyl-cyclopropenyl and cyclohexenyl.
The term "heterocyclyl" refers to a cycloalkyi or cycloalkenyl moiety in which the ring contains one or more (e.g. one, two or three, such as one or two, especially one) heteroatom selected from O, N and S. Examples include azetidine, pyrrolidine, piperidine, piperazine, N-methylpiperazine, morpholine and thiomorpholine.
The term "aryl" refers to an aromatic ring structure that can be part of a linkage or part of a substituent. Aryl moieties may contain one ring (e.g. phenyl) or two rings (e.g. naphthyl). Aryl groups may be substituted e.g. by one or more (e.g. one or two, such as one) substituent selected from alkyl, alkenyl, alkynyl, fluoroalkyl, halogen, alkoxy, nitro and cyano. An exemplary aryl is phenyl.
The term "heteroaryl" refers to a heteroaromatic ring structure that can be part of a linkage or part of a substituent. The heteroaromatic ring may contain 1-4 (more usually 1-3 e.g. one or two) heteroatoms selected from O, N and S. Heteroaryl moieties may contain one ring or two rings.
Example groups containing one 6 membered ring include pyridine and pyrimidine. Example groups containing one 5 membered ring include pyrrole, furan, thiophene, oxazole, thiazole, diazole, thiadiazole and tetrazole. Heteroaryl moieties that contain two rings may contain heteroatoms in one or both rings. Examples include quinoline and isoquinoline. Heteroaryl groups may be substituted e.g. by one or more (e.g. one or two, such as one) substituent selected from alkyl, alkenyl, alkynyl, fluoroalkyl, halogen, alkoxy, nitro and cyano.
The term "aromatic halide" refers to an aromatic ring (typically phenyl) which is substituted by at least one (e.g. one) halo group such as fluorine, chloride, bromide or iodine. Said aromatic ring may contain further substituents e.g. those mentioned for a ryl.
The term "azide" and "azido" refers to a N=N(+)=N(-) functional group. The term "cycloalkyne" refers to a cyclic arrangement of carbon atoms (typically 6-9 membered, especially 8-9 membered) which includes a carbon-carbon triple bond captured in the ring structure. Examples include cyclooctyne and cyclononyne. A further example is benzyne.
Cycloalkyne groups may containing branching. The total number of carbon atoms will typically be 6 to 12 e.g. 6 to 10.
The term "ketone" refers to a C-C(=0)-C linkage.
The term "pyrrolysine analog" means an amino acid derivative recognized by either native or genetically evolved PylRS and incorporated into proteins at an amber codon site.
The expression "the side chain of one of the 20 natural amino acids" refers to the group R in the formula HOOC-CHR-NH2 relating to the 20 natural amino acids known by their single letter codes A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W and Y. Either L or S stereochemistry (or a mixture thereof) is intended, although L stereochemistry is preferred.
The present invention discloses pyrrolysine analogs.
Some pyrrolysine analogs of the resent invention have the structure of Formula V:
Figure imgf000006_0001
Formula V
wherein
Z = bond, CH2, CH-NH2, CH-OH, NH, O, S or CH-NH2;
b is 0 or an integer 1-7; and
FG = azide, alkene, alkyne, ketone, ester, aryl or cycloalkyne.
In formulae V when FG represents aryl, an example is aromatic halide e.g. 4-halo phenyl such as 4- iodo phenyl.
Moiety Z(CH2)bFG may, for example, represent CO-aryl e.g. CO-phenyl or -COalkyl e.g. - COMe. Exemplary compounds of formula V are the following:
(2S)-2-amino-6-{[(2-azidoethoxy)carbonyl]amino}hexanoic acid
Figure imgf000006_0002
Formula V.l;
(2S)-2-amino-6-{[(prop-2-yn-l-yloxy)carbonyl]amino}hexanoic acid
Figure imgf000007_0001
Formula V.2;
(2S)-2-amino-6-{[(prop-2-en-l-yloxy)carbonyl]amino}hexanoic acid
Figure imgf000007_0002
Formula V.3;
(2S)-2-amino-6-(3-azidopropanamido)hexanoic acid
Figure imgf000007_0003
Formula V.4;
(2S)-2-amino-6-(pent-4-enamido)hexanoic acid
Figure imgf000007_0004
Formula V.5. -2-amino-6((2-oxo-2-phenylacetamide)hexanoic acid
Figure imgf000007_0005
(S)-2-amino-6((2-oxo-2-propanamide)hexanoic acid HO
NH2 C
Formula V.7; and
(2S)-2-amino-6-(2-azidoacetamido)hexanoic acid
Figure imgf000008_0001
Formula V.8
Alternative pyrrolysine analogs suitable for use as non natural amino acids in the present invention have the structure of Formula VI:
Figure imgf000008_0002
Formula VI
wherein
Z = CH2, CH-NH2, CH-OH, NH, 0 or S;
FG = azide, alkene, alkyne, ketone, ester, aryl or cycloalkyne; and
b = an integer 1-4.
In formulae VI when FG represents aryl, an example is aromatic halide e.g.4-halo phenyl such as 4-iodo phenyl.
Suitbly Z represents NH. In another embodiment it represents CH.
b may, for example, represent 1 or 2.
FG may, for example, represent -N3, -CH=CH2, -C≡CH, -COCH3, COOCH3, phenyl substituted by halogen or cyclooctyne.
Exemplary compounds of Formula VI are:
(2S)-2-amino-6-{[(2-azidoethyl)carbamoyl]oxy}hexanoic acid
Figure imgf000008_0003
Formula VI.1;
(2S)-2-amino-6-{[(prop-2-yn-l-yl)carbamoyl]oxy}hexanoic acid
Figure imgf000009_0001
Formula VI.2; and
(2S)-2-amino-6-{[(prop-2-en-l-yl)carbamoyl]oxy}hexanoic acid
Figure imgf000009_0002
Formula VI.3
In structures of formulae V and VI, when FG represents alkene, it suitably represents -CH=CH2 or - CH=CH-CH3, preferably -CH=CH2.
In structures of formulae V and VI, when FG represents alkyne, it suitably represents -C≡CH or - C≡C-CH3, preferably -C≡CH.
In structures of formulae V and VI, when FG represents ketone, it suitably represents -C(=0)-CH3 or -C(=0)-CH2-CH3, preferably -C(=0)-CH3.
In structures of formula VI, when FG represents ketone it may, for example, represent -C(=0)-aryl e.g. -C(=0)-phenyl.
In structures of formulae V and VI, when FG represents ester, it suitably represents -C(=0)-Oalkyl e.g. -C(=0)-Omethyl.
In structures of formulae V and VI, when FG represents aromatic halide, it suitably represents phenyl substituted by halogen, especially iodine (e.g. 4-iodo-phenyl).
In structures of formulae V and VI, when FG represents cycloalkyne, it suitably represents cyclooctyne, e.g. cyclooct-4,5-yne.
Advantageously, the nnAAs of formulas V and VI of the present invention have been shown to have good incorporation as demonstrated by GFP assay. Formula VI.1 had a similar level of translational compentency to Formula V.l in the GFP assay incorporation assay. Both the Formula V and VI are easily modified to incorporate a variety of useful functional groups which can be used for site selective post translational modification. Alkynes and alkenes are readily incorporated. The pyrrolysine analogs disclosed herein can be made using various methods. The reaction conditions can generally be determined by one of the ordinary skill in the art.
Formula V analogs are readily prepared by the addition of an activated carbonyl group, such as a chloroformate, activated carboxylic acid ester, isocyanate, activated carbonate or sulfonyl halide to a mono-protected diamino substrate of type 1, in which the a-amino group is protected by a protecting group ("PG") such as a Boc, Cbz, TFA, Acetyl or Fmoc group (see Scheme 1). The coupled product 3 can undergo further modifications, such as the displacement of halides with an azido nucleophile to install the desired functionality. Otherwise, the intermediate 3 is deprotected to remove the a-amino acid masking group to afford the desired Formula V analog. Scheme 1:
Figure imgf000010_0001
. or ac va e car oxy ac
1) Additional modificiations if necessary
Figure imgf000010_0002
Formula VI analogs were prepared by conjugation of hydroxyl amino acids 9 to substrates with activated carbonyls such as carboxylic acid ester, isocyanate, acid chlorides, activated carbonates or sulfonyl halides. The coupled product 11 can undergo further modifications, such as the installation of the azide functional group by displacement of leaving groups such as halides or activated alcohols. The desired amino acid analog 12 is obtained by final deprotection to remove the a-amino acid masking group. Protecting groups may be used as per Scheme 1. See Scheme 2
Figure imgf000011_0001
Figure imgf000011_0002
incorporation of non-natural amino acid into proteins
The pyrrolysine analogs disclosed herein can be incorporated into recombinant proteins. In particular, site specific incorporation of the analog into a recombinant protein can be achieved through amber suppression, wherein a nonsense (amber) codon is inserted within the nucleotide sequence encoding the recombinant protein, at a site where the pyrrolysine analog is to be inserted. The mutated nucleotide sequence, along with one or more plasmids encoding the PylRS and tRNApyl are inserted into a cell of a cell free expression system.
The host cell may be a eukaryotic cell line which is transformed with a vector comprising a DNA construct as aforesaid.
Alternatively, a cell-free expression system is provided, wherein a synthesis reaction lysate obtained from a host cell comprises at least one component required for the synthesis of polypeptides. The synthesis reaction lysate is obtained from bacterial or eukaryotic cells.
Preferably, the synthesis reaction lysate is obtained from eukaryotic cells, more preferably, from rabbit reticulocytes or wheat germ.
Preferably, the cell-free expression system is capable of expressing WT PylRS and tRNApyl of the present invention, wherein tRNApyl is introduced into the cells used to obtain the synthesis reaction lysate with DNA constructs of the invention.
Cell-free expression systems suitable for use in the present invention are described for instance in WO201008110, WO2010081111, WO2010083148, incorporated in their entirety herein by reference.
When the pyrrolysine analog is added to the cell or expression system, said analog is incorporated in the recombinant protein at the specified position. The nnAA and the tRNApyl are bound by the pylRS and the tRNApyl is subsequently aminoacylated with the nnAA. This tRNApyl containing an amber anticodon is released into the cytosol where in response to an amber stop codon can interact with the ribosome and the nnAA released to form a peptide bond with the growing polypeptide chain.
Recombinant proteins modified to incorporate a pyrroiysine analog of the invention include all recombinant proteins amenable to site specific post translational modifications, e.g. therapeutic proteins, for instance cytokines, antibodies and antibody derivatives (such as Fab fragments, or single chain antibodies, e.g. single chain variable fragments (scfvs)), peptides, enzymes, fusion proteins, decoy receptors, protein vaccines, protein hormones, e.g. insulin, growth factors,( e.g. human growth hormone, hGH, hGCSF, hFSH, hHCG). Further proteins modifiable with pyrroiysine analogs of the invention include diagnostic labels, imaging reagents.
Suitably, proteins may be modified site specifically to incorporate one or more than one nnAA (pyrroiysine analog) of the invention. For instance, an antibody may incorporate a nnAA of the invention at the heavy chain, or at the light chain, or at both light and heavy chain.
Site specific conjugation of proteins with incorporated non-natural amino acids
Proteins having incorporated pyrroiysine analogs of the present invention may be used for the preparation of functionalized protein conjugates. Molecules that may be conjugated to proteins having incorporated non-natural amino acids include (i) other proteins, e.g. antibodies especially monoclonal antibodies; (ii) polymers e.g. PEG groups or other groups that may cause half life extension in the system; (iv) cytotoxic agents e.g. Auristatin F; and (v) drug moieties e.g.
doxorubicin and moieties containing radioactive isotopes. Moreover these modified proteins can be conjugated to drugs or nucleotides for targeted delivery of these potent compounds.
More details of certain embodiments are given below in the discussion of antibody drug conjugates.
Pyrroiysine analogs may conveniently contain a unique chemical group permitting conjugation in a targeted fashion without risk of side reaction with other amino acids. For example non-natural amino acids may contain azide or alkyne groups permitting reaction with a molecule to be conjugated which contains a corresponding alkyne or azide group using the Huisgen 1,3-dipolar cycloaddition reaction.
Preferred conjugation chemistries of the invention include reactions which are orthogonal to the natural twenty amino acids. Such reactions do not interact or cause side reactions with the native 20 amino acids, they are specific to the functional groups associated with the reaction. Suitably the necessary functional groups are incorporated into the target protein via the pyrroiysine analogs of the present invention. Further, said reactions proceed under conditions which are not destructive to the protein, for instance aqueous solvents, with a pH range which is acceptable to the protein and maintains its solubility, at a temperature which does not lead to deleterious effects upon the protein.
Increasing the stability of the attachment moiety between the protein and the linker can be advantageous. Conventional methods conjugate to the thiol groups of cysteine by reaction with a maleimide forming a thiol ether. The thiol ether can undergo the reverse reaction releasing the linker drug derivative from the antibody. In an embodiment of the invention, the conjugation chemistry employed between an azide and an alkyne results in an aromatic triazole which is significantly more stable, and not as prone to reversibility.
In addition, the product of the reaction, the linkage between protein and payload, ought to be stable, equal to or greater than the stability associated with conventional linkages (amide, thiol ether). Though not an impediment to conjugation, it is often advantageous if the conjugation reactions can be done under native conditions, as this will eliminate an extra refolding processing step.
Preferred chemical conjugations for production of conjugates of the invention include : a 3+2 alkyne-azide cycloaddition, 3+2 dipolar cycloaddition, Husigen 3+2 cycloaddition, Copper promoted azide-alkyne cycloaddition (CuAAC), Ruthenium promoted azide alkyne cycloaddition (RAAC), metal promoted azide alkyne cycloaddition (MAAC), and strain promoted azide alkyne cycloaddition (SPAAC), palladium based couplings including the Heck reaction, Sonogashira reaction Suzuki reaction Sti lie coupling Hiyama/Denmark reaction olefin metathesis Diels-alder reaction carbonyl condensation with hydrazine, hydrazide, alkoxy amine or hydroxyl amine; strain promoted cycloadditions with nitriles and nitrile oxides,; electron promoted cycloaddition;
fragment extrusion cycloaddition; alkene cycloaddition followed by a β-elimination reaction.
According to one preferred embodiment, the incorporated amino acid contains an azide or an alkyne group and the process of chemical modification comprises reacting said azide or alkyne group with a reagent comprising an alkyne or azide group. The envisaged reaction is a Huisgen 1,3-dipolar cycloaddition reaction which leads to production of a triazole linkage. The reagent comprising an alkyne or azide group may be a protein (e.g. an antibody) or a cytotoxic agent or a drug or a substance suitable for half life extension (e.g. a PEG group) which carries an alkyne or azide group optionally via a linker.
Optionally, the Huisgen 1,3-dipolar cycloaddition reaction can be performed in the presence of Cu(l) catalysis.
Preferably, copper catalyzed cycloaddition reactions are carried at room temperature, in acqueous solution in presence of cysteine and tris[(l-benzyl-lH-l,2,3-triazol-4-yl)methyl]amine (TBTA). Alternatively, the copper catalyzed cycloaddition reactions are carried out from 4°C to 50°C in aqueous solution in the presence of sodium ascorbate and tris(3- hydroxypropyltriazolylmethyl)amine (THPTA). The reactions can also be carried out in mixed aqueous/organic solution with the organic component consisting of DMSO, DMF, methanol, ethanol, i-butanol, trifluoroethanol, propylene glycol, ethylene glycol and hexylene glycol.
In a variant reaction, the incorporated amino acid contains an azide or an alkene group and the process of chemical modification comprises reacting said azide or alkene group with a reagent comprising an alkene or azide group. The reagent comprising an alkene or azide group may be a protein (eg an antibody) or a toxin or a substance suitable for half life extension (eg a PEG group) which carries an alkyne or alkene group optionally via a linker.
The site specific conjugations between the incorporated nnAA and the target payioad can be done with fully folded proteins such as antibodies, antibody fragments, and cytokines. Alternatively, the conjugation can be done on denatured proteins in the presence of denaturants such as sodium dodecylsulfate and urea. The copper catalyzed azide alkyne addition can be done in the presence of denaturants and reducing agents such as dithiothreitol and 2-mercaptoethanol.
When more than one nnAA is incorporated into a target protein (e.g. an antibody), the chemical modification may be the same or different. For example if two nnAAs are incorporated, one may be modified to be conjugated to a drug moiety and one may be modified to be conjugated to a PEG moiety.
Conveniently, upon incorporation of more than one nnAA of the invention bearing different but complementary reactive groups, said nnAAs can react with each other to generate an
intramolecular link.
In an embodiment, conjugation chemistry of the invention is used for preparing an antibody drug conjugate. The conjugation chemistry may also be used to assemble antibody-protein conjugates, protein protein conjugates such as bispecifics composed of antibody fragments. The conjugation chemistry may also be used to conjugate polymer bond drug conjugates to targeting agents such antibodies and antibody fragments. The conjugation chemistry can also be used to attach polymers such as PEG to proteins to manipulate pharmacokinetic properties.
PEG moieties
Target proteins may be conjugated to PEG moieties. PEG moieties may be incorporated into antibody drug conjugates. The PEG moiety may typically have a molecular weight ranging between 0.5 kDa and 40 kDa e.g. 5kDa and 40 kDa. More preferably, the PEG moiety may have a molecular weight of around 20 kDa. In addition, the PEG moieties can have a molecular weight range from 100 - 2000 Da. PEG moieties may be straight chain or branched or multi armed
The PEG moieties can be functionalized with terminal alkynes, azides, cyanides, cycloalkynes, alkenes, aryl halides. The PEG can be functionalized in such as way as to be monofunctional, homobifunctional, heterobifunctional, and multi-homofunctional. Antibody Drug Conjugates (ADCs)
Pyrrolysine analogs according to the invention are particularly useful for production of Antibody Drug Conjugates (recombinant antibody covalently bound by a synthetic linker to a given drug, typically a cytotoxic drug, or else a protein or a PEG group) which are homogeneous nature, in which the number of drugs (or other conjugated molecule) per antibody and position of those drugs upon the antibody are explicitly controlled, whereby monoclonal antibodies containing incorporated non-natural amino acids are obtained and site specifically conjugated to a linker carrying a drug moiety (or other conjugated molecule) through orthogonal chemistry.
ADCs obtained with pyrrolysine analogs of the present invention may be manufactured following methods including the following steps:
1. Introducing into a stable cell line of the invention one or more plasmids carrying the DNA sequence coding for a full length antibody, whereby a stop codon is introduced at specific positions within the sequence
2. Purify the modified antibody with the pyrrolysine analog (nnAA) installed at desired position(s).
3. React a cytotoxin-linker derivative modified to include a functional group complimentary to the nnAA installed in the antibody with the modified antibody containing a complementary reactive group through an orthogonal chemistry
4. Purify the resulting ADC
Thus, the present invention also provides ADCs whereby the antibody component has been modified to incorporate non natural amino acids bearing a unique reactive functional group at desired positions, whereby such functional group allows conjugation to a drug moiety (or protein or PEG group).
In an embodiment the present invention provides an antibody conjugate comprising an anti-Her-2 antibody which is conjugated to one or more moieties (e.g. one, two, three or four, preferably one or two, especially one) selected from protein, drug and PEG moieties via linkers comprising a triazole moiety.
In particular, the triazole moiety may be formed by reaction of an azide or alkyne moiety in the side chain of a non-natural amino acid incorporated into the sequence of the anti-Her-2 antibody and an alkyne or azide moiety attached to the protein, drug or PEG moiety.
In one embodiment, the triazole moiety is formed by reaction of an azide or alkyne moiety in the side chain of a non-natural amino acid incorporated into the sequence of the anti-Her-2 antibody and an alkyne or azide moiety attached to the protein, drug or PEG moiety under conditions of Cu(l) catalysis. Cu(l) catalysis is accomplished by using either a native Cu(l) source such as copper iodide, copper bromide, copper chloride, copper thiolate, copper cyanide. The Cu(l) species can also be generated in situ by using a copper (II) source and a reducing agent. The copper (II) source can be copper sulfate, copper (II) chloride, or copper acetate. The reducing agent can be sodium ascorbate, dithiothreitol, TCEP, b-mercaptoethanol, hydrazine, hydroxylamine, sodium bisulfite, cystamine and cysteine.
Suitably, Cu(l) catalyzed cycloaddition are carried out in presence of ligands to stabilize the Cu(l) species present at the start of the reaction or generated in situ by reduction of a Cu(ll) source such as sodium sulfate with sodium ascorbate, including TBTA, THPTA, phenanthroline derivatives, pyridylmethanimine derivatives, diethylenetriamine, bipyridine derivatives, TMEDA, N,N-bis(2- pyridylmethyl)amine (BPMA) derivatives,N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (TPEN) derivatives, trialkylamines such as triethylamine, diisopropyl ethylamine, HEPES and MES.
In one embodiment a copper azide alkyne cycloaddition is used for the conjugation. Suitably, the reaction utilizes a a cytotoxic agent such as auristatin, amanitin, taxol or doxorubicin bearing a terminal alkyne. Further, the reaction employs a copper source such as copper sulfate, copper acetate, copper iodide or copper bromide; a reducing agents such as sodium ascorbate, hydrazine, hydroxylamine, sodium bisulfite, dithiothreitol, cysteine, b-mercaptoethanol;a copper chelating ligand such as Tris[(l-benzyl-lH-l,2,3-triazol-4-yl)methyl]amine (TBTA) or Tris(3- hydroxypropyltriazolylmethyl)amine (THPTA). Suitably, the reaction may be performed at 4 - 50°C. Suitably, the reaction time ranges from 0.5 to 48 hrs. In an alternative embodiment, a strain promoted azide alkyne cycloaddition is used for conjugation. Suitably, the reaction utilizes a dye, a PEG polymer, or cytotoxic agent such as auristatin bearing a cycloocytne group. Suitably, the reaction is allowed to incubate at room temperature for 0.5 - 48h.
Drug moieties
Drug moieties of the present invention, such as cytotoxin drug moieties, include small molecules, natural products, synthetically derived drugs, proteins such as immunotoxins, and radionuclides.
In an embodiment, the drug moietyis an auristatin moiety eg auristatin or a derivative thereof such as monomethyl auristatin E (MMAE)(Vedotin) or monomethyl auristatin F (MMAF),
Auristatin F (AF), amanitin, Paclitaxel and doxorubicin.
Other drug moieties include maytansine, paclitaxel, doxorubicin and immunotoxins such as exotoxin or bouganin as well as radionuclides such as lodine-131, Yttrium-90,Samarium-135, and Strontium-89 which may also be incorporated into organic molecules. (see for instance: MMAE: Senter, PE, et. a I, BLOOD, 102, 1458-1465. MMAF : Senter, PE, et. al., Bioconj. Chem. 2006, 17, 114-124. Maytansine : Lewis-Phillips GD, Cancer Res., 63, 9280-9290, 2008. Bouganin :MacDonald GC, et. al, J. lmmunotherapy,32 574-84, 2009. Most suitably the drug moiety is a moiety selected from a doxorubicin, paclitaxel and auristatin moiety.
Salts
Pyrrolysine analogues described herein may optionally be employed in the form of a salt. Any such salts form an aspect of the invention. Salts of carboxylic acids may include salts formed with Group 1 and Group 2 metals, especially soluble salts such as sodium and potassium salts. Salts of amines may include salts formed with weak and strong acids, such as HCI, HBr or acetic acid.
EXAMPLES
Example 1. Preparation of Formula V and VI analogs
Preparation of (2S)-2-amino-6-(pent-4-enamido)hexanoic acid (Formula V.5)
Figure imgf000017_0001
Figure imgf000017_0002
In a 25mL roundbottomed flask was placed N-Boc-Lysine (500mg, 2.0mmol) suspended in dioxane (lOmL). 1M K2C03 was added (5mL) and the solution was cooled to OC. 4-pentenoyl chloride (224uL, 2.0mmol) in dioxane (2mL) was added slowly. The solution was allowed to stir at OC for lh and then at room temperature for 4h. The solution was transferred to a extraction funnel and partitioned between water and ether. The organic layer was removed and the aqueous layer made acidic (pH=2) with citric acid. The aqueous layer was extracted with ethyl acetate (3x50mL), the organic layers combined and dried over sodium sulfate, filtered and concentrated. The resulting residue was carried forward into the next step.
The crude N-Boc-s-N-4-pentenoyl amide-lysine was placed in a 50mL round bottomed flask with acetonitrile (5mL) and TFA (2mL) and magnetically stirred for 2h. The mixture was concentrated. The solution was treated with toluene (lOmL) and concentrated (2X) and acetonitrile (lOmL) and concentrated (2X). The residue was dried overnight under vacuum. The residue was taken up in MeOH and precipitated with methyl-t-butyl ether. The viscous oil was isolated by centrifugation, the supernatant was disposed. Analytical MS : m/z (ES+) expected 229.2 (M+H)+, found 230.3. Preparation of Preparation of (S)-2-amino-6((2-oxo-2-phenylacetamide)hexanoic acid (Formula V.6)
Figure imgf000018_0001
In a 50mL round bottomed flask with magnetic stirrer was dissolved pyruvic acid (3.5g, 23.3mmol) in a 2:1 mixture of dichloromethane and DMF (20mL). To this mixture was added DCC (5.7g, 27.6mmol) and NHS (3.2g, 27.6mmol). The mixture was heated to 50C for 30min with stirring. The solution was allowed to cool and then added through a filter to a suspension of N-Boc-Lysine (5.2g, 21.2mmol) in DMF (20mL) in a separate lOOmL round bottomed flask with magnetic stirrer. Triethyl amine (8.8mL, 63.6mmol) was added after addition of the activated ester, and the mixture was stirred overnight. The mixture was partitioned between ethyl acetate and citric acid. The layers were separated and the aqueous layer was extracted 4 times with ethyl acetate. The organic layers were combined, dried over sodium sulfate and concentrated. The resulting residue was further purified by flash chromatography to afford the final N-Boc lysine derivative as an oil. In a lOOmL roundbottomed flask was placed the keto-N-Boc lysine derivative (4g, 10.6mmol) in acetonitrile (50mL). To this was added a solution of hydrochloric acid (15mL, 4N in dioxane). The solution was stirred for 2h and concentrated. Final purification by flash chromatography afforded the target amino acid. Analytical MS : m/z (ES+) expected 278.1 (M+H)+, found 279.2.
Preparation of (2S)-2-amino-6-(2-azidoacetamido)hexanoic acid (Form
Figure imgf000019_0001
In a 25mL roundbottomed flask was placed N-Boc-Lysine (500mg, 2.0mmol) suspended in dioxane (5mL). Saturated NaHC03 was added (2mL) and the solution was cooled to 0°C. Bromoacetyl chloride (169uL, 2.0mmol) in dioxane (2mL) was added slowly. The solution was allowed to stir at 0C for lh and then at room temperature for 4h. The solution was transferred to a extraction funnel and partitioned between water and ether. The organic layer was removed and the aqueous layer made acidic (pH=2) with citric acid. The aqueous layer was extracted with ethyl acetate (3x50mL), the organic layers combined and dried over sodium sulfate, filtered and concentrated. The resulting residue was carried forward into the next step.
In a 50mL round bottomed flask was placed the crude N-Boc-£-2-bromoacetyl-lysine (740mg, 2.0mmol) in dioxane (lOmL). To this was added a solution of sodium azide (lOmL, 1M). The solution was stirred at 60°C overnight. The mixture was partitioned between citric acid (1M, 50mL) and ethyl acetate (lOOmL). The organic layer was retained, and the aqueous layer extracted 3 additional times. The organic layers were combined, dried over sodium sulfate and concentrated to an oil.
The crude N-Boc-£-2-azido-acetyl-lysine was dissolved in acetonitrile (lOmL) and TFA (2mL) was added. The mixture was stirred for 2h and then concentrated. The solution was treated with toluene (lOmL) and concentrated (2X) and acetonitrile (lOmL) and concentrated (2X). The residue was dried overnight under vacuum. The residue was taken up in MeOH and precipitated with methyl-t-butyl ether. The viscous oil was isolated by centrifugation, the supernatant was disposed. Analytical MS : m/z (ES+) expected 229.1 (M+H)+, found 230.2.
Preparation of Hydroxy - Norleucine derivatives (Formula VI.1 and Formula VI.2)
Figure imgf000019_0002
In a lOOmL roundbottomed flask with magnetic stirring was placed N-Boc-Hydroxyl Norleucine (lg, 4.1mmol) and acetonitrile (50mL). The mixture was cooled to 0°C and p- nitrophenylchloroformate (979mg, 4.9mmol) and Pyridine (2mL) was added and the mixture stirred overnight. The mixture was concentrated and purified by flash chromatography. (Silica, DCM/MeOH gradient).
Figure imgf000020_0001
H
In a lOOmL roundbottomed flask with magnetic stirring was placed 2-N-Boc-ethylbromide (lg, 4.4mmol) in 25mL of dioxane. To this was added a solution of sodium azide (1M, 22.2mmol). The solution was stirred at 60C overnight. The mixture was partitioned between water and ethyl acetate. The ethyl acetate layer was retained and the aqueous layer was extracted with ethyl acetate three additional times. The organic layers were combined, dried over sodium sulfate and concentrated to an oil.
The oil was taken up in acetonitrile (35mL) and HCL in dioxane was added (4M, lOmL). The mixture was stirred for two hours and concentrated under vacuum.
Preparation of (2S)-2-amino-6-{[(2-azidoethyl)carbamoyl]oxy}hexanoic acid (Formula VI.1)
Figure imgf000020_0002
In a 50mL round bottomed flask was placed the N-Boc-Norleucine p-nitrophenyl carbonate (503mg, 1.2mmoL) in dioxane (lOmL). To this was added a solution of the amino-azide (105mg, 1.2mmol) in dioxane (5mL) and pyidine (lmL). The solution was stirred overnight. The mixture was partitioned between ethyl acetate and 500mM citric acid. The ethyl acetate layer was retained and the aqueous layer was extracted with ethyl acetate three additional times. The organic layers were combined, dried over sodium sulfate and concentrated to an oil. The oil was further purified by flash chromatography.
The isolated Boc-protected amino acid was taken up in acetontirile (15mL) and treated with HCI in dioxane (4M, 5mL). The mixture was stirred for two hours and concentrated under vacuum.
Alternative Preparation of (2S)-2-amino-6-[[(2-azidoethyl)carbamoyl]oxy]hexanoic acid, Formula VI.1.
Figure imgf000020_0003
Step 1 : In a 4mL vial with magnetic stirrer was placed Boc-N-6-hydroxynorleucine (50mg, leq) and DMF (ImL). To this was added 2-chloroethyl isocyanate (17.3mg, l.Oeq) and pyridine (32.3uL, 2 eq). The vial was capped and allowed to stir for 5h. The solution was transferred to a extraction funnel, diluted with ethylacetate and lOOmM citric acid. The mixture shaken and the layers separated. The aqueous layer was extracted with ethyl acetate two additional times. The organic layers combined, washed with 5% lithium chloride, dried with sodium sulfate, filtered and concentrated. The product was identified by mass spectrometry and taken forward into the next step directly.
Step 2 : In a 4mL vial with magnetic stirrer was placed the crude chloro derivative from above and DMSO (ImL). Sodium azide (130mg, 5eq) and pyridine (32.3uL, 2 eq) were added to the mixture and the vial was capped. The mixture was stirred overnight at 60°C. The mixture was transferred to an extraction funnel and diluted with lOOmM citric acid and ethyl acetate. The mixture was shaken and the layers separated. The aqueous layer was extracted with ethyl acetate two additional times. The organic layers combined, washed with 5% lithium chloride, dried with sodium sulfate, filtered and concentrated. The product was carried on to the next step.
Final Step : In a 20mL vial was placed the crude Boc protected amino acid and acetonitrile (2mL). To this was added a solution of hydrochloric acid in dioxane (4N, 2.5mL). The solution was stirred for 2h and then concentrated under reduced pressure. The mixture was lyophilized to a semi solid and used in translational testing. Analytical MS : m/z (ES+) expected 259.1 (M+H)+, found 260.2. Preparation of (2S)-2-amino-6-{[(prop-2-yn-l-yl)carbamoyl]oxy}hexanoic acid (Formula VI.2)
Figure imgf000021_0001
In a 50mL round bottomed flask was placed the N-Boc-Norleucine p-nitrophenyl carbonate (337mg, 0.8mmoL) in dioxane (lOmL). To this was added a solution of the amino-azide (135mg, 2.4mmol) in dioxane (5mL). The solution was stirred overnight. The mixture was partitioned between ethyl acetate and 500mM citric acid. The ethyl acetate layer was retained and the aqueous layer was extracted with ethyl acetate three additional times. The organic layers were combined, dried over sodium sulfate and concentrated to an oil. The oil was further purified by flash chromatography.
The isolated Boc-protected amino acid was taken up in acetontirile (15mL) and treated with HCI in dioxane (4M, 5mL). The mixture was stirred for two hours and concentrated under vacuum Preparation of (2S)-2-amino-6-{[(prop-2-en-l-yl)carbamoyl]amino}hexanoic acid, Formula VI.3.
Figure imgf000022_0001
In a 4mL vial with magnetic stirrer was placed Boc-N-6-hydroxynorleucine (50mg, leq) and DMF (1.5mL). To this was added allyl isocyanate (18.0uL, l.Oeq) and pyridine (32.3uL, 2 eq). The vial was capped and allowed to stir for 4h. The solution was transferred to an extraction funnel, diluted with ethylacetate and lOOmM citric acid. The mixture shaken and the layers separated. The aqueous layer was extracted with ethyl acetate two additional times. The organic layers were combined, washed with 5% lithium chloride, dried with sodium sulfate, filtered and concentrated. The product was identified by mass spectrometry and taken forward into the next step directly. In a 20mL vial was placed the crude hydroxyl leucine - allyl carbamate derivative in acetonitrile (2mL). To this was added a solution of hydrochloric acid in dioxane (4N, 2.5mL). The solution was stirred for 2h and then concentrated under reduced pressure. The mixture was lyophilized to a semi solid and used in translational testing. The product was confirmed by mass spectrometry. Additional purification could be done with ion exchange chromatography (DOWEX-50). Analytical MS : m/z (ES+) expected 230.1 (M+H)+, found 231.2.
Example 2. Translational testing of novel pyrrolysine analogs as nnAAs with a GFP assay.
An in vitro cell based assay was developed to assess the compatibility of the pylRS/tRNA pair and the the pyrrolysine analogs of the present invention (nnAAs) by and the efficiency of nnAAs integration into a target protein. For this, HEK293 cells stably expressing pylRS (3H7) were transiently transfected with plasmids for the expression of tRNApyl and a reporter construct encoding GFPY40 (containing amber codon in place of tyrosine at amino acid residue number 40 (where 1 is the initiator methionine)) using standard transfection protocols. Transfected cells were incubated with nnAAs at 2mM for 2-3 days GFP production was analyzed qualitatively by visual inspection under the microcope. The GFP fluorescence was quantified by flow cytometry using an Accuri flow cytometer and the geometric mean of the fluorescent cells determined.
This cell based assay was used to determine whether the different nnAAs were suitable substrates for the pylRS and allowed its translation into a target protein. Cells expressing the PylRS/tRNApyl pair and containing a vector encoding the GFPY40 reporter genewere incubated in the presence of the nnAAs. nnAAs that are readily utilized by the PylRS/tRNApyl pair support the translation of the nnAA into the amber site of GFP and allow read-through of the gene producing full length GFP (fluorescent protein). The fluorescence intensity of the cells depends on the efficiency of nnAA incorporation. Thus, nnAAs that are poorly utilized produce weakly fluorescent or non-fluorescing cells. Microscopic observation identified a number of nnAAs usable by the pylRS (Table 1, Positive GFP). Furthermore, the relative expression levels in each sample was compared to those generated by substrates known to be efficiently utilized by pylRS. Formula V.l (MFI = 931,289), Formula V.2 (MFI=1,676,250) and Formula V.3 (MFI=2,250,000) (see Table 1) supported high levels of GFP expression with a geometric mean.
Analog Formulae VI.1 and VI.3 and of the present invention were found by the inventors to be incorporated in the GFP reporter gene and yield green cells under the experimental conditions used. Among these, the analog of Formula VI.1 supported high levels of GFP expression (MFI 904206) and represents an analogue that is efficiently utilized by the pylRS/tRNA pair under the experimental conditions tested (see Table 2).
Table 1 : Formula V analog GFP results
Figure imgf000023_0001
Table 2 : Formula VI analog GFP results
Figure imgf000023_0002
Construction and expression of anti-Her2 antibody
A full length anti-Her2 antibody containing two non natural amino acids (one in each heavy chain)
(4D5-2AZ ab) was expressed in mammalian cells. A nnAA, containing an azide moiety, was incorporated at the selected sites and purified by affinity chromatography using either protein A resin (GE Healthcare) or by IgSelect (GE Healthcare, 17096901). The purified material was then concentrated and subjected to a conjugation reaction.
An antibody directed to the extracellular domain of Her2/neu was generated by cloning the variable regions of both the heavy and light chains of the mouse antibody 4D5 into vectors containing genes encoding human IgG. The variable regions of 4D5 were generated by gene synthesis using overlapping oligomers and cloned into the human IgGl frameworks encoded by pFUSE-CHIg-hGl (IgGl heavy chain;gamma) and pFUSE-CHLIg-hK (light chain; kappa; Invivogen) to generate a mouse-human hybrid. Amber codons were introduced into the heavy chain (gamma) at positions K274 by site directed mutagenesis. Clones containing the amber codon were identified by DNA sequencing. To generate an integrating construct the promoters and ORF for the heavy chain was amplified by PCR and cloned by restriction enzyme digestion and ligation into pOptivec (Life Technologies). The light chain and a single copy of the tRNA were joined by two step PCR method using overlapping oligomers and cloned into available sites into the pOptivec plasmid containing the heavy chain. The construct was then transfected into a CHO cell line containing the pylRS/tRNA pair and stably transfected cell lines showing high expression of the IgG selected. This represents a second example of a cell line stably expressing a mAb containing a nnAA indicating that the process has wide applicability for the use in the expression of mAbs. This cell line was utilized to generate IgG containing the nnAAs described above. The cells were grown to a density of 1-2 x 106 cells/mL in Excel DHFR- medium (Sigma-Aldrich) and nnAA added to culture to a final concentration of 1 mM. Cells were incubated for 5 days and IgG purified from the growth medium. Supernatants were harvested and subjected to centrifugation to collect suspended cells and other debris. The supernatant was then filtered through a 0.22um filter to remove any particulate material prior to application to a chromatography column. The filtered supernatant was applied to a lmL -5mL prepacked HiTrap protein A Sepharose at 1-5 mL/min flow rate using an AKTA chromatography system. The bound material and resin were washed with PBS to remove loosely bound proteins and the bound material eluted with lOOmM glycine (pH 3.0) at a flow rate of 1 mL/min. Peak fractions containing the target protein were neutralized with 0.1 fraction volumes of 1M Tris-HCI (pH8.0). All constructs were dialyzed to PBS at 4°C for 16 hours into the final phosphate buffer. The antibody with Formula VI.1 as nnAA incorporated into both of its heavy chains at position 274 was called "4D5-2AzAb-HC274-(2S)-2-amino-6-{[(2- azidoethyl)carbamoyl]oxy}hexanoic acid".
PEGylation of 4D5-2AzAb-HC274-(2S)-2-amino-6-{[(2-azidoethyl)carbamoyl]oxy}hexanoic acid
In a 200uL PCR tube was placed phosphate buffer (5uL, 500mM, pH=7.4). A solution of 4D5- 2AzAb-HC274-(2S)-2-amino-6-{[(2-azidoethyl)carbamoyl]oxy}hexanoic acid (Formula VI.1). (IOUL, 0.55 mg/mL) was added followed by a solution of 20KPEG cyclooctyne (3.3, 60mg/mL). The solution was mixed vigorously on a vortexer. The mixture was allowed to stand overnight. The mixture was diluted to 200uL and applied to Protein-A magnetic beads. The mixture was vortexed and allowed to rotate to mix the beads for 90min. The beads were immobilized and the run through material disposed. The beads were washed with PBS (2X) and then suspended in reducing gel buffer. Vortexed and then heated to 95C for 3min. The suspension was loaded directly onto an SDS-PAGE gel. Commassie staining of the SDS-PAGE gel indicated the selective PEGylation of the Heavy chain (Figure 1, Lane 3).
Conjugation of 4D5-2AzAb-HC274-(2S)-2-amino-6-{[(2-azidoethyl)carbamoyl]oxy}hexanoic acid with Fluoroscene dye by SPAAC.
I n a 200uL PCR tube was placed phosphate buffer (65uL, 50mM, pH=7.4). A solution of 4D5- 2AzAb-HC274-(2S)-2-amino-6-{[(2-azidoethyl)carbamoyl]oxy}hexanoic acid (30uL, 0.55 mg/mL) was added followed by a solution DMCO-Fluor 488 cyclooctyne (5.4, 5mM in DMSO, click chemistry tools). The solution was mixed vigorously on a vortexer. The mixture was allowed to stand for 24h. The mixture was analyzed by HIC chromatography (Tosoh TSKgel Butyl NPR with a gradient of 1M Sodium sulfate to phosphate buffer) showing the conjugation had occurred and resulted in a mixture wherein conjugation had occurred at one or two sites (generally referred to as DAR1 and DAR2 species; wherein DAR is defined as drug-to-antibody ratio) (Figure 2).
SEQUENCE LISTI NG SEQ ID NO 1
PylRS Methanosarcina mazei WT nucleotide sequence
ATGGATAAAAAACCACTAAACACTCTGATATCTGCAACCGGGCTCTGGATGTCCAGGACCGGAACAATTC ATAAAATAAAACACCACGAAGTCTCTCGAAGCAAAATCTATATTGAAATGGCATGCGGAGACCACCTTGT TGTAAACAACTCCAGGAGCAGCAGGACTGCAAGAGCGCTCAGGCACCACAAATACAGGAAGACCTGCAAA CGCTGCAGGGTTTCGGATGAGGATCTCAATAAGTTCCTCACAAAGGCAAACGAAGACCAGACAAGCGTAA AAGTCAAGGTCGTTTCTGCCCCTACCAGAACGAAAAAGGCAATGCCAAAATCCGTTGCGAGAGCCCCGAA ACCTCTTGAGAATACAGAAGCGGCACAGGCTCAACCTTCTGGATCTAAATTTTCACCTGCGATACCGGTT TCCACCCAAGAGTCAGTTTCTGTCCCGGCATCTGTTTCAACATCAATATCAAGCATTTCTACAGGAGCAA CTGCATCCGCACTGGTAAAAGGGAATACGAACCCCATTACATCCATGTCTGCCCCTGTTCAGGCAAGTGC CCCCGCACTTACGAAGAGCCAGACTGACAGGCTTGAAGTCCTGTTAAACCCAAAAGATGAGATTTCCCTG AATTCCGGCAAGCCTTTCAGGGAGCTTGAGTCCGAATTGCTCTCTCGCAGAAAAAAAGACCTGCAGCAGA TCTACGCGGAAGAAAGGGAGAATTATCTGGGGAAACTCGAGCGTGAAATTACCAGGTTCTTTGTGGACAG GGGTTTTCTGGAAATAAAATCCCCGATCCTGATCCCTCTTGAGTATATCGAAAGGATGGGCATTGATAAT
GATACCGAACTTTCAAAACAGATCTTCAGGGTTGACAAGAACTTCTGCCTGAGACCCATGCTTGCTCCAA ACCTTTACAACTACCTGCGCAAGCTTGACAGGGCCCTGCCTGATCCAATAAAAATTTTTGAAATAGGCCC ATGCTACAGAAAAGAGTCCGACGGCAAAGAACACCTCGAAGAGTTTACCATGCTGAACTTCTGCCAGATG GGATCGGGATGCACACGGGAAAATCTTGAAAGCATAATTACGGACTTCCTGAACCACCTGGGAATTGATT TCAAGATCGTAGGCGATTCCTGCATGGTCTATGGGGATACCCTTGATGTAATGCACGGAGACCTGGAACT TTCCTCTGCAGTAGTCGGACCCATACCGCTTGACCGGGAATGGGGTATTGATAAACCCTGGATAGGGGCA GGTTTCGGGCTCGAACGCCTTCTAAAGGTTAAACACGACTTTAAAAATATCAAGAGAGCTGCAAGGTCCG AGTCTTACTATAACGGGATTTCTACCAACCTGTAA SEQ ID NO 2
PylRS, Methanosarcina mazei WT amino acid sequence
M DKKPLNTLISATGLWMSRTGTIHKI KHHEVSRSKIYIEMACGDHLVVNNSRSSRTARALRHHKYRKTCK RCRVSDEDLNKFLTKANEDQTSVKVKVVSAPTRTKKAM PKSVARAPKPLENTEAAQAQPSGSKFSPAI PV STQESVSVPASVSTSISSISTGATASALVKGNTNPITSMSAPVQASAPALTKSQTDRLEVLLNPKDEISL NSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEI KSPILI PLEYIERMGI DN DTELSKQI FRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKI FEIGPCYRKESDGKEHLEEFTM LNFCQM GSGCTRENLESI ITDFLNHLGI DFKIVGDSCMVYGDTLDVM HGDLELSSAVVGPIPLDREWGIDKPWIGA GFGLERLLKVKHDFKN IKRAARSESYYNGISTNL SEQ ID NO 3
PylRS Methanosarcina mazei Y384F mutant nucleotide sequence
ATGGATAAAAAACCACTAAACACTCTGATATCTGCAACCGGGCTCTGGATGTCCAGGACCGGAACAATTC ATAAAATAAAACACCACGAAGTCTCTCGAAGCAAAATCTATATTGAAATGGCATGCGGAGACCACCTTGT TGTAAACAACTCCAGGAGCAGCAGGACTGCAAGAGCGCTCAGGCACCACAAATACAGGAAGACCTGCAAA CGCTGCAGGGTTTCGGATGAGGATCTCAATAAGTTCCTCACAAAGGCAAACGAAGACCAGACAAGCGTAA AAGTCAAGGTCGTTTCTGCCCCTACCAGAACGAAAAAGGCAATGCCAAAATCCGTTGCGAGAGCCCCGAA ACCTCTTGAGAATACAGAAGCGGCACAGGCTCAACCTTCTGGATCTAAATTTTCACCTGCGATACCGGTT TCCACCCAAGAGTCAGTTTCTGTCCCGGCATCTGTTTCAACATCAATATCAAGCATTTCTACAGGAGCAA CTGCATCCGCACTGGTAAAAGGGAATACGAACCCCATTACATCCATGTCTGCCCCTGTTCAGGCAAGTGC CCCCGCACTTACGAAGAGCCAGACTGACAGGCTTGAAGTCCTGTTAAACCCAAAAGATGAGATTTCCCTG AATTCCGGCAAGCCTTTCAGGGAGCTTGAGTCCGAATTGCTCTCTCGCAGAAAAAAAGACCTGCAGCAGA TCTACGCGGAAGAAAGGGAGAATTATCTGGGGAAACTCGAGCGTGAAATTACCAGGTTCTTTGTGGACAG GGGTTTTCTGGAAATAAAATCCCCGATCCTGATCCCTCTTGAGTATATCGAAAGGATGGGCATTGATAAT GATACCGAACTTTCAAAACAGATCTTCAGGGTTGACAAGAACTTCTGCCTGAGACCCATGCTTGCTCCAA ACCTTTACAACTACCTGCGCAAGCTTGACAGGGCCCTGCCTGATCCAATAAAAATTTTTGAAATAGGCCC ATGCTACAGAAAAGAGTCCGACGGCAAAGAACACCTCGAAGAGTTTACCATGCTGAACTTCTGCCAGATG GGATCGGGATGCACACGGGAAAATCTTGAAAGCATAATTACGGACTTCCTGAACCACCTGGGAATTGATT TCAAGATCGTAGGCGATTCCTGCATGGTCTTTGGGGATACCCTTGATGTAATGCACGGAGACCTGGAACT TTCCTCTGCAGTAGTCGGACCCATACCGCTTGACCGGGAATGGGGTATTGATAAACCCTGGATAGGGGCA GGTTTCGGGCTCGAACGCCTTCTAAAGGTTAAACACGACTTTAAAAATATCAAGAGAGCTGCAAGGTCCG AGTCTTACTATAACGGGATTTCTACCAACCTGTAA SEQ ID NO 4
PylRS Methanosarcina mazei Y384F mutant amino acid sequence
M DKKPLNTLISATGLWMSRTGTIHKI KHHEVSRSKIYIEMACGDHLVVNNSRSSRTARALRHHKYRKTCK RCRVSDEDLNKFLTKANEDQTSVKVKVVSAPTRTKKAM PKSVARAPKPLENTEAAQAQPSGSKFSPAI PV STQESVSVPASVSTSISSISTGATASALVKGNTNPITSMSAPVQASAPALTKSQTDRLEVLLN PKDEISL NSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEI KSPILI PLEYIERMGI DN DTELSKQI FRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKI FEIGPCYRKESDGKEHLEEFTM LNFCQM GSGCTRENLESI ITDFLN HLGI DFKIVGDSCMVFGDTLDVM HGDLELSSAVVGPIPLDREWGIDKPWIGA GFGLERLLKVKHDFKNI KRAARSESYYNGISTNL SEQ ID NO 5
tRNApyl Methanosarcina mazei Gol
GGAAACCTGATCATGTAGATCGAATGGACTCTAAATCCGTTCAGCCGGGTTAGATTCCCGGGGTTTCCGCC A
SEQ ID NO 6
U6 snRNA promoter
Agagggcctatttcccatgattccttcatatttgcatatacgatacaaggctgttagagagataattagaattaatttgactgtaaacacaaag atattagtacaaaatacgtgacgtagaaagtaataatttcttgggtagtttgcagttttaaaattatgttttaaaatggactatcatatgcttacc gtaacttgaaagtatttcgatttcttggctttatatatcttgtggaaaggacgaaacacc SEQ ID NO 7
U6-tRNApyl construct
Aaggtcgggcaggaagagggcctatttcccatgattccttcatatttgcatatacgatacaaggctgttagagagataattagaattaatttg actgtaaacacaaagatattagtacaaaatacgtgacgtagaaagtaataatttcttgggtagtttgcagtttttaaaattatgttttaaaatg gactatcatatgcttaccgtaacttgaaagtatttcgatttcttggctttatatatcttgtggaaaggacgaaacaccgaattctctagactcga gggaaacctgatcatgtagatcgaatggactctaaatccgttcagccgggttagattcccggggtttccggacaagtgcggtttttgttt
SEQ ID NO 8
GFP nucie!otide sequence
ATGGCCTCCAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCA GTGGAGAGGGTGAAGGTGATGCTACATACGGAAAGCTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACAC TTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCATATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAA GGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTT AATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACACAAACTCGAGTACAACTATAACTCACACAATGTAT ACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTAACTTCAAAATTCGTCACAACATTGAAGATGGATCCGTTCAACTAGCAGACC ATTATCAACAAAATACTCCAATTG G CGATG G CCCTGTCCTTTTACCAG ACAACCATTACCTGTCG ACACAATCTG CCCTTTCG AAAG ATCCC AACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATCAGGCCAAGCCTTTGTCTCAA GAAGAATCCACCCTCATTGAAAGAGCAACGGCTACAATCAACAGCATCCCCATCTCTGAAGACTACAGCGTCGCCAGCGCAGCTCTCTCTA GCGACGGCCG CATCTTCACTG GTGTCAATGTATATC ATTTTACTG G G G G ACCTTGTG CAG AACTCGTG GTG CTG G G CACTG CTG CTG CTG CGGCAGCTGGCAACCTGACTTGTATCGTCGCGATCGGAAATGAGAACAGGGGCATCTTGAGCCCCTGCGGACGGTGCCGACAGGTGCTT CTCGATCTGCATCCTGGGATCAAAGCCATAGTGAAGGACAGTGATGGACAGCCGACGGCAGTTGGGATTCGTGAATTGCTGCCCTCTGG TTATGTGTG G G AG G G CTAA
SEQ ID NO 9
GFP amino acid sequence
MASKGEELFTGVVPILVELDGDVNGH KFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRH DFFKSAMPEGYV QERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGN ILGH KLEYNYNSH NVYITADKQKNGIKANFKIRH NIEDGSVQLADHYQQNTPIG DGPVLLPDNHYLSTQSALSKDPN EKRDH MVLLEFVTAAGITHGMDQAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTGVNVYH F TGGPCAELVVLGTAAAAAAGNLTCIVAIGN EN RGILSPCGRCRQVLLDLH PGIKAIVKDSDGQPTAVGIRELLPSGYVWEG
SEQ ID NO 10
GFPY40 nucleotide sequence
ATGGCCTCCAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGATGGTGATGTTAATGGGCACAAATTTTCTGTCA GTGGAGAGGGTGAAGGTGATGCTACATAGGGAAAGCTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACAC TTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCATATGAAACGGCATGACTTTTTCAAGAGTGCCATGCCCGAA GGTTATGTACAGGAACGCACTATATCTTTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTTGTT AATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACACAAACTCGAGTACAACTATAACTCACACAATGTAT ACATCACGGCAGACAAACAAAAGAATGGAATCAAAGCTAACTTCAAAATTCGTCACAACATTGAAGATGGATCCGTTCAACTAGCAGACC ATTATCAACAAAATACTCCAATTG G CGATG G CCCTGTCCTTTTACCAG ACAACCATTACCTGTCG ACACAATCTG CCCTTTCG AAAG ATCCC AACGAAAAGCGTGACCACATGGTCCTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATCAGGCCAAGCCTTTGTCTCAA GAAGAATCCACCCTCATTGAAAGAGCAACGGCTACAATCAACAGCATCCCCATCTCTGAAGACTACAGCGTCGCCAGCGCAGCTCTCTCTA GCGACGGCCG CATCTTCACTG GTGTCAATGTATATC ATTTTACTG G G G G ACCTTGTG CAG AACTCGTG GTG CTG G G CACTG CTG CTG CTG CGGCAGCTGGCAACCTGACTTGTATCGTCGCGATCGGAAATGAGAACAGGGGCATCTTGAGCCCCTGCGGACGGTGCCGACAGGTGCTT CTCGATCTGCATCCTGGGATCAAAGCCATAGTGAAGGACAGTGATGGACAGCCGACGGCAGTTGGGATTCGTGAATTGCTGCCCTCTGG TTATGTGTG G G AG G G CTAA
SEQ ID N0 11
GFPY40 amino acid sequence
MASKGEELFTGVVPILVELDGDVNGH KFSVSGEGEGDAT*GKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDH MKRH DFFKSAMPEGY VQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGN ILGHKLEYNYNSH NVYITADKQKNGIKAN FKIRH NIEDGSVQLADHYQQNTPI GDG PVLLPDNHYLSTQSALSKDPN EKRDHMVLLEFVTAAGITHGMDQAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTGVNVYH FTGGPCAELVVLGTAAAAAAGN LTCIVAIGNENRGILSPCGRCRQVLLDLH PGIKAIVKDSDGQPTAVGIRELLPSGYVWEG SEQ ID NO 12
anti-Her2 (4D5) gamma nucleotide sequence
ATGGAGGCTCCCGCCCAGCTGCTCTTTCTGCTCCTTCTCTGGCTTCCCGACACAACCGGTGAGGTGCAGCTGGTGGAGTCTGGCGGTGGC TTGGTACAGCCGGGCGGGTCCCTGCG CCTCTCCTGTG CCG CTTCCG G ATTCAACATCAAAG ACACGTATATTCACTG G GTCCGTCAG G CAC CTGGCAAGGGTCTGGAGTGGGTGAGCCGCATTTATCCTACCAATGGTTACACTCGCTACGCCGACTCTGTGAAGGGCCGCTTCACCATCA GCGCCGACACGTCCAAGAACACCCTGTATCTGCAAATGAACAGCCTGCGTGCCGAGGACACCGCGGTGTATTACTGCAGCCGCTGGGGC G GTG ATG G CTTTTACG CGATG GACTACTG G G G CCAG G G CACCCTG GTCACCGTCTCG AGTG CTAG CACCAAG G G CCCATCG GTCTTCCCC CTG G CACCCTCCTCCAAG AG CACCTCTG G G G G CACAG CG G CCCTG G G CTG CCTG GTCAAG G ACTACTTCCCCG AACCG GTGACGGTGTC GTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGAC CGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGC CCAAATCTTGTG ACAAAACTCACACATG CCC ACCGTG CCCAG CACCTG AACTCCTG G G G G G ACCGTCAGTCTTCCTCTTCCCCCCAAAACC CAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACT GGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCT CACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCAT CTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGA CCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCT CCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGC TCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA
SEQ ID NO 13
anti-Her2 (4D5) gamma amino acid sequence MEAPAQLLFLLLLWLPDTTGEVQLVESGGGLVQPGGSLRLSCAASGFN IKDTYIHWVRQAPGKGLEWVSRIYPTNGYTRYADSVKGRFTISADT SKNTLYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN H KPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVH NAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHN HYTQKSLSLSPG K
SEQ ID NO 14
anti-Her2 (4D5) gamma_K274amber nucleotide sequence
ATGGAGGCTCCCGCCCAGCTGCTCTTTCTGCTCCTTCTCTGGCTTCCCGACACAACCGGTGAGGTGCAGCTGGTGGAGTCTGGCGGTGGC TTGGTACAGCCGGGCGG GTCCCTG CG CCTCTCCTGTG CCG CTTCCG G ATTCAACATCAAAG ACACGTATATTCACTG G GTCCGTCAG G CAC CTGGCAAGGGTCTGGAGTGGGTGAGCCGCATTTATCCTACCAATGGTTACACTCGCTACGCCGACTCTGTGAAGGGCCGCTTCACCATCA GCGCCGACACGTCCAAGAACACCCTGTATCTGCAAATGAACAGCCTGCGTGCCGAGGACACCGCGGTGTATTACTGCAGCCGCTGGGGC GGTGATGG CTTTTACG CG ATG G ACTACTG G G G CCAG G G CACCCTG GTCACCGTCTCG AGTG CTAG CACCAAG G G CCCATCG GTCTTCCCC CTG G CACCCTCCTCCAAG AG CACCTCTG G G G G CACAG CG G CCCTG G G CTG CCTG GTCAAG G ACTACTTCCCCG AACCG GTGACGGTGTC GTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTGAC CGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGC CCAAATCTTGTG ACAAAACTCACACATG CCC ACCGTG CCCAG CACCTG AACTCCTG G G G G G ACCGTCAGTCTTCCTCTTCCCCCCAAAACC CAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGGTCTAGTTCAACTG GTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTC ACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATC TCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCTGAC CTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTC CCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCT CCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA SEQ ID NO 15
anti-Her2 (4D5) gamma_K274amber amino acid sequence
MEAPAQLLFLLLLWLPDTTGEVQLVESGGGLVQPGGSLRLSCAASGFN IKDTYIHWVRQAPGKGLEWVSRIYPTNGYTRYADSVKGRFTISADT SKNTLYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH KPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEV* FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH N HYTQKSLSLSPG K
SEQ ID NO 16
anti-Her2 (4D5) Kappa nucleotide sequence ATGGAGGCTCCCGCCCAGCTGCTCTTTCTGCTCCTTCTCTGGCTTCCCGACACAACCGGTGACATCCAGATGACCCAGTCTCCATCCTCCCT GTCTGCATCTGTGGGAGACCGTGTCACAATCACTTGCCGTGCTAGCCAGGATGTGAATACAGCGGTGGCCTGGTATCAGCAGAAACCTG GCAAAGCCCCTAAGCTCCTGATCTATTCTGCATCCTTTTTGTACAGCGGCGTGCCGAGCCGCTTCAGCGGCAGCCGTTCTGGTACCGATTT CACTCTCACC ATCAG CTCTCTG CAACCG G AAG ATTTTG CAACTTACTACTGTCAACAG CACTACACCACTCCTCCG ACGTTCG G CCAAG G G ACCAAGGTGGAAATCGAACGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTG TTGTGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGA GTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGT CTACGCCTGCGAAGTCACCCATCAGGGCCTGAGTTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAA
SEQ ID O 17
anti-Her2 (4D5) Kappa amino acid sequence
MEAPAQLLFLLLLWLPDTTGDIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSRSGTDFTLTIS SLQPEDFATYYCQQHYTTPPTFGQGTKVEIERTVAAPSVFIFPPSDEQLKSGTASVVCLLN NFYPREAKVQWKVDNALQSGNSQESVTEQDSKD STYS LSSTLTLSKADYEKH KVYACEVTH QG LSSPVTKSFNRGEC
REFERENCES
Fekner, T., Li, X., & Chan, M. K. (2010). Pyrrolysine Analogs for Translational Incorporation into Proteins. European Jouranal of Organic Chemistry , 4171-4179.
Kavran, J. M., Gundllapalli, S., O' Donoghue, P., Englert, M., Soil, D., & Steltz, T. A. (2007). Structure of pyrrolysyl-tRNA synthetase, an archaeal enzyme for genetic code innovation. Proceedings National Academy of Sciences, 104 (27), 11268-11273.
Kobayashi, T., Yanagisawa, T., Sakamoto, K., & Yokoyama, S. (2009). Recognition of Non-a-amino Substrates by Pyrrolysyl-tRNA Synthetase. J. Mol. Biol. (1352-1360), 385.
Liu, Chang C, and Peter G Schultz. "Adding New Chemistries to the Genetic Code." Annual Review of Biochemistry, 2010: 413-444.
Chan, Michael K, Tomasz Fekner, Xin Li, Marianne Lee, and Jennifer J Ottesen. International Patent WO2011/044255A1. 2011.
Nguyen, D. P., Lusic, H., Neumann, H. K., Deiters, A., & Chin, J. W. (2009). Genetic Encoding and Labeling of Aliphatic Azides and Alkynes in Recombinant Proteins via a Pyrrolysyl-tRNA
Synthetase/tRNAcua Pair and Click Chemistry. Journal of the American Chemical Society , 8720- 8721.
Yanagisawa, T., Ishii, R., Fukunaga, R., Kobayashi, T., Sakamoto, K., & Yokoyama, S. (2008).
Crystallographic Studies on Multiple Conformational States of Active-site loops in Pyrrolysyl-tRNA synthetase. J. Mol. Biol. , 378, 634-652.
Yanagisawa, T., Ishii, R., Fukunaga, R., Kobayashi, T., Sakamoto, K., & Yokoyama, S. (2008).
Multistep Engineering of Pyrrolysyl-tRNA Synthetase to Genetically Encode Ne-(o- Azidobenzyloxycarbonyl)lysine for Site Specific Protein Modification. Chemistry and Biology, 15, 1187-1197.
Yanagisawa, T., Sumida, T., Ishii, R., & Yokoyama, S. (2013). A novel crystal fom of pyrrolysyl-tRNA synthetase reveals the pre- and post-aminoacyl-tRNA synthesis conformational states of the adenylate and aminoacyl moieties and an asparagine residue in the catalytic site. Acta
Crystallographica Section D, D69, 5-15.
All patents and patent applications referred to herein are incorporated by reference in their entirety.

Claims

CLAIMS:
A pyrrolysine analog of Formula VI :
Figure imgf000033_0001
Formula VI
wherein
Z = CH2, CH-NH2, CH-OH, NH, 0, S;
FG = azide, alkene, alkyne, ketone, ester, aryl or cycloalkyne; and
b = an integer 1-4.
A pyrrolysine analog of formula VI according to claim 1 wherein Z is NH.
A pyrrolysine analog of formula VI according to claim 1 or 2 wherein b is 1 or 2.
A pyrrolysine analog of formula VI according to any one of claims 1 to 3 wherein FG represents -N3, -CH=CH2, -C≡CH, -COCH3, COOCH3, phenyl substituted by halogen or cyclooctyne.
An pyrrolysine analog according to claim 1 selected from:
Figure imgf000033_0002
A pyrrolysine analog selected from:
Formula V.3
Figure imgf000034_0001
Figure imgf000034_0002
Figure imgf000034_0003
Figure imgf000034_0004
Figure imgf000034_0005
7. A mutant protein containing as non-natural amino acid one or more pyrrolysine analogs according to any one of claims 1 to 6.
8. A mutant protein according to claim 7 containing as non-natural amino acid one pyrrolysine analog according to any one of claims 1 to 6.
9. An antibody which contains as non-natural amino acid one or more pyrrolysine analogs according to any one of claims 1 to 6 in each heavy chain and/or light chain.
10. An antibody according to claim 10 which contains as non-natural amino acid a pyrrolysine analog according to any one of claims 1 to 6 in each heavy chain and/or light chain.
11. A mutant protein or antibody according to any one of claims 7 to 9 which is conjugated via the one or more non-natural amino acids to one or more moieties selected from proteins, cytotoxic agents, drugs and polymers.
12. A mutant protein according to claim 11 which is conjugated to a PEG moiety.
13. A mutant protein according to claim 11 which is conjugated to an antibody moiety.
14. A mutant protein according to claim 11 which is conjugated to a cytotoxic agent moiety.
15. A mutant protein according to claim 11 which is conjugated to a drug moiety.
16. Use of a pyrrolysine analog according to any one of claims 1 to 6 in the manufacture of a mutant protein containing one or more non-natural amino acids.
17. Use according to claim 16 wherein the protein is an antibody.
PCT/EP2013/069888 2012-09-24 2013-09-24 Amino acid derivatives WO2014044873A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
EP13766526.1A EP2897935B1 (en) 2012-09-24 2013-09-24 Amino acid derivatives
US14/430,412 US9670521B2 (en) 2012-09-24 2013-09-24 Amino acid derivatives
JP2015532458A JP6321658B2 (en) 2012-09-24 2013-09-24 Amino acid derivatives
CN201380060971.9A CN104812734B (en) 2012-09-24 2013-09-24 Amino acid derivativges
HK15112515.4A HK1211569A1 (en) 2012-09-24 2015-12-18 Amino acid derivatives
US15/610,931 US10214761B2 (en) 2012-09-24 2017-06-01 Amino acid derivatives

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201261705116P 2012-09-24 2012-09-24
US61/705,116 2012-09-24
US201361862495P 2013-08-05 2013-08-05
US61/862,495 2013-08-05

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/430,412 A-371-Of-International US9670521B2 (en) 2012-09-24 2013-09-24 Amino acid derivatives
US15/610,931 Division US10214761B2 (en) 2012-09-24 2017-06-01 Amino acid derivatives

Publications (1)

Publication Number Publication Date
WO2014044873A1 true WO2014044873A1 (en) 2014-03-27

Family

ID=49237211

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/EP2013/069888 WO2014044873A1 (en) 2012-09-24 2013-09-24 Amino acid derivatives
PCT/EP2013/069887 WO2014044872A1 (en) 2012-09-24 2013-09-24 Cell lines

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/069887 WO2014044872A1 (en) 2012-09-24 2013-09-24 Cell lines

Country Status (11)

Country Link
US (4) US9732367B2 (en)
EP (2) EP2898085B1 (en)
JP (2) JP6532404B2 (en)
KR (1) KR102155389B1 (en)
CN (2) CN104812734B (en)
AU (1) AU2013320184B2 (en)
BR (1) BR112015006368B1 (en)
CA (1) CA2885796C (en)
HK (2) HK1211569A1 (en)
SG (2) SG11201502216UA (en)
WO (2) WO2014044873A1 (en)

Families Citing this family (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3202903B1 (en) 2010-12-22 2020-02-12 President and Fellows of Harvard College Continuous directed evolution
IN2014DN09922A (en) 2012-05-18 2015-08-14 Medical Res Council
AU2013320184B2 (en) 2012-09-24 2017-10-12 Medimmune Limited Cell lines
JP6550339B2 (en) 2013-03-15 2019-07-24 メディミューン リミテッド Novel nucleic acid molecule
US9764039B2 (en) * 2013-07-10 2017-09-19 Sutro Biopharma, Inc. Antibodies comprising multiple site-specific non-natural amino acid residues, methods of their preparation and methods of their use
EP3030545B1 (en) 2013-08-05 2020-10-07 MedImmune Limited Amino acid derivatives
US20160303242A1 (en) 2013-12-09 2016-10-20 Durect Corporation Pharmaceutically Active Agent Complexes, Polymer Complexes, and Compositions and Methods Involving the Same
GB2528227A (en) * 2014-03-14 2016-01-20 Medical Res Council Cyclopropene amino acids and methods
WO2016077052A2 (en) 2014-10-22 2016-05-19 President And Fellows Of Harvard College Evolution of proteases
CN106146663B (en) * 2015-04-10 2019-11-08 北京大学 Novel antibodies-drug conjugates of unnatural amino acid label and its preparation
US11299729B2 (en) 2015-04-17 2022-04-12 President And Fellows Of Harvard College Vector-based mutagenesis system
US10392674B2 (en) 2015-07-22 2019-08-27 President And Fellows Of Harvard College Evolution of site-specific recombinases
US11524983B2 (en) 2015-07-23 2022-12-13 President And Fellows Of Harvard College Evolution of Bt toxins
WO2017019895A1 (en) 2015-07-30 2017-02-02 President And Fellows Of Harvard College Evolution of talens
US10906990B2 (en) * 2015-08-19 2021-02-02 Riken Antibody with non-natural amino acid introduced therein
CN106929482A (en) * 2015-12-31 2017-07-07 北京大学 Influenza virus, its live vaccine of rite-directed mutagenesis and its preparation method and application
US11708413B2 (en) 2016-01-27 2023-07-25 Sutro Biopharma, Inc. Anti-CD74 antibody conjugates, compositions comprising anti-CD74 antibody conjugates and methods of using anti-CD74 antibody conjugates
CN107012121B (en) * 2016-01-27 2021-01-26 北京大学 Construction of Stable cell lines carrying orthogonal tRNA/aminoacyltRNA synthetases
CN105524167A (en) * 2016-01-30 2016-04-27 深圳市贝沃德克生物技术研究院有限公司 Preparation method of anti-HBeAg (hepatitis B virus e antigen) green fluorescent antibody
CN105647918A (en) * 2016-02-20 2016-06-08 深圳市圣必智科技开发有限公司 Preparation method of red fluorescent antibody resisting HBeAg (hepatitis B virus e antigen)
MA45408A (en) 2016-06-17 2019-04-24 Magenta Therapeutics Inc COMPOSITIONS AND METHODS FOR DEPLOYING CD117 + CELLS
US11214820B2 (en) * 2016-09-02 2022-01-04 Ikaria Inc. Functionally modified polypeptides and radiobiosynthesis
WO2018044143A1 (en) * 2016-09-05 2018-03-08 한국과학기술원 Mouse in which site-specific modification of target protein is temporospatially controlled, method for producing mouse, and use thereof
KR102013742B1 (en) * 2016-09-05 2019-11-04 한국과학기술원 Transgenic mouse capable of controlling site-specific modification of target protein temporally and spatially, method and uses thereof
CN110603261A (en) * 2016-12-23 2019-12-20 拜斯科阿迪有限公司 Peptide derivatives having novel bond structure
CA3049501A1 (en) 2017-01-20 2018-07-26 Magenta Therapeutics, Inc. Compositions and methods for the depletion of cd137+ cells
US11447809B2 (en) 2017-07-06 2022-09-20 President And Fellows Of Harvard College Evolution of tRNA synthetases
US11624130B2 (en) 2017-09-18 2023-04-11 President And Fellows Of Harvard College Continuous evolution for stabilized proteins
AU2018394189B2 (en) 2017-12-27 2023-12-21 Kyowa Kirin Co., Ltd. IL-2 variant
WO2019241649A1 (en) 2018-06-14 2019-12-19 President And Fellows Of Harvard College Evolution of cytidine deaminases
CN110835633B (en) * 2018-08-13 2021-10-01 北京大学 Preparation of PTC stable cell line by using optimized gene codon expansion system and application
US20210356377A1 (en) * 2018-09-07 2021-11-18 Medimmune, Llc Methods Of Cell Selection
CN109553643B (en) * 2018-11-29 2020-09-22 深圳先进技术研究院 Monosaccharide analogue, molecular probe containing monosaccharide analogue and application of molecular probe
CN111850020B (en) * 2019-04-25 2021-05-07 苏州鲲鹏生物技术有限公司 Introduction of unnatural amino acids in proteins using plasmid systems
CN111909256A (en) * 2019-05-10 2020-11-10 宁波鲲鹏生物科技有限公司 Polypeptide derivatives and process for preparing the same
CN117529558A (en) * 2021-04-21 2024-02-06 阿西莫夫公司 Stable production system for adeno-associated virus production
WO2022232377A2 (en) * 2021-04-28 2022-11-03 The Regents Of The University Of California Bioreactive proteins containing unnatural amino acids
CA3222899A1 (en) * 2021-07-29 2023-02-02 Jinwei Yang Unnatural amino acid, and use thereof, recombinant protein containing same, and recombinant protein conjugate
EP4130254A1 (en) * 2021-08-03 2023-02-08 Fraunhofer-Gesellschaft zur Förderung der angewandten Forschung e.V. Eukaryotic cell lysates comprising exogenous enzymes and methods for preparing the same
CN113788890B (en) * 2021-09-01 2022-11-08 浙江新码生物医药有限公司 Human interleukin 2-polyethylene glycol conjugate and application thereof
CN113698468B (en) * 2021-09-01 2022-10-11 浙江新码生物医药有限公司 Human interleukin 2-polyethylene glycol conjugate and application thereof
WO2023164676A1 (en) * 2022-02-27 2023-08-31 The Regents Of The University Of California Methods to generate novel acyl-trna species

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004041752A2 (en) * 2002-11-04 2004-05-21 University Of Massachusetts Chemical encoding technology for combinatorial synthesis
EP1911840A1 (en) 2005-08-02 2008-04-16 Riken tRNA SYNTHESIS METHOD, NUCLEIC ACID, AMINOACYL tRNA SYNTHESIS METHOD, AND PROCESS FOR PRODUCTION OF PROTEIN HAVING NON-NATURAL AMINO ACID INTEGRATED THEREIN
WO2010008110A1 (en) 2008-07-18 2010-01-21 Alantum Corporation Filter device for filtering automobile exhaust gas
WO2010081111A1 (en) 2009-01-12 2010-07-15 Sutro Biopharma, Inc. Mono charging system for selectively introducing non-native amino acids into proteins using an in vitro protein synthesis system
WO2010083148A1 (en) 2009-01-13 2010-07-22 Sutro Biopharma, Inc. Use of dna gyrase inhibitors for in vitro polypeptide synthesis reactions
WO2010139948A2 (en) 2009-06-04 2010-12-09 Medical Research Council Methods
WO2011044255A1 (en) 2009-10-06 2011-04-14 The Ohio State University Pyrrolysine analogs
WO2011087810A1 (en) * 2009-12-21 2011-07-21 Ambrx, Inc. Modified porcine somatotropin polypeptides and their uses

Family Cites Families (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3711458A (en) 1969-08-21 1973-01-16 Research Corp Substituted and unsubstituted vinyloxycarbonyl groups as amino protecting groups in the syntheses of peptides
US4512979A (en) 1981-03-23 1985-04-23 Merck & Co., Inc. Dipeptides containing thialysine and related amino acids as antihypertensives
JPH0710451B2 (en) 1986-11-25 1995-02-08 三五重機株式会社 Steel sheet cutter
HU207287B (en) 1989-01-17 1993-03-29 Biosignal Kutato Fejlesztoe Kf Polyene fatty acid derivatives of tyrozine-quinaze inhibiting activity and pharmaceutical composition containing them as active component
WO1991016449A1 (en) 1990-04-16 1991-10-31 The Trustees Of The University Of Pennsylvania Saccharide compositions, methods and apparatus for their synthesis
US7045337B2 (en) 2001-04-19 2006-05-16 The Scripps Research Institute In vivo incorporation of unnatural amino acids
ES2556338T3 (en) 2001-10-10 2016-01-15 Novo Nordisk A/S Remodeling and glycoconjugation of peptides
KR20050073559A (en) 2002-10-16 2005-07-14 더 스크립스 리서치 인스티튜트 Glycoprotein synthesis
AU2004233083B2 (en) * 2003-04-17 2010-09-16 The Scripps Research Institute Expanding the eukaryotic genetic code
ES2545533T3 (en) 2004-11-01 2015-09-11 The Regents Of The University Of California Compositions and methods for biomolecule modification
WO2007099854A1 (en) 2006-02-22 2007-09-07 Riken METHOD FOR SYNTHESIS OF SUPPRESSOR tRNA, DNA CONSTRUCT, AND PRODUCTION OF PROTEIN HAVING NON-NATURAL AMINO ACID INTEGRATED THEREIN BY USING THE DNA CONSTRUCT
CA2653748A1 (en) 2006-05-02 2007-11-15 Allozyne, Inc. Non-natural amino acid substituted polypeptides
KR20090094812A (en) * 2006-10-18 2009-09-08 더 스크립스 리서치 인스티튜트 Genetic incorporation of unnatural amino acids into proteins in mammalian cells
AU2008301614A1 (en) 2007-09-20 2009-03-26 Riken Mutant pyrrolysyl-TRNA synthetase, and method for production of protein having non-natural amino acid integrated therein by using the same
WO2010114615A2 (en) 2009-04-03 2010-10-07 The Scripps Research Institute A facile system for encoding unnatural amino acids in mammalian cells
CA2784793A1 (en) * 2009-12-21 2011-07-21 Ambrx, Inc. Modified bovine somatotropin polypeptides and their uses
DK2563753T6 (en) 2010-04-27 2016-04-04 Synaffix Bv Fused cyclooctynforbindelser and their use in metal-free click-reactions
JP6173911B2 (en) * 2010-09-10 2017-08-09 メディミューン リミテド Antibody derivatives
DE102010041261A1 (en) * 2010-09-23 2012-03-29 Robert Bosch Gmbh Flip-chip arrangement with a cooling element and method for producing a flip-chip arrangement
WO2012038706A1 (en) * 2010-09-24 2012-03-29 Medical Research Council Methods for incorporating unnatural amino acids in eukaryotic cells
EP2670767B1 (en) * 2011-02-03 2017-12-20 European Molecular Biology Laboratory Unnatural amino acids comprising a cyclooctynyl or trans-cyclooctenyl analog group and uses thereof
HUE045227T2 (en) 2012-08-31 2019-12-30 Sutro Biopharma Inc Modified amino acids comprising an azido group
AU2013320184B2 (en) 2012-09-24 2017-10-12 Medimmune Limited Cell lines
JP6550339B2 (en) 2013-03-15 2019-07-24 メディミューン リミテッド Novel nucleic acid molecule

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004041752A2 (en) * 2002-11-04 2004-05-21 University Of Massachusetts Chemical encoding technology for combinatorial synthesis
EP1911840A1 (en) 2005-08-02 2008-04-16 Riken tRNA SYNTHESIS METHOD, NUCLEIC ACID, AMINOACYL tRNA SYNTHESIS METHOD, AND PROCESS FOR PRODUCTION OF PROTEIN HAVING NON-NATURAL AMINO ACID INTEGRATED THEREIN
WO2010008110A1 (en) 2008-07-18 2010-01-21 Alantum Corporation Filter device for filtering automobile exhaust gas
WO2010081111A1 (en) 2009-01-12 2010-07-15 Sutro Biopharma, Inc. Mono charging system for selectively introducing non-native amino acids into proteins using an in vitro protein synthesis system
WO2010083148A1 (en) 2009-01-13 2010-07-22 Sutro Biopharma, Inc. Use of dna gyrase inhibitors for in vitro polypeptide synthesis reactions
WO2010139948A2 (en) 2009-06-04 2010-12-09 Medical Research Council Methods
WO2011044255A1 (en) 2009-10-06 2011-04-14 The Ohio State University Pyrrolysine analogs
WO2011087810A1 (en) * 2009-12-21 2011-07-21 Ambrx, Inc. Modified porcine somatotropin polypeptides and their uses

Non-Patent Citations (15)

* Cited by examiner, † Cited by third party
Title
DOSE ET AL: "Single nucleotide specific detection of DNA by native chemical ligation of fluorescence labeled PNA-probes", BIOORGANIC & MEDICINAL CHEMISTRY, PERGAMON, GB, vol. 16, no. 1, 1 January 2008 (2008-01-01), pages 65 - 77, XP022485927, ISSN: 0968-0896, DOI: 10.1016/J.BMC.2007.04.059 *
FEKNER, T.; LI, X.; CHAN, M. K.: "Pyrrolysine Analogs for Translational Incorporation into Proteins", EUROPEAN JOURANAL OF ORGANIC CHEMISTRY, 2010, pages 4171 - 4179
KAVRAN, J. M.; GUNDLLAPALLI, S.; 0' DONOGHUE, P.; ENGLERT, M.; SOLL, D.; STELTZ, T. A.: "Structure of pyrrolysyl-tRNA synthetase, an archaeal enzyme for genetic code innovation", PROCEEDINGS NATIONAL ACADEMY OF SCIENCES, vol. 104, no. 27, 2007, pages 11268 - 11273, XP002610072, DOI: doi:10.1073/pnas.0704769104
KOBAYASHI, T.; YANAGISAWA, T.; SAKAMOTO, K.; YOKOYAMA, S.: "Recognition of Non-a-amino Substrates by Pyrrolysyl-tRNA Synthetase", J. MOL. BIOL., 2009, pages 385
LEWIS-PHILLIPS GD, CANCER RES., vol. 63, 2008, pages 9280 - 9290
LIU, CHANG C; PETER G SCHULTZ: "Adding New Chemistries to the Genetic Code", ANNUAL REVIEW OF BIOCHEMISTRY, 2010, pages 413 - 444, XP055026250, DOI: doi:10.1146/annurev.biochem.052308.105824
MACDONALD GC, J. IMMUNOTHERAPY, vol. 32, 2009, pages 574 - 84
MILAN VRABEL ET AL: "Optimization of the posttranslational click modification of proteins", COLLECTION OF CZECHOSLOVAK CHEMICAL COMMUNICATIONS, INSTITUTE OF ORGANIC CHEMISTRY & BIOCHEMISTRY, PRAGUE; CZ, vol. 76, no. 9, 1 September 2011 (2011-09-01), pages 1089 - 1101, XP008166226, ISSN: 0010-0765, [retrieved on 20110822], DOI: 10.1135/CCCC2011103 *
NAOKO YASOBU ET AL: "Design, Synthesis, and Antitumor Activity of 4-Halocolchicines and Their Pro-drugs Activated by Cathepsin B", ACS MEDICINAL CHEMISTRY LETTERS, AMERICAN CHEMICAL SOCIETY, US, vol. 2, no. 5, 12 May 2011 (2011-05-12), pages 348 - 352, XP008166236, ISSN: 1948-5875, [retrieved on 20110304], DOI: 10.1021/ML100287Y *
NGUYEN, D. P.; LUSIC, H.; NEUMANN, H. K.; DEITERS, A.; CHIN, J. W.: "Genetic Encoding and Labeling of Aliphatic Azides and Alkynes in Recombinant Proteins via a Pyrrolysyl-tRNA Synthetase/tRNAcua Pair and Click Chemistry", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, 2009, pages 8720 - 8721, XP009127968, DOI: doi:10.1021/ja900553w
SENTER, PE, BIOCONJ. CHEM., vol. 17, 2006, pages 114 - 124
SENTER, PE, BLOOD, vol. 102, pages 1458 - 1465
YANAGISAWA, T.; ISHII, R.; FUKUNAGA, R.; KOBAYASHI, T.; SAKAMOTO, K.; YOKOYAMA, S.: "Crystallographic Studies on Multiple Conformational States of Active-site loops in Pyrrolysyl-tRNA synthetase", J. MOL. BIOL., vol. 378, 2008, pages 634 - 652, XP022762540, DOI: doi:10.1016/j.jmb.2008.02.045
YANAGISAWA, T.; SUMIDA, T.; ISHII, R.; YOKOYAMA, S.: "A novel crystal fom of pyrrolysyl-tRNA synthetase reveals the pre- and post-aminoacyl-tRNA synthesis conformational states of the adenylate and aminoacyl moieties and an asparagine residue in the catalytic site", ACTA CRYSTALLOGRAPHICA SECTION D, vol. D69, 2013, pages 5 - 15
YANAGISAWA, T; ISHII, R.; FUKUNAGA, R; KOBAYASHI, T; SAKAMOTO, K; YOKOYAMA, S: "Multistep Engineering of Pyrrolysyl-tRNA Synthetase to Genetically Encode Ne-(o- Azidobenzyloxycarbonyl)lysine for Site Specific Protein Modification", CHEMISTRY AND BIOLOGY, vol. 15, 2008, pages 1187 - 1197, XP025678151, DOI: doi:10.1016/j.chembiol.2008.10.004

Also Published As

Publication number Publication date
US9670521B2 (en) 2017-06-06
JP2015530091A (en) 2015-10-15
CA2885796A1 (en) 2014-03-27
US10214761B2 (en) 2019-02-26
SG11201502216UA (en) 2015-04-29
EP2897935B1 (en) 2019-02-27
KR20150070186A (en) 2015-06-24
AU2013320184B2 (en) 2017-10-12
EP2898085A1 (en) 2015-07-29
US10253345B2 (en) 2019-04-09
AU2013320184A1 (en) 2015-04-09
WO2014044872A1 (en) 2014-03-27
CN104812734A (en) 2015-07-29
HK1211569A1 (en) 2016-05-27
US20170306381A1 (en) 2017-10-26
JP6532404B2 (en) 2019-06-19
US20170306380A1 (en) 2017-10-26
BR112015006368B1 (en) 2022-02-08
SG10201702387YA (en) 2017-04-27
US20150251994A1 (en) 2015-09-10
CN105026574A (en) 2015-11-04
EP2897935A1 (en) 2015-07-29
EP2898085B1 (en) 2019-01-23
JP6321658B2 (en) 2018-05-09
US20150259721A1 (en) 2015-09-17
US9732367B2 (en) 2017-08-15
BR112015006368A2 (en) 2017-09-05
CN105026574B (en) 2019-08-30
HK1211623A1 (en) 2016-05-27
CA2885796C (en) 2022-05-03
JP2015531789A (en) 2015-11-05
CN104812734B (en) 2017-08-22
KR102155389B1 (en) 2020-09-11

Similar Documents

Publication Publication Date Title
US10214761B2 (en) Amino acid derivatives
EP3030545B1 (en) Amino acid derivatives
WO2019240288A1 (en) Substance having affinity for antibody, and compound or salt thereof having bioorthogonal functional group
JP7413999B2 (en) Compounds having affinity for antibodies, cleavable moieties, and reactive groups, or salts thereof
US20220088212A1 (en) C-terminal lysine conjugated immunoglobulins
Xiao Modulation of protein properties and functions by site-specific protein modification

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13766526

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2015532458

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14430412

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2013766526

Country of ref document: EP