CN111909256A - Polypeptide derivatives and process for preparing the same - Google Patents

Polypeptide derivatives and process for preparing the same Download PDF

Info

Publication number
CN111909256A
CN111909256A CN201910390476.3A CN201910390476A CN111909256A CN 111909256 A CN111909256 A CN 111909256A CN 201910390476 A CN201910390476 A CN 201910390476A CN 111909256 A CN111909256 A CN 111909256A
Authority
CN
China
Prior art keywords
polypeptide
insulin
group
derivative
lysine
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
CN201910390476.3A
Other languages
Chinese (zh)
Inventor
查若鹏
张振山
吴松
刘慧玲
陈卫
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ningbo Kunpeng Biotech Co Ltd
Original Assignee
Ningbo Kunpeng Biotech Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ningbo Kunpeng Biotech Co Ltd filed Critical Ningbo Kunpeng Biotech Co Ltd
Priority to CN201910390476.3A priority Critical patent/CN111909256A/en
Priority to CN202080035118.1A priority patent/CN113811614A/en
Priority to EP20806421.2A priority patent/EP3967759A4/en
Priority to CA3139826A priority patent/CA3139826A1/en
Priority to JP2021567053A priority patent/JP7453698B2/en
Priority to US17/610,606 priority patent/US20220211857A1/en
Priority to BR112021022629A priority patent/BR112021022629A2/en
Priority to PCT/CN2020/089217 priority patent/WO2020228610A1/en
Priority to AU2020276560A priority patent/AU2020276560A1/en
Publication of CN111909256A publication Critical patent/CN111909256A/en
Pending legal-status Critical Current

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/542—Carboxylic acids, e.g. a fatty acid or an amino acid
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/545—Heterocyclic compounds
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/605—Glucagons
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/62—Insulins
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575—Hormones
    • C07K14/635—Parathyroid hormone (parathormone); Parathyroid hormone-related peptides
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00—Preparation of peptides or proteins
    • C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y601/00—Ligases forming carbon-oxygen bonds (6.1)
    • C12Y601/01—Ligases forming aminoacyl-tRNA and related compounds (6.1.1)
    • C12Y601/01026—Pyrrolysine-tRNAPyl ligase (6.1.1.26)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Abstract

The invention provides polypeptide derivatives and a preparation method thereof. Specifically, the invention provides a polypeptide derivative. The experimental result shows that the polypeptide derivative has obviously prolonged half-life while maintaining the biological activity. The invention also discloses a preparation method of the polypeptide derivative and an application of the polypeptide derivative in treatment.

Description

Polypeptide derivatives and process for preparing the same
Technical Field
The invention belongs to the field of biological medicines, and particularly relates to a polypeptide derivative and a preparation method thereof.
Background
Pharmacokinetic studies indicate that polypeptide/protein drugs are cleared in vivo mainly through degradation, excretion, and receptor-mediated endocytosis. Wherein the polypeptide factor with the molecular weight less than 20kDa is easily filtered by glomerulus in the metabolic process; the polypeptide factor is partially degraded by protease in the polypeptide factor and excreted from urine when passing through the renal tubule, and thus has a short half-life. Taking GLP-1 as an example, the in vivo biological half-life period is generally 20min, in order to achieve the treatment effect, frequent large-dose medication is needed, and long-term frequent injection not only increases the pain and treatment cost of patients, but also easily causes a series of serious toxic and side effects. The development of long-acting polypeptide/protein drugs has become an important direction for the secondary development of the first generation of genetically engineered polypeptide/protein drugs. At present, the half-life of protein drugs is prolonged mainly based on increasing the molecular weight of the protein drugs, reducing the glomerular filtration rate and reducing the immunogenicity of heterologous proteins, thereby reducing the clearance rate in vivo; sustained and slow release to maintain the drug concentration, and prolonged action time of the drug. The common techniques are: preparing a sustained-release preparation, constructing a mutant, chemically modifying, fusing genes and the like.
Therefore, the protein or polypeptide is subjected to fatty acid modification, and then the protein or polypeptide is bound with albumin through non-covalent bonds of fatty acid, so that the half life of the protein or polypeptide in blood can be prolonged.
Disclosure of Invention
The object of the present invention is to provide a new, more potent polypeptide derivative.
In a first aspect of the invention, there is provided a polypeptide derivative comprising:
(a) a polypeptide; and
(b) a modifying group L, wherein the modifying group L is connected to a lysine site of the polypeptide and is a group shown in a formula I,
Figure BDA0002056315260000011
wherein the wavy line represents the position of attachment to the lysine site, and m is an integer of 0 to 8; a. b, c, d, e and f are each independently integers selected from 0 to 10; n is an integer of 14 to 16.
In another preferred embodiment, the group Y is a group selected from the group consisting of:
Figure BDA0002056315260000021
in another preferred embodiment, the polypeptide is selected from the group consisting of: insulin, GLP-1, PTH, or a combination thereof.
In another preferred embodiment, the polypeptide derivative is selected from the group consisting of: an insulin derivative, a GLP-1 derivative, a PTH derivative, or a combination thereof.
In another preferred example, the A chain of the insulin has a sequence as shown in SEQ ID No. 1 or 2.
In another preferred embodiment, the B chain of the insulin has a sequence as shown in SEQ ID No. 3, 4, 5 or 6.
In another preferred example, the GLP-1 has a sequence as shown in any one of SEQ ID No. 7-9.
In another preferred embodiment, the PTH has the sequence shown in SEQ ID No. 10.
In another preferred embodiment, the polypeptide derivative has the structure shown below, wherein
Figure BDA0002056315260000022
Insulin, GLP-1 or PTH:
Figure BDA0002056315260000023
wherein m is an integer of 0 to 8; a. b, c, d, e and f are each independently integers selected from 0 to 10; n is an integer of 14 to 16.
In another preferred embodiment, the polypeptide derivative is selected from the group consisting of
Figure BDA0002056315260000024
Insulin, GLP-1 or PTH:
Figure BDA0002056315260000031
in another preferred embodiment, the polypeptide derivative is selected from the group consisting of: L0-GFA 16-polypeptide, L2-GFA 16-polypeptide, L3-GFA 16-polypeptide, L4-GFA 16-polypeptide, L5-GFA 16-polypeptide, or L6-GFA 16-polypeptide.
In another preferred embodiment, the structure of the polypeptide derivative L0-GFA 16-polypeptide is as follows, wherein
Figure BDA0002056315260000032
Is a polypeptide:
Figure BDA0002056315260000033
in another preferred embodiment, the structure of the polypeptide derivative L2-GFA 16-polypeptide is as follows, wherein
Figure BDA0002056315260000034
Is a polypeptide:
Figure BDA0002056315260000035
in another preferred embodiment, the structure of the polypeptide derivative L3-GFA 16-polypeptide is as follows, wherein
Figure BDA0002056315260000036
Is a polypeptide:
Figure BDA0002056315260000037
in another preferred embodiment, the structure of the polypeptide derivative L4-GFA 16-polypeptide is as follows, wherein
Figure BDA0002056315260000038
Is a polypeptide:
Figure BDA0002056315260000041
in another preferred embodiment, the structure of the polypeptide derivative L5-GFA 16-polypeptide is as follows, wherein
Figure BDA0002056315260000042
Is a polypeptide:
Figure BDA0002056315260000043
in another preferred embodiment, the structure of the polypeptide derivative L6-GFA 16-polypeptide is as follows:
Figure BDA0002056315260000044
in another preferred embodiment, the insulin comprises an insulin a chain and an insulin B chain.
In another preferred embodiment, the insulin comprises human insulin or animal insulin, preferably, the insulin is human insulin.
In another preferred example, the animal insulin comprises porcine insulin and bovine insulin.
In another preferred embodiment, the insulin further comprises one or more disulfide bonds between the A chain and the B chain.
In another preferred embodiment, the insulin comprises native insulin, an insulin precursor, or a variant of insulin.
In another preferred embodiment, the insulin derivative comprises an insulin precursor and the modifying group L.
In another preferred example, the A chain of the insulin has a sequence as shown in SEQ ID No. 1 or 2.
In another preferred embodiment, the B chain of the insulin has a sequence as shown in SEQ ID No. 3, 4, 5 or 6.
In another preferred example, the A chain of the insulin has a sequence shown in SEQ ID No.:1, and the B chain of the insulin has a sequence shown in SEQ ID No.:3, 5 or 6.
In another preferred example, the A chain of the insulin has a sequence shown in SEQ ID No.:2, and the B chain of the insulin has a sequence shown in SEQ ID No.:4 or 6.
In another preferred embodiment, the modifying group L is covalently linked to the lysine (K) site.
In another preferred embodiment, the modifying group L is covalently linked to the-amino group of the lysine (K).
In another preferred embodiment, the insulin comprises a PK, DKT, PKT or KPT motif and the modifying group L is linked to a lysine (K) site in said motif.
In another preferred embodiment, the insulin comprises a TPK, TKP or TDK motif and the modifying group L is attached to the lysine (K) site in said motif.
In another preferred embodiment, the insulin comprises a YTPK, YTDKT, YTPKT or YTKPT motif and the modifying group L is linked to a lysine (K) site in said motif.
In another preferred embodiment, the modifying group L is attached to lysine (K) at position 28 or 29 of the B chain.
In another preferred embodiment, the modifying group L is covalently linked to a lysine (K) corresponding to position 29 in the sequence shown in SEQ ID No. 3, 4 or 6.
In another preferred example, the B chain of the insulin has a sequence as shown in SEQ ID No. 3, 4 or 6, and the modifying group L is linked to lysine (K) at position 29 in the sequence as shown in SEQ ID No. 3, 4 or 6.
In another preferred example, the B chain of the insulin has a sequence shown in SEQ ID No. 5, and the modifying group L is linked to lysine (K) at position 28 in the sequence shown in SEQ ID No. 5.
In another preferred embodiment, the insulin derivative is selected from the group consisting of: L0-GFA 16-insulin, L2-GFA 16-insulin, L3-GFA 16-insulin, L4-GFA 16-insulin, L5-GFA 16-insulin, or L6-GFA 16-insulin.
In another preferred embodiment, said GLP-1 derivative comprises a GLP-1 analog and said modifying group L.
In another preferred example, the GLP-1 has a sequence as shown in any one of SEQ ID No. 7-9.
In another preferred embodiment, the modifying group L is covalently linked to the lysine (K) site.
In another preferred embodiment, the modifying group L is covalently linked to the-amino group of the lysine (K).
In another preferred embodiment, said GLP-1 comprises an AKE motif and said modifying group L is attached to a lysine (K) site in said motif.
In another preferred embodiment, said GLP-1 comprises an AAKEF motif and said modifying group L is attached to a lysine (K) site in said motif.
In another preferred embodiment, the modifying group L is attached to lysine (K) at position 20 or 26 of the chain.
In another preferred embodiment, the GLP-1 derivative is selected from the group consisting of: L0-GFA16-GLP-1, L2-GFA16-GLP-1, L3-GFA16-GLP-1, L4-GFA16-GLP-1, L5-GFA16-GLP-1, or L6-GFA 16-GLP-1.
In another preferred embodiment, said PTH derivative comprises a PTH analogue and said modifying group L.
In another preferred embodiment, the PTH has the sequence shown in SEQ ID No. 10.
In another preferred embodiment, the modifying group L is covalently linked to the lysine (K) site.
In another preferred embodiment, the modifying group L is covalently linked to the-amino group of the lysine (K).
In another preferred embodiment, the PTH comprises an RKR motif and the modification group L is attached to a lysine (K) site in the motif.
In another preferred embodiment, the PTH comprises an LRKRL motif and the modifying group L is linked to a lysine (K) site in the motif.
In another preferred embodiment, said modifying group L is linked to lysine (K) at position 26 of said PTH.
In another preferred embodiment, the PTH derivative is selected from the group consisting of: L0-GFA16-PTH, L2-GFA16-PTH, L3-GFA16-PTH, L4-GFA16-PTH, L5-GFA16-PTH, or L6-GFA 16-PTH.
In a second aspect of the invention, there is provided a pharmaceutical composition comprising a polypeptide derivative according to the first aspect of the invention, and a pharmaceutically acceptable carrier.
In a third aspect of the invention, there is provided the use of a polypeptide derivative according to the first aspect of the invention for the preparation of a medicament or formulation for the prevention and/or treatment of osteoporosis, diabetes, hyperglycemia and other diseases where lowering blood glucose would be beneficial.
In a fourth aspect of the present invention, there is provided a method for producing a polypeptide derivative, the method comprising the steps of:
(1) culturing a strain containing an insulin-encoding sequence in the presence of an X group-lysine, a pyrrolysinyl-tRNA synthetase and its cognate tRNA, wherein in the encoding sequence for lysine in the polypeptide is replaced with TAG (encodes a lysine derivative), thereby producing a polypeptide derivative, wherein the polypeptide derivative comprises:
(a) a polypeptide chain; and
(b) a modifying group L attached to a lysine site of the polypeptide and being a group X as defined in the first aspect of the invention; and optionally
(2) Isolating said polypeptide derivative from the fermentation product.
In another preferred embodiment, the polypeptide is selected from the group consisting of: insulin, GLP-1, PTH, or a combination thereof.
In another preferred embodiment, the polypeptide derivative is selected from the group consisting of: an insulin derivative, a GLP-1 derivative, a PTH derivative, or a combination thereof.
In a fifth aspect of the present invention, there is provided a method for preparing a polypeptide derivative, the method comprising the steps of:
(1) in the presence of a compound of formula III, a pyrrolysinyl-tRNA synthetase and its cognate tRNA,
culturing a strain containing a polypeptide coding sequence in which the coding sequence for lysine in the polypeptide is replaced with TAG (encoding a lysine derivative) to provide a compound of formula IV; and
Figure BDA0002056315260000061
(2) reacting a compound of formula IV with a compound of formula V in an inert solvent to obtain a polypeptide derivative,
Figure BDA0002056315260000062
in the formula V, a, b, c, d, e and f are respectively and independently integers selected from 0 to 10; n is an integer of 14 to 16.
In another preferred embodiment, the polypeptide is selected from the group consisting of: insulin, GLP-1, PTH, or a combination thereof.
In another preferred embodiment, the polypeptide derivative is selected from the group consisting of: an insulin derivative, a GLP-1 derivative, a PTH derivative, or a combination thereof.
In a sixth aspect of the present invention, there is provided a method for producing a polypeptide derivative, the method comprising the steps of:
(1) in the presence of a compound of formula VI, a pyrrolysinyl-tRNA synthetase and its cognate tRNA,
cultivating a strain comprising a polypeptide-encoding sequence in which the sequence encoding lysine in the polypeptide is replaced with TAG (encoding a lysine derivative) to provide a compound of formula VII; and
Figure BDA0002056315260000071
(2) reacting a compound of formula VII with a compound of formula VIII in an inert solvent to obtain a polypeptide derivative,
Figure BDA0002056315260000072
in the formula VIII, a, b, c, d, e and f are respectively and independently integers selected from 0 to 10; n is an integer of 14 to 16.
In another preferred embodiment, the polypeptide is selected from the group consisting of: insulin, GLP-1, PTH, or a combination thereof.
In another preferred embodiment, the polypeptide derivative is selected from the group consisting of: an insulin derivative, a GLP-1 derivative, a PTH derivative, or a combination thereof.
In a seventh aspect of the present invention, there is provided an intermediate comprising:
(a) a polypeptide, wherein the polypeptide is insulin, GLP-1 or PTH; and
(b) a modifying group L, wherein the modifying group L is connected to a lysine site of the polypeptide and is a group shown in a formula A,
Figure BDA0002056315260000073
wherein the wavy line represents the position of attachment to the lysine site, and m is an integer of 0 to 8.
In another preferred embodiment, the intermediate has a structure as shown in formula IV, wherein
Figure BDA0002056315260000074
Is insulin, GLP-1 or PTH,
Figure BDA0002056315260000075
in another preferred embodiment, said intermediate is used for the preparation of a polypeptide derivative according to the first aspect of the invention.
The present invention also provides the use of an intermediate according to the seventh aspect of the present invention for the preparation of a polypeptide derivative according to the first aspect of the present invention.
It is to be understood that within the scope of the present invention, the above-described features of the present invention and those specifically described below (e.g., in the examples) may be combined with each other to form new or preferred embodiments. Not to be reiterated herein, but to the extent of space.
Detailed Description
The present inventors have conducted extensive and intensive studies to obtain a polypeptide derivative, and as a result, the polypeptide derivative has a remarkably prolonged half-life while maintaining biological activity. The invention also provides pharmaceutical application of the polypeptide derivative, and the effect of the polypeptide derivative in treating or preventing diabetes, promoting osteoblast osteogenesis and the like. On this basis, the inventors have completed the present invention.
The ideal effect of long acting insulin is to reestablish basal insulin secretion in diabetic patients by injecting the insulin as few times as possible. Chemical modification is one of the ways to obtain long-acting insulins, and the chemical modifier must be structurally stable, non-toxic, non-antigenic and of a suitable size and molecular weight. Through specific chemical modification, the invention can prolong the half-life period and reduce the antigenicity of the insulin while maintaining the biological activity. The modified insulin derivative is a high molecular compound with better biocompatibility, has no toxicity to human bodies, and increases the water solubility of the medicine. And can reduce the clearance rate of glomeruli to the glomeruli and increase the half-life of the drug in circulation in vivo, thereby obtaining long-acting effect. The insulin, GLP-1, PTH protein containing butynyloxycarbonyl-lysine and the fatty acid acyl compound are connected through click reaction to obtain a series of GLP-1 and PTH derivatives with obviously prolonged half-life.
Term(s) for
Before the present invention is described, it is to be understood that this invention is not limited to the particular methodology and experimental conditions described, as such methodologies and conditions may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
As used herein, the term "about" when used in reference to a specifically recited value means that the value may vary by no more than 1% from the recited value. For example, as used herein, the expression "about 100" includes 99 and 101 and all values in between (e.g., 99.1, 99.2, 99.3, 99.4, etc.).
As used herein, the term "comprising" or "includes" can be open, semi-closed, and closed. In other words, the term also includes "consisting essentially of …," or "consisting of ….
GLP-1
GLP-1 is a glucose-dependent incretin polypeptide hormone, the GLP-1 stimulates insulin secretion without hypoglycemia, the glucose-dependent insulinotropic secretion characteristic avoids the risk of hypoglycemia frequently existing in diabetes treatment, and the physiological functions enable the development of GLP-1 as a type 2 diabetes treatment medicament to have wide prospects. GLP-1 usually acts on the GLP-1 receptor (GLP-1R), a receptor on the beta cell membrane of pancreatic islets, and promotes the secretion of insulin. However, while native GLP-1 has many advantages in treating diabetes, it is rapidly degraded in vivo by dipeptidyl peptidase IV (DPP-IV). In addition, the natural GLP-1 is rapidly filtered and metabolized by the kidney, so the natural GLP-1 needs to be modified by people to hopefully find GLP-1 analogues which can resist DPP-IV degradation and avoid the rapid filtering and metabolizing of the kidney.
GLP-1 has blood sugar dependent incretin secretion effect; prevent pancreatic beta-cell degeneration, stimulate beta-cell proliferation and differentiation; inducing the transcription of the proinsulin gene and promoting the biosynthesis of the proinsulin; increasing insulin sensitivity; increase somatostatin secretion, inhibit glucagon production (this effect is also glucose-dependent).
Parathyroid hormone (PTH)
Parathyroid hormone (PTH), a 84 amino acid single-chain polypeptide protein secreted by the parathyroid gland, is one of the most important peptide hormones in regulating calcium and phosphorus metabolism and bone turnover. The physiological functions of hPTH are mainly to promote osteogenesis of bone cells, stimulate reabsorption of calcium by the kidney, secretion of phosphorus and remodeling of bone. The current drawback of PTH is mainly that the hPTH molecule is cysteine-free and very unstable in vivo. The PTHI has small molecular weight and is easy to be filtered by glomeruli, so the PTHI has short in-vivo half-life, and the half-life of subcutaneous administration or intramuscular injection is about 12h generally. In order to achieve the treatment effect, frequent large-dose administration (subcutaneous injection once a day for several months) is generally needed, but the frequent administration mode and the long treatment period make patients difficult to bear, and clinically cause adverse reactions such as headache, vomit, fever and the like, and the compliance of the patients is poor. There is therefore an urgent need for long acting formulations or analogues of PTH modified by parathyroid hormone to increase its half-life.
Fatty acid acyl compounds
The polypeptides (such as insulin, PTH and GLP-1) containing the butynyloxycarbonyl-lysine are connected with the fatty acid acyl compound through click reaction to obtain a series of polypeptide derivatives with obviously prolonged half-life.
The fatty acid acyl compound of the invention is a fatty acid acyl compound with 14-18 carbons, and the structural formula is shown as the following formula V or a compound with formula VIII:
Figure BDA0002056315260000091
wherein: a. b, c, d, e and f are each independently integers selected from 0 to 10; n is an integer of 14 to 16.
In another preferred embodiment, the fatty acid acyl compound is selected from the group consisting of: L0-GFA, L2-GFA, L3-GFA, L4-GFA, L5-GFA, or L6-GFA, wherein n is an integer of 14 to 16.
Figure BDA0002056315260000092
Figure BDA0002056315260000101
In another preferred embodiment, the fatty acid acyl compound is selected from the group consisting of: L0-GFA16, L2-GFA16, L3-GFA16, L4-GFA16, L5-GFA16, or L6-GFA 16.
Figure BDA0002056315260000102
Figure BDA0002056315260000111
Polypeptide derivatives
As used herein, the terms "polypeptide analogue", "polypeptide derivative", "derivative of the invention" are used interchangeably and all refer to a polypeptide derivative according to the first aspect of the invention.
The invention also provides a polypeptide derivative as described in the first aspect of the invention.
Specifically, the polypeptide derivatives include:
(a) a polypeptide chain; and
(b) a modifying group L that is attached to a lysine site of the polypeptide chain and that is a group of formula I,
Figure BDA0002056315260000112
wherein the wavy line represents the position of attachment to the lysine site, and m is an integer of 0 to 8; a. b, c, d, e and f are each independently integers selected from 0 to 10; n is an integer of 14 to 16.
In another preferred embodiment, the polypeptide derivative comprises an insulin derivative, a GLP-1 derivative, a PTH derivative, or a combination thereof.
In another preferred example, the A chain of the insulin has a sequence as shown in SEQ ID No. 1 or 2.
In another preferred embodiment, the B chain of the insulin has a sequence as shown in SEQ ID No. 3, 4, 5 or 6.
GIVEQCCTSICSLYQLENYCN(SEQ ID NO.:1)
GIVEQCCTSICSLYQLENYCG(SEQ ID NO.:2)
FVNQHLCGSHLVEALYLVCGERGFFYTPKT(SEQ ID NO.:3)
FVNQHLCGSHLVEALYLVCGERGFFYTPK(SEQ ID NO.:4)
FVNQHLCGSHLVEALYLVCGERGFFYTKPT(SEQ ID NO.:5)
FVNQHLCGSHLVEALYLVCGERGFFYTDKT(SEQ ID NO.:6)
In another preferred example, the GLP-1 has a sequence as shown in any one of SEQ ID No. 7-9.
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG(SEQ ID NO.:7)
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG(SEQ ID NO.:8)
HXEGTFTSDVSSYLEGQAAAKEFIAWLVRGRG (SEQ ID NO: 9) (where X is 2-aminoisobutyric acid (Aib))
In another preferred embodiment, the PTH has the sequence shown in SEQ ID No. 10.
SVSEIQLMHNLGRHLNSMERVEWLRKRLQDVHNF(SEQ ID NO.:10)
In the present invention, insulin derivatives include insulin, insulin precursors and variants of insulin. The variants of insulin differ from any naturally occurring insulin but can nevertheless perform similar actions as human insulin in a glycemic controlled manner in humans. Through genetic engineering of the underlying DNA, the amino acid sequence of insulin can be altered, thereby altering its absorption, distribution, metabolism and secretion properties. Improvements include insulin analogs that are more readily absorbed by the injection site and therefore act more rapidly than the subcutaneous injection of native insulin, intended to supply the drug level of insulin required for meal time (prandial insulin); whereas those insulin analogues, which are slowly released between 8 hours and 24 hours, are intended to provide basal levels of insulin during the day (basal insulin), especially at night. Fast-acting insulin analogs include insulin lispro (li et al) and insulin aspart (Novo Nordisk), while long-acting insulin analogs include NPH insulin, insulin glulisine (Sanofi-Aventis), insulin detemir (Novo Nordisk), and insulin glargine (cenofil-amplat).
As used herein, the term "variant" includes any variant in which (a) one or more amino acid residues are replaced with a naturally or non-naturally occurring amino acid residue; (b) the order of two or more amino acid residues is reversed; (c) both (a) and (b) are present simultaneously; (d) a spacer group is present between any two amino acid residues; (e) one or more amino acid residues are in peptoid form; (f) (iv) the (N-C) backbone of one or more amino acid residues of the peptide is modified, or any combination of (a) to (f). Preferably, the variant is one of (a), (b) or (c).
More preferably, one or two amino acid residues are replaced by one or more other amino acid residues. Still more preferably, one amino acid residue is substituted with another amino acid residue. Preferably, the substitutions are homologous.
Homologous substitutions (both substitutions and substitutions as used herein refer to the interchange of an existing amino acid residue with an alternative residue) may occur, i.e., homologous substitutions, e.g., basic for basic, acidic for acidic, polar for polar, etc. Non-homologous substitutions may also occur, i.e., substitution of one residue for another, or alternatively including unnatural amino acids such as ornithine, diaminobutyric acid ornithine, norleucine ornithine, pyridylalanine, thienylalanine, naphthylalanine and phenylglycine, a more detailed list of which is set forth below. Also more than one amino acid residue may be modified. As used herein, amino acids are classified according to the following categories: alkalinity: H. k, R, respectively; acidity: D. e; non-polar: A. f, G, I, L, M, P, V, W, respectively; polarity: C. n, Q, S, T, Y are provided.
In addition to amino acid spacers (e.g., glycine or β -alanine residues), suitable spacers that may be inserted between any two amino acid residues of the carrier moiety include: alkyl groups such as methyl, ethyl or propyl. One skilled in the art will appreciate that in another variant form, form (e), includes one or more amino acid residues in peptoid form. For the avoidance of doubt, "peptoid form" is used herein to denote variant amino acid residues in which the alpha-C substituent is located on the N atom of the residue rather than on the alpha-C. Preparation of peptides in peptoid form is known in the art, e.g., SimonRJ et al, PNAS (1992)89(20), 9367-. (f) Type modification can be carried out by the methods described in International publication No. PCT/GB 99/01855. Amino acid variants, preferably of type (a) or (b), preferably occur independently at any position. As noted above, more than one homologous or nonhomologous substitution may occur simultaneously. Other variants may be obtained by reversing the sequence of some amino acid residues within the sequence. In one embodiment, the replacement amino acid residue is selected from the group consisting of alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine.
The polypeptide derivatives of the invention may be present in the form of salts or esters, in particular pharmaceutically acceptable salts or esters.
Pharmaceutically acceptable salts of the compounds of the present invention include suitable acid addition or base salts thereof. Suitable pharmaceutically acceptable salts are described in Berge et al, review J Pharm Sci,66,1-19 (1977). With strong mineral acids, such as mineral acids (e.g., sulfuric acid, phosphoric acid, or hydrohalic acids); with strong organic carboxylic acids, such as unsubstituted or substituted (e.g., by halogen) alkanecarboxylic acids having 1 to 4 carbon atoms (e.g., acetic acid); with saturated or unsaturated dicarboxylic acids, such as oxalic acid, malonic acid, succinic acid, maleic acid, fumaric acid, phthalic acid or terephthalic acid; with hydroxycarboxylic acids, such as ascorbic acid, glycolic acid, lactic acid, malic acid, tartaric acid or citric acid; with amino acids, such as aspartic acid or glutamic acid; with benzoic acid; or with organic sulfonic acids, such as unsubstituted or substituted (e.g. by halogen), alkyl-or aryl-sulfonic acids (e.g. methanesulfonic acid or p-toluenesulfonic acid).
The invention also includes solvate forms of the derivatives of the invention. The terms used in the claims encompass these forms. The invention also relates to various crystalline forms, polymorphs and (anhydrous) aqueous forms of the analogs of the invention. The pharmaceutical industry has established the way in which chemical compounds can be isolated in any such form by slightly modifying the purification and/or isolation procedures of the solvents used in the synthetic preparation of the compounds.
The invention also includes derivatives of the invention in prodrug form. Such prodrugs are generally derivatives of the invention wherein one or more suitable groups are modified such that the modification is reversible upon administration to a human or mammalian subject. Such reversion is typically performed by an enzyme naturally present in the subject, although a second agent may also be administered with such a prodrug to perform the reversion in vivo. Examples of such modifications include esters (such as any of those described above) wherein the reversal may be by an esterase. Other such systems are well known to those skilled in the art.
Compared with the prior art, the invention has the beneficial effects that:
(1) compared with the prior art, the insulin derivative and the GLP-1 derivative have more lasting and stable drug effect, lower blood sugar for a long time and obviously prolong the half-life period.
(2) The insulin derivative and the GLP-1 derivative do not cause hypoglycemia, can reduce the injection frequency and have small side effect.
(3) Compared with the prior art, the PTH derivative has more lasting and stable drug effect and obviously prolonged half-life.
(4) The PTH derivative of the invention can reduce the injection frequency and has small side effect.
(5) The preparation method has the advantages of few byproducts, high yield, low cost and simple process, and is suitable for large-scale production. Cyanogen bromide cleavage, oxidative sulfitolysis and related purification steps are not required. Without the need to use high concentrations of mercaptans or hydrophobic adsorption resins. The purification steps are few, and the production cost is low.
The present invention will be described in further detail with reference to the following examples. It should be understood that these examples are for illustrative purposes only and are not intended to limit the scope of the present invention. Experimental procedures without specifying the detailed conditions in the following examples, generally followed by conventional conditions such as Sambrook et al, molecular cloning: the conditions described in the laboratory Manual (New York: Cold Spring harbor laboratory Press,1989), or according to the manufacturer's recommendations. Unless otherwise indicated, percentages and parts are by weight. The test materials and reagents used in the following examples are commercially available without specific reference.
Example 1: synthesis of recombinant insulin protein containing butynyloxycarbonyl-lysine
A DNA fragment encoding a recombinant insulin protein comprising butynyloxycarbonyl-lysine having the amino acid sequence of SEQ ID No. 11, in which the coding sequence of lysine (K) at position 80 is replaced with TAG (encoding a lysine derivative), was chemically synthesized. The DNA fragment encoding the complete amino acid sequence of SEQ ID No. 11 was then cloned into the modified pBAD-Hi sA vector. The resulting plasmid was used for expression of recombinant insulin protein with the structure of butynyloxycarbonyl-lysine. This plasmid was transformed into the E.coli strain Top10 together with the enzyme plasmid pEvol-pylRs-pylT. The transformation solution was cultured overnight at 37 ℃ on LB agar medium containing 25. mu.g/mL of kanamycin and 17. mu.g/mL of chloramphenicol. Single colonies were picked and shake-cultured overnight at 220rpm at 37 ℃ in LB liquid medium containing 25. mu.g/mL kanamycin and 17. mu.g/mL chloramphenicol. Then, the overnight culture was inoculated into 100mL TB liquid medium containing 25. mu.g/mL kanamycin and 17. mu.g/mL chloramphenicol, and cultured at 37 ℃ until OD600Is 2-4. Then, a 25% arabinose solution was added to the medium to a final concentration of 0.25%, and a 0.1M butynyloxycarbonyl-lysine solution was added to a final concentration of 5mM to induceExpression of the fusion protein. The culture solution is cultured for 16-20h, and then centrifuged (10000rpm, 5min, 4 ℃) for collection.
Amino acid sequence of SEQ ID No. 11:
MVSKGEELFTGVTYKTRAEVKFEGDDDDDKTLVNRIELKGIDFENLYFQGRFVNQHLCGSHLVEALYLVCGERGFFYTPKTRGIVEQCCTSICSLYQLENYCN, wherein K at position 80 is a lysine to which is covalently attached a butynyloxycarbonyl group.
The fusion protein is expressed as insoluble "inclusion bodies". In order to release the inclusion body, high pressure homogenizer is used to break the Escherichia coli cells, 5000g centrifugation method is used to remove cell debris and soluble Escherichia coli host protein, Tween 80, EDTA, NaCl solution washing inclusion body, and pure water washing inclusion body 1-2 times. The washed inclusion bodies were dissolved in 7.5M urea pH 10.5-11.5 containing 2-10mM beta-mercaptoethanol to a total protein concentration of 10-25mg/ml after dissolution. The sample is diluted 5-10 times, maintained at 4-8 deg.C, and folded for 14-30 hr under pH 10.5-11.7. Keeping pH at 8.0-9.5 at 18-25 deg.C, performing enzyme digestion with trypsin and carboxypeptidase B for 10-20 hr, and adding 0.45M ammonium sulfate to terminate enzyme digestion reaction. The reverse phase HPLC analysis showed that the yield of this cleavage step was higher than 90%. The insulin analogue obtained after cleavage of trypsin with carboxypeptidase B was named butynyloxycarbonyl-lysine-human insulin. And (3) clarifying the sample by membrane filtration, and primarily purifying by hydrophobic chromatography by using 0.45M ammonium sulfate as a buffer solution A and pure water as a buffer solution B to obtain crude extract of the butynyloxycarbonyl-lysine-human insulin, wherein the electrophoretic purity reaches 90%. Then purifying by polymer reversed-phase filler and C8 reversed-phase filler to finally obtain the butynyloxycarbonyl-lysine-human insulin with the purity higher than 99 percent.
Figure BDA0002056315260000151
Example 2: synthesis of L0-GFA 16-insulin (n is 14)
Because the fatty acid acyl compound has an azide group, the insulin protein with terminal alkyne is introduced, and the alkyne and the azide react to generate a1, 2, 3-triazole ring by utilizing the click chemistry reaction principle to form cross-linking. To a 1.5ml clean centrifuge tube was added 4. mu.L copper sulfate (50. mu.M), followed by 3. mu.L BTTAA (300. mu.M) and 10. mu.L of the compound IV prepared in example 1 (human insulin protein N- (butynyloxycarbonyl) -lysine) (approximately 5. mu.M) in that order. At this point, the solution may be diluted to the appropriate volume or protein concentration. To this solution was added 1. mu.L of L0-GFA16 (1mM), and 2. mu.L of sodium ascorbate (2.5mM) to initiate the reaction. After about 1 hour at room temperature, 5. mu.L of SDS-PAGE sample buffer was added, heated to 100 ℃ for 10min, and analyzed by 12% SDS-PAGE. The gel was recovered, imaged on the gel, analyzed by fluorescence, and then stained with Coomassie Brilliant blue.
Figure BDA0002056315260000152
Example 3: synthesis of L2-GFA 16-insulin, L3-GFA 16-insulin, L4-GFA 16-insulin, L5-GFA 16-insulin, L6-GFA 16-insulin (n is 14)
To a 1.5ml clean centrifuge tube was added 4. mu.L copper sulfate (50. mu.M), followed by 3. mu.L LBTTAA (300. mu.M) and 10. mu.L of the N- (butynyloxycarbonyl) -lysine human insulin protein prepared in example 1 (approximately 5. mu.M) in that order. At this point, water may need to be added to dilute the solution to the correct volume or protein concentration. To this solution was added 1. mu.L of L0-GFA16 (1mM), and 2. mu.L of sodium ascorbate (2.5mM) to initiate the reaction. After about 1 hour at room temperature, 5. mu.L of SDS-PAGE sample buffer was added, heated to 100 ℃ for 10min, and analyzed by 12% SDS-PAGE. The gel was recovered, imaged on the gel, analyzed by fluorescence, and then stained with Coomassie Brilliant blue.
Figure BDA0002056315260000161
Similarly, the structures of products obtained by click-reacting the IV compound prepared in example 1 with L3-GFA16, L4-GFA16, L5-GFA16, and L6-GFA16, respectively, are as follows.
Figure BDA0002056315260000162
Example 4: pharmacokinetic study of insulin derivatives in rat
The experiment is divided into a control group and a test group, recombinant human insulin and L6-GFA 16-insulin are respectively injected subcutaneously, the administration dose is 0.45mg/kg, and the administration is carried out once. Blood was collected at time points of 15min, 30min, 1h, 2h, 3h, 5h, 7h, 12h, and 24h after administration for each group of animals. And detecting the content of different insulin analogues by an LC-MS/MS analysis method. Plasma concentration data were statistically analyzed using the pharmacokinetic data analysis software WinNonlin 7.0 and drug parameters were calculated using the non-compartmental model (NCA) (table 1). As can be seen from Table 1, the peak reaching time of the drug in each group of animals is close and is 0.5-1 hour, the half-life of the L6-GFA 16-insulin is 3-4 times of that of the recombinant human insulin, the exposure time of the drug in vivo is prolonged, and the exposure amount is increased.
TABLE 1 major pharmacokinetic parameters in the animals of each group
Figure BDA0002056315260000171
The above experiment was repeated except that the present invention was used with L0-GFA 16-insulin, L2-GFA 16-insulin, L3-GFA 16-insulin, L4-GFA 16-insulin, and L5-GFA 16-insulin. As a result, the insulin derivative provided by the invention has the advantages that the biological activity is maintained, and meanwhile, the half-life period is remarkably prolonged.
Example 5: synthesis of GLP-1 protein containing butynyloxycarbonyl-lysine
A DNA fragment encoding a GLP-1 protein comprising butynyloxycarbonyl-lysine having the amino acid sequence of SEQ ID No. 12, wherein the coding sequence of lysine (K) at position 70 is replaced with TAG (encoding a lysine derivative), was chemically synthesized. The DNA fragment encoding the complete amino acid sequence of SEQ ID No. 12 was then cloned into the modified pBAD-HisA vector. The resulting plasmid was used for the structure butynyloxycarbonyl-expression of recombinant GLP-1 protein of lysine. This plasmid was transformed into the E.coli strain Top10 together with the enzyme plasmid pEvol-pylRs-pylT. The transformation solution was cultured overnight at 37 ℃ on LB agar medium containing 25. mu.g/mL of kanamycin and 17. mu.g/mL of chloramphenicol. Single colonies were picked and shake-cultured overnight at 220rpm at 37 ℃ in LB liquid medium containing 25. mu.g/mL kanamycin and 17. mu.g/mL chloramphenicol. Then, the overnight culture was inoculated into 100mL TB liquid medium containing 25. mu.g/mL kanamycin and 17. mu.g/mL chloramphenicol, and cultured at 37 ℃ until OD600Is 2-4. Then, a 25% arabinose solution was added to the medium to a final concentration of 0.25%, and a 0.1M butynyloxycarbonyl-lysine solution was added to a final concentration of 5mM to induce expression of the fusion protein. The culture solution is cultured for 16-20h, and then centrifuged (10000rpm, 5min, 4 ℃) for collection.
Amino acid sequence of SEQ ID No. 12:
MVSKGEELFTGVTYKTRAEVKFEGDTLVNRIELKGIDFENLYFQGDDDDKHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, wherein the K at position 70 is a lysine to which is covalently attached a butynyloxycarbonyl group.
The fusion protein is expressed as insoluble "inclusion bodies". In order to release the inclusion body, high pressure homogenizer is used to break the Escherichia coli cells, 5000g centrifugation method is used to remove cell debris and soluble Escherichia coli host protein, after Tween 80, EDTA, NaCl solution washing inclusion body, and then pure water washing inclusion body 1-2 times. The washed inclusion bodies were dissolved in 7.5M urea pH 10.5-11.5 containing 2-10mM beta-mercaptoethanol to a total protein concentration of 10-25mg/ml after dissolution. The sample is diluted 5-10 times, maintained at 4-8 deg.C, and folded for 14-30 hr under pH 10.5-11.7. After the renaturation liquid is clarified, the fusion protein is separated and purified by weak anion filler under the condition of pH9.0, and the electrophoretic purity of the target protein reaches 80%. Desalting the high-salt eluted sample, maintaining the pH value at about 8.0-9.0 at 25 ℃, performing enzyme digestion for about 10-20 hours by enterokinase, and analyzing the result by reverse phase HPLC, wherein the yield of the enzyme digestion step is higher than 90%. The GLP-1 analogue obtained after enterokinase cleavage is named butynyloxycarbonyl-lysine-GLP-1. After enzyme digestion, the mixture is purified by hydrophobic filler to extract the butynyloxycarbonyl-lysine-GLP-1, and the electrophoretic purity reaches 90 percent.
Figure BDA0002056315260000181
Example 6: synthesis of L0-GFA16-GLP-1 (n is 14)
Because the fatty acid acyl compound has an azide group, GLP-1 protein with terminal alkyne is introduced, and the alkyne and the azide react to generate 1, 2, 3-triazole ring by utilizing the click chemistry reaction principle to form cross-linking. To a 1.5ml clean centrifuge tube was added 4. mu.L copper sulfate (50. mu.M), followed by 3. mu.L BTTAA (300. mu.M) and 10. mu.L of the IV compound prepared in example 5 (GLP-1 protein of N- (butynyloxycarbonyl) -lysine) (approximately 5. mu.M) in that order. At this point, the solution may be diluted to the appropriate volume or protein concentration. To this solution was added 1. mu.L of L0-GFA16 (1mM), and 2. mu.L of sodium ascorbate (2.5mM) to initiate the reaction. After about 1 hour at room temperature, 5. mu.L of SDS-PAGE sample buffer was added, heated to 100 ℃ for 10min, and analyzed by 12% SDS-PAGE. The gel was recovered, imaged on the gel, analyzed by fluorescence, and then stained with Coomassie Brilliant blue.
Figure BDA0002056315260000182
Example 7: synthesis of L2-GFA16-GLP-1, L3-GFA16-GLP-1, L4-GFA16-GLP-1, L5-GFA16-GLP-1, L6-GFA16-GLP-1 (n is 14)
To a 1.5ml clean centrifuge tube was added 4. mu.L copper sulfate (50. mu.M), followed by 3. mu.L LBTTAA (300. mu.M) and 10. mu.L of the N- (butynyloxycarbonyl) -lysine GLP-1 protein prepared in example 5 (about 5. mu.M) in that order. At this point, water may need to be added to dilute the solution to the correct volume or protein concentration. To this solution was added 1. mu.L of L0-GFA16 (1mM), and 2. mu.L of sodium ascorbate (2.5mM) to initiate the reaction. After about 1 hour at room temperature, 5. mu.L of SDS-PAGE sample buffer was added, heated to 100 ℃ for 10min, and analyzed by 12% SDS-PAGE. The gel was recovered, imaged on the gel, analyzed by fluorescence, and then stained with Coomassie Brilliant blue.
Figure BDA0002056315260000191
Similarly, the products obtained by click-reacting the IV compound prepared in example 5 with L3-GFA16, L4-GFA16, L5-GFA16, and L6-GFA16, respectively, have the following structures.
Figure BDA0002056315260000192
Example 8: pharmacokinetics study of GLP-1 derivative in rat body
The experiment is divided into a reference substance group and a test substance group, GLP-1 and L6-GFA16-GLP-1 are respectively injected into the vein, the administration dose is 0.5mg/kg, and the administration is carried out once. Blood was collected at time points of 15min, 30min, 1h, 2h, 3h, 5h, 7h, 12h, and 24h after administration for each group of animals. And detecting the content of different insulin analogues by an LC-MS/MS analysis method. Plasma concentration data were statistically analyzed using the pharmacokinetic data analysis software WinNonlin 7.0 and drug parameters were calculated using the non-compartmental model (NCA) (table 2).
As can be seen from Table 2, the peak reaching time of the drug in each group of animals is close, about 4.8min, the exposure time of L6-GFA16-GLP-1 in vivo is prolonged, and the exposure amount is obviously increased.
TABLE 2 major pharmacokinetic parameters in the animals of each group
Figure BDA0002056315260000201
The above experiment was repeated except that the present invention was used L0-GFA16-GLP-1, L2-GFA16-GLP-1, L3-GFA1-GLP-1, L4-GFA16-GLP-1, and L5-GFA 16-GLP-1. As a result, the GLP-1 derivative provided by the invention has the advantages that the half-life period is remarkably prolonged while the bioactivity is maintained.
Example 9: synthesis of butynyloxycarbonyl-lysine-containing PTH protein
A DNA fragment encoding a PTH protein of butynyloxycarbonyl-lysine comprising the amino acid sequence of SEQ ID No. 13 was synthesized chemically, in which the coding sequence of lysine (K) at position 76 was replaced with TAG (encoding a lysine derivative). The DNA fragment encoding the complete amino acid sequence of SEQ ID No. 13 was then cloned into the modified pBAD-HisA vector. The resulting plasmid was used for expression of recombinant PTH protein with the structure butynyloxycarbonyl-lysine. This plasmid was transformed into the E.coli strain Top10 together with the enzyme plasmid pEvol-pylRs-pylT. The transformation solution was cultured overnight at 37 ℃ on LB agar medium containing 25. mu.g/mL of kanamycin and 17. mu.g/mL of chloramphenicol. Single colonies were picked and shake-cultured overnight at 220rpm at 37 ℃ in LB liquid medium containing 25. mu.g/mL kanamycin and 17. mu.g/mL chloramphenicol. Then, the overnight culture was inoculated into 100mL TB liquid medium containing 25. mu.g/mL kanamycin and 17. mu.g/mL chloramphenicol, and cultured at 37 ℃ until OD600Is 2-4. Then, a 25% arabinose solution was added to the medium to a final concentration of 0.25%, and a 0.1M butynyloxycarbonyl-lysine solution was added to a final concentration of 5mM to induce expression of the fusion protein. The culture solution is cultured for 16-20h, and then centrifuged (10000rpm, 5min, 4 ℃) for collection.
Amino acid sequence of SEQ ID No. 13:
MVSKGEELFTGVTYKTRAEVKFEGDTLVNRIELKGIDFENLYFQGDDDDKSVSEIQLMHNLGRHLNSMERVEWLRKRLQDVHNF, wherein K at position 76 is a lysine to which is covalently attached a butynyloxycarbonyl group.
The fusion protein is expressed as insoluble "inclusion bodies". In order to release the inclusion body, high pressure homogenizer is used to break the Escherichia coli cells, 5000g centrifugation method is used to remove cell debris and soluble Escherichia coli host protein, after Tween 80, EDTA, NaCl solution washing inclusion body, and then pure water washing inclusion body 1-2 times. The washed inclusion bodies were dissolved in 7.5M urea pH 10.5-11.5 containing 2-10mM beta-mercaptoethanol to a total protein concentration of 10-25mg/ml after dissolution. The sample is diluted 5-10 times, maintained at 4-8 deg.C, and folded conventionally at pH 10.5-11.7 for 14-30 hr. After the renaturation liquid is clarified, the fusion protein is separated and purified by weak anion filler under the condition of pH9.0, and the electrophoretic purity of the target protein reaches 80%. Desalting the high-salt eluted sample, maintaining the pH value at about 8.0-9.0 at 25 ℃, performing enzyme digestion for about 10-20 hours by enterokinase, and analyzing the result by reverse phase HPLC, wherein the yield of the enzyme digestion step is higher than 90%. The PTH analogue obtained after enterokinase cleavage was named butynyloxycarbonyl-lysine-PTH. After enzyme digestion, the product is purified by hydrophobic filler to extract butynyloxycarbonyl-lysine-PTH, and the electrophoresis purity reaches 90%.
Figure BDA0002056315260000211
The same procedures as in examples 6 and 7 were carried out by replacing the N- (butynyloxycarbonyl) -lysine-containing GLP-1 protein with the N- (butynyloxycarbonyl) -lysine-containing PTH protein to synthesize L0-GFA16-PTH, L2-GFA16-PTH, L3-GFA16-PTH, L4-GFA16-PTH, L5-GFA16-PTH and L6-GFA 16-PTH.
Example 10: pharmacokinetic study of PTH-1 derivative of the present invention in rat
The experiment is divided into a control group and a test group, PTH and L6-GFA16-PTH are injected subcutaneously respectively, the administration dosage is 8.6 mu g/kg, and the administration is carried out once. Blood was collected at time points 0min, 5min, 15min, 30min, 1h, 2h, and 4h after administration for each group of animals. And detecting the content of different insulin analogues by an LC-MS/MS analysis method. Plasma concentration data were statistically analyzed using the pharmacokinetic data analysis software WinNonlin 7.0 and drug parameters were calculated using the non-compartmental model (NCA) (table 3). As shown in Table 3, the peak reaching time of L6-GFA16-PTH in the animals was prolonged to about 1.6h, and the exposure time of the drug in vivo was prolonged and the exposure amount was increased.
TABLE 3 major pharmacokinetic parameters in the animals of each group
Figure BDA0002056315260000212
The above experiment was repeated except that the present invention was used with L0-GFA16-PTH, L2-GFA16-PTH, L3-GFA16-PTH, L4-GFA16-PTH, L5-GFA 16-PTH. As a result, the PTH derivative provided by the invention is remarkably prolonged in half-life while maintaining the bioactivity.
All documents referred to herein are incorporated by reference into this application as if each were individually incorporated by reference. Furthermore, it should be understood that various changes and modifications of the present invention can be made by those skilled in the art after reading the above teachings of the present invention, and these equivalents also fall within the scope of the present invention as defined by the appended claims.
Sequence listing
<110> Ningbo spread Biotechnology Ltd
<120> polypeptide derivatives and process for producing the same
<130> P2018-1748
<160> 13
<170> SIPOSequenceListing 1.0
<210> 1
<211> 21
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 1
Gly Ile Val Glu Gln Cys Cys Thr Ser Ile Cys Ser Leu Tyr Gln Leu
1 5 10 15
Glu Asn Tyr Cys Asn
20
<210> 2
<211> 21
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 2
Gly Ile Val Glu Gln Cys Cys Thr Ser Ile Cys Ser Leu Tyr Gln Leu
1 5 10 15
Glu Asn Tyr Cys Gly
20
<210> 3
<211> 30
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 3
Phe Val Asn Gln His Leu Cys Gly Ser His Leu Val Glu Ala Leu Tyr
1 5 10 15
Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Pro Lys Thr
20 25 30
<210> 4
<211> 29
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 4
Phe Val Asn Gln His Leu Cys Gly Ser His Leu Val Glu Ala Leu Tyr
1 5 10 15
Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Pro Lys
20 25
<210> 5
<211> 30
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 5
Phe Val Asn Gln His Leu Cys Gly Ser His Leu Val Glu Ala Leu Tyr
1 5 10 15
Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Lys Pro Thr
20 25 30
<210> 6
<211> 30
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 6
Phe Val Asn Gln His Leu Cys Gly Ser His Leu Val Glu Ala Leu Tyr
1 5 10 15
Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Asp Lys Thr
20 25 30
<210> 7
<211> 31
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 7
His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg Gly
20 25 30
<210> 8
<211> 31
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 8
His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Arg Gly Arg Gly
20 25 30
<210> 9
<211> 31
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 9
His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly
1 5 10 15
Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Arg Gly Arg Gly
20 25 30
<210> 10
<211> 34
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 10
Ser Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Arg His Leu Asn
1 5 10 15
Ser Met Glu Arg Val Glu Trp Leu Arg Lys Arg Leu Gln Asp Val His
20 25 30
Asn Phe
<210> 11
<211> 103
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 11
Met Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Thr Tyr Lys Thr
1 5 10 15
Arg Ala Glu Val Lys Phe Glu Gly Asp Asp Asp Asp Asp Lys Thr Leu
20 25 30
Val Asn Arg Ile Glu Leu Lys Gly Ile Asp Phe Glu Asn Leu Tyr Phe
35 40 45
Gln Gly Arg Phe Val Asn Gln His Leu Cys Gly Ser His Leu Val Glu
50 55 60
Ala Leu Tyr Leu Val Cys Gly Glu Arg Gly Phe Phe Tyr Thr Pro Lys
65 70 75 80
Thr Arg Gly Ile Val Glu Gln Cys Cys Thr Ser Ile Cys Ser Leu Tyr
85 90 95
Gln Leu Glu Asn Tyr Cys Asn
100
<210> 12
<211> 81
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 12
Met Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Thr Tyr Lys Thr
1 5 10 15
Arg Ala Glu Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu
20 25 30
Leu Lys Gly Ile Asp Phe Glu Asn Leu Tyr Phe Gln Gly Asp Asp Asp
35 40 45
Asp Lys His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu
50 55 60
Glu Gly Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg
65 70 75 80
Gly
<210> 13
<211> 84
<212> PRT
<213> Artificial sequence (artificial sequence)
<400> 13
Met Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Thr Tyr Lys Thr
1 5 10 15
Arg Ala Glu Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu
20 25 30
Leu Lys Gly Ile Asp Phe Glu Asn Leu Tyr Phe Gln Gly Asp Asp Asp
35 40 45
Asp Lys Ser Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Arg His
50 55 60
Leu Asn Ser Met Glu Arg Val Glu Trp Leu Arg Lys Arg Leu Gln Asp
65 70 75 80
Val His Asn Phe

Claims (10)

1. A polypeptide derivative, wherein said polypeptide derivative comprises:
(a) a polypeptide; and
(b) a modifying group L, wherein the modifying group L is connected to a lysine site of the polypeptide and is a group shown in a formula I,
Figure FDA0002056315250000011
wherein the wavy line represents the position of attachment to the lysine site, and m is an integer of 0 to 8; a. b, c, d, e and f are each independently integers selected from 0 to 10; n is an integer of 14 to 16.
2. The polypeptide derivative of claim 1, wherein the group Y is a group selected from the group consisting of:
Figure FDA0002056315250000012
3. the polypeptide derivative of claim 1, wherein the polypeptide is selected from the group consisting of: insulin, GLP-1, PTH, or a combination thereof.
4. The polypeptide derivative of claim 1, wherein the a chain of insulin has a sequence as set forth in SEQ ID No.:1 or 2; and/or
The B chain of the insulin has a sequence shown as SEQ ID No. 3, 4, 5 or 6; and/or
The GLP-1 has a sequence shown in any one of SEQ ID NO. 7-9; and/or
The PTH has a sequence shown in SEQ ID No. 10.
5. A pharmaceutical composition comprising the polypeptide derivative of claim 1, and a pharmaceutically acceptable carrier.
6. Use of a polypeptide derivative according to claim 1 for the preparation of a medicament or formulation for the prevention and/or treatment of osteoporosis, diabetes, hyperglycemia and other diseases where a reduction of blood glucose would be beneficial.
7. A method for preparing a polypeptide derivative, said method comprising the steps of:
(1) culturing a strain comprising an insulin-encoding sequence in the presence of an X group-lysine, a pyrrolysinyl-tRNA synthetase and its cognate tRNA, wherein the encoding sequence for the lysine site in the polypeptide is TAG, thereby producing a polypeptide derivative, wherein the polypeptide derivative comprises:
(a) a polypeptide chain; and
(b) a modifying group L, said modifying group L being attached to a lysine site of said polypeptide and said modifying group L being a group X, group X being as defined in claim 1; and optionally
(2) Isolating said polypeptide derivative from the fermentation product.
8. A method for preparing a polypeptide derivative, said method comprising the steps of:
(1) in the presence of a compound of formula III, a pyrrolysinyl-tRNA synthetase and its cognate tRNA,
culturing a strain containing a polypeptide coding sequence, wherein the coding sequence of a lysine site in the polypeptide is TAG, thereby obtaining a compound of formula IV; and
Figure FDA0002056315250000021
(2) reacting a compound of formula IV with a compound of formula V in an inert solvent to obtain a polypeptide derivative,
Figure FDA0002056315250000022
in the formula V, a, b, c, d, e and f are respectively and independently integers selected from 0 to 10; n is an integer of 14 to 16.
9. A method for preparing a polypeptide derivative, said method comprising the steps of:
(1) in the presence of a compound of formula VI, a pyrrolysinyl-tRNA synthetase and its cognate tRNA,
culturing a strain comprising a polypeptide-encoding sequence, wherein the coding sequence for a lysine site in a polypeptide in said encoding sequence is TAG, thereby obtaining a compound of formula VII; and
Figure FDA0002056315250000031
(2) reacting a compound of formula VII with a compound of formula VIII in an inert solvent to obtain a polypeptide derivative,
Figure FDA0002056315250000032
in the formula VIII, a, b, c, d, e and f are respectively and independently integers selected from 0 to 10; n is an integer of 14 to 16.
10. An intermediate, comprising:
(a) a polypeptide, wherein the polypeptide is insulin, GLP-1 or PTH; and
(b) a modifying group L, wherein the modifying group L is connected to a lysine site of the polypeptide and is a group shown in a formula A,
Figure FDA0002056315250000033
wherein the wavy line represents the position of attachment to the lysine site, and m is an integer of 0 to 8.
CN201910390476.3A 2019-05-10 2019-05-10 Polypeptide derivatives and process for preparing the same Pending CN111909256A (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
CN201910390476.3A CN111909256A (en) 2019-05-10 2019-05-10 Polypeptide derivatives and process for preparing the same
CN202080035118.1A CN113811614A (en) 2019-05-10 2020-05-08 Polypeptide derivatives and process for preparing the same
EP20806421.2A EP3967759A4 (en) 2019-05-10 2020-05-08 Polypeptide derivative and preparation method therefor
CA3139826A CA3139826A1 (en) 2019-05-10 2020-05-08 Polypeptide derivative and preparation method therefor
JP2021567053A JP7453698B2 (en) 2019-05-10 2020-05-08 Polypeptide derivatives and methods for their preparation
US17/610,606 US20220211857A1 (en) 2019-05-10 2020-05-08 Polypeptide derivative and preparation method thereof
BR112021022629A BR112021022629A2 (en) 2019-05-10 2020-05-08 Polypeptide derivative and method of preparation thereof
PCT/CN2020/089217 WO2020228610A1 (en) 2019-05-10 2020-05-08 Polypeptide derivative and preparation method therefor
AU2020276560A AU2020276560A1 (en) 2019-05-10 2020-05-08 Polypeptide derivative and preparation method thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201910390476.3A CN111909256A (en) 2019-05-10 2019-05-10 Polypeptide derivatives and process for preparing the same

Publications (1)

Publication Number Publication Date
CN111909256A true CN111909256A (en) 2020-11-10

Family

ID=73242938

Family Applications (2)

Application Number Title Priority Date Filing Date
CN201910390476.3A Pending CN111909256A (en) 2019-05-10 2019-05-10 Polypeptide derivatives and process for preparing the same
CN202080035118.1A Pending CN113811614A (en) 2019-05-10 2020-05-08 Polypeptide derivatives and process for preparing the same

Family Applications After (1)

Application Number Title Priority Date Filing Date
CN202080035118.1A Pending CN113811614A (en) 2019-05-10 2020-05-08 Polypeptide derivatives and process for preparing the same

Country Status (8)

Country Link
US (1) US20220211857A1 (en)
EP (1) EP3967759A4 (en)
JP (1) JP7453698B2 (en)
CN (2) CN111909256A (en)
AU (1) AU2020276560A1 (en)
BR (1) BR112021022629A2 (en)
CA (1) CA3139826A1 (en)
WO (1) WO2020228610A1 (en)

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101133082A (en) * 2005-03-18 2008-02-27 诺和诺德公司 Acylated GLP-1 compounds
CN102504022A (en) * 2011-11-30 2012-06-20 苏州元基生物技术有限公司 Proinsulin containing protecting lysine and preparation method for insulin by utilizing proinsulin
CN104099360A (en) * 2013-04-12 2014-10-15 北京大学 Preparation for protein or peptide labeled by unnatural amino acid
CN104120163A (en) * 2013-04-28 2014-10-29 正大天晴药业集团股份有限公司 Determination method of modification site of protein pharmaceutical modified by polyethylene glycol
CN105154498A (en) * 2007-12-28 2015-12-16 诺沃—诺迪斯克有限公司 Semi-recombinant preparation of GLP-1 analogues
CN108220315A (en) * 2016-12-22 2018-06-29 珠海冀百康生物科技有限公司 The preparation method and fusion protein of a kind of small molecular protein or polypeptide

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2018437A2 (en) 2006-05-02 2009-01-28 Allozyne, Inc. Non-natural amino acid substituted polypeptides
US8962794B2 (en) * 2007-08-15 2015-02-24 Novo Nordisk A/S Insulins with an acyl moiety comprising repeating units of alkylene glycol containing amino acids
CN102307905B (en) 2008-12-10 2015-11-25 斯克利普斯研究院 Chemical reactivity alpha-non-natural amino acid is utilized to produce carrier-peptide conjugate
US20130078671A1 (en) * 2011-03-25 2013-03-28 The Texas A&M University System Incorporation of two different noncanonical amino acids into a single protein
US8772277B2 (en) * 2011-08-04 2014-07-08 Takeda Pharmaceutical Company Limited Nitrogen-containing heterocyclic compound
CN105026574B (en) * 2012-09-24 2019-08-30 米迪缪尼有限公司 Cell line
US10588980B2 (en) * 2014-06-23 2020-03-17 Novartis Ag Fatty acids and their use in conjugation to biomolecules
US9434778B2 (en) * 2014-10-24 2016-09-06 Bristol-Myers Squibb Company Modified FGF-21 polypeptides comprising an internal deletion and uses thereof
EP3309260A1 (en) * 2016-10-14 2018-04-18 European Molecular Biology Laboratory Archaeal pyrrolysyl trna synthetases for orthogonal use
CN110366428A (en) 2016-12-30 2019-10-22 Sutrovax公司 Polypeptide with unnatural amino acid-antigen conjugate
CN107033234B (en) * 2017-01-03 2018-06-26 北京凯因科技股份有限公司 Acylated glp-1 derivatives
JP2020506932A (en) * 2017-02-03 2020-03-05 ハンミ ファーマシューティカル カンパニー リミテッド Conjugates of bioactive substances with increased persistence and uses thereof

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101133082A (en) * 2005-03-18 2008-02-27 诺和诺德公司 Acylated GLP-1 compounds
CN105154498A (en) * 2007-12-28 2015-12-16 诺沃—诺迪斯克有限公司 Semi-recombinant preparation of GLP-1 analogues
CN102504022A (en) * 2011-11-30 2012-06-20 苏州元基生物技术有限公司 Proinsulin containing protecting lysine and preparation method for insulin by utilizing proinsulin
CN104099360A (en) * 2013-04-12 2014-10-15 北京大学 Preparation for protein or peptide labeled by unnatural amino acid
CN104120163A (en) * 2013-04-28 2014-10-29 正大天晴药业集团股份有限公司 Determination method of modification site of protein pharmaceutical modified by polyethylene glycol
CN108220315A (en) * 2016-12-22 2018-06-29 珠海冀百康生物科技有限公司 The preparation method and fusion protein of a kind of small molecular protein or polypeptide

Also Published As

Publication number Publication date
JP7453698B2 (en) 2024-03-21
CN113811614A (en) 2021-12-17
US20220211857A1 (en) 2022-07-07
BR112021022629A2 (en) 2022-01-04
AU2020276560A1 (en) 2022-01-20
WO2020228610A1 (en) 2020-11-19
EP3967759A4 (en) 2023-08-23
JP2022533066A (en) 2022-07-21
EP3967759A1 (en) 2022-03-16
CA3139826A1 (en) 2020-11-19

Similar Documents

Publication Publication Date Title
TWI433681B (en) Novel insulin derivatives with extremely delayed time/action profile
JP5694779B2 (en) Novel insulin derivatives with extremely delayed time action profiles
KR102066987B1 (en) Polypeptides
US7566691B2 (en) Vasoactive intestinal polypeptide pharmaceuticals
JPH0469128B2 (en)
JP2011526886A (en) Novel insulin analogues with sustained activity
DE102008003566A1 (en) New insulin analogs useful for treating diabetes
EP2720711A1 (en) Multi substituted insulins
EP3845240A1 (en) Novel pro-insulin aspart structure and method for preparing insulin aspart
CN113105536A (en) Novel proinsulin and method for preparing insulin glargine by using same
US20170368147A1 (en) Chemically and thermodynamically stable insulin analogues and improved methods for their production
CA3166496A1 (en) Long-acting glp-1 compound
CN111909256A (en) Polypeptide derivatives and process for preparing the same
RU2792236C1 (en) Polypeptide derivative and method for its production
RU2792236C9 (en) Polypeptide derivative and method for its production
CN111909255A (en) Insulin derivatives and process for preparing the same
KR20050059258A (en) Glp-2 compounds, formulations, and uses thereof
WO2014122653A1 (en) Process for preparing insulin
CN116789801B (en) Novel insulin derivatives and uses thereof
KR20190043609A (en) Proinsulin derivative
DE102008025007A1 (en) Insulin analogs which comprise A chain and B chain with disulfide bonds for use in treatment of diabetes and for cartilage regeneration

Legal Events

Date Code Title Description
PB01 Publication
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
CB03 Change of inventor or designer information
CB03 Change of inventor or designer information

Inventor after: Zhang Zhenshan

Inventor after: Wu Song

Inventor after: Liu Huiling

Inventor after: Chen Wei

Inventor before: Zha Ruopeng

Inventor before: Zhang Zhenshan

Inventor before: Wu Song

Inventor before: Liu Huiling

Inventor before: Chen Wei