WO2014039585A2 - Chimeric polypeptides having targeted binding specificity - Google Patents
Chimeric polypeptides having targeted binding specificity Download PDFInfo
- Publication number
- WO2014039585A2 WO2014039585A2 PCT/US2013/058100 US2013058100W WO2014039585A2 WO 2014039585 A2 WO2014039585 A2 WO 2014039585A2 US 2013058100 W US2013058100 W US 2013058100W WO 2014039585 A2 WO2014039585 A2 WO 2014039585A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- recombinase
- tale
- protein
- serine recombinase
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/80—Fusion polypeptide containing a DNA binding domain, e.g. Lacl or Tet-repressor
Definitions
- the present invention relates generally to the field of biotechnology, and more specifically to chimeric recombinases that recognize specific DNA sequences.
- ZFPs C 2 H 2 zinc-finger proteins
- Transcription activator-like effector (TALE) domains are a class of naturally occurring DNA-binding domains (DBDs) that represent a potential alternative to ZFP technology.
- TALEs which are found in the plant pathogen Xanthomonas, contain a series of 33 to 35 amino acid repeats that function to selectively bind target DNA sequences. These repeats are identical with the exception of two adjacent repeat variable di-residues (RVDs) that confer DNA specificity by mediating binding to a single nucleotide. Arrays of over 30 repeats have been described that bind to DNA sites of similar numbers of base pairs (bps). Although there is inherent degeneracy in the binding of each RVD, recent reports have indicated that synthetic TALE proteins are specific enough to target single loci within the human genome.
- TALENs DNA double-strand breaks
- SSRs site-specific recombinases
- Cre and Flp site-specific recombinases
- recombinases of the resolvase/invertase type provide a versatile alternative to tyrosine recombinases for genome engineering.
- these enzymes function as multi-domain protein complexes that coordinate recombination in a highly modular manner.
- mutants of several serine recombinases have been identified that do not require accessory factors for recombination.
- numerous studies have shown that the native DBDs of serine recombinases can be replaced with custom-designed ZFPs to generate chimeric zinc-finger recombinases (ZFRs).
- ZFRs capable of recognizing an extended number of sequences could be generated, however, the lack of zinc-finger domains capable of recognizing all possible DNA triplets limits the potential modular targeting capacity of these enzymes.
- ZFRs are composed of an activated catalytic domain derived from the
- ZFRs catalyze recombination between specific ZFR target sites that consist of two-inverted zinc- finger binding sites (ZFBS) flanking a central 20-bp core sequence recognized by the recombinase catalytic domain ( Figure 30B).
- ZFNs zinc- finger nucleases
- TALENs TAL effector nucleases
- Site-specific DNA recombination systems such as Cre-loxP, FLP-FRT and A C31- att have emerged as powerful tools for genetic engineering.
- the site-specific recombinases that promote these DNA rearrangements recognize short (30- to 40-bp) sequences and coordinate DNA cleavage, strand exchange and re-ligation by a mechanism that does not require DNA synthesis or a high-energy cofactor. This simplicity has allowed researchers to study gene function with extraordinary spatial and temporal sensitivity.
- the strict sequence requirements imposed by site-specific recombinases have limited their application to cells and organisms that contain artificially introduced recombination sites.
- compositions thereof including compositions thereof, expression vectors, and methods of use thereof, for the generation of transgenic cells, tissues, plants, and animals.
- compositions, vectors, and methods of the present invention are also useful in gene therapy techniques.
- the invention provides a chimeric polypeptide.
- the polypeptide includes: a) a recombinase, nuclease or transcription factor, or fragment thereof; and b) a transcription activator-like effector (TALE) protein.
- TALE transcription activator-like effector
- the TALE protein is truncated and includes a C-terminal or N-terminal truncation.
- the TALE protein is AcrXa7, Tallc, and PthXol .
- the TALE protein includes all or a portion an amino acid sequence as set forth in SEQ ID NO: 2.
- the TALE protein is truncated between amino acid residues 27 and 268, 92 and 134, 120 and 129, 74 and 147, or 87 and 120 of SEQ ID NO: 2. In some embodiments, the TALE protein is truncated at amino acid residue 28, 74, 87, 92, 95, 120, 124, 128, 129, 147 and 150 of SEQ ID NO: 2.
- the invention provides a method of generating a transcription activator-like effector (TALE) protein binding domain which specifically binds a desired nucleotide.
- the method includes a) randomizing the amino acid sequence of the TALE protein binding domain by mutating an amino acid residue within a variable di-residue (RVD), or within 1 to 2 amino acid residues N-terminal or C-terminal of the RVD; and b) selecting for the randomized TALE protein binding domain of (a), wherein the TALE protein binding domain specifically binds to the desired nucleotide.
- RVD variable di-residue
- the invention provides an isolated polypeptide comprising a Xanthamonus derived transcription activator-like effector (TALE) protein, the TALE protein having an N-terminal domain (NTD) comprising an amino acid sequence as set forth in SEQ ID NO: 3 (VGKQWSGARAL) having one or more mutations or deletions selected from: Q is Y, Q is S, Q is R, W is R, W is G, W is deleted, S is R, S is H, S is A, S is N, and S is T.
- TALE Xanthamonus derived transcription activator-like effector
- the invention provides an isolated polypeptide including a Ralstonia derived transcription activator-like effector (TALE) protein, the TALE protein having an N-terminal domain (NTD) including an amino acid sequence as set forth in SEQ ID NO: 8 (IVDIARiQR 2 SGDLA) having one or more mutations or deletions selected from: Ri is K, Q is Y, Q is S, Q is R, R 2 is W, R 2 is G, R 2 is deleted, S is R, S is H, S is A, S is N, and S is T.
- TALE Ralstonia derived transcription activator-like effector
- the invention provides a method of generating a transcription activator-like effector (TALE) protein N-terminal domain (NTD).
- the method includes: a) randomizing an amino acid sequence of the NTD by mutating or deleting one or more amino acid residues within the NTD, wherein the amino acid sequence is SEQ ID NO: 14 (VGKXXXGAR) or SEQ ID NO: 15 (VDIAXXXXGDLA); and b) selecting for the randomized TALE protein NTD of (a), wherein the TALE protein NTD specifically binds to a desired nucleotide or exhibits enhanced activity.
- TALE transcription activator-like effector
- compositions, vectors, and methods of use thereof for the generation of transgenic cells, tissues, plants, and animals.
- the compositions, vectors, and methods of the present invention are also useful in gene therapy techniques.
- the invention provides a method of generating a plurality of zinc finger recombinase (ZFRs) proteins having catalytic specificity greater than the ZFRs
- the method includes performing random mutagenesis on a recombinase catalytic domain at positions equivalent to Gin Ilel20, Thrl23, Leul27, Ilel36 and Glyl37 or a combination thereof, mutating the DNA at positions 2 and 3 for each amino acid; fusing the recombinase catalytic domain with a plurality of zinc finger binding domains to form ZFRs, and enriching for ZFRs having catalytic specificity greater than the corresponding wild type recombinase.
- the ZFRs have increased catalytic activity on DNA targets selected from GC, GT, CA, TT and AC.
- the recombinase catalytic domain is mutagenized at Ilel36 and/or Glyl37.
- chimeric polypeptides described herein include a
- SC8F4.15c serine recombinase S. coelicolor chromosome SCD12A.23 serine recombinase; S. coelicolor chromosome SCH10.38c serine recombinase; S.
- tuberculosis prophage c()RVl serine recombinase YBCK ECOLI; Y4bA; Bja; Spn; Cac 1956; and Cac 1954; or b) muteins of a).
- the invention provides an isolated nucleic acid molecule encoding the chimeric polypeptide described herein.
- the invention provides an expression cassette including the nucleic acid molecule the chimeric polypeptide described herein.
- the invention provides a vector including the expression cassette described herein.
- the invention provides an isolated host cell containing the vector described herein.
- the invention provides a method for site-specific integration into a DNA sequence.
- the method includes contacting the DNA sequence with a chimeric polypeptide of the present invention, wherein the chimeric polypeptide catalyzes site-specific integration.
- the invention provides a method for gene therapy.
- the method includes administering to a subject a composition comprising a nucleic acid molecule encoding the chimeric polypeptide described herein, wherein upon expression of the nucleic acid molecule, a gene present in the genome of the subject is specifically removed or inactivated.
- the invention provides a pharmaceutical composition.
- the composition includes the chimeric polypeptide described herein; and a pharmaceutically acceptable carrier.
- the composition includes a nucleic acid molecule encoding the chimeric polypeptide described herein; and a pharmaceutically acceptable carrier.
- the invention provides a transgenic organism produced by recombination catalyzed by the chimeric polypeptide of the present invention.
- the invention provides a method for gene therapy.
- the method includes administering to a subject a cell comprising a nucleic acid molecule having the DNA sequence generated by the method of site-specific integration described herein.
- the invention provides an isolated nucleic acid molecule encoding the chimeric protein described herein.
- the invention provides a method for site-specific recombination.
- the method includes: a) providing a DNA sequence comprising at least two binding sites for specifically interacting with the chimeric protein described herein; and b) reacting the DNA sequence with the chimeric protein, wherein the chimeric protein catalyzes a site-specific recombination event in which both strands of the DNA sequence are cleaved between the two sites specifically interacting with the chimeric protein.
- Figure 1 is a series of graphical and diagrammatic representations regarding TALER fusion orientation and activity.
- D) Gin-Avr activity against cognate (Avr-20G) and non-cognate (Avr-20T, Avr-20GG, PthXol-20G) DNA targets. Error bars indicate standard deviation (s.d.) (n 3).
- Figure 2 is a series of graphical and diagrammatic representations regarding recombination profiles of selected TALER truncations.
- C) Gin-AvrXa7A120 activity against a diverse panel of substrates containing non-cognate cores sequences or core sites of increasing length. Error bars indicate s.d. (n 3).
- Figure 3 is a series of graphical representations regarding TALER variants selected from incremental truncation library.
- C) Activity of Gin-AvrA74, Gin-AvrA128 and Gin-AvrA145 against a diverse panel of cognate and non-cognate DNA targets. Error bars indicate s.d. (n 3).
- Figure 4 is a series graphical representations regarding activity of synthetic TALERs.
- B) Activity of synthetic TALERs with DBDs between 15 and 20 repeats in length based on Gin-AvrA120 against Avr-32G and Avr- 32T. Error bars indicate s.d. (n 3).
- Figure 5 is a series of graphical representations regarding TALER activity in mammalian cells.
- Figure 6 is a diagrammatic representation of location of primers for N-terminal designed truncations of AvrXa7 (SEQ ID NO: 1 DNA sequence; SEQ ID NO: 2 amino acid sequence). Star denotes the location of ⁇ 120 fusion point.
- Figure 7 is a diagrammatic representation of a comparison of native wild-type and synthetic RDV domains for the AvrXa7 target sequence (SEQ ID NOs: 16-18).
- Figure 8 is a diagrammatic representation of TALE and TALER amino acid sequences of AvrXa7 protein (SEQ ID NO: 19).
- Figure 9 is a diagrammatic representation of construct AvrXa7 DNA sequence (SEQ ID NO: 20).
- Figure 10 is a diagrammatic representation of construct Gin-AvrA74 amino acid sequence (SEQ ID NO: 21).
- Figure 11 is a diagrammatic representation of construct Gin-AvrA87 amino acid sequence (SEQ ID NO: 22).
- Figure 12 is a diagrammatic representation of construct Gin-AvrA120 amino acid sequence (SEQ ID NO: 23).
- Figure 13 is a diagrammatic representation of construct Gin-AvrA120* amino acid sequence (SEQ ID NO: 24).
- Figure 14 is a diagrammatic representation of construct Gin-AvrA147 amino acid sequence (SEQ ID NO: 25).
- Figure 15 is a diagrammatic representation of construct GinAvrl5A128-synthetic protein amino acid sequence (SEQ ID NO: 26).
- Figure 16 is a diagrammatic representation of construct Gin- Avrl5A 128 -synthetic protein DNA sequence (SEQ ID NO: 27).
- Figure 17 is a diagrammatic representation of construct GinAvrl5A128-synthetic protein amino acid sequence (SEQ ID NO: 28).
- Figure 18 is a series of pictorial and graphical representations pertaining to the specificity of the TALE N-terminal domain.
- Figure 19 is a series of graphical and diagrammatic representations pertaining to recombinase variants.
- A-C Activities of recombinase selection variants against substrates with A) 5' G, B) 5 ⁇ , and C) 5' C.
- Figure 18D is an alignment of optimized TALE NTDs SEQ ID NOs: 33-36), illustrating sequence differences in the N-l hairpin.
- Figure 20 is a series of diagrammatic and graphical representations of analysis of selected NTDs in the context of TALE-TFs.
- Figure 21 is a series of diagrammatic and graphical representations of design and activity of TALEN pairs with wild-type and evolved NTD's with varying 5' bases.
- Figure 22 is a diagrammatic representation showing alignment of N- and C- terminal domains SEQ ID NOs: 48-53).
- FIG 23 is a schematic representation illustrating TALE -Recombinase selection protocol.
- a library of NTD was cloned into Avrl5 TALE-R using Notl/Stul restriction enzymes and complementary ligation. Active TALE-R's result in more frequent
- Figure 24 is a diagrammatic representation of a summary of variant populations discovered from library selections (Library XXXSGAR (SEQ ID NO: 39) and Library KXXGAR (SEQ ID NO: 291)).
- Figure 25 is a diagrammatic representation showing alignment of NT-G (SEQ ID NO: 54) with NTD-Brgl 1 (SEQ ID NO: 55), a Ralstonia TALE domain. Alignment indicates Brgl 1 could exhibit specificity for 5 ' G bases.
- Figure 26 is a series of graphical representations of relative binding affinity of MBP-TALE proteins to target 5' A/G/C/T Avrl5 hairpin oligonucleotides as assayed by ELISA. Protein concentrations were ⁇ 75nM and plates were developed for 120 minutes.
- Figure 27 is a series of pictorial and graphical representations of a cell assay of PCR amplified CCR5 after TALEN editing with % indels and indel populations shown on the right.
- Figure 28 is a diagrammatic representation showing alignment indel sequencing of selected TALEN experiments from Figure 27 (SEQ ID NOs: 292-332 from top to bottom).
- Figure 29 is a graphical representation of a comparison of the activity of two separate Goldy TALE -Transcription factor architectures, each targeting identical 5x AvrXa7 promoters varying only in the 5' residue.
- FIG 30 is a series of diagrammatic representations relating to the structure of the zinc-finger recombinase dimer bound to DNA.
- ZFR zinc-finger recombinase
- Each zinc-finger recombinase (ZFR) monomer blue or orange
- ZFR zinc-finger recombinase
- Model was generated from crystal structures of the ⁇ resolvase and Aart zinc-finger protein (PDB IDs: IGDT and 2113, respectively).
- PDB IDs: IGDT and 2113 Aart zinc-finger protein
- ZFR target sites consist of two-inverted zinc-finger binding sites (ZFBS) flanking a central 20-bp core sequence recognized by the ZFR catalytic domain.
- ZFPs Zinc-finger proteins
- ZFPs can be designed to recognize 'left' or 'right' half-sites (blue and orange boxes, respectively).
- N indicates A, T, C, or G
- R indicates G or A
- Y indicates C or T.
- Figure 31 is a series of graphical and diagrammatic representations of specificity of the Gin recombinase catalytic domain.
- A-D Recombination was measured on DNA targets that contained (A, SEQ ID NO: 335) each possible two-base combination at the dinucleotide core, (B, SEQ ID NO: 336) each possible two-base combination at positions 3 and 2, (C, SEQ ID NO: 337) each possible single-base substitution at positions 6, 5, and 4, and (D, SEQ ID NO: 338) each possible single-base substitution at positions 10, 9, 8, and 7. Substituted bases are boxed above each panel.
- Figure 32 is a series of graphical and diagrammatic representations of re- engineering Gin recombinase catalytic specificity.
- A) The canonical 20-bp core recognized by the Gin catalytic domain. Positions 3 and 2 are boxed (SEQ ID NO: 339).
- B) (Top) Structure of the ⁇ resolvase in complex with DNA (PDB ID: 1GDT). Arm region residues selected for mutagenesis are shown as purple sticks.
- Black arrows indicate arm region positions selected for mutagenesis.
- Figure 33 is a series of graphical and diagrammatic representations illustrating the ability of ZFRs to recombine user-defined sequences in mammalian cells.
- Underlined bases indicate zinc-finger targets and positions 3 and 2 (SEQ ID NO: 343).
- Figure 34 is a series of graphical and diagrammatic representations illustrating ZFRs ability to target integration into the human genome.
- B) Efficiency of ZFR-mediated integration. Data were normalized to data from cells transfected with donor plasmid only. Error bars indicate standard deviation (n 3).
- PCR primer combinations amplified (top) unmodified locus or integrated plasmid in (middle) the forward or (bottom) the reverse orientation.
- Figure 35 is a diagrammatic representation of recombinase DNA-binding residues are located outside the dimer interface. The ⁇ resolvase in complex with target DNA.
- Catalytic domain dimer is colored cyan. DNA is colored grey. Arm region residues are shown as red sticks. Residues at the dimer interface are shown as purple sticks (PDB ID: 1GDT).
- Figure 36 is a diagrammatic representation of sequence analysis of selected recombinases. Pie charts showing the percentage of amino acid substitutions at each targeted arm position. After the 4 th round of selection, >20 clones were sequenced from each library. Sequence analysis of clones that recombine TT are described elsewhere(l).
- Figure 37 is a table showing core specificity of isolated catalytic domains. After 4 rounds of selection, the ability of selected catalytic domains to recombine core sequences with substitutions at positions 3 and 2 was evaluated. Assigned DNA targets are underlined. Recombinase mutations are shown. Asterisks indicate catalytic domains selected for further analysis. Wild-type base combination at positions 3 and 2 is CC. Recombination was determined by split gene reassembly(2) and performed in triplicate. Catalytic domains that recombine TT substitutions are described elsewhere(l).
- Figure 39 is a series of graphical representations of ZFR homodimer activity.
- HEK293T cells were co-transfected with 150 ng ZFR-L or 150 ng ZFR-R with 2.5 ng of corresponding pGL3 ZFR reporter plasmid. Recombination was normalized to co- transfection with 150 ng ZFR-L and 150 ng ZFR-R with 2.5 ng pGL3 ZFR reporter plasmid.
- Figure 40 is a series of pictorial representations depicting clonal analysis of ZFR- modified cells. PCR primer combinations amplified either unmodified genomic target or integrated plasmid in the forward or reverse orientation.
- the present provides the first disclosure of a TALE recombinase (TALER).
- TALER TALE recombinase
- TALE Transcription activator-like effector
- TALE activity In the absence of a 5 ' T, decreases in TALE activity up to > 1000-fold in TALE-TF activity, up to 100-fold in TALE-R activity and up to 10-fold reduction in TALEN activity compared with target sequences containing a 5 ' T was observed.
- structure- guided library design coupled with TALE-R activity selections were used to evolve novel TALE N-terminal domains to accommodate any NO base.
- a G-selective domain and broadly reactive domains were isolated and characterized.
- the engineered TALE domains selected in the TALE-R format demonstrated modularity and were active in TALE-TF and TALEN architectures. Evolved N-terminal domains provide effective and unconstrained TALE -based targeting of any DNA sequence as TALE binding proteins and designer enzymes.
- Recombinases are a family of enzymes that mediate site-specific recombination between specific DNA sequences recognized by the recombinase (Esposito, D., and Scocca, J. J., Nucleic Acids Research 25, 3605-3614 (1997); Nunes-Duby, S. E., et al, Nucleic Acids Research 26, 391-406 (1998); Stark, W. M., et al, Trends in Genetics 8, 432-439 (1992)).
- chimeric TALE recombinase includes without limitation recombinases having a TALE domain derived from a naturally-occurring TALE protein or a synthetically derived TALE protein or domain with sequence-specific binding activity.
- chimeric zinc finger recombinase includes without limitation recombinases having a zinc finger binding domain derived from a naturally- occurring zinc finger DNA binding protein or a synthetically derived zinc finger binding protein or domain with sequence-specific binding activity.
- zinc finger As used herein, the term "zinc finger,” “zinc finger nucleotide binding domain,” or similar terminology refers both to naturally occurring and artificially produced zinc fingers.
- Such zinc fingers can have various framework structures, such as, but not limited to, C2H2, C4, H4, H3C, C3X, H3X, C2X2, and H2X2, where X is a zinc ligating amino acid.
- framework structures such as, but not limited to, C2H2, C4, H4, H3C, C3X, H3X, C2X2, and H2X2, where X is a zinc ligating amino acid.
- C represents a cysteine residue
- H represents a histidine residue.
- Zinc fingers having the framework C2H2 include, but are not limited to, zinc fingers described, for example, in International Publication Number WO2008/006028 to Barbas et al, United States Patent No. 7,101 ,972 to Barbas, United States Patent No. 7,067,617 to Barbas et al, United States Patent No. 6,790,941 to Barbas et al, United States Patent No. 6,610,512 to Barbas, United States Patent No. 6,242,568 to Barbas et al, United States Patent No. 6,140,466 to Barbas et al., United States Patent No. 6,140,081 to Barbas, United States Patent Application
- Patent No. 6,607,882 to Cox IM et al U.S. Patent No. 6,599,692 to Case et al; U.S. Patent No. 6,534,261 to Cox II et al; U.S. Patent No. 6,503,717 to Case et al; U.S. Patent No.
- a "D-able” site is a region of a target site that allows an appropriately designed zinc finger module or zinc finger DNA binding domain to bind to four bases rather than three of the target strand.
- Such a zinc finger module or zinc finger DNA binding domain binds to a triplet of three bases on one strand of a double-stranded DNA target segment (target strand) and a fourth base on the other, complementary, strand. Binding of a single zinc finger to a four base target segment imposes constraints both on the sequence of the target strand and on the amino acid sequence of the zinc finger.
- amino acids which occur in the various amino acid sequences appearing herein, are identified according to their well-known, three-letter or one-letter abbreviations.
- the nucleotides, which occur in the various DNA fragments, are designated with the standard single-letter designations used routinely in the art.
- a conservative substitutions of amino acids are known to those of skill in this art and may be made generally without altering the biological activity of the resulting molecule.
- Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g. Watson et al. Molecular Biology of the Gene, 4th Edition, 1987, Benjamin/Cummings, p. 224).
- such a conservative variant has a modified amino acid sequence, such that the change(s) do not substantially alter the protein's (the conservative variant's) structure and/or activity, e.g., antibody activity, enzymatic activity, or receptor activity.
- amino acid sequence i.e., amino acid substitutions, additions or deletions of those residues that are not critical for protein activity, or substitution of amino acids with residues having similar properties (e.g., acidic, basic, positively or negatively charged, polar or non-polar, etc.) such that the substitutions of even critical amino acids does not substantially alter structure and/or activity.
- amino acids having similar properties e.g., acidic, basic, positively or negatively charged, polar or non-polar, etc.
- one exemplary guideline to select conservative substitutions includes (original residue followed by exemplary substitution): Ala/Gly or Ser; Arg/Lys; Asn/Gln or His; Asp/Glu; Cys/Ser; Gln/Asn; Gly/Asp; Gly/Ala or Pro; His/Asn or Gin; Ile/Leu or Val; Leu/Ile or Val; Lys/Arg or Gin or Glu; Met/Leu or Tyr or He; Phe/Met or Leu or Tyr; Ser/Thr; Thr/Ser; Trp/Tyr; Tyr/Trp or Phe; Val/Ile or Leu.
- An alternative exemplary guideline uses the following six groups, each containing amino acids that are conservative substitutions for one another: (1) alanine (A or Ala), serine (S or Ser), threonine (T or Thr); (2) aspartic acid (D or Asp), glutamic acid (E or Glu); (3) asparagine (N or Asn), glutamine (Q or Gin); (4) arginine (R or Arg), lysine (K or Lys); (5) isoleucine (I or He), leucine (L or Leu), methionine (M or Met), valine (V or Val); and (6) phenylalanine (F or Phe), tyrosine (Y or Tyr), tryptophan (W or Trp); (see also, e.g., Creighton (1984) Proteins, W.
- substitutions are not the only possible conservative substitutions. For example, for some purposes, one may regard all charged amino acids as conservative substitutions for each other whether they are positive or negative.
- individual substitutions, deletions or additions that alter, add or delete a single amino acid or a small percentage of amino acids in an encoded sequence can also be considered "conservatively modified variations" when the three-dimensional structure and the function of the protein to be delivered are conserved by such a variation.
- expression vector refers to a plasmid, virus, phagemid, or other vehicle known in the art that has been manipulated by insertion or incorporation of heterologous DNA, such as nucleic acid encoding the fusion proteins herein or expression cassettes provided herein.
- Such expression vectors typically contain a promoter sequence for efficient transcription of the inserted nucleic acid in a cell.
- the expression vector typically contains an origin of replication, a promoter, as well as specific genes that permit phenotypic selection of transformed cells.
- the term "host cells” refers to cells in which a vector can be propagated and its DNA expressed.
- the term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. Such progeny are included when the term "host cell” is used. Methods of stable transfer where the foreign DNA is continuously maintained in the host are known in the art.
- genetic therapy involves the transfer of heterologous DNA to the certain cells, target cells, of a mammal, particularly a human, with a disorder or conditions for which such therapy is sought.
- the DNA is introduced into the selected target cells in a manner such that the heterologous DNA is expressed and a therapeutic product encoded thereby is produced.
- the heterologous DNA may in some manner mediate expression of DNA that encodes the therapeutic product, or it may encode a product, such as a peptide or RNA that in some manner mediates, directly or indirectly, expression of a therapeutic product.
- Genetic therapy may also be used to deliver nucleic acid encoding a gene product that replaces a defective gene or supplements a gene product produced by the mammal or the cell in which it is introduced.
- the introduced nucleic acid may encode a therapeutic compound, such as a growth factor inhibitor thereof, or a tumor necrosis factor or inhibitor thereof, such as a receptor therefor, that is not normally produced in the mammalian host or that is not produced in therapeutically effective amounts or at a therapeutically useful time.
- the heterologous DNA encoding the therapeutic product may be modified prior to introduction into the cells of the afflicted host in order to enhance or otherwise alter the product or expression thereof.
- Genetic therapy may also involve delivery of an inhibitor or repressor or other modulator of gene expression.
- heterologous DNA is DNA that encodes RNA and proteins that are not normally produced in vivo by the cell in which it is expressed or that mediates or encodes mediators that alter expression of endogenous DNA by affecting transcription, translation, or other regulatable biochemical processes.
- Heterologous DNA may also be referred to as foreign DNA. Any DNA that one of skill in the art would recognize or consider as heterologous or foreign to the cell in which is expressed is herein encompassed by heterologous DNA.
- heterologous DNA examples include, but are not limited to, DNA that encodes traceable marker proteins, such as a protein that confers drug resistance, DNA that encodes therapeutically effective substances, such as anti-cancer agents, enzymes and hormones, and DNA that encodes other types of proteins, such as antibodies.
- Antibodies that are encoded by heterologous DNA may be secreted or expressed on the surface of the cell in which the heterologous DNA has been introduced.
- heterologous DNA or foreign DNA includes a DNA molecule not present in the exact orientation and position as the counterpart DNA molecule found in the genome. It may also refer to a DNA molecule from another organism or species (i.e., exogenous).
- a therapeutically effective product is a product that is encoded by heterologous nucleic acid, typically DNA, that, upon introduction of the nucleic acid into a host, a product is expressed that ameliorates or eliminates the symptoms, manifestations of an inherited or acquired disease or that cures the disease.
- DNA encoding a desired gene product is cloned into a plasmid vector and introduced by routine methods, such as calcium-phosphate mediated DNA uptake (see, (1981) Somat. Cell. Mol. Genet. 7:603-616) or microinjection, into producer cells, such as packaging cells. After amplification in producer cells, the vectors that contain the heterologous DNA are introduced into selected target cells.
- an expression or delivery vector refers to any plasmid or virus into which a foreign or heterologous DNA may be inserted for expression in a suitable host cell— i.e., the protein or polypeptide encoded by the DNA is synthesized in the host cell's system.
- Vectors capable of directing the expression of DNA segments (genes) encoding one or more proteins are referred to herein as "expression vectors”. Also included are vectors that allow cloning of cDNA (complementary DNA) from mRNAs produced using reverse transcriptase.
- a gene refers to a nucleic acid molecule whose nucleotide sequence encodes an RNA or polypeptide.
- a gene can be either RNA or DNA. Genes may include regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons).
- the term "isolated" with reference to a nucleic acid molecule or polypeptide or other biomolecule means that the nucleic acid or polypeptide has been separated from the genetic environment from which the polypeptide or nucleic acid were obtained. It may also mean that the biomolecule has been altered from the natural state. For example, a polynucleotide or a polypeptide naturally present in a living animal is not “isolated,” but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is "isolated,” as the term is employed herein. Thus, a polypeptide or polynucleotide produced and/or contained within a recombinant host cell is considered isolated.
- isolated polypeptide or an “isolated polynucleotide” are polypeptides or polynucleotides that have been purified, partially or substantially, from a recombinant host cell or from a native source.
- a recombinantly produced version of a compound can be substantially purified by the one-step method described in Smith et al. (1988) Gene 67:3140. The terms isolated and purified are sometimes used interchangeably.
- isolated is meant that the nucleic acid is free of the coding sequences of those genes that, in a naturally-occurring genome immediately flank the gene encoding the nucleic acid of interest.
- Isolated DNA may be single-stranded or double-stranded, and may be genomic DNA, cDNA, recombinant hybrid DNA, or synthetic DNA. It may be identical to a native DNA sequence, or may differ from such sequence by the deletion, addition, or substitution of one or more nucleotides.
- isolated or purified as those terms are used to refer to preparations made from biological cells or hosts means any cell extract containing the indicated DNA or protein including a crude extract of the DNA or protein of interest.
- a purified preparation can be obtained following an individual technique or a series of preparative or biochemical techniques and the DNA or protein of interest can be present at various degrees of purity in these preparations.
- the procedures may include for example, but are not limited to, ammonium sulfate fractionation, gel filtration, ion exchange change chromatography, affinity chromatography, density gradient centrifugation, electrofocusing, chromatofocusing, and electrophoresis.
- a preparation of DNA or protein that is "substantially pure” or “isolated” should be understood to mean a preparation free from naturally occurring materials with which such DNA or protein is normally associated in nature. "Essentially pure” should be understood to mean a “highly” purified preparation that contains at least 95% of the DNA or protein of interest.
- a cell extract that contains the DNA or protein of interest should be understood to mean a homogenate preparation or cell-free preparation obtained from cells that express the protein or contain the DNA of interest.
- the term "cell extract” is intended to include culture media, especially spent culture media from which the cells have been removed.
- a promoter region of a gene includes the regulatory element or elements that typically lie 5' to a structural gene; multiple regulatory elements can be present, separated by intervening nucleotide sequences. If a gene is to be activated, proteins known as transcription factors attach to the promoter region of the gene. This assembly resembles an "on switch" by enabling an enzyme to transcribe a second genetic segment from DNA into RNA. In most cases the resulting RNA molecule serves as a template for synthesis of a specific protein; sometimes RNA itself is the final product.
- the promoter region may be a normal cellular promoter or, for example, an onco -promoter. An onco-promoter is generally a virus-derived promoter. Viral promoters to which zinc finger binding polypeptides may be targeted include, but are not limited to, retroviral long terminal repeats (LTRs), and
- Lentivirus promoters such as promoters from human T-cell lymphotrophic virus (HTLV) 1 and 2 and human immunodeficiency virus (HIV) 1 or 2.
- HTLV human T-cell lymphotrophic virus
- HAV human immunodeficiency virus
- truncated or similar terminology refers to a polypeptide derivative that contains less than the full amino acid sequence of a native protein, such as a ZFP, TALE or serine recombinase.
- polypeptide “variant” or “derivative” refers to a polypeptide that is a mutagenized form of a polypeptide or one produced through recombination but that still retains a desired activity, such as the ability to bind to a ligand or a nucleic acid molecule or to modulate transcription.
- compositions, carriers, diluents and reagents are used interchangeably and represent that the materials are capable of administration to or upon a human without the production of undesirable physiological effects such as nausea, dizziness, gastric upset and the like which would be to a degree that would prohibit administration of the composition.
- vector refers to a nucleic acid molecule capable of transporting between different genetic environments another nucleic acid to which it has been operatively linked.
- Preferred vectors are those capable of autonomous replication and expression of structural gene products present in the DNA segments to which they are operatively linked.
- Vectors therefore, preferably contain the replicons and selectable markers described earlier.
- Vectors include, but are not necessarily limited to, expression vectors.
- operatively linked means the sequences or segments have been covalently joined, preferably by conventional phosphodiester bonds, into one strand of DNA, whether in single or double-stranded form such that operatively linked portions function as intended.
- the choice of vector to which transcription unit or a cassette provided herein is operatively linked depends directly, as is well known in the art, on the functional properties desired, e.g., vector replication and protein expression, and the host cell to be transformed, these being limitations inherent in the art of constructing recombinant DNA molecules.
- administration of a therapeutic composition can be effected by any means, and includes, but is not limited to, oral, subcutaneous, intravenous, intramuscular, intrasternal, infusion techniques, intraperitoneal administration and parenteral administration.
- Methods of transforming cells are well known in the art.
- transformed it is meant a heritable alteration in a cell resulting from the uptake of foreign DNA. Suitable methods include viral infection, transfection, conjugation, protoplast fusion, electroporation, particle gun technology, calcium phosphate precipitation, direct microinjection, and the like. The choice of method is generally dependent on the type of cell being transformed and the circumstances under which the transformation is taking place (i.e. in vitro, ex vivo, or in vivo). A general discussion of these methods can be found in Ausubel, et al, Short Protocols in Molecular Biology, 3rd ed., Wiley & Sons, 1995.
- nucleic acid molecule and “polynucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown.
- Non-limiting examples of polynucleotides include a gene, a gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- mRNA messenger RNA
- transfer RNA transfer RNA
- ribosomal RNA ribozymes
- cDNA recombinant polynucleotides
- branched polynucleotides branched polynucleotides
- plasmids vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- An "expression cassette” comprises any nucleic acid construct capable of directing the expression of a gene/coding sequence of interest. Such cassettes can be constructed into a “vector,” “vector construct,” “expression vector,” or “gene transfer vector,” in order to transfer the expression cassette into target cells. Thus, the term includes cloning and expression vehicles, as well as viral vectors.
- sequence identity also is known in the art. Typically, such techniques include determining the nucleotide sequence of the mRNA for a gene and/or determining the amino acid sequence encoded thereby, and comparing these sequences to a second nucleotide or amino acid sequence. In general, “identity” refers to an exact nucleotide-to-nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively.
- Two or more sequences can be compared by determining their "percent identity.”
- the percent identity of two sequences, whether nucleic acid or amino acid sequences is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100.
- An approximate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981). This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein
- a preferred method of establishing percent identity in the context of the present invention is to use the MPSRCE package of programs copyrighted by the University of Edinburgh, developed by John F. Collins and Shane S. Sturrok, and distributed by IntelliGenetics, Inc. (Mountain View, Calif). From this suite of packages the Smith-Waterman algorithm can be employed where default parameters are used for the scoring table (for example, gap open penalty of 12, gap extension penalty of one, and a gap of six). From the data generated the "Match" value reflects "sequence identity.”
- Other suitable programs for calculating the percent identity or similarity between sequences are generally known in the art, for example, another alignment program is BLAST, used with default parameters.
- homology can be determined by hybridization of polynucleotides under conditions that form stable duplexes between homologous regions, followed by digestion with single-stranded-specific nuclease(s), and size determination of the digested fragments.
- Two DNA, or two polypeptide sequences are "substantially homologous" to each other when the sequences exhibit at least about 80%-85%, preferably at least about 85%- 90%, more preferably at least about 90%>-95%>, and most preferably at least about 95%>-98%> sequence identity over a defined length of the molecules, as determined using the methods above.
- substantially homologous also refers to sequences showing complete identity to the specified DNA or polypeptide sequence.
- DNA sequences that are substantially homologous can be identified in a Southern hybridization experiment under, for example, stringent conditions, as defined for that particular system. Defining appropriate hybridization conditions is within the skill of the art. See, e.g., Sambrook et al, supra; DNA Cloning, supra; Nucleic Acid Hybridization, supra.
- the invention provides nucleic acid and amino acid sequences encoding chimeric polypeptides of the invention which are substantially homologous and encode polypeptides that retain equivalent biological activity.
- Two nucleic acid fragments are considered to "selectively hybridize" as described herein.
- the degree of sequence identity between two nucleic acid molecules affects the efficiency and strength of hybridization events between such molecules.
- a partially identical nucleic acid sequence will at least partially inhibit a completely identical sequence from hybridizing to a target molecule. Inhibition of hybridization of the completely identical sequence can be assessed using hybridization assays that are well known in the art (e.g., Southern blot, Northern blot, solution hybridization, or the like, see Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, (1989) Cold Spring Harbor, N.Y.).
- Such assays can be conducted using varying degrees of selectivity, for example, using conditions varying from low to high stringency. If conditions of low stringency are employed, the absence of non-specific binding can be assessed using a secondary probe that lacks even a partial degree of sequence identity (for example, a probe having less than about 30% sequence identity with the target molecule), such that, in the absence of non-specific binding events, the secondary probe will not hybridize to the target.
- a secondary probe that lacks even a partial degree of sequence identity (for example, a probe having less than about 30% sequence identity with the target molecule), such that, in the absence of non-specific binding events, the secondary probe will not hybridize to the target.
- a nucleic acid probe is chosen that is complementary to a target nucleic acid sequence, and then by selection of appropriate conditions the probe and the target sequence "selectively hybridize,” or bind, to each other to form a hybrid molecule.
- a nucleic acid molecule that is capable of hybridizing selectively to a target sequence under "moderately stringent” typically hybridizes under conditions that allow detection of a target nucleic acid sequence of at least about 10-14 nucleotides in length having at least approximately 70%> sequence identity with the sequence of the selected nucleic acid probe.
- Stringent hybridization conditions typically allow detection of target nucleic acid sequences of at least about 10-14 nucleotides in length having a sequence identity of greater than about 90-95%) with the sequence of the selected nucleic acid probe.
- Hybridization conditions useful for probe/target hybridization where the probe and target have a specific degree of sequence identity can be determined as is known in the art (see, for example, Nucleic Acid Hybridization: A Practical Approach, editors B. D.
- stringency conditions for hybridization it is well known in the art that numerous equivalent conditions can be employed to establish a particular stringency by varying, for example, the following factors: the length and nature of probe and target sequences, base composition of the various sequences, concentrations of salts and other hybridization solution components, the presence or absence of blocking agents in the hybridization solutions (e.g., formamide, dextran sulfate, and polyethylene glycol), hybridization reaction temperature and time parameters, as well as, varying wash conditions.
- the selection of a particular set of hybridization conditions is selected following standard methods in the art (see, for example, Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, (1989) Cold Spring Harbor, N.Y.)
- a first polynucleotide is "derived from” a second polynucleotide if it has the same or substantially the same basepair sequence as a region of the second polynucleotide, its cDNA, complements thereof, or if it displays sequence identity as described above.
- a first polypeptide is "derived from” a second polypeptide if it is (i) encoded by a first polynucleotide derived from a second polynucleotide, or (ii) displays sequence identity to the second polypeptides as described above.
- Hyperactivated variants of the resolvase/invertase family of serine recombinases function without accessory factors, and thus can be re-targeted to sequences of interest by replacing native DNA-binding domains with engineered zinc-finger proteins (ZFPs).
- ZFPs zinc-finger proteins
- the zinc finger recombinases described herein are chimeric enzymes composed of an activated catalytic domain derived from the resolvase/invertase family of serine recombinases and a custom- designed zinc-finger DNA-binding domain.
- the ZFRs assembled from engineered catalytic domains efficiently recombine user-defined DNA targets with high specificity and designed ZFRs integrate DNA into targeted endogenous loci in human cells.
- the invention provides a method of generating a plurality of zinc finger recombinase (ZFRs) proteins having catalytic specificity greater than the ZFRs
- the method includes performing random mutagenesis on a recombinase catalytic domain at positions equivalent to Gin Ilel20, Thrl23, Leul27, Ilel36 and Glyl37 or a combination thereof with reference to a wild-type Gin catalytic domain, mutating the DNA at positions 2 and 3 for each amino acid; fusing the recombinase catalytic domain with a plurality of zinc finger binding domains to form ZFRs, and enriching for ZFRs having catalytic specificity greater than the corresponding wild type recombinase.
- the ZFRs have increased catalytic activity on DNA targets selected from GC, GT, CA, TT and AC.
- the recombinase catalytic domain is mutagenized at Ilel36 and/or Glyl37.
- a wild-type Gin catalytic domain refers to a Gin catalytic domain including all or a portion of a polypeptide having the amino acid sequence set forth as SEQ ID NO: 56 as follows:
- the chimeric polypeptides of the invention include a Gin catalytic domain, such as those generated by the method of the invention.
- Particular Gin catalytic domains include those set forth in Table 1.
- the ZFRs generated by the method of the invention include a Gin catalytic domain operatively linked to a plurality of zinc finger binding domains.
- Exemplary ZFRs generated by the invention include those set forth in Table 2.
- recombinases include: a) Tn3, also known as EcoTn3; Hin, also known as StyHin; MuGin; Sin; Beta; Pin; Min; Din; Cin; EcoTn21; SfaTn917; BmeTn5083; Bme53; Cpe; SauSKl; SauSK41; SauTn552; Ran; Aac; Lla; pMER05; Mlo92; Mlo90; Rrh; Pje; Req; PpsTn5501; Pae; Xan; ISXc5; Spy; RhizY4cG; SarpNLl; SsolSC1904a; SsolSC1904b; SsoISC1913; Aam606; MjaM0014; Pab; HpylS607; MtulS_Y
- SC8F4.15c serine recombinase S. coelicolor chromosome SCD12A.23 serine recombinase; S. coelicolor chromosome SCH10.38c serine recombinase; S.
- tuberculosis prophage c()RVl serine recombinase YBCK ECOLI; Y4bA; Bja; Spn; Cac 1956; and Cac 1954; and b) muteins of a).
- TALE transcription activator-like effector
- TALERs recombine DNA in mammalian cells.
- the TALER architecture described herein provides a platform for insertion of customized TALE domains, thus significantly expanding the targeting capacity of engineered recombinases and their potential applications in biotechnology and medicine.
- TALE Transcription activator-like effector
- TALE activity In the absence of a 5' T, we observed decreases in TALE activity up to > 1000-fold in TALE-TF activity, up to 100-fold in TALE-R activity and up to 10-fold reduction in TALEN activity compared with target sequences containing a 5' T.
- a structure-guided library design coupled with TALE-R activity selections was used to evolve novel TALE N-terminal domains to accommodate any No base.
- a G-selective domain and broadly reactive domains were isolated and characterized.
- the engineered TALE domains selected in the TALE-R format demonstrated modularity and were active in TALE-TF and TALEN architectures. Evolved N-terminal domains provide effective and unconstrained TALE -based targeting of any DNA sequence as TALE binding proteins and designer enzymes.
- the invention provides a method of generating a transcription activator-like effector (TALE) protein binding domain which specifically binds a desired nucleotide.
- the method includes a) randomizing the amino acid sequence of the TALE protein binding domain by mutating an amino acid residue within a variable di-residue (RVD), or within 1 to 2 amino acid residues N-terminal or C-terminal of the RVD; and b) selecting for the randomized TALE protein binding domain of (a), wherein the TALE protein binding domain specifically binds to the desired nucleotide.
- RVD variable di-residue
- sequence-specific nucleases include customized TAL effector DNA binding domains.
- the invention provides a chimeric polypeptide.
- the polypeptide includes: a) a recombinase, a transcription factor or nuclease; and b) a transcription activator-like effector (TALE) protein.
- TALE transcription activator-like effector
- TALEs are proteins of plant pathogenic bacteria that are injected by the pathogen into the plant cell, where they travel to the nucleus and function as transcription factors to turn on specific plant genes.
- the primary amino acid sequence of a TALE dictates the nucleotide sequence to which it binds.
- target sites can be predicted for TALE, and TALE also can be engineered and generated for the purpose of binding to particular nucleotide sequences, as described herein.
- Fused to the TALE-encoding nucleic acid sequences are sequences encoding a nuclease, transcription factor or recombinase, or a portion thereof. Many such proteins are known in art that may be used in the present invention.
- the chimeric polypeptide includes a catalytic domain of a recombinase.
- catalytic domains of a number of recombinases may be utilized.
- Such recombinases include: a) Tn3, also known as EcoTn3; Hin, also known as StyHin; Gin, also known as MuGin; Sin; Beta; Pin; Min; Din; Cin; EcoTn21; SfaTn917; BmeTn5083; Bme53; Cpe; SauSKl; SauSK41; SauTn552; Ran; Aac; Lla; pMER05; Mlo92; Mlo90; Rrh; Pje; Req; PpsTn5501; Pae; Xan; ISXc5; Spy; RhizY4cG; SarpNLl;
- SsolSC1904a SsolSC1904b; SsoISC1913; Aam606; MjaM0014; Pab; HpylS607;
- tuberculosis prophage c()RVl serine recombinase YBCK ECOLI; Y4bA; Bja; Spn; Cac 1956; and Cac 1954; and b) muteins of a).
- a highly active Gin catalytic domain is utilized. Such a domain may be generated using the methods of the present invention as described herein.
- TALEs may include a number of imperfect repeats that determine the specificity with which they interact with DNA. Each repeat binds to a single base, depending on the particular di-amino acid sequence at residues 12 and 13 of the repeat. Thus, by engineering the repeats within a TALE, particular DNA sites can be targeted. Such engineered TALEs can be used, for example, as transcription factors targeted to particular DNA sequences.
- the chimeric proteins of the present invention are exemplified by the variants and portions thereof (e.g., RVDs and NTDs) as set forth in Table 3.
- NTD N-Terminal Domain
- Gl 82 NG-NN-HD-NG-HD-NI-NG-NG-NI-HD-NI-HD-NI-HD-HD-NG-NN-HD- NI targeting (TCTTCATTACACCTGCA; SEQ ID NO: 280)
- Tl 87 NG-HD-NI-NG-NG-NI-HD-NI-HD-NI-HD-NG-NN-HD-NI-NN-HD-NI-NN-HD targeting (TC ATT AC ACCTGC AGC ; SEQ ID NO: 285)
- T2 88 HD-NG-NG-HD-HD-NI-NN-NI-NI-NG-NG-NN-NI-NG-NI-HD-NG- NN targeting (CTTCCAGAATTGATACTG; SEQ ID NO: 286)
- NTD dHax3- 89 ATGAGATCTCCTAAGAAAAAGAGGAAGATGGTGGACTTGA TALEN DNA GGACACTCGGTTATTCGCAACAGCAACAGGAGAAAATCAA
- NTD dHax3- 90 MRSPKKKRKMVDLRTLGYSQQQEKIKPKVRSTVAQHHEAL TALEN VGHGFTHAHIVALSQHPAALGTVAVKYQDMIAALPEATHEAI VGVGKQWSGARALEALLTVAGELRGPPLQLDTGQLLKIAKRG GVT AVE AVH ASRN ALTGAP ... repeat variable diresidues
- NTD ⁇ - ⁇ 91 ATGAGATCTCCTAAGAAAAAGAGGAAGGTGCAGGTGGATC TALEN DNA TACGCACGCTCGGCTACAGTCAGCAGCAGCAAGAGAAGAT
- NTD ⁇ - ⁇ 92 MRSPKKKRKVQVDLRTLGYSQQQQEKIKPKVRSTVAQHHEAL TALEN VGHGFTHAHIVALSQHPAALGTVAVTYQHIITALPEATHEDIV GVGKYHGARALEALLTDAGELRGPPLQLDTGQLVKIAKRGGV TAMEAVHASRNALTGAP.... repeat variable diresidues NTD NT-G 93 ATGAGATCTCCTAAGAAAAAGAGGAAGGTGCAGGTGGATC TALEN DNA TACGCACGCTCGGCTACAGTCAGCAGCAGCAAGAGAAGAT
- NTD NT-oN 95 ATGAGATCTCCTAAGAAAAAGAGGAAGGTGCAGGTGGATC TALEN DNA TACGCACGCTCGGCTACAGTCAGCAGCAGCAAGAGAAGAT
- NTD NT-oN 96 MRSPKKKRKVQVDLRTLGYSQQQEKIKPKVRSTVAQHHGA TALEN Protein LVGHGFTHAHIVALSQHPAALGTVAVTYQHIITALPEATHEDI
- NTD NT-T T-l 97 ATGAGATCTCCTAAGAAAAAGAGGAAGGTGCAGGTGGATC TALEN DNA TACGCACGCTCGGCTACAGTCAGCAGCAGCAAGAGAAGAT CAAACCGAAGGTGCGTTCGACAGTGGCGCAGCACCACGAG GCACTGGTGGGCCATGGGTTTACACACGCGCACATCGTTGC
- Avrl5 TALE-TF 100 MAQAASGSPRPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYS Protein Sequence QQQQEKIKPKVRSTVAQHHEALVGHGFTHAHIVALSQHPAAL
- Avrl5 VD 101 NI-NG-NI-NI-NI-HD-HD-HD-HD-HD-NI-HD-NI-NI-NI targeting Sequence (for (ATAAACCCCCTCCAA; SEQ ID NO: 287)
- chimeric protein includes a TALE protein having a C- terminal or N-terminal truncation.
- the TALE protein may include all or a portion of SEQ ID NO: 2.
- the TALE protein is truncated between amino acid residues 27 and 268, 92 and 134, 120 and 129, 74 and 147, or 87 and 120, such at amino acid residue 28, 74, 87, 92, 95, 120, 124, 128, 129, 147 and 150.
- a isolated polypeptide comprising a transcription activator-like effector (TALE) protein in which the TALE protein has an N- terminal domain (NTD) comprising an amino acid sequence as set forth in SEQ ID NO: 3 (VGKQWSGARAL) having one or more mutations or deletions selected from: Q is Y, Q is S, Q is R, W is R, W is G, W is deleted, S is R, S is H, S is A, S is N, and S is T.
- NTD N- terminal domain
- the NTD comprises an amino acid sequence selected from: VGKYRGARAL (SEQ ID NO: 4), VGKSRSGARAL (SEQ ID NO: 5), VGKYHGARAL (SEQ ID NO: 6), and VGKRGAGARAL (SEQ ID NO: 7).
- an isolated polypeptide comprising a transcription activator-like effector (TALE) protein in which the TALE protein has an N- terminal domain (NTD) comprising an amino acid sequence as set forth in SEQ ID NO: 8 (IVDIARiQR 2 SGDLA) having one or more mutations or deletions selected from: Ri is K, Q is Y, Q is S, Q is R, R 2 is W, R 2 is G, R 2 is deleted, S is R, S is H, S is A, S is N, and S is T.
- NTD N- terminal domain
- the NTD comprises an amino acid sequence selected from: IVDIARQWSGDLA (SEQ ID NO: 9), IVDIARYRGDLA (SEQ ID NO: 10), IVDIARSRSGDLA (SEQ ID NO: 11), IVDIARYHGDLA (SEQ ID NO: 12), and
- the TALE protein includes a modified No domain having an amino acid sequence set forth as follows:
- the TALE protein includes a mutated variant in which KRGG (SEQ ID NO: 103) of SEQ ID NO: 102 is selected from LDYE (SEQ ID NO: 104), INLV (SEQ ID NO: 105), YSK (SEQ ID NO: 106), NMAH (SEQ ID NO: 107), SPTN (SEQ ID NO: 108), SNTR (SEQ ID NO: 109), LTTT (SEQ ID NO: 1 10), VADL (SEQ ID NO: 111), MVLS (SEQ ID NO: 112), YNGR (SEQ ID NO: 113), RIPR (SEQ ID NO: 114), YSKI (SEQ ID NO: 115), LTQY (SEQ ID NO: 116), YLSK (SEQ ID NO: 117), LRPN (SEQ ID NO: 118), LFTN (SEQ ID NO: 103)
- the TALE protein includes a modified N_i domain having an amino acid sequence set forth as follows:
- XXXXX of SEQ ID NO: 131 is KRPAG (SEQ ID NO: 132) or KRPSG (SEQ ID NO: 133). Additionally, the protein may include, a E40G mutation (with reference to SEQ ID NO: 131) that exhibits enhanced activity.
- the TALE protein includes a repeat domain having an amino acid sequence set forth as follows:
- the TALE protein includes a mutated variant in which SNNG (SEQ ID NO: 135) of SEQ ID NO: 134 is selected from RGGG (SEQ ID NO: 136), RGGR (SEQ ID NO: 137), RGVR (SEQ ID NO: 138), KGGG (SEQ ID NO: 139), SGGG (SEQ ID NO: 140), GGRG (SEQ ID NO: 141), LGGS (SEQ ID NO: 142), MDNI (SEQ ID NO: 143), RVMA (SEQ ID NO: 144), LASV (SEQ ID NO: 145), VGTG (SEQ ID NO: 146) and QGGG (SEQ ID NO: 147).
- This study provides the first example of a TALE recombinase (TALER).
- TALER TALE recombinase
- AvrXa7 N RC +12 SEQ ID NO: 158 TTAATTAAGAGTCTAGATTAGCACCTGGTTGG F AGGGGGTTTATAGCTTCAGCTTCATCCAAAAC
- AvrXa7 N RC -3 F SEQ ID NO: 160 TTAATTAAGAGTCTAGATTAGCACCTGGTTGG AGGGGGTTTATAAAAACCATGGTTTATATAAA
- AvrXa7 N C GG SEQ ID NO: 162 TTAATTAAGAGTCTAGATTAGCACCTGGTTGG F AGGGGGTTTATATCCAAAACCGGGGTTTACA GTATAAACCCCCTCCAACCAGGTGCTAAAGA TCTAGGAGGAATTTAAAATGAG
- AvrXa7 32t F SEQ ID NO: 168 TTAATTAAGAGTCTAGATTAGCACCTGGTTG
- AvrXa7 32t SEQ ID NO: 169 ACTGACCTAGAGAAGCTTTTAGCACCTGGTT
- Gin_N-term SEQIDNO 177 ATGCTGATATCTAGACTATCCCGATTTAGGTGG
- GinNTALPCRfusR SEQIDNO: 192 GGATCCCGATTTACGCGGGC
- Nhe-SD-Gin F SEQIDNO: 193 ATCGTAGCAGCTAGCGCCACCATGCTGATTGGC
- the Gin catalytic domain was PCR amplified with primers 5 ' Gin N-term and 3 ' Gin N-term or 5' Gin C-term and 3' Gin C-term, respectively.
- PCR products were ligated into the Sad and Xbal restriction sites of pBluescriptll (Fermentas) to generate pB-Bam-Gin and pB-Gin-Bam.
- the AvrXa7 gene was generated the C-terminal and N-terminal TALER fusions.
- AvrXa7 was PCR amplified using the Expand High Fidelity PCR System (Roche) with 5' Avr-n-(l-lO) and 3' Avr +28 or 3 ' Avr +95 primers with the following program: 1 cycle of 3 min at 94 °C, 16 cycles of 1 min at 94 °C, 1 min at 52 °C, 6 min at 68 °C; and a final cycle of 1 hr at 68 °C.
- the Gin catalytic domain was PCR amplified under standard PCR conditions with 5' Gin C-term and 3' GinNTalPCRFus and fused to truncated AvrXa7 variants by overlap PCR using the PCR conditions described above. Purified Gin- Avr PCR products were mixed in an equimolar ratio and digested with Sacl and Xbal.
- TALEN kit (Addgene) with the following modification: pTALl was modified to include truncations at ⁇ 120, ⁇ 128, or +28.
- AvrXa7A120 and AvrXa7A128 fragments were PCR amplified with 5' Avr n4 or Avr nl28 and 3' TalR Xba+28 and ligated into the BamHl restriction site of pTALl to generate pTALA120 and pTALA128.
- the plasmids pTALA120 and pTALA128 retained the Esp31 restriction sites for Golden Gate cloning.
- TALE arrays cloned into pTALA120 and pTALA128 were digested with BamHl and Xbal for ligation into pB-Gin-Bam.
- the Gin catalytic domain was PCR amplified from pB-Gin-Avr with 5' Nhe-SD-Gin F and 3' GinGS R and ligated into the Nhel and BamHl restriction sites of pcDNA 3.1 (Invitrogen).
- Avr 15 was digested from pTALA120 or pTALA128 with BamHl and Xbal and ligated into pcDNA-Gin-Bam to generate pcDNA-Gin-Avr expression vectors.
- the pBLA substrate plasmids were constructed as previously described.
- the SV40 promoter was PCR amplified from pGL3 -Promoter (Promega) with the recombination site-containing primers 5' pGL3 SV40 Bglll and 3 ' pGL3 S V40 Hindlll and ligated into the BgUl and Hindlll restriction sites of pGL3 -Promoter.
- the incremental truncation library was generated using a modified protocol previously described. Briefly, in order to protect the Gin coding sequence from exonuclease digestion, a stuff er fragment with a Smal restriction site was inserted into BamHl to generate pB-Gin-Smal-Bam-Avr. This plasmid was linearized with Nhel and incubated with
- Exonuclease III for 2.5 min at 37 °C followed by heat inactivation at 75 °C for 25 min.
- pB- Gin-Bam-Avr was then incubated with Klenow Fragment (3 ' to 5 ' Exo) with 200 ⁇ dNTPs and 5 ⁇ [a]-S-dNTPs for 30 min at 37 °C followed by heat inactivation at 80 °C for 25 min.
- pB-Gin-Bam-Avr was incubated with Exonuclease III for 2.5 min at 37 °C followed by heat inactivation and subsequent blunt-ending with Mung Bean Nuclease for 1 hr at 30 °C. After digestion with Smal, the blunt 3' end of the recombinase coding sequence was ligated to the blunt-ended library of TALE fragments.
- the plasmids were digested with Sad and Xbal to release Gin-AAvr.
- HEK293T cells were seeded onto 96-well plates at a density of 4 x 10 4 cells per well and grown in a humidified 5% C0 2 atmosphere at 37 °C. At 24 hr after seeding, cells were transfected with 150 ng pcDNA TALER expression vector, 2.5 ng pGL3 reporter plasmid, and 1 ng pRL-CMV for expression of Renilla luciferase using Lipofectamine 2000 (Invitrogen) according to the manufacturer's instructions.
- luciferase expression was determined using the Dual-Luciferase Reporter Assay System (Promega) according to the manufacturer's instructions. Luminescence was measured using a Veritas Microplate Luminometer (Turner Biosystems).
- TALER architecture [0161] A quantitative system for the evaluation and directed evolution of recombinase activity has been described.
- Figure 1 A a GFPuv transgene flanked by recombination sites is inserted into the gene encoding TEM-1 ⁇ -lactamase. This alteration disrupts ⁇ -lactamase expression and renders Escherichia coli cells that harbor this plasmid (pBLA) susceptible to ampicillin.
- pBLA Escherichia coli cells that harbor this plasmid
- Expression of an active recombinase from the substrate- containing plasmid leads to recombination between target sites and restoration of the ⁇ -lactamase reading frame.
- This modification establishes host-cell resistance to ampicillin and enables the isolation of active recombinase variants from the substrate-containing plasmid. By measuring the number of ampicillin-resistant transformants following plasmid purification and re-transformation, recombinase activity can be also directly assessed.
- this split gene reassembly selection system can also be used to evaluate the effectiveness of individual DBDs.
- the system was adapted to determine an optimal TALER architecture.
- Gin-AvrXa7 was cloned into a pBLA selection vector containing recombination sites composed of a central 20-bp core sequence, which is recognized by the Gin catalytic domain, and two flanking 26-bp AvrXa7 binding sites. As anticipated, the Gin-AvrXa7 fusion was unable to recombine DNA when AvrXa7 binding sites were positioned adjacent to the 20-bp core ( Figure 1C).
- Avr-G-ZF 206 GCGGGAGGCGTG
- PthXol-32G 208 GTGGTGTACAGTAGGGGGAGATGCA
- Gin-AvrXa7 fusion described above catalyzed recombination, the activity of this variant was considerably lower than that of engineered ZFRs. Further, specificity analysis revealed that the Gin-AvrXa7 fusion was unable to faithfully discriminate between recognition sites containing non-cognate DBD sites and non-native 20-bp core sequences, indicating that recombination might not be Gin-mediated ( Figure ID). Recent reports have shown that TALEN activity can be enhanced when the TALE portion of the fusion protein is truncated. Thus, in order to attempt to improve TALER activity, a series of N and C-terminal AvrXa7 truncations were generated ( Figure 2A).
- Each TALE truncation variant was fused to the Gin catalytic domain and this 20-member TALER library was cloned into a pBLA selection vector containing Avr-20G recognition sites. Following one round of selection in bacterial cells (Materials and Methods), individual ampicillin- resistant clones were sequences and it was found that all selected TALERs contained either one of two N-terminal truncations: ⁇ 87 and ⁇ 120. Each selected clone was also +28 on the C-terminus. With the exception of a single ⁇ 120 clone with a spontaneous 12 amino acid deletion near the fusion point ( ⁇ 120*), the activity of these clones was quite low (Figure 2B).
- Gin-based ZFRs routinely show 20-40% recombination, however, the highest activity observed amongst the selected TALER fusions was ⁇ 7% recombination (Gin- AvrXa7A120*). Because the TALE DBD is three times larger than a ZF domain (not including the required flanking peptide sequence), we reasoned that the 20-bp spacer used for these TALER constructs might not be the optimal length for recombination.
- Gin-AvrXa7A120 recombined targets containing a cognate core sequence > 100-fold more efficiently than a non-cognate core (Avr-20T, Avr-20GG, Avr-32T and Avr-32GG) ( Figure 2C).
- the Gin-AvrXa7A120 fusion was not as active on 44-bp cores (Avr-44G) (recombination was ⁇ 3-fold lower than Avr-32G) ( Figure 2C), indicating that core lengths between 26 and 44-bp are likely optimal for recombination by Gin-AvrXa7A120 in E. coli.
- Gin-AvrXa7A120 showed increased recombination in comparison to Gin-AvrXa7, it was suspected that Gin-AvrXa7A120 might not be an optimal TALE fusion architecture because: (i) ZFRs containing the Gin catalytic domain recombined DNA >2-fold more efficiently than Gin-AvrXa7A120 and (ii) Gin-AvrXa7A120 was not identified from a comprehensive library of TALE truncation variants. Thus, in order to identify better fusion architectures, a screen was devised based on the generation of a library of incrementally truncated TALE DBDs.
- Gin-Avr32GA74 and Gin-Avr32GA145 had modest activity on spacers longer than 20-bp, whereas Gin-Avr32GA128 recombined DNA with efficiencies comparable to the ZFR GinC4 ( Figure 3C). Furthermore, specificity analysis revealed that Gin-Avr32GA74, Gin-Avr32GA128, and Gin-Avr32GA145 could recombine substrates harboring cognate cores > 100-fold more efficiently than non-cognate cores (Avr-32T, Avr- 32GG and PthXol-32G) (Figure 3C). Together, these results suggest that TALE proteins containing N-terminal deletions between ⁇ 120 and ⁇ 129 represent an optimal truncation for fusion to a recombinase.
- the cloning plasmid was modified to include the +28 C-terminal truncation and either the ⁇ 120 or ⁇ 128 N-terminal truncation.
- Designed TALEs were fused to the Gin catalytic domain (denoted as Gin-Avrl5A120 and Gin-Avrl5A128) and cloned into a pBLA selection vector containing Avr-32G or Avr-32T target sites.
- TALERs based on the ⁇ 120 truncation were also found to recombine DNA as effectively as TALEs based on the ⁇ 128 architecture ( Figure 4A), indicating that designed TALEs may be less sensitive to N-terminal truncation than those containing the native AvrXa7 DBD.
- Gin-Pthl5A120 was highly active on its cognate substrate and that both Gin-Pthl5A120 and Gin-Avrl5A120 showed a >600 fold increase in recombination for targets with their cognate binding sites (Figure 4A).
- TALERs could modify DNA in mammalian cells.
- HEK human embryonic kidney
- pGL3 reporter plasmid
- TALE DBDs Unlike ZFPs, which contain a very minimal fusion architecture, TALE DBDs require native protein framework on either side of the DBD array to function.
- the so-called 0 th and 1 st repeats which mediate binding of the thymidine residue at position 0 and are found in almost all known TALE recognition sites, represent such an N-terminal framework.
- a recent crystal structure provided a description of the binding of the position 0 thymine, yet there remains insufficient data to determine a minimal TALE architecture. Indeed, all studies to date have used an N-terminal truncation containing considerably more residues than those required to mediate binding at position 0.
- Each target site contains a central 20-bp core sequence, which is recognized by the recombinase catalytic domain, and two adjacent ZFP binding sites.
- the fusion orientation of TALERs necessitates that TALE binding sites are on the opposite strand relative to the central core sequence.
- This unique geometry led us to investigate the minimum core sequence requirements for recombination. Because of the length of TALE DBDs (TALE repeats are 3 to 4 times longer than ZFPs) and the extended N-terminal linker between the catalytic domain and the TALE domain, we reasoned that longer core sequences (32 or 44- bp) would be necessary for recombination.
- Gin-AvrXa7A128 was identified as an optimal TALE fusion, but subsequent studies using synthetic TALE proteins generated using a publicly available TALE assembly kit indicated that ⁇ 128 and A120-based TALERs showed similar activity in E. coli. These designed TALEs were based on a chimeric protein derived from the closely related and naturally occurring Tallc and PthXol TALE proteins. Although TALEs share high homology, they are not identical. While polymorphisms in RVD repeats outside of residues 12 and 13 have been shown to have no affect on TALE fusion activities, to our knowledge no systematic evaluation of differences in TALE framework outside the DBDs has been reported.
- Gin-AvrXa7A120 and the synthetic Gin- Avrl5A120 may be attributable to the sequence variations between AvrXa7 framework and the TALE framework architecture used previously.
- RVDs NI: A, HD: C, NG: T, and NN: G
- NI A, HD: C, NG: T, and NN: G
- NN G
- a synthetic version targeting the same sequence would have 16 changes in RVD composition (Figure 7). It was hypothesized that because they are more commonly found in nature, the four RVDs selected for synthetic use might have a higher affinity for their cognate bases than other RVDs. If this were the case, it would be reasonable to assume that a TALE created with the synthetic RVD repeats could have higher DNA-binding affinity than a TALE using the native domains.
- TALEs can tolerate some mismatches in their target sequence. These findings are unsurprising, as RVDs that are positively associated with particular bases have been shown to tolerate non-cognate bases in nature.
- the cooperative specificity afforded by TALERs could be used to circumvent potential limitations, however. Because the catalytic domain contributes specificity to recombination, it is envisioned that designer TALERs capable of selectively modifying highly homologous genomic sequences could be generated as well. Indeed, it has been recently demonstrated that recombinase catalytic specificity can be effectively reprogrammed to target unnatural core sites.
- TALs transcription activator-like effectors constitute a novel class of DNA-binding proteins with predictable specificity.
- Tal effectors are employed by Gram-negative plant-pathogenic bacteria of the genus Xanthomonas which translocate a cocktail of different effector proteins via a type III secretion system (T3SS) into plant cells where they serve as virulence determinants.
- T3SS type III secretion system
- DNA-binding specificity of TALs is determined by a central domain of tandem repeats. Each repeat confers recognition of one base pair (bp) in the DNA. Rearrangement of repeat modules allows design of proteins with desired DNA-binding specificities with certain important limitations.
- the most constraining feature of targeting a DNA sequence with a Tal domain is the requirement that the Tal DNA site start with the base T and sometimes C. Targeting a binding site starting with a G or A base has not been possible at the -1 position.
- Tal-recombinase activity selections were used to select for Tal DNA binding domains that lack this restriction by targeting mutations to the -1 and 0 th RVD regions.
- the practical consequences of this discovery are vast since now every DNA sequence can be targeted with new Tal domains facilitating new unrestricted approaches to TAL transcription factors to turn transcription on/up or off/down, to target TAL nucleases to knock out gene function or to direct homologous recombination or to target our own TAL recombinases or other TAL enzymes.
- GmAvrl5A128-synthetic protein Following 3 rounds of tal recombinase activity selection of the resulting library, novel tal binding domains with the selected sequences RSNG (SEQ ID NO: 210) and SRSG (SEQ ID NO: 211) in the targeted region were selected. These were then shown to bind G at the 0th position of the target sequence over the parental T recognized by the starting clone. The selection was repeated randomizing the KQW region shown below in red that overlaps with the QWSG (SEQ ID NO: 212) selected initially. Now clones with selected SSR, SRA, SRC, and KRC sequences were selected.
- Subsequent refinements in binding activities can be achieved by random mutagenesis of the N-terminal domain or target mutagenesis of the KRGG (SEQ ID NO: 224) sequence within the 0th domain and reselection in the recombinase system.
- LTPDQ V V AI AS HD GGKQ ALET VQRLLP VLC QDHG (prototype RVD sequence; SEQ ID NO: 225)
- the library allows all amino acids at these two positions, though libraries limited to N, D, H, K, and Q amino acids are often successful substitutes for the H residue.
- libraries limited to N, D, H, K, and Q amino acids are often successful substitutes for the H residue.
- Tal recombinase activity selections then rapidly allow for the selection of new specificities within the targeted RVD domain.
- the resulting RVDs can be highly modular or context dependent in their sequence recognition and can be then used to create Tal nucleases and transcription factors.
- Utility of this technology includes unrestricted approaches to TAL transcription factors to turn transcription on/up or off/down, to target TAL nucleases to knock out gene function or to direct homologous recombination or to target our own TAL recombinases or other TAL enzymes for use as tools and therapeutics.
- TALE Transcription activator- like effector
- TALE-TFs transcription factors that target plant avirulence genes have a 5' thymidine. Synthetic TALE-TFs also have this requirement. Recent structural data indicate that there is an interaction between the N-terminal domain (NTD) and a 5 ' T of the target sequence. A survey of the recent TALE nuclease (TALEN) literature yielded conflicting data regarding the importance of the first base of the target sequence, the No residue. Additionally, there have been no studies regarding the impact of the No base on the activities of TALE recombinases (TALE-Rs).
- TALE-Rs TALE-TFs
- TALE DNA-binding domains expressed as fusions with maltose binding protein (MBP-TALEs) and TALENs.
- MBP-TALEs maltose binding protein
- TALENs fusions with maltose binding protein
- Novel NTD sequences were identified that provided highly active and selective TALE-R activity on TALE binding sites with 5 ' G, and additional domain sequences were selected that permitted general targeting of any 5' No residue. These domains were imported into TALE-TF, MBP- TALE and TALEN architectures and consistently exhibited greater activity than did the wild- type NTD on target sequences with non-T 5 ' residues.
- the novel NTDs are compatible with the golden gate TALEN assembly protocol and now make possible the efficient construction of TALE transcription factors, recombinases, nucleases and DNA-binding proteins that recognize any DNA sequence allowing for precise and unconstrained positioning of TALE- based proteins on DNA without regard to the 5 ' T rule that limits most natural TALE proteins.
- Avr 5'T 241 5'Biosg/ATC TTA GCA CCT GGT TGG AGG GGG TTT AT AGG GTT biotin hai in TTC CCTAT AAA CCC CCT CCA ACC AGG TGC TAA GAT
- 262 actgctatctcgagcGATAAACCCCCTCCAACCAGGcGATAAACCCCCTCCAACCAGGcGATAAACCCCCTCCAACC
- Hindlll/Spel The stuffer (Avr X, where X is the NO base), containing twin recombinase sites, was digested with Hindlll/Xbal and ligated into the vector to create a split beta- lactamase gene.
- pBCS AvrX was then digested with BamHl/Sacl, and Ginl27-N-stuffer- Avrl5 was digested with BamHl/Sacl and ligated into the vector to create Ginl27-N-stuffer- Avrl5-X.
- the stuffer was digested with Notl/Stul for evolutions at the N_i TALE hairpin and Notl/Sphl for evolutions at the No TALE hairpin.
- Primer ptall27 Notl fwd and reverse primers KXXG lib rev or KXXX lib rev were used to generate N-terminal variants at the N_i TALE hairpin and were subsequently digested with Notl/Stul then ligated into digested Ginl27-AvrX.
- Forward primer ptall27 Notl fwd and reverse primer KRGG Lib Rev were used to PCR amplify a library with mutations in the No TALE hairpin. This was subsequently digested with Notl/Sphl and ligated into Notl/Sphl -digested Ginl27-AvrX.
- TALEN pairs 50-75 ng each TALEN/well were transfected into HeLa cells in wells of 96-well plates at a density of 1.5 x 10 4 cells/well. After transfection, cells were placed in a 37° C incubator for 24 h, then were moved to 30° C for 2 days and then moved to 37° C for 24 h. Genomic DNA was isolated according to a published protocol, and DNA mutation rates were quantified with the Cell Surveyor assay and by sequencing. For Cell assays, genomic DNA was amplified by nested PCR, first with primers CCR5 outer fwd/CCR5 outer rev and then with CCR5 inner fwd/CCR5 inner rev.
- the second PCR was performed with CCR5 indel fwd/CCR5 indel rev. Fragments were then digested with BamHl/EcoRl and ligated into pUC19 with complementary digestion.
- Variant NTDs from the recombinase selection were PCR amplified with primers ptall27 SFI fwd and N-Term Sphl .
- the PCR product was amplified and digested with Notl/Stul and ligated into pTAL127-SFI Avrl5, which contains twin SFI-1 digestion sites facilitating transfer of the N-terminal-modified TALE from pTAL127-SFI Avrl5 into pcDNA 3.0 VP64.
- Corresponding TALE binding sites were cloned into the pGL3 Basic vector (Promega) upstream of the luciferase gene.
- pcDNA 100 ng was co- transfected with 5 ng of pGL3 vector and 1 ng of pRL Renilla luciferase control vector into HEK293t cells in a well of a 96-well plate using Lipofectimine 2000 (Life Technology) according to manufacturer's specifications. After 48 h, cells were washed, lysed and luciferase activity assessed with the Dual-Luciferase reporter system (Promega) on a Veritas Microplate luminometer (Turner Biosystems). Transfections were done in triplicate and results averaged.
- Affinity assays of MBP-TALE binding to biotinylated oligonucleotides were performed using a protocol previously described. Briefly, AvrXa7 TALE domains were expressed from pMAL MBP-AvrXa7 plasmid in XLl-Blue cells and purified on amylose resin. Biotinylated oligonucleotides containing the target AvrXa7 target site with modified residues were used to determine TALE -binding activity in sandwich enzyme-linked immunosorbent assay format. Antibodies targeting the MBP substituent were used for assay development.
- NT-G One clone (NT-G) of several observed with a W232 to R232 mutation demonstrated a significant shift of selectivity from 5' T to 5' G; the sequence resembles that of the NTD of a recently described Ralstonia TALE protein in this region.
- the Ralstonia NTD in the context of plant transcription factor reporter gene regulation, has been reported to prefer a 5 ' G in its substrate (see Figure 25 for a protein alignment).
- Residue R232 may contact the G base specifically, as indicated by the stringency of NT-G for 5' G.
- the preference of NT-G for a 5' G was comparable with the specificity of the wild-type domain for 5' T.
- NTD variants specific for 5' A or 5' C were not able to be derived, but a permissive NTD, NT-aN, was obtained that resembles the K265-G268 No hairpin that accepts substrates with any 5' residue and maintains high activity. It was hypothesized that this variant makes enhanced non-specific contacts with the DNA phosphate backbone compared with the wild-type NTD, enhancing the overall binding of the TALE -DNA complex without contacting a specific 5' residue. It was hypothesized that a shortened hairpin structure would allow selection of variants with specificity for 5' A or 5' C residues. A library with randomization at Q231-W232 and with residue 233 deleted was designed to shorten the putative DNA-binding loop.
- TALE-TFs with NT-G, NT-aN and ⁇ - ⁇ domains demonstrated 400-1500-fold increases in transcriptional activation of a luciferase target gene bearing operator sites without a 5 ' T residue when compared with the TALE-TF with the NT-T domain.
- the NT-G- based TF retained the 5 ' G selectivity as observed in the TALE-R selection system.
- the activities of NT-aN- and ⁇ - ⁇ -based TFs against all 5' nucleotides tracked the relative activity observed in the recombinase format (Figure 20).
- MBP-TALEs also exhibited greater relative binding affinity for target oligonucleotides with sites that did not have a 5 ' T than did the wild-type MBP-TALE ( Figure 26), providing further evidence that the selected domains enhanced recognition of or tolerance for non-thymine 5' bases.
- NT-aN had activity 9- and 2-fold higher than the wild-type NT-T on TALEN pairs A1/A2 and C1/C2, respectively.
- the optimized NTDs greatly improved TALEN activity when used in gene editing experiments.
- NTD's that can accommodate any 5' residue would further simplify the rules for effective TALE construction and greatly enhance applications requiring precise TALE placement for genome engineering and interrogation (e.g. precise cleavage of DNA at a defined base pair using TALENs, seamless gene insertion and exchange via TALE-Recombinases,
- DNA-based nanotechnology include decorating DNA nanostructures/origami with specific DNA-binding proteins.
- targeting to specific sites is constrained based on DNA folding/structure and thus being able to bind any site is critical.
- Elaboration of these structures and devices with DNA-binding proteins could be a beautiful approach to expanding function. Indeed, it is not difficult to imagine many applications for DNA binding proteins and their fusions when all targeting constraints are removed.
- the recently developed TALE-R system was used to evolve the NTD of the TALE to remove the 5'-T constraint.
- an NTD was obtained with specificity for a 5' G. Numerous selections were performed in attempts to obtain variants that recognized either 5 ' A or 5' C.
- the G230-K234 hairpin was inverted, the K230-G234/ins232 hairpin extended, modification of the K265-G268 No hairpin attempted, and random mutagenesis libraries evaluated. None of these strategies yielded NTDs with affinity for target sequences with 5' A or 5' C, although we did identify an NTD, ⁇ - ⁇ , with a deletion that recognized substrates with both 5' A and 5' C residues with acceptable affinity.
- NTDs Brgl 1 and NT-T Owing to the high structural homology between the NTDs Brgl 1 and NT-T, it may be possible to modify the preference of the Ralstonia TALE NTD to thymine by a simple arginine to tryptophan mutation or to eliminate specificity by grafting NT-aN or ⁇ - ⁇ domains into this related protein. It is also interesting to note that arginine-guanine interactions are common in evolved zinc finger domains.
- TALE-TFs with optimized NTDs enhanced TALE activation between 400- and 1500-fold relative to the activity of NT-T against AvrXa7 promoter sites with non-T 5' residues.
- TALE-TFs with optimized NTDs enhanced TALE activation between 400- and 1500-fold relative to the activity of NT-T against AvrXa7 promoter sites with non-T 5' residues.
- our NTD with non- T selectivity enhanced activity 2-9-fold relative to that of the NT-T domain on substrates with 5' A, C or G.
- the increases in TALEN gene editing generally correlated with increases in activity observed in TALE-R and TALE-TF constructs.
- NT-G The specificity and high activity of NT-G was maintained, as evidenced by the lower activity in assays with TALEN pairs A1/A2, C1/C2, and T1/T2, and the generally high activity of NT-aN and ⁇ - ⁇ was also imparted into the TALEN ⁇ 152/+63 architecture.
- TALE DBDs and TALE-TFs allow for the precise placement of TALE DBDs and TALE-TFs at any DNA sequence to facilitate gene regulation, displacement of endogenous DNA-binding proteins and synthetic biology applications where precise binding might be key.
- TALENs based on the native NTD show varying degrees of tolerance of No base substitutions, the data indicate that the novel NTDs reported here also facilitate higher efficiency gene editing with any No base as compared with natural NTD-based TALENs.
- the split gene reassembly vector (pBLA) was derived from pBluescriptll SK (-) (Stratagene) and modified to contain a chloramphenicol resistance gene and an interrupted TEM-1 p lactamase gene under the control of a lac promoter. ZFR target sites were introduced as previously described. Briefly, GFPuv (Clontech) was PCR amplified with the primers GFP- ZFR-Xbal-Fwd and GFP-ZFR-Hindlll-Rev and cloned into the Spel and Hindlll restriction sites of pBLA to generate pBLA-ZFR substrates. All primer sequences are provided in Table 8.
- ZFR-Target- 272 CACCTTCTCCCAGGATAAGG
- the SV40 promoter was PCR amplified from pGL3- Prm (Promega) with the primers SV40-ZFR-BglIII-Fwd and SV40-ZFR- Hindlll-Rev. PCR products were digested with Bglll and Hindlll and ligated into the same restriction sites of pGL3-Prm to generate pGL3-ZFR-l, 2, 3...18.
- the pBPS-ZFR donor plasmid was constructed as previously described with the following exception: the ZFR-1, 2 and 3 recombination sites were encoded by primers 3' CMV-PstI-ZFR-1, 2 or 3-Rev. Correct construction of each plasmid was verified by sequence analysis.
- ZFRs were assembled by PCR as previously described. PCR products were digested with Sacl and Xbal and ligated into the same restrictions sites of pBLA. Ligations were transformed by electroporation into Escherichia coli TOPI OF' (Invitrogen). After 1 hr recovery in SOC medium, cells were incubated with 5 mL SB medium with 30 A g mL "1 chloramphenicol and cultured at 37°C. At 16 hr, cells were harvested; plasmid DNA was isolated by Mini-prep (Invitrogen) and 200 ng pBLA was used to transform E. coli T0P1 OF'. After 1 hr recovery in SOC, cells were plated on solid LB media with 30 A g mL "1
- the ZFR library was constructed by overlap extension PCR as previously described. Mutations were introduced at positions 120, 123, 127, 136 and 137 with the degenerate codon NNK (N: A, T, C or G and K: G or T), which encodes all 20 amino acids.
- PCR products were digested with Sacl and Xbal and ligated into the same restriction sites of pBLA. Ligations were ethanol precipitated and used to transform E. coli T0P1 OF'. Library size was routinely determined to be ⁇ 5 x 10 7 . After 1 hr recovery in SOC medium, cells were incubated in 100 mL SB medium with 30 A g mL "1 chloramphenicol at 37°C.
- Enriched ZFRs were isolated by Sacl and Xbal digestion and ligated into fresh pBLA for further selection. After 4 rounds of selection, sequence analysis was performed on individual carbenicillin-resistant clones. Recombination assays were performed as described above.
- Zinc-fingers were assembled by SuperZiF and ligated into the Agel and Spel restriction sites of pBH-Gin-a, P, y, 5, s or Z to generate pBH-ZFR-L/R-1, 2, 3.18 (L: left ZFR; R: right ZFR).
- ZFR genes were released from pBH by Sfil digestion and ligated into pcDNA 3.1 (Invitrogen) to generate pcDNA-ZFR-L/R-1, 2, 3.18. Correct construction of each ZFR was verified by sequence analysis (Table 9).
- Catalytic domain Target 120 123 127 136 137
- the ⁇ catalytic domain also contains the substitutions M124S, R131I and P141R.
- HEK293 and 293T cells were maintained in DMEM containing 10% (vol/vol) FBS and 1% (vol/vol) Antibiotic- Antimycotic (Anti-Anti; Gibco).
- HEK293 cells were seeded onto 96-well plates at a density of 4 x 10 4 cells per well and established in a humidified 5% C0 2 atmosphere at 37°C.
- cells were transfected with 150 ng pcDNA-ZFR-L 1-18, 150 ng pcDNA-ZFR-R 1-18, 2.5 ng pGL3-ZFR-l, 2, 3.
- HEK293 cells were seeded onto 6-well plates at a density of 5 x 10 5 cells per well and maintained in serum-containing media in a humidified 5% C0 2 atmosphere at 37°C.
- cells were transfected with 1 A g pcDNA-ZFR-L-1, 2 or 3 and 1 A g pcDNA-ZFR- R-l, 2 or 3 and 200 ng pBPS-ZFR-1, 2 or 3 using Lipofectamine 2000 according to the manufacturer's instructions.
- cells were split onto 6-well plates at a density of 5 x 10 4 cells per well and maintained in serum-containing media with 2 A g mL" puromycin.
- ZFR targets were PCR amplified with the following primer combinations: ZFR-Target-1, 2 or 3-Fwd and ZFR-Target-1 , 2 or 3-Rev (Unmodified target); ZFR-Target-1, 2 or 3-Fwd and CMV-Mid-Prim-1 (Forward integration); and CMV-Mid-Prim-1 and ZFR-Target-1, 2 or 3- Rev (Reverse integration) using the Expand High Fidelity Taq System (Roche).
- Recombination was determined by split gene reassembly, a previously described method that links recombinase activity to antibiotic resistance.
- Gin tolerates (i) 12 of the 16 possible two-base combinations at the dinucleotide core (AA, AT, AC, AG, TA, TT, TC, TG, CA, CT, GA, GT); (ii) 4 of the 16 possible two-base combinations at positions 3 and 2 (CC, CG, GG and TG); (iii) a single A to T substitution at positions 6, 5, or 4; and (iv) all 12 possible single- base substitutions at positions 10, 9, 8, and 7 ( Figure 31A-D). Further, it was found that Gin could recombine a target site library containing at least 10 6 (of a possible 4.29 x 10 9 ) unique base combinations at positions 10, 9, 8, and 7 ( Figure 3 ID).
- Gin catalytic specificity could be re- engineered to specifically recognize core sequences containing each of the 12 base combinations not tolerated by the native enzyme (Figure 32A) was investigated.
- Figure 32A the crystal structures of two related serine recombinases, the y6 resolvase and Sin recombinase, in complex with their respective DNA targets were examined. Based on these models, five residues were identified that contact DNA at positions 3 and 2: Leu 123, Thr 126, Arg 130, Val 139, and Phe 140
- the ZFR library was cloned into substrate plasmids containing one of the five base combinations not tolerated by the native enzyme (GC, GT, CA, AC, or TT) and enriched for active ZFRs by split gene reassembly (Figure 32C). After 4 rounds of selection, it was found that the activity of each ZFR population increased > 1,000-fold on DNA targets containing GC, GT, CA, and TT substitutions and > 100-fold on a DNA target containing AC
- Gin p, y, 6, e and Z five Gin variants shown to recognize nine of the 12 possible two-base combinations not tolerated by the parental enzyme (GC, TC, GT, CT, GA, CA, AG, AC, and TT) (Table 1).
- Gin p, 6, and e recombined their intended core sequences with activity and specificity comparable to that of the parental enzyme (hereafter referred to as Gin a) and that Gin y and Z were able to recombine their intended core sequences with specificity exceeding that of Gin a ( Figure 32E).
- sequence profiles of the selected Gin variants includes approximately 7 x 10 (of a possible
- a transient reporter assay was developed that correlates ZFR-mediated recombination to reduced luciferase expression ( Figures 33A and 39).
- ZFR target sites were introduced upstream and downstream an S V40 promoter that drives expression of a luciferase reporter gene.
- Human embryonic kidney (HEK) 293T cells were co-transfected with expression vectors for each ZFR pair and its corresponding reporter plasmid. Luciferase expression was measured 48 hr after transfection.
- Engineered ZFRs mediate targeted integration into the human genome.
- HEK293 cells were co-transfected with ZFR expression vectors and a corresponding DNA donor plasmid that contained a specific ZFR target site and a puromycin- resistance gene under the control of an SV40 promoter.
- ZFR pairs 1 , 2, and 3 were used which were designed to target non-protein coding loci on human chromosomes 4, X, and 4, respectively ( Figure 34A).
- puromycin- containing media were incubated with puromycin- containing media and measured integration efficiency by determining the number of puromycin- resistant (puro R ) colonies.
- ZFRs can be designed to recombine user-defined sequences with high specificity and that ZFRs can integrate DNA into pre-determined endogenous loci in human cells. By combining substrate specificity analysis and directed evolution, virtually all sequence requirements imposed by the ZFR catalytic domain were eliminated. Using the archive of 45 pre-selected zinc-finger modules, it is estimated that ZFRs can be designed to
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Environmental Sciences (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Animal Husbandry (AREA)
- Biodiversity & Conservation Biology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (21)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/425,944 US9902962B2 (en) | 2012-09-04 | 2013-09-04 | Chimeric polypeptides having targeted binding specificity |
| SG11201501525QA SG11201501525QA (en) | 2012-09-04 | 2013-09-04 | Chimeric polypeptides having targeted binding specificity |
| CN201380057657.5A CN104781404B (zh) | 2012-09-04 | 2013-09-04 | 具有靶向结合特异性的嵌合多肽 |
| EP13834893.3A EP2893022B1 (en) | 2012-09-04 | 2013-09-04 | Chimeric polypeptides having targeted binding specificity |
| AU2013312801A AU2013312801B2 (en) | 2012-09-04 | 2013-09-04 | Chimeric polypeptides having targeted binding specificity |
| BR112015004696-7A BR112015004696B1 (pt) | 2012-09-04 | 2013-09-04 | Polipeptídeos quiméricos tendo especificidade de ligação direcionada, método de geração de um domínio n-terminal (ntd) de proteína efetora tipo ativador de transcrição (tale) e método para a recombinação sítio-específica |
| KR1020227002477A KR102596125B1 (ko) | 2012-09-04 | 2013-09-04 | 표적화된 바인딩 특이도를 갖는 키메라 폴리펩타이드들 |
| DK13834893.3T DK2893022T3 (da) | 2012-09-04 | 2013-09-04 | Kimæriske polypeptider med målrettet bindingsspecificitet |
| EP20167774.7A EP3750999B1 (en) | 2012-09-04 | 2013-09-04 | Chimeric polypeptides having targeted binding specificity |
| CN201811108126.5A CN109517068B (zh) | 2012-09-04 | 2013-09-04 | 具有靶向结合特异性的嵌合多肽 |
| JP2015530154A JP6442406B2 (ja) | 2012-09-04 | 2013-09-04 | 標的結合特異性を有するキメラポリペプチド |
| KR1020157008001A KR102201867B1 (ko) | 2012-09-04 | 2013-09-04 | 표적화된 바인딩 특이도를 갖는 키메라 폴리펩타이드들 |
| CA2883511A CA2883511C (en) | 2012-09-04 | 2013-09-04 | Chimeric polypeptides having targeted binding specificity |
| EP22181257.1A EP4148134A1 (en) | 2012-09-04 | 2013-09-04 | Chimeric polypeptides having targeted binding specificity |
| KR1020217000390A KR102357105B1 (ko) | 2012-09-04 | 2013-09-04 | 표적화된 바인딩 특이도를 갖는 키메라 폴리펩타이드들 |
| IL23744215A IL237442B (en) | 2012-09-04 | 2015-02-26 | Chimeric polypeptides with targeted binding specificity |
| US15/878,043 US10829766B2 (en) | 2012-09-04 | 2018-01-23 | Chimeric polypeptides having targeted binding specificity |
| AU2019200922A AU2019200922B2 (en) | 2012-09-04 | 2019-02-08 | Chimeric polypeptides having targeted binding specificity |
| US17/031,149 US11466277B2 (en) | 2012-09-04 | 2020-09-24 | Chimeric polypeptides having targeted binding specificity |
| AU2021240252A AU2021240252B2 (en) | 2012-09-04 | 2021-09-30 | Chimeric polypeptides having targeted binding specificity |
| US17/951,849 US20230304022A1 (en) | 2012-09-04 | 2022-09-23 | Chimeric polypeptides having targeted binding specificity |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261696689P | 2012-09-04 | 2012-09-04 | |
| US61/696,689 | 2012-09-04 | ||
| US201361753763P | 2013-01-17 | 2013-01-17 | |
| US61/753,763 | 2013-01-17 | ||
| US201361818364P | 2013-05-01 | 2013-05-01 | |
| US61/818,364 | 2013-05-01 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/425,944 A-371-Of-International US9902962B2 (en) | 2012-09-04 | 2013-09-04 | Chimeric polypeptides having targeted binding specificity |
| US15/878,043 Division US10829766B2 (en) | 2012-09-04 | 2018-01-23 | Chimeric polypeptides having targeted binding specificity |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2014039585A2 true WO2014039585A2 (en) | 2014-03-13 |
| WO2014039585A3 WO2014039585A3 (en) | 2014-05-22 |
Family
ID=50237752
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/058100 Ceased WO2014039585A2 (en) | 2012-09-04 | 2013-09-04 | Chimeric polypeptides having targeted binding specificity |
Country Status (12)
| Country | Link |
|---|---|
| US (4) | US9902962B2 (cg-RX-API-DMAC7.html) |
| EP (3) | EP4148134A1 (cg-RX-API-DMAC7.html) |
| JP (4) | JP6442406B2 (cg-RX-API-DMAC7.html) |
| KR (3) | KR102357105B1 (cg-RX-API-DMAC7.html) |
| CN (2) | CN104781404B (cg-RX-API-DMAC7.html) |
| AU (3) | AU2013312801B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112015004696B1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2883511C (cg-RX-API-DMAC7.html) |
| DK (1) | DK2893022T3 (cg-RX-API-DMAC7.html) |
| IL (1) | IL237442B (cg-RX-API-DMAC7.html) |
| SG (2) | SG10201701675PA (cg-RX-API-DMAC7.html) |
| WO (1) | WO2014039585A2 (cg-RX-API-DMAC7.html) |
Cited By (48)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016016842A1 (en) * | 2014-07-30 | 2016-02-04 | Zumutor Biologics, Inc. | Non-fucosylated protein and methods thereof |
| WO2017015545A1 (en) * | 2015-07-22 | 2017-01-26 | President And Fellows Of Harvard College | Evolution of site-specific recombinases |
| US9771574B2 (en) | 2008-09-05 | 2017-09-26 | President And Fellows Of Harvard College | Apparatus for continuous directed evolution of proteins and nucleic acids |
| US10179911B2 (en) | 2014-01-20 | 2019-01-15 | President And Fellows Of Harvard College | Negative selection and stringency modulation in continuous evolution systems |
| CN109771403A (zh) * | 2019-01-24 | 2019-05-21 | 广州医科大学附属第一医院 | 一种大鼠造影剂肾病模型的构建方法 |
| US10336997B2 (en) | 2010-12-22 | 2019-07-02 | President And Fellows Of Harvard College | Continuous directed evolution |
| US10507232B2 (en) | 2014-04-02 | 2019-12-17 | University Of Florida Research Foundation, Incorporated | Materials and methods for the treatment of latent viral infection |
| US10612011B2 (en) | 2015-07-30 | 2020-04-07 | President And Fellows Of Harvard College | Evolution of TALENs |
| US10829766B2 (en) | 2012-09-04 | 2020-11-10 | The Scripps Research Institute | Chimeric polypeptides having targeted binding specificity |
| US10912833B2 (en) | 2013-09-06 | 2021-02-09 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US10920208B2 (en) | 2014-10-22 | 2021-02-16 | President And Fellows Of Harvard College | Evolution of proteases |
| US10947530B2 (en) | 2016-08-03 | 2021-03-16 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10954548B2 (en) | 2013-08-09 | 2021-03-23 | President And Fellows Of Harvard College | Nuclease profiling system |
| WO2021087358A1 (en) * | 2019-11-01 | 2021-05-06 | Sangamo Therapeutics, Inc. | Gin recombinase variants |
| US11053481B2 (en) | 2013-12-12 | 2021-07-06 | President And Fellows Of Harvard College | Fusions of Cas9 domains and nucleic acid-editing domains |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US11299729B2 (en) | 2015-04-17 | 2022-04-12 | President And Fellows Of Harvard College | Vector-based mutagenesis system |
| US11299755B2 (en) | 2013-09-06 | 2022-04-12 | President And Fellows Of Harvard College | Switchable CAS9 nucleases and uses thereof |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11447809B2 (en) | 2017-07-06 | 2022-09-20 | President And Fellows Of Harvard College | Evolution of tRNA synthetases |
| US11524983B2 (en) | 2015-07-23 | 2022-12-13 | President And Fellows Of Harvard College | Evolution of Bt toxins |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11578343B2 (en) | 2014-07-30 | 2023-02-14 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US11624130B2 (en) | 2017-09-18 | 2023-04-11 | President And Fellows Of Harvard College | Continuous evolution for stabilized proteins |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US20230234993A1 (en) * | 2020-12-17 | 2023-07-27 | National Marine Biodiversity Institute Of Korea | Composition for preventing or treating neurological diseases related to copper metabolism, comprising multi-copper oxidase peptide |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US11820969B2 (en) | 2016-12-23 | 2023-11-21 | President And Fellows Of Harvard College | Editing of CCR2 receptor gene to protect against HIV infection |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11913044B2 (en) | 2018-06-14 | 2024-02-27 | President And Fellows Of Harvard College | Evolution of cytidine deaminases |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US12060553B2 (en) | 2017-08-25 | 2024-08-13 | President And Fellows Of Harvard College | Evolution of BoNT peptidases |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| US12559737B2 (en) | 2013-09-06 | 2026-02-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9708589B2 (en) * | 2012-12-18 | 2017-07-18 | Monsanto Technology Llc | Compositions and methods for custom site-specific DNA recombinases |
| US10793867B2 (en) | 2013-03-15 | 2020-10-06 | Monsanto Technology, Llc | Methods for targeted transgene-integration using custom site-specific DNA recombinases |
| US11339408B2 (en) | 2015-08-20 | 2022-05-24 | Applied Stemcell, Inc. | Nuclease with enhanced efficiency of genome editing |
| WO2018187796A1 (en) * | 2017-04-07 | 2018-10-11 | Donald Danforth Plant Science Center | Methods for increasing resistance to cotton bacterial blight and plants produced thereby |
| US12312383B2 (en) | 2018-04-18 | 2025-05-27 | Altius Institute For Biomedical Sciences | Animal pathogen-derived polypeptides and uses thereof for genetic engineering |
| US12264181B2 (en) | 2018-06-27 | 2025-04-01 | Altius Institute For Biomedical Sciences | Nucleic acid binding domains and methods of use thereof |
| US12012433B1 (en) * | 2020-02-27 | 2024-06-18 | Integrated Dna Technologies Inc. | Expression and purification of Cas enzymes |
| CN116096878A (zh) | 2020-05-01 | 2023-05-09 | 合成Dna技术公司 | 在非经典tttt前间区序列邻近基序处具有增强的切割活性的毛螺菌科菌种cas12a突变体 |
| US20230313154A1 (en) * | 2020-07-17 | 2023-10-05 | Cb Therapeutics, Inc. | Prenyltransferase enzymes |
Citations (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6140466A (en) | 1994-01-18 | 2000-10-31 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US6140081A (en) | 1998-10-16 | 2000-10-31 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US6242568B1 (en) | 1994-01-18 | 2001-06-05 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US20020081614A1 (en) | 1999-09-14 | 2002-06-27 | Sangamo Biosciences, Inc. | Functional genomics using zinc finger proteins |
| US6453242B1 (en) | 1999-01-12 | 2002-09-17 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
| US20020165356A1 (en) | 2001-02-21 | 2002-11-07 | The Scripps Research Institute | Zinc finger binding domains for nucleotide sequence ANN |
| US6503717B2 (en) | 1999-12-06 | 2003-01-07 | Sangamo Biosciences, Inc. | Methods of using randomized libraries of zinc finger proteins for the identification of gene function |
| US20030021776A1 (en) | 2000-12-07 | 2003-01-30 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US20030166141A1 (en) | 1999-01-12 | 2003-09-04 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6706470B2 (en) | 1999-05-28 | 2004-03-16 | Sangamo Biosciences, Inc. | Gene switches |
| US6794136B1 (en) | 2000-11-20 | 2004-09-21 | Sangamo Biosciences, Inc. | Iterative optimization in the design of binding proteins |
| US20040224385A1 (en) | 2001-08-20 | 2004-11-11 | Barbas Carlos F | Zinc finger binding domains for cnn |
| US20050084885A1 (en) | 1994-01-18 | 2005-04-21 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US20050257062A1 (en) | 1998-03-11 | 2005-11-17 | Paul Ignatius | System and method for providing encryption in pipelined storage operations in a storage network |
| US20060078880A1 (en) | 2002-02-07 | 2006-04-13 | The Scripps Research Institute | Zinc finger libraries |
| US7030215B2 (en) | 1999-03-24 | 2006-04-18 | Sangamo Biosciences, Inc. | Position dependent recognition of GNN nucleotide triplets by zinc fingers |
| US7067317B2 (en) | 2000-12-07 | 2006-06-27 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
| US20060211846A1 (en) | 2002-02-13 | 2006-09-21 | Barbas Carlos F Iii | Zinc finger binding domains for nucleotide sequence ANN |
| US20060246567A1 (en) | 2001-01-22 | 2006-11-02 | Sangamo Biosciences, Inc. | Modified zinc finger binding proteins |
| WO2008006028A2 (en) | 2006-07-05 | 2008-01-10 | The Scripps Research Institute | Chimeric zinc finger recombinases optimized for catalysis by directed evolution |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1993025682A2 (en) * | 1992-06-11 | 1993-12-23 | New York University | Chimeric receptor polypeptides, human h13 proteins and uses thereof |
| US8586526B2 (en) | 2010-05-17 | 2013-11-19 | Sangamo Biosciences, Inc. | DNA-binding proteins and uses thereof |
| WO2011072246A2 (en) * | 2009-12-10 | 2011-06-16 | Regents Of The University Of Minnesota | Tal effector-mediated dna modification |
| CN103210087B (zh) * | 2010-09-06 | 2015-04-29 | 淡马锡生命科学研究院有限公司 | Xa10与AvrXa10之间的分子相互作用 |
| US9499592B2 (en) * | 2011-01-26 | 2016-11-22 | President And Fellows Of Harvard College | Transcription activator-like effectors |
| HK1200871A1 (en) | 2011-11-16 | 2015-08-14 | Sangamo Therapeutics, Inc. | Modified dna-binding proteins and uses thereof |
| WO2013101877A2 (en) * | 2011-12-29 | 2013-07-04 | Iowa State University Research Foundation, Inc. | Genetically modified plants with resistance to xanthomonas and other bacterial plant pathogens |
| KR102357105B1 (ko) * | 2012-09-04 | 2022-02-08 | 더 스크립스 리서치 인스티튜트 | 표적화된 바인딩 특이도를 갖는 키메라 폴리펩타이드들 |
-
2013
- 2013-09-04 KR KR1020217000390A patent/KR102357105B1/ko active Active
- 2013-09-04 BR BR112015004696-7A patent/BR112015004696B1/pt active IP Right Grant
- 2013-09-04 JP JP2015530154A patent/JP6442406B2/ja active Active
- 2013-09-04 KR KR1020157008001A patent/KR102201867B1/ko active Active
- 2013-09-04 CN CN201380057657.5A patent/CN104781404B/zh active Active
- 2013-09-04 DK DK13834893.3T patent/DK2893022T3/da active
- 2013-09-04 EP EP22181257.1A patent/EP4148134A1/en active Pending
- 2013-09-04 SG SG10201701675PA patent/SG10201701675PA/en unknown
- 2013-09-04 CN CN201811108126.5A patent/CN109517068B/zh active Active
- 2013-09-04 AU AU2013312801A patent/AU2013312801B2/en not_active Revoked
- 2013-09-04 SG SG11201501525QA patent/SG11201501525QA/en unknown
- 2013-09-04 KR KR1020227002477A patent/KR102596125B1/ko active Active
- 2013-09-04 WO PCT/US2013/058100 patent/WO2014039585A2/en not_active Ceased
- 2013-09-04 EP EP13834893.3A patent/EP2893022B1/en active Active
- 2013-09-04 US US14/425,944 patent/US9902962B2/en active Active
- 2013-09-04 EP EP20167774.7A patent/EP3750999B1/en active Active
- 2013-09-04 CA CA2883511A patent/CA2883511C/en active Active
-
2015
- 2015-02-26 IL IL23744215A patent/IL237442B/en active IP Right Grant
-
2018
- 2018-01-23 US US15/878,043 patent/US10829766B2/en active Active
- 2018-08-02 JP JP2018146232A patent/JP6728283B2/ja active Active
-
2019
- 2019-02-08 AU AU2019200922A patent/AU2019200922B2/en active Active
-
2020
- 2020-07-01 JP JP2020114229A patent/JP7100681B2/ja active Active
- 2020-09-24 US US17/031,149 patent/US11466277B2/en active Active
-
2021
- 2021-09-30 AU AU2021240252A patent/AU2021240252B2/en active Active
-
2022
- 2022-07-01 JP JP2022106801A patent/JP7459174B2/ja active Active
- 2022-09-23 US US17/951,849 patent/US20230304022A1/en active Pending
Patent Citations (46)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6242568B1 (en) | 1994-01-18 | 2001-06-05 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US20050084885A1 (en) | 1994-01-18 | 2005-04-21 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US6140466A (en) | 1994-01-18 | 2000-10-31 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US6790941B2 (en) | 1994-01-18 | 2004-09-14 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US20030059767A1 (en) | 1994-01-18 | 2003-03-27 | Barbas Iii Carlos F. | Zinc finger protein derivatives and methods therefor |
| US20050257062A1 (en) | 1998-03-11 | 2005-11-17 | Paul Ignatius | System and method for providing encryption in pipelined storage operations in a storage network |
| US20050148075A1 (en) | 1998-10-16 | 2005-07-07 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US6140081A (en) | 1998-10-16 | 2000-10-31 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US20060223757A1 (en) | 1998-10-16 | 2006-10-05 | Barbas Carlos F | Zinc finger binding domains for GNN |
| US7101972B2 (en) | 1998-10-16 | 2006-09-05 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US6610512B1 (en) | 1998-10-16 | 2003-08-26 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US7013219B2 (en) | 1999-01-12 | 2006-03-14 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6979539B2 (en) | 1999-01-12 | 2005-12-27 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6607882B1 (en) | 1999-01-12 | 2003-08-19 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US20030087817A1 (en) | 1999-01-12 | 2003-05-08 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US20030166141A1 (en) | 1999-01-12 | 2003-09-04 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US20050130304A1 (en) | 1999-01-12 | 2005-06-16 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US20030105593A1 (en) | 1999-01-12 | 2003-06-05 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
| US6785613B2 (en) | 1999-01-12 | 2004-08-31 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
| US20060078878A1 (en) | 1999-01-12 | 2006-04-13 | Sangamo Biosciences, Incorporated | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US20050215502A1 (en) | 1999-01-12 | 2005-09-29 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US6453242B1 (en) | 1999-01-12 | 2002-09-17 | Sangamo Biosciences, Inc. | Selection of sites for targeting by zinc finger proteins and methods of designing zinc finger proteins to bind to preselected sites |
| US6933113B2 (en) | 1999-01-12 | 2005-08-23 | Sangamo Biosciences, Inc. | Modulation of endogenous gene expression in cells |
| US6824978B1 (en) | 1999-01-12 | 2004-11-30 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7030215B2 (en) | 1999-03-24 | 2006-04-18 | Sangamo Biosciences, Inc. | Position dependent recognition of GNN nucleotide triplets by zinc fingers |
| US6706470B2 (en) | 1999-05-28 | 2004-03-16 | Sangamo Biosciences, Inc. | Gene switches |
| US20040203064A1 (en) | 1999-09-14 | 2004-10-14 | Sangamo Biosciences, Inc. | Functional genomics using zinc finger proteins |
| US6599692B1 (en) | 1999-09-14 | 2003-07-29 | Sangamo Bioscience, Inc. | Functional genomics using zinc finger proteins |
| US20020081614A1 (en) | 1999-09-14 | 2002-06-27 | Sangamo Biosciences, Inc. | Functional genomics using zinc finger proteins |
| US6777185B2 (en) | 1999-09-14 | 2004-08-17 | Sangamo Biosciences, Inc. | Functional genomics using zinc finger proteins |
| US6503717B2 (en) | 1999-12-06 | 2003-01-07 | Sangamo Biosciences, Inc. | Methods of using randomized libraries of zinc finger proteins for the identification of gene function |
| US20030134318A1 (en) | 1999-12-06 | 2003-07-17 | Sangamo Biosciences, Inc. | Methods of using randomized libraries of zinc finger proteins for the identification of gene function |
| US20060166263A1 (en) | 1999-12-06 | 2006-07-27 | Sangamo Biosciences, Inc. | Randomized libraries of zinc finger proteins |
| US6794136B1 (en) | 2000-11-20 | 2004-09-21 | Sangamo Biosciences, Inc. | Iterative optimization in the design of binding proteins |
| US7026462B2 (en) | 2000-12-07 | 2006-04-11 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
| US20030021776A1 (en) | 2000-12-07 | 2003-01-30 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
| US7067317B2 (en) | 2000-12-07 | 2006-06-27 | Sangamo Biosciences, Inc. | Regulation of angiogenesis with zinc finger proteins |
| US20060246588A1 (en) | 2001-01-22 | 2006-11-02 | Sangamo Biosciences, Inc. | Modified zinc finger binding proteins |
| US20060246567A1 (en) | 2001-01-22 | 2006-11-02 | Sangamo Biosciences, Inc. | Modified zinc finger binding proteins |
| US7067617B2 (en) | 2001-02-21 | 2006-06-27 | The Scripps Research Institute | Zinc finger binding domains for nucleotide sequence ANN |
| US20020165356A1 (en) | 2001-02-21 | 2002-11-07 | The Scripps Research Institute | Zinc finger binding domains for nucleotide sequence ANN |
| US20040224385A1 (en) | 2001-08-20 | 2004-11-11 | Barbas Carlos F | Zinc finger binding domains for cnn |
| US20060078880A1 (en) | 2002-02-07 | 2006-04-13 | The Scripps Research Institute | Zinc finger libraries |
| US20060211846A1 (en) | 2002-02-13 | 2006-09-21 | Barbas Carlos F Iii | Zinc finger binding domains for nucleotide sequence ANN |
| WO2008006028A2 (en) | 2006-07-05 | 2008-01-10 | The Scripps Research Institute | Chimeric zinc finger recombinases optimized for catalysis by directed evolution |
Non-Patent Citations (16)
| Title |
|---|
| "Nucleic Acid Hybridization: A Practical Approach", 1985, IRL PRESS |
| AUSUBEL ET AL.: "Wisconsin Sequence Analysis Package Program Manual", 1995, WILEY & SONS |
| CREIGHTON: "Proteins", 1984, W. H. FREEMAN AND COMPANY |
| ESPOSITO, D.SCOCCA, J. J., NUCLEIC ACIDS RESEARCH, vol. 25, 1997, pages 3605 - 3614 |
| GRIBSKOV, NUCL. ACIDS RES., vol. 14, no. 6, 1986, pages 6745 - 6763 |
| MILLER ET AL.: "A TALE nuclease architecture for efficient genome editing supplementary information", NATURE BIOTECHNOLOGY, vol. 29, no. 2, 2010, pages 143 - 148 |
| MUSSOLINO ET AL.: "A novel TALE nuclease scaffold enables high genome editing activity in combination with low toxicity", NUCLEIC ACIDS RESEARCH, vol. 39, no. 21, 2011, pages 9283 - 9293, XP055021128, DOI: 10.1093/nar/gkr597 |
| NUNES-DUBY, S. E. ET AL., NUCLEIC ACIDS RESEARCH, vol. 26, 1998, pages 391 - 406 |
| SAMBROOK ET AL., DNA CLONING |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR |
| SCHULZSCHIMER: "Principles of Protein Structure", 1979, SPRINGER-VERLAG |
| SMITH ET AL., GENE, vol. 67, 1988, pages 3140 |
| SMITHWATERMAN, ADVANCES IN APPLIED MATHEMATICS, vol. 2, 1981, pages 482 - 489 |
| SOMAT. CELL. MOL. GENET., vol. 7, 1981, pages 603 - 616 |
| STARK, W. M. ET AL., TRENDS IN GENETICS, vol. 8, 1992, pages 432 - 439 |
| WATSON ET AL.: "Molecular Biology of the Gene", 1987, BENJAMIN/CUMMINGS, pages: 224 |
Cited By (82)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9771574B2 (en) | 2008-09-05 | 2017-09-26 | President And Fellows Of Harvard College | Apparatus for continuous directed evolution of proteins and nucleic acids |
| US10336997B2 (en) | 2010-12-22 | 2019-07-02 | President And Fellows Of Harvard College | Continuous directed evolution |
| US12366009B2 (en) | 2010-12-22 | 2025-07-22 | President And Fellows Of Harvard College | Continuous directed evolution |
| US11214792B2 (en) | 2010-12-22 | 2022-01-04 | President And Fellows Of Harvard College | Continuous directed evolution |
| US12006520B2 (en) | 2011-07-22 | 2024-06-11 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
| US11466277B2 (en) | 2012-09-04 | 2022-10-11 | The Scripps Research Institute | Chimeric polypeptides having targeted binding specificity |
| US10829766B2 (en) | 2012-09-04 | 2020-11-10 | The Scripps Research Institute | Chimeric polypeptides having targeted binding specificity |
| US11920181B2 (en) | 2013-08-09 | 2024-03-05 | President And Fellows Of Harvard College | Nuclease profiling system |
| US10954548B2 (en) | 2013-08-09 | 2021-03-23 | President And Fellows Of Harvard College | Nuclease profiling system |
| US11299755B2 (en) | 2013-09-06 | 2022-04-12 | President And Fellows Of Harvard College | Switchable CAS9 nucleases and uses thereof |
| US10912833B2 (en) | 2013-09-06 | 2021-02-09 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
| US12584118B2 (en) | 2013-09-06 | 2026-03-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US12559737B2 (en) | 2013-09-06 | 2026-02-24 | President And Fellows Of Harvard College | Cas9 variants and uses thereof |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US11053481B2 (en) | 2013-12-12 | 2021-07-06 | President And Fellows Of Harvard College | Fusions of Cas9 domains and nucleic acid-editing domains |
| US12215365B2 (en) | 2013-12-12 | 2025-02-04 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US11124782B2 (en) | 2013-12-12 | 2021-09-21 | President And Fellows Of Harvard College | Cas variants for gene editing |
| US10179911B2 (en) | 2014-01-20 | 2019-01-15 | President And Fellows Of Harvard College | Negative selection and stringency modulation in continuous evolution systems |
| US12398390B2 (en) | 2014-01-20 | 2025-08-26 | President And Fellows Of Harvard College | Negative selection and stringency modulation in continuous evolution systems |
| US10507232B2 (en) | 2014-04-02 | 2019-12-17 | University Of Florida Research Foundation, Incorporated | Materials and methods for the treatment of latent viral infection |
| US10077434B2 (en) | 2014-07-30 | 2018-09-18 | Zumutor Biologics Inc. | Non-fucosylated protein and methods thereof |
| WO2016016842A1 (en) * | 2014-07-30 | 2016-02-04 | Zumutor Biologics, Inc. | Non-fucosylated protein and methods thereof |
| US11578343B2 (en) | 2014-07-30 | 2023-02-14 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US12398406B2 (en) | 2014-07-30 | 2025-08-26 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
| US11760986B2 (en) | 2014-10-22 | 2023-09-19 | President And Fellows Of Harvard College | Evolution of proteases |
| US10920208B2 (en) | 2014-10-22 | 2021-02-16 | President And Fellows Of Harvard College | Evolution of proteases |
| US11299729B2 (en) | 2015-04-17 | 2022-04-12 | President And Fellows Of Harvard College | Vector-based mutagenesis system |
| WO2017015545A1 (en) * | 2015-07-22 | 2017-01-26 | President And Fellows Of Harvard College | Evolution of site-specific recombinases |
| US10392674B2 (en) | 2015-07-22 | 2019-08-27 | President And Fellows Of Harvard College | Evolution of site-specific recombinases |
| US11104967B2 (en) | 2015-07-22 | 2021-08-31 | President And Fellows Of Harvard College | Evolution of site-specific recombinases |
| US11905623B2 (en) | 2015-07-22 | 2024-02-20 | President And Fellows Of Harvard College | Evolution of site-specific recombinases |
| US11524983B2 (en) | 2015-07-23 | 2022-12-13 | President And Fellows Of Harvard College | Evolution of Bt toxins |
| US11913040B2 (en) | 2015-07-30 | 2024-02-27 | President And Fellows Of Harvard College | Evolution of TALENs |
| US11078469B2 (en) | 2015-07-30 | 2021-08-03 | President And Fellows Of Harvard College | Evolution of TALENs |
| US10612011B2 (en) | 2015-07-30 | 2020-04-07 | President And Fellows Of Harvard College | Evolution of TALENs |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| US12344869B2 (en) | 2015-10-23 | 2025-07-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
| US11999947B2 (en) | 2016-08-03 | 2024-06-04 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US10947530B2 (en) | 2016-08-03 | 2021-03-16 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| US11702651B2 (en) | 2016-08-03 | 2023-07-18 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
| EP3497214B1 (en) * | 2016-08-09 | 2023-06-28 | President and Fellows of Harvard College | Programmable cas9-recombinase fusion proteins and uses thereof |
| US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
| US12084663B2 (en) | 2016-08-24 | 2024-09-10 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
| US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
| US11820969B2 (en) | 2016-12-23 | 2023-11-21 | President And Fellows Of Harvard College | Editing of CCR2 receptor gene to protect against HIV infection |
| US12390514B2 (en) | 2017-03-09 | 2025-08-19 | President And Fellows Of Harvard College | Cancer vaccine |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US12516308B2 (en) | 2017-03-09 | 2026-01-06 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US12435331B2 (en) | 2017-03-10 | 2025-10-07 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11447809B2 (en) | 2017-07-06 | 2022-09-20 | President And Fellows Of Harvard College | Evolution of tRNA synthetases |
| US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US12359218B2 (en) | 2017-07-28 | 2025-07-15 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
| US12060553B2 (en) | 2017-08-25 | 2024-08-13 | President And Fellows Of Harvard College | Evolution of BoNT peptidases |
| US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11932884B2 (en) | 2017-08-30 | 2024-03-19 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US11624130B2 (en) | 2017-09-18 | 2023-04-11 | President And Fellows Of Harvard College | Continuous evolution for stabilized proteins |
| US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
| US12406749B2 (en) | 2017-12-15 | 2025-09-02 | The Broad Institute, Inc. | Systems and methods for predicting repair outcomes in genetic engineering |
| US12157760B2 (en) | 2018-05-23 | 2024-12-03 | The Broad Institute, Inc. | Base editors and uses thereof |
| US11913044B2 (en) | 2018-06-14 | 2024-02-27 | President And Fellows Of Harvard College | Evolution of cytidine deaminases |
| US12522807B2 (en) | 2018-07-09 | 2026-01-13 | The Broad Institute, Inc. | RNA programmable epigenetic RNA modifiers and uses thereof |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| CN109771403A (zh) * | 2019-01-24 | 2019-05-21 | 广州医科大学附属第一医院 | 一种大鼠造影剂肾病模型的构建方法 |
| US12509680B2 (en) | 2019-03-19 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11643652B2 (en) | 2019-03-19 | 2023-05-09 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11795452B2 (en) | 2019-03-19 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12570972B2 (en) | 2019-03-19 | 2026-03-10 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12281303B2 (en) | 2019-03-19 | 2025-04-22 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US20210130828A1 (en) * | 2019-11-01 | 2021-05-06 | Sangamo Therapeutics, Inc. | Gin recombinase variants |
| WO2021087358A1 (en) * | 2019-11-01 | 2021-05-06 | Sangamo Therapeutics, Inc. | Gin recombinase variants |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12031126B2 (en) | 2020-05-08 | 2024-07-09 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US20230234993A1 (en) * | 2020-12-17 | 2023-07-27 | National Marine Biodiversity Institute Of Korea | Composition for preventing or treating neurological diseases related to copper metabolism, comprising multi-copper oxidase peptide |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11466277B2 (en) | Chimeric polypeptides having targeted binding specificity | |
| IL263375A (en) | Methods and preparations for integrating exogenous sequence into the genome of plants | |
| CN101484462A (zh) | 通过定向进化产生催化优化的嵌合锌指重组酶 | |
| HK40089287A (en) | Chimeric polypeptides having targeted binding specificity | |
| HK40043614A (en) | Chimeric polypeptides having targeted binding specificity | |
| HK40043614B (en) | Chimeric polypeptides having targeted binding specificity | |
| Casini | Better safe than sorry: new CRISPR/Cas9 tools for improved genome engineering | |
| Sun | Engineering of transcription activator-like effector nucleases (talens) for targeted genome editing | |
| Sarkar | Directed evolution of an HIV-1 LTR specific recombinase for anti-retroviral therapy-a proof of concept study |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13834893 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 237442 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2883511 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2015530154 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14425944 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2013312801 Country of ref document: AU Date of ref document: 20130904 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20157008001 Country of ref document: KR Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13834893 Country of ref document: EP Kind code of ref document: A2 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015004696 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112015004696 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150303 |