WO2013184577A1 - Alpha-amylase variants derived from the alpha amylase of cytophaga sp.amylase|(cspamy2). - Google Patents

Alpha-amylase variants derived from the alpha amylase of cytophaga sp.amylase|(cspamy2). Download PDF

Info

Publication number
WO2013184577A1
WO2013184577A1 PCT/US2013/043897 US2013043897W WO2013184577A1 WO 2013184577 A1 WO2013184577 A1 WO 2013184577A1 US 2013043897 W US2013043897 W US 2013043897W WO 2013184577 A1 WO2013184577 A1 WO 2013184577A1
Authority
WO
WIPO (PCT)
Prior art keywords
amylase
composition
variant
starch
acid
Prior art date
Application number
PCT/US2013/043897
Other languages
French (fr)
Inventor
Luis G. Cascao-Pereira
David A. Estell
Marc Kolkman
Original Assignee
Danisco Us Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=48626134&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2013184577(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to EP21193640.6A priority Critical patent/EP3967757B1/en
Priority to CN201380030152.XA priority patent/CN104379738A/en
Priority to EP13729864.2A priority patent/EP2859097B9/en
Priority to US14/406,494 priority patent/US20150152401A1/en
Priority to CA2874198A priority patent/CA2874198A1/en
Application filed by Danisco Us Inc. filed Critical Danisco Us Inc.
Priority to DK13729864.2T priority patent/DK2859097T3/en
Priority to ES13729864T priority patent/ES2905323T3/en
Priority to BR112014030449A priority patent/BR112014030449A2/en
Priority to EP24154279.4A priority patent/EP4389885A3/en
Publication of WO2013184577A1 publication Critical patent/WO2013184577A1/en
Priority to US15/288,901 priority patent/US20170037387A1/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2405—Glucanases
    • C12N9/2408—Glucanases acting on alpha -1,4-glucosidic bonds
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2405—Glucanases
    • C12N9/2408—Glucanases acting on alpha -1,4-glucosidic bonds
    • C12N9/2411—Amylases
    • C12N9/2414—Alpha-amylase (3.2.1.1.)
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L2/00—Non-alcoholic beverages; Dry compositions or concentrates therefor; Their preparation
    • A23L2/38—Other non-alcoholic beverages
    • A23L2/382—Other non-alcoholic beverages fermented
    • C—CHEMISTRY; METALLURGY
    • C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00—Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16—Organic compounds
    • C11D3/38—Products with no well-defined composition, e.g. natural products
    • C11D3/386—Preparations containing enzymes, e.g. protease or amylase
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2405—Glucanases
    • C12N9/2408—Glucanases acting on alpha -1,4-glucosidic bonds
    • C12N9/2411—Amylases
    • C12N9/2414—Alpha-amylase (3.2.1.1.)
    • C12N9/2417—Alpha-amylase (3.2.1.1.) from microbiological source
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2405—Glucanases
    • C12N9/2408—Glucanases acting on alpha -1,4-glucosidic bonds
    • C12N9/2411—Amylases
    • C12N9/2414—Alpha-amylase (3.2.1.1.)
    • C12N9/2417—Alpha-amylase (3.2.1.1.) from microbiological source
    • C12N9/242—Fungal source
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00—Preparation of compounds containing saccharide radicals
    • C12P19/02—Monosaccharides
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00—Preparation of compounds containing saccharide radicals
    • C12P19/14—Preparation of compounds containing saccharide radicals produced by the action of a carbohydrase (EC 3.2.x), e.g. by alpha-amylase, e.g. by cellulase, hemicellulase
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/01001—Alpha-amylase (3.2.1.1)
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
    • C—CHEMISTRY; METALLURGY
    • C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D2111/00—Cleaning compositions characterised by the objects to be cleaned; Cleaning compositions characterised by non-standard cleaning or washing processes
    • C11D2111/10—Objects to be cleaned
    • C11D2111/12—Soft surfaces, e.g. textile
    • C—CHEMISTRY; METALLURGY
    • C11—ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11D—DETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D2111/00—Cleaning compositions characterised by the objects to be cleaned; Cleaning compositions characterised by non-standard cleaning or washing processes
    • C11D2111/10—Objects to be cleaned
    • C11D2111/14—Hard surfaces

Definitions

  • compositions and methods relating to variant a-amylases are useful, for example, for starch liquefaction and saccharification, cleaning starchy stains, textile desizing, baking, and brewing.
  • Starch consists of a mixture of amylose (15-30% w/w) and amylopectin (70-85% w/w).
  • Amylose consists of linear chains of a-l,4-linked glucose units having a molecular weight
  • Amylopectin is a branched polymer containing a- 1,6 branch points every 24-30 glucose units; its MW may be as high as 100 million.
  • the resulting syrup also may be fermented with microorganisms, such as yeast, to produce commercial products including ethanol, citric acid, lactic acid, succinic acid, itaconic acid, monosodium glutamate, gluconates, lysine, other organic acids, other amino acids, and other biochemicals, for example. Fermentation and saccharification can be conducted simultaneously (i.e., an SSF process) to achieve greater economy and efficiency.
  • a-amylases hydrolyze starch, glycogen, and related polysaccharides by cleaving internal a-l,4-glucosidic bonds at random, ⁇ -amylases, particularly from Bacilli, have been used for a variety of different purposes, including starch liquefaction and saccharification, textile desizing, starch modification in the paper and pulp industry, brewing, baking, production of syrups for the food industry, production of feedstocks for fermentation processes, and in animal feed to increase digestability. These enzymes can also be used to remove starchy soils and stains during dishwashing and laundry washing.
  • compositions and methods relate to variant amylase polypeptides, and methods of use, thereof. Aspects and embodiments of the present compositions and methods are summarized in the following separately- numbered paragraphs:
  • the productive position is an amino acid position that can be substituted with a plurality of different amino acid residues, each of which substitutions result in a variant ⁇ -amylase that meets the requirements of (i), and (iii) the combinable mutation is listed in Lists A, B, C, D, E, or F, or in Table D, which uses SEQ ID NO: 1 for numbering.
  • each of the at least one combinable mutations produce a variant amylase wherein the minimum performance indices (PI) relative to the parental amylase for (i) protein expression, (ii) activity, and (iii) detergent stability or thermostability are greater than or equal to 0.9, and the PI for any one of (i), (ii), or
  • each of the at least one combinable mutations produce a variant amylase wherein the minimum performance indices (PI) relative to the parental amylase for (i) protein expression, (ii) activity, and (iii) detergent stability or thermostability are greater than or equal to 0.8, and the PI for any one of (i), (ii), or (iii) that is greater than or equal to 1.2.
  • PI minimum performance indices
  • each of the at least one combinable mutations produce a variant amylase wherein the minimum performance indices (PI) relative to the parental amylase for (i) protein expression, (ii) activity, and (iii) detergent stability or thermostability are greater than or equal to 0.5, and the PI for any one of (i), (ii), or (iii) that is greater than or equal to 1.5. 5.
  • each of the at least one combinable mutations have a suitability score of +++, ++++, or +++++, referring to Table C.
  • each of the at least one combinable mutation have a suitability score of ++++, or +++++, referring to
  • each of the at least one combinable mutation has a suitability score of +++++, referring to Table C.
  • each of the at least one combinable mutation has a productivity score of 1 or 2, referring to Table B.
  • the variant amylase of any of the preceding paragraphs further comprises a deletion corresponding to a residue selected from the group consisting of Arg-178, Gly-179, Thr-180, and Gly-181, using SEQ ID NO: 1 for numbering.
  • the variant amylase of any of the preceding paragraphs further comprises deletions corresponding to residues Arg-178 and Gly-179, using SEQ ID NO: 1 for numbering.
  • the parental ⁇ -amylase or the variant ⁇ -amylase has at least 60% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
  • the parental ⁇ -amylase or the variant ⁇ -amylase has at least 70% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2. 14. In some embodiments of the variant amylase of any of the preceding paragraphs, the parental ⁇ -amylase or the variant ⁇ -amylase has at least 80% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
  • the parental ⁇ -amylase or the variant ⁇ -amylase has at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2. 16.
  • a composition comprising the variant amylase of any of paragraphs 1-15 is provided.
  • composition of paragraph 16 is effective for removing starchy stains from laundry, dishes, or textiles. 18. In some embodiments of the composition of paragraphs 16 or 17, further comprising a surfactant.
  • the composition is a detergent composition.
  • the composition is a laundry detergent or a laundry detergent additive.
  • the composition is a manual or automatic dishwashing detergent.
  • composition of paragraphs 16-21 further comprises one or more additional enzymes selected from the group consiting of protease, hemicellulase, cellulase, peroxidase, lipolytic enzyme, metallolipolytic enzyme, xylanase, lipase,
  • the composition of paragraph 16 is for liquifying starch.
  • composition of paragraph 16 is for saccharifying a composition comprising starch, for SSF post liquefaction, or for direct SSF without prior liquefaction.
  • composition of paragraph 16 is for producing a fermented beverage.
  • composition of paragraph 16 is for producing a baked food product.
  • composition of paragraph 16 is for textile desizing.
  • a method for removing a starchy stain or soil from a surface comprising: contacting the surface in the presence of a aqueous composition comprising an effective amount of the variant amylase of any of the paragraphs 1-15 and, allowing the polypeptide to hydrolyze starch components present in the starchy stain to produce smaller starch-derived molecules that dissolve in the aqueous composition, and rinsing the surface, thereby removing the starchy stain from the surface.
  • the aqueous composition further comprises a surfactant.
  • the surface is a textile surface.
  • the surface is on dishes.
  • the surface is a soiled hard surface.
  • the composition further comprises at least one additional enzymes selected from the group consiting of protease, hemicellulase, cellulase, peroxidase, lipolytic enzyme, metallolipolytic enzyme, xylanase, lipase, phospholipase, esterase, perhydrolase, cutinase, pectinase, pectate lyase, mannanase, keratinase, reductase, oxidase, phenoloxidase, lipoxygenase, ligninase, pullulanase, tannase, pentosanase, malanase, ⁇ -glucanase, arabinosidase, hyaluronidase, chondroitinase, laccase, and an amylase other than the amylase of any one of paragraphs 1-15
  • a method of saccharifying a composition comprising starch to produce a composition comprising glucose comprises: (i) contacting the solution comprising starch with effective amount of the variant amylase of any of the paragraphs 1-15; and (ii) saccharifying the solution comprising starch to produce the composition comprising glucose; wherein the variant amylase catalyzes the saccharification of the starch solution to glucose.
  • the composition comprising starch comprises liquefied starch, gelatinized starch, or granular starch.
  • saccharification is conducted at a temperature range of about 30°C to about 75°C.
  • the temperature range is 47°C-74°C. 38.
  • saccharification is conducted over a pH range of pH 2.0-7.5. 39.
  • the pH range is pH 3.5-5.5.
  • the pH range is pH 3.5-4.5.
  • the method of any of paragraphs 34-40 further comprises fermenting the glucose composition to produce an end of fermentation (EOF) product.
  • EEF end of fermentation
  • the fermentation is a simultaneous saccharification and fermentation (SSF) reaction.
  • the fermentation is conducted for 48-70 hours at pH 2-8 and in a temperature range of 25°C-70°C.
  • the EOF product comprises ethanol.
  • the EOF product comprises 8-18% (v/v) ethanol.
  • the method further comprises contacting a mash and/or a wort with an amylase. 47. In some embodiments of the method of paragraph 46, the method further comprises:
  • step (a) preparing a mash; (b) filtering the mash to obtain a wort; and (c) fermenting the wort to obtain a fermented beverage, wherein the variant amylase of any one of paragraphs 1-16 and 74- 80 is added to: (i) the mash of step (a) and/or (ii) the wort of step (b) and/or (iii) the wort of step (c).
  • the EOF product comprises a metabolite.
  • the metabolite is citric acid, lactic acid, succinic acid, monosodium glutamate, gluconic acid, sodium gluconate, calcium gluconate, potassium gluconate, glucono delta-lactone, sodium erythorbate, omega 3 fatty acid, butanol, an amino acid, lysine, itaconic acid, 1,3-propanediol, or isoprene.
  • the method of any of paragraphs 34-49 further comprises adding glucoamylase, hexokinase, xylanase, glucose isomerase, xylose isomerase, phosphatase, phytase, pullulanase, ⁇ -amylase, a-amylase that is not the variant a-amylase, protease, cellulase, hemicellulase, lipase, cutinase, isoamylase, redox enzyme, esterase, transferase, pectinase, alpha-glucosidase, beta-glucosidase, or a combination thereof, to the starch solution. 51.
  • the glucoamylase is added to 0.1-2 glucoamylase units (GAU)/g ds.
  • the amylase is expressed and secreted by a host cell.
  • the composition comprising starch is contacted with the host cell.
  • the host cell further expresses and secretes a glucoamylase or other enzyme.
  • the host cell is capable of fermenting the composition.
  • composition comprising glucose produced by the method of any one of paragraphs 34-55 is provided.
  • a liquefied starch produced by the method of any one of paragraphs 34-55 is provided.
  • a fermented beverage produced by the method of any one of paragraphs 34-55 is provided.
  • the fermented beverage or end of fermentation product is selected from the group consisting of (i) a beer selected from the group consisting of full malted beer, beer brewed under the "Rösgebot", ale, IPA, lager, bitter, Happoshu (second beer), third beer, dry beer, near beer, light beer, low alcohol beer, low calorie beer, porter, bock beer, stout, malt liquor, non-alcoholic beer, and non-alcoholic malt liquor; and (ii) cereal or malt beverages selected from the group consisting of fruit flavoured malt beverages, liquor flavoured malt beverages, and coffee flavoured malt beverages.
  • a method of producing a food composition comprising combining: (i) one or more food ingredients, and (ii) a variant a- amylase of any of paragraphs 1-15, wherein the variant a- amylase thereof catalyzes the hydrolysis of starch components present in the food ingredients to produce glucose.
  • the food composition is selected from the group consisting of a food product, a baking composition, a food additive, an animal food product, a feed product, a feed additive, an oil, a meat, and a lard.
  • the one or more food ingredients comprise a baking ingredient or an additive.
  • the one or more food ingredients is/are selected from the group consisting of flour; an anti-staling amylase; a phospholipase; a phospholipid; a maltogenic alpha-amylase or a variant, homologue, or mutants thereof which has maltogenic alpha-amylase activity; a bakery xylanase; and a lipase.
  • the one or more food ingredients is/are selected from the group consisting of: (i) a maltogenic alpha-amylase from Bacillus stearothermophilus, (ii) a bakery xylanase is from Bacillus, Aspergillus, Thermomyces or Trichoderma, (iii) a glycolipase from Fusarium heterosporum.
  • the food composition comprises a dough or a dough product, preferably a processed dough product.
  • the method of any one of paragraphs 65-70 further comprises baking the food composition to produce a baked good.
  • the method of any one of paragraphs 65-70 further comprises: (i) providing a starch medium; (ii) adding to the starch medium an amylase; and (iii) applying heat to the starch medium during or after step (b) to produce a bakery product.
  • a method of desizing a textile comprising contacting a desizing composition with a sized textile for a time sufficient to desize the textile, wherein the desizing composition comprises a variant a-amylase of any one of paragraphs 1-15.
  • the desizing composition comprises a variant a-amylase of any one of paragraphs 1-15.
  • an isolated polynucleotide encoding a polypeptide of any of paragraphs 1-15 is provided.
  • an expression vector comprising the polynucleotide of paragraph 74 is provided.
  • a host cell comprising the expression vector of paragraph 75 is provided.
  • SEQ ID NO: 1 sets forth the amino acid sequence of the mature form of Cytophaga sp. amylase (CspAmy2).
  • SEQ ID NO: 2 sets forth the amino acid sequence of the mature form of a variant Cytophaga sp. amylase (CspAmy2-vl) having deletions of both Arginine 178 and Glycine 179.
  • SEQ ID NO: 3 sets forth the amino acid sequence of the immature/precursor form of the variant form of Cytophaga sp. amylase (CspAmy2-vl) having a signal peptide.
  • SEQ ID NO: 4 sets forth the nucleotide sequence of a synthetic DNA fragment
  • CspAmy2-vl DNA encoding CspAmy2-vl amylase (SEQ ID NO: 2).
  • compositions and methods relating to variant amylase enzymes were discovered by a combination of experimental approaches, as detailed in the appended Examples.
  • the approaches include the use of site evaluation libraries (SELs) and structure-based analysis.
  • Exemplary applications for the variant amylase enzymes are for starch liquefaction and saccharification, for cleaning starchy stains in laundry, dishwashing, and other applications, for textile processing (e.g., desizing), in animal feed for improving digestibility, and and for baking and brewing.
  • IPTG isopropyl ⁇ -D-thiogalactoside
  • PAHBAH p-hydroxybenzoic acid hydrazide
  • ppm parts per million e.g., ⁇ g protein per gram dry solid
  • TrGA Trichoderma reesei glucoamylase
  • amylase or "amylolytic enzyme” refer to an enzyme that is, among other things, capable of catalyzing the degradation of starch
  • a- Amylases are hydrolases that cleave the a-D-(l ⁇ 4) O-glycosidic linkages in starch.
  • a-amylases (EC 3.2.1.1; a-D-(l ⁇ 4)- glucan glucanohydrolase) are defined as endo-acting enzymes cleaving a-D-(l ⁇ 4) O-glycosidic linkages within the starch molecule in a random fashion yielding polysaccharides containing three or more (l-4)-a-linked D-glucose units.
  • the exo-acting amylolytic enzymes such as ⁇ -amylases (EC 3.2.1.2; a-D-(l ⁇ 4)-glucan maltohydrolase) and some product- specific amylases like maltogenic a-amylase (EC 3.2.1.133) cleave the polysaccharide molecule from the non-reducing end of the substrate, ⁇ -amylases, a-glucosidases (EC 3.2.1.20; a-D-glucoside glucohydrolase), glucoamylase (EC 3.2.1.3; a-D-(l ⁇ 4)-glucan glucohydrolase), and product- specific amylases like the maltotetraosidases (EC 3.2.1.60) and the maltohexaosidases (EC 3.2.1.98) can produce malto-oligosaccharides of a specific length or enriched syrups of specific maltooligosaccharides.
  • Enzyme units herein refer to the amount of product formed per time under the specified conditions of the assay.
  • a "glucoamylase activity unit” GAU
  • a "soluble starch unit” SSU
  • SSU soluble starch unit
  • starch refers to any material comprised of the complex polysaccharide carbohydrates of plants, comprised of amylose and amylopectin with the formula (C 6 H 10 O5) x , wherein X can be any number.
  • the term includes plant-based materials such as grains, cereal, grasses, tubers and roots, and more specifically materials obtained from wheat, barley, corn, rye, rice, sorghum, brans, cassava, millet, milo, potato, sweet potato, and tapioca.
  • starch includes granular starch.
  • granular starch refers to raw, i.e., uncooked starch, e.g., starch that has not been subject to gelatinization.
  • wild-type refers to a naturally-occurring polypeptide that does not include a man-made substitution, insertion, or deletion at one or more amino acid positions.
  • wild-type refers to a naturally-occurring polynucleotide that does not include a man-made nucleoside change.
  • a polynucleotide encoding a wild-type, parental, or reference polypeptide is not limited to a naturally-occurring
  • polynucleotide encompasses any polynucleotide encoding the wild- type, parental, or reference polypeptide.
  • a "mature" polypeptide or variant, thereof, is one in which a signal sequence is absent, for example, cleaved from an immature form of the polypeptide during or following expression of the polypeptide.
  • variant refers to a polypeptide that differs from a specified wild-type, parental, or reference polypeptide in that it includes one or more naturally-occurring or man-made substitutions, insertions, or deletions of an amino acid.
  • variant refers to a polynucleotide that differs in nucleotide sequence from a specified wild- type, parental, or reference polynucleotide.
  • identity of the wild-type, parental, or reference polypeptide or polynucleotide will be apparent from context.
  • recombinant when used in reference to a subject cell, nucleic acid, protein or vector, indicates that the subject has been modified from its native state.
  • recombinant cells express genes that are not found within the native (non-recombinant) form of the cell, or express native genes at different levels or under different conditions than found in nature.
  • Recombinant nucleic acids differ from a native sequence by one or more nucleotides and/or are operably linked to heterologous sequences, e.g., a heterologous promoter in an expression vector.
  • Recombinant proteins may differ from a native sequence by one or more amino acids and/or are fused with heterologous sequences.
  • a vector comprising a nucleic acid encoding an amylase is a recombinant vector.
  • Combinatorial variants are variants comprising two or more mutations, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, etc., substitutions, deletions, and/or insertions.
  • Combinable mutations are mutations at any amino acid position that can be used to make combinatorial variants. Combinable mutations improve at least one desired property of the molecule (in this case, an amylase), while not significantly decreasing either expression, activity, or stability. Combinable mutations can be grouped as follows:
  • Group A A mutation that produces a variant wherein the minimum performance indices (PI) relative to a defined parental protein for: (i) protein expression, (ii) CS-28 microswatch activity at pH 8 (25°C) or pHIO (50°C), or activity in Ceralpha assay, or activity in corn flour or corn starch application assays, and (iii) detergent stability or thermostability at pH 5.0 or pH 5.7 is greater than or equal to 0.9, and in addition have a PI for any one of these tests that is greater than or equal to 1.0.
  • PI minimum performance indices
  • Group B A mutation that produces a variant wherein the minimum performance indices (PI) relative to a defined parental protein for: (i) protein expression, (ii) CS-28 microswatch activity at pH 8 (25°C) or pHIO (50°C), or activity in Ceralpha assay, or activity in corn flour or corn starch application assays, and (iii) detergent stability or thermostability at pH 5.0 or pH 5.7 is greater than or equal to 0.8, and in addition have a PI for any one of these tests that is greater than or equal to 1.2.
  • PI minimum performance indices
  • Group C A mutation that produces a variant wherein the minimum performance indices (PI) relative to a defined parental protein for: (i) protein expression, (ii) CS-28 microswatch activity at pH 8 (25°C) or pHIO (50°C), or activity in Ceralpha assay, or activity in corn flour or corn starch application assays, and (iii) detergent stability or thermostability at pH 5.0 or pH 5.7 is greater than or equal to 0.5, and in addition have a PI for any one of these tests that is greater than or equal to 1.5.
  • PI minimum performance indices
  • Preferred combinable mutations are at "productive positions,” as described, below.
  • activity refers to amylase activity, which can be measured as described, herein.
  • Productive positions are amino acid positions that are tolerant to substitution with different amino acid residues, wherein the resulting variants meet a set of performance criteria for combinability, as set forth above.
  • Productive positions can be assigned a Productivity Score as follows: Positions where less than 15% of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "1.” Positions where less than 30%, but greater than, or equal to 15% of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "2.” Positions where less than 50%, but greater than, or equal to 30% of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "3.” Positions where 50% or more of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "4.” Productivity scores are described in the following Table:
  • Preferred productive positions are combinable mutations.
  • Suitability score refers to the ability of one or more combinable mutations to be used to make combinatorial variants, based on the performance criteria for combinability (i.e. , A, B, and C, as set forth, above) in which each of the mutations fall. A higher suitability score indicates a mutation or mutations that are more suitable for use in making combinatorial variants. Suitability scores are described in the following Table:
  • polypeptides cell, nucleic acid, amino acid, or other specified material or component that is removed from at least one other material or component with which it is naturally associated as found in nature.
  • the term “purified” refers to material (e.g. , an isolated polypeptide or polynucleotide) that is in a relatively pure state, e.g., at least about 90% pure, at least about 95% pure, at least about 98% pure, or even at least about 99% pure.
  • enriched refers to material (e.g., an isolated polypeptide or polynucleotide) that is in about 50% pure, at least about 60% pure, at least about 70% pure, or even at least about 70% pure.
  • thermostable and “thermostability,” with reference to an enzyme, refer to the ability of the enzyme to retain activity after exposure to an elevated temperature.
  • the thermostability of an enzyme is measured by its half-life (t ⁇ ) given in minutes, hours, or days, during which half the enzyme activity is lost under defined conditions. The half-life may be calculated by measuring residual a- amylase activity following exposure to (i.e. , challenge by) an elevated temperature.
  • a "pH range,” with reference to an enzyme refers to the range of pH values under which the enzyme exhibits catalytic activity.
  • pH stable and “pH stability,” with reference to an enzyme, relate to the ability of the enzyme to retain activity over a wide range of pH values for a predetermined period of time (e.g., 15 min., 30 min., 1 hour).
  • amino acid sequence is synonymous with the terms “polypeptide,” “protein,” and “peptide,” and are used interchangeably. Where such amino acid sequences exhibit activity, they may be referred to as an "enzyme.”
  • amino acid sequences exhibit activity, they may be referred to as an "enzyme.”
  • the conventional one-letter or three-letter codes for amino acid residues are used, with amino acid sequences being presented in the standard amino- to-carboxy terminal orientation (i.e., N ⁇ C).
  • nucleic acid encompasses DNA, RNA, heteroduplexes, and synthetic molecules capable of encoding a polypeptide. Nucleic acids may be single stranded or double stranded, and may be chemical modifications. The terms “nucleic acid” and “polynucleotide” are used interchangeably. Because the genetic code is degenerate, more than one codon may be used to encode a particular amino acid, and the present compositions and methods encompass nucleotide sequences that encode a particular amino acid sequence. Unless otherwise indicated, nucleic acid sequences are presented in 5'-to-3' orientation.
  • Hybridization refers to the process by which one strand of nucleic acid forms a duplex with, i.e., base pairs with, a complementary strand, as occurs during blot hybridization techniques and PCR techniques.
  • Hybridized, duplex nucleic acids are characterized by a melting temperature (T m ), where one-half of the hybridized nucleic acids are unpaired with the complementary strand. Mismatched nucleotides within the duplex lower the T m .
  • a nucleic acid encoding a variant a-amylase may have a T m reduced by 1°C - 3°C or more compared to a duplex formed between the nucleotide of SEQ ID NO: 2 and its identical complement.
  • a "synthetic" molecule is produced by in vitro chemical or enzymatic synthesis rather than by an organism.
  • transformed means that the cell contains a non-native (e.g., heterologous) nucleic acid sequence integrated into its genome or carried as an episome that is maintained through multiple generations.
  • introduction in the context of inserting a nucleic acid sequence into a cell, means “transfection”, “transformation” or “transduction,” as known in the art.
  • a "host strain” or “host cell” is an organism into which an expression vector, phage, virus, or other DNA construct, including a polynucleotide encoding a polypeptide of interest (e.g. , an amylase) has been introduced.
  • exemplary host strains are microorganism cells (e.g. , bacteria, filamentous fungi, and yeast) capable of expressing the polypeptide of interest and/or fermenting saccharides.
  • the term "host cell” includes protoplasts created from cells.
  • heterologous with reference to a polynucleotide or protein refers to a polynucleotide or protein that does not naturally occur in a host cell.
  • endogenous with reference to a polynucleotide or protein refers to a polynucleotide or protein that occurs naturally in the host cell.
  • expression refers to the process by which a polypeptide is produced based on a nucleic acid sequence.
  • the process includes both transcription and translation.
  • a "selective marker” or “selectable marker” refers to a gene capable of being expressed in a host to facilitate selection of host cells carrying the gene.
  • selectable markers include but are not limited to antimicrobials (e.g. , hygromycin, bleomycin, or chloramphenicol) and/or genes that confer a metabolic advantage, such as a nutritional advantage on the host cell.
  • a "vector” refers to a polynucleotide sequence designed to introduce nucleic acids into one or more cell types.
  • Vectors include cloning vectors, expression vectors, shuttle vectors, plasmids, phage particles, cassettes and the like.
  • An "expression vector” refers to a DNA construct comprising a DNA sequence encoding a polypeptide of interest, which coding sequence is operably linked to a suitable control sequence capable of effecting expression of the DNA in a suitable host.
  • control sequences may include a promoter to effect transcription, an optional operator sequence to control transcription, a sequence encoding suitable ribosome binding sites on the mRNA, enhancers and sequences which control termination of transcription and translation.
  • operably linked means that specified components are in a relationship (including but not limited to juxtaposition) permitting them to function in an intended manner.
  • a regulatory sequence is operably linked to a coding sequence such that expression of the coding sequence is under control of the regulatory sequences.
  • a "signal sequence” is a sequence of amino acids attached to the N-terminal portion of a protein, which facilitates the secretion of the protein outside the cell. The mature form of an extracellular protein lacks the signal sequence, which is cleaved off during the secretion process.
  • Bioly active refer to a sequence having a specified biological activity, such an enzymatic activity.
  • specific activity refers to the number of moles of substrate that can be converted to product by an enzyme or enzyme preparation per unit time under specific conditions. Specific activity is generally expressed as units (U)/mg of protein.
  • water hardness is a measure of the minerals (e.g. , calcium and magnesium) present in water.
  • a "swatch" is a piece of material such as a fabric that has a stain applied thereto.
  • the material can be, for example, fabrics made of cotton, polyester or mixtures of natural and synthetic fibers.
  • the swatch can further be paper, such as filter paper or nitrocellulose, or a piece of a hard material such as ceramic, metal, or glass.
  • the stain is starch based, but can include blood, milk, ink, grass, tea, wine, spinach, gravy, chocolate, egg, cheese, clay, pigment, oil, or mixtures of these compounds.
  • a "smaller swatch" is a section of the swatch that has been cut with a single hole punch device, or has been cut with a custom manufactured 96-hole punch device, where the pattern of the multi-hole punch is matched to standard 96-well microtiter plates, or the section has been otherwise removed from the swatch.
  • the swatch can be of textile, paper, metal, or other suitable material.
  • the smaller swatch can have the stain affixed either before or after it is placed into the well of a 24-, 48- or 96-well microtiter plate.
  • the smaller swatch can also be made by applying a stain to a small piece of material.
  • the smaller swatch can be a stained piece of fabric 5/8" or 0.25" in diameter.
  • the custom manufactured punch is designed in such a manner that it delivers 96 swatches simultaneously to all wells of a 96-well plate.
  • the device allows delivery of more than one swatch per well by simply loading the same 96-well plate multiple times.
  • Multi-hole punch devices can be conceived of to deliver simultaneously swatches to any format plate, including but not limited to 24- well, 48- well, and 96-well plates.
  • the soiled test platform can be a bead made of metal, plastic, glass, ceramic, or another suitable material that is coated with the soil substrate.
  • a cultured cell material comprising an amylase refers to a cell lysate or supernatant (including media) that includes an amylase as a component.
  • the cell material may be from a heterologous host that is grown in culture for the purpose of producing the amylase.
  • Percent sequence identity means that a particular sequence has at least a certain percentage of amino acid residues identical to those in a specified reference sequence, when aligned using the CLUSTAL W algorithm with default parameters. See Thompson et al. (1994) Nucleic Acids Res. 22:4673-4680. Default parameters for the CLUSTAL W algorithm are:
  • Gap extension penalty 0.05
  • Deletions are counted as non-identical residues, compared to a reference sequence. Deletions occurring at either termini are included. For example, a variant with five amino acid deletions of the C-terminus of the mature CspAmy2 polypeptide of SEQ ID NO: 1 would have a percent sequence identity of 99% (612 / 617 identical residues x 100, rounded to the nearest whole number) relative to the mature polypeptide. Such a variant would be encompassed by a variant having "at least 99% sequence identity" to a mature amylase polypeptide.
  • fused polypeptide sequences are connected, i.e. , operably linked, via a peptide bond between two subject polypeptide sequences.
  • filamentous fungi refers to all filamentous forms of the subdivision
  • Eumycotina particulary Pezizomycotina species.
  • the term "degree of polymerization” refers to the number (n) of anhydro- glucopyranose units in a given saccharide.
  • DPI the monosaccharides glucose and fructose.
  • DP2 the disaccharides maltose and sucrose.
  • DE or "dextrose equivalent,” is defined as the percentage of reducing sugar, i.e., D-glucose, as a fraction of total carbohydrate in a syrup.
  • dry solids content (ds) refers to the total solids of a slurry in a dry weight percent basis.
  • slurry refers to an aqueous mixture containing insoluble solids.
  • SSF saccharification and fermentation
  • An "ethanologenic microorganism” refers to a microorganism with the ability to convert a sugar or oligosaccharide to ethanol.
  • the term "fermented beverage” refers to any beverage produced by a method comprising a fermentation process, such as a microbial fermentation, e.g., a bacterial and/or fungal fermentation.
  • a fermentation process such as a microbial fermentation, e.g., a bacterial and/or fungal fermentation.
  • "Beer” is an example of such a fermented beverage, and the term “beer” is meant to comprise any fermented wort produced by fermentation/brewing of a starch-containing plant material. Often, beer is produced exclusively from malt or adjunct, or any combination of malt and adjunct. Examples of beers include: full malted beer, beer brewed under the
  • fruit flavored malt beverages e.g., citrus flavored, such as lemon-, orange-, lime-, or berry-flavored malt beverages
  • liquor flavored malt beverages e.g., vodka-, rum-, or tequila
  • malt refers to any malted cereal grain, such as malted barley or wheat.
  • adjct refers to any starch and/or sugar containing plant material that is not malt, such as barley or wheat malt. Examples of adjuncts include common corn grits, refined corn grits, brewer's milled yeast, rice, sorghum, refined corn starch, barley, barley starch, dehusked barley, wheat, wheat starch, torrified cereal, cereal flakes, rye, oats, potato, tapioca, cassava and syrups, such as corn syrup, sugar cane syrup, inverted sugar syrup, barley and/or wheat syrups, and the like.
  • wort refers to an aqueous slurry of any starch and/or sugar containing plant material, such as grist, e.g., comprising crushed barley malt, crushed barley, and/or other adjunct or a combination thereof, mixed with water later to be separated into wort and spent grains.
  • grist e.g., comprising crushed barley malt, crushed barley, and/or other adjunct or a combination thereof, mixed with water later to be separated into wort and spent grains.
  • wort refers to the unfermented liquor run-off following extracting the grist during mashing.
  • Iodine-positive starch or "IPS” refers to (1) amylose that is not hydrolyzed after liquefaction and saccharification, or (2) a retrograded starch polymer.
  • IPS a retrograded starch polymer.
  • the high DPn amylose or the retrograded starch polymer binds iodine and produces a characteristic blue color.
  • the saccharide liquor is thus termed “iodine-positive saccharide,” “blue saccharide,” or “blue sac.”
  • compositions and methods are variant amylase enzymes discovered using a combination of experimental approaches, including the use of site evaluation libraries (SELs) and structure-based analysis.
  • SELs site evaluation libraries
  • structure-based analysis 2.1 a-Amylase variants based on an SEL library of Cytophaga sp. a-amylase
  • CspAmy2 amylase An a-amylase from Cytophaga sp. (herein, CspAmy2 amylase”) has been previously described (Jeang,C-L et al. (2002) Applied and Environmental Microbiology, 68:3651-54). The amino acid sequence of the mature CspAmy2 amylase polypeptide is shown, below (SEQ ID NO: 1):
  • Cytophaga sp. ⁇ -amylase having a deletion of both Arginine 178 and Glycine 179 has also been described (Shiau, R-J. et al. (2003) Applied and Environmental Microbiology, 69:2383-85).
  • the amino acid sequence of the mature CspAmy2-vl amylase polypeptide is shown, below, as SEQ ID NO: 2:
  • a-amylase variants that include combinable mutations were identified by making a site evaluation library (SEL) based on CspAmy2-vl and testing the resulting variants for corn flour and corn starch hydrolysis, thermostability assay, cleaning performance, detergent stability, activity in a standardized amylases assay, and expression levels, the detailed procedures for which are described in the Examples or otherwise known.
  • SEL site evaluation library
  • PI performance index
  • PI values were then used to identify combinable mutations and productive positions.
  • Combinable mutations are mutations at any amino acid position that improve at least one desired property of the molecule, while not significantly decreasing expression, activity, or stability. Combinable mutations are assigned to one of three Groups (i.e., A, B, or C), as set forth, herein. Preferred combinable mutations are at productive positions. Productive positions are amino acid positions that are tolerant to substitution with different amino acid residues, wherein the resulting variants meet a set of performance criteria for combinability, as set forth herein.
  • combinable mutations may be only incrementally beneficial in improving any one performance or stability feature of an variant amylase. However, they are carefully selected to be minimally detrimental to other desired performance or stability features, making them well suited for use in combination with other combinable mutations to contract variant amylases having desired improved enzymatic and biochemical properties without being crippled in others, resulting in robust variants having a good balance of performance, stability, and expression potential.
  • the suitability scores of the different mutations for making combinatorial variants were determined.
  • the suitabilty score refers to the ability of one or more combinable mutations to be used to make combinatorial variants, based on the performance criteria for combinability (i.e., A, B, and C, as set forth, above), in which each of the mutations fall.
  • suitability scores of individual substitutions in CspAmy2-vl are shown in Table D.
  • the position numbering is based on the amino acid sequence of the mature CspAmy2 polypeptide (SEQ ID NO: 1). Wild-type residues at the indicated postitions are given a suitability score of +++. Substitutions more likely to be combinable with other mutations are given a suitability score of ++++, or even +++++.
  • preferred suitabilty scores are +++, ++++, or +++++, ++++ or +++++, or even +++++.
  • the first listed amino acid residue is the wild-type residue.
  • Each productive position identified in the following lists with specified criteria, and each substitution identified in parenthesis following the numerical position identifier in each of these lists, represents a mutation, identified by experimental data, that either directly contributes to the performance of an amylase variant, or is determined to be combinable with other mutations to produce a amylase variant with improved performance.
  • 150 (Y,D,F,G,H,I,M,P,Q,W); 151(S,D); 152(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,W);
  • 170 (S,C,G,H,N,R,T); 171(L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T);
  • 318 (N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y); 320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y);
  • 318 (N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y); 320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y);
  • 215 K,E,F,L,M,N,Q,R,T,Y
  • 241 S,A,C,D,E,F,G,H,I,K,L,N,P,Q,R,T,V,W,Y
  • 317 (S,A,C,D,E,G,H,K,L,M,Q,T,W,Y); 318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y);
  • 112 T,A,C,D,E,F,G,I,L,M,P,Q,R,V,W,Y); 116(T,A,C,D,E,G,H,I,K,L,M,N,S,V,W);
  • 171 (L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T); 193(G,A,C,F,H,I,K,R,S,T,V); 203(I,A,C,F,H,L,M,N,Q,V,Y); 207(H,A,D,E,F,K,M,N,R,S,Y); 208(P,A,D,E,H,K,L,N,Q,R,S,T); 211(V,C,D,E,F,I,L,M,N,Q,S,T);
  • 317 (S,A,C,D,E,G,H,K,L,M,Q,T,W,Y); 318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y);
  • CspAmy2-vl SEQ ID NO: 2
  • Bacillus amylases e.g., from fi.
  • Carbohydrate- Active Enzymes database (CAZy) Family 13 amylases, or any amylase that has heretofore been referred to by the descriptive term, "Termamyl-like."
  • CAZy Carbohydrate- Active Enzymes database
  • the present ⁇ -amylase variants have at least one combinable mutation at a productive position corresponding to the combinable mutations at productive positions described, above, in Lists A, B, C, D, E, and/or F, and/or a combinable mutation as described in Table D (which use SEQ ID NO: 1 for numbering) and a defined degree of amino acid sequence homology/identity to SEQ ID NO: 1 or SEQ ID NO: 2, for example, at least 60%, at least 65%, at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or even at
  • the suitability score of the at least one mutation is +++, ++++, or +++++. In some embodiments, the suitability score of the at least one mutation is ++++, or +++++. In some embodiments, the suitability score of the at least one mutation is +++++. In some embodiments, the variants have a plurality (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, or more) combinable mutations.
  • a plurality e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, or more
  • the present a-amylase variants have at least one combinable mutation at a productive position corresponding to the combinable mutations at productive positions described, above, in Lists A, B, C, D, E, and/or F, and/or a combinable mutation as described in Table D (which use SEQ ID NO: 1 for numbering) and are derived from a parental amylase having a defined degree of amino acid sequence homology/identity to SEQ ID NO: 1 or SEQ ID NO: 2, for example, at least 60%, at least 65%, at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least
  • the suitability score of the at least one mutation is +++, ++++, or +++++. In some embodiments, the suitability score of the at least one mutation is ++++, or +++++. In some embodiments, the suitability score of the at least one mutation is +++++. In some embodiments, the variants have, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more combinable mutations.
  • the present a-amylase variants have a mutation in the calcium binding loop based on the work of Suzuki et al. (1989) J. Biol. Chem. 264: 18933-938.
  • Exemplary mutations include a deletion or substitution at one or more residues corresponding to Arg-178, Gly-179, Thr-180, or Gly-181 in SEQ ID NO: 1.
  • the mutation corresponds to the deletion of Arg-178 and Gly-179 or Thr-180 and Gly-181 (using SEQ ID NO: 1 numbering).
  • Homologous residues in other amylases can be determined by structural alignment, or by primary structure alignment, as illustrated by Figure 6.
  • the mutation(s) in the calcium binding loop are combined with any of the aforementioned combinable mutations and mutations at productive positions.
  • the present amylases further include one or more mutations that provide a further performance or stability benefit.
  • Exemplary performance benfits include but are not limited to increased hydrolysis of a starch substrate, increased grain, cereal or other starch substrate liquifaction performance, increased cleaning performance, increased thermal stability, increased storage stability, increased solubility, an altered pH profile, decreased calcium dependence, increased specific activity, modified substrate specificity, modified substrate binding, modified pH-dependent activity, modified pH-dependent stability, increased oxidative stability, and increased expression.
  • the performance benefit is realized at a relatively low temperature. In some cases, the performance benefit is realized at relatively high temperature.
  • the present amylases may include any number of conservative amino acid substitutions. Exemplary conservative amino acid substitutions are listed in the Table E
  • Tyrosine Y D-Tyr Phe, D-Phe, L-Dopa, His, D-His
  • the present amylase may be "precursor,” “immature,” or “full-length,” in which case they include a signal sequence, or “mature,” in which case they lack a signal sequence. Mature forms of the polypeptides are generally the most useful. Unless otherwise noted, the amino acid residue numbering used herein refers to the mature forms of the respective amylase
  • amylase polypeptides may also be truncated to remove the N or C- termini, so long as the resulting polypeptides retain amylase activity.
  • the present amylase may be a "chimeric" or “hybrid” polypeptide, in that it includes at least a portion of a first amylase polypeptide, and at least a portion of a second amylase polypeptide (such chimeric amylases have recently been “rediscovered” as domain-swap amylases).
  • the present amylases may further include heterologous signal sequence, an epitope to allow tracking or purification, or the like.
  • Exemplary heterologous signal sequences are from B. licheniformis amylase (LAT), B. subtilis (AmyE or AprE), and Streptomyces CelA.
  • nucleic acids encoding a variant amylase polypeptide are provided.
  • the nucleic acid may encode a particular amylase polypeptide, or an amylase having a specified degree of amino acid sequence identity to the particular amylase.
  • the nucleic acid encodes an amylase having at least 60%, at least 65%, at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or even at least 99%
  • SEQ ID NO: 1 or SEQ ID NO: 2 (excluding the portion of the nucleic acid that encodes the signal sequence). It will be appreciated that due to the degeneracy of the genetic code, a plurality of nucleic acids may encode the same polypeptide.
  • the nucleic acid hybridizes under stringent or very stringent conditions to a nucleic acid encoding (or complementary to a nucleic acid encoding) an amylase having at least 60%, at least 65%, at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or even at least 99% homology/identity to SEQ ID NO: 1 or SEQ ID NO: 2 (excluding the portion of the nucleic acid that encodes the signal sequence).
  • Such hybridization conditions are described herein but are also well known in the art.
  • Nucleic acids may encode a "full-length” (“fl” or “FL”) amylase, which includes a signal sequence, only the mature form of an amylase, which lacks the signal sequence, or a truncated form of an amylase, which lacks the N or C-terminus of the mature form.
  • fl full-length amylase
  • a nucleic acid that encodes a a-amylase can be operably linked to various promoters and regulators in a vector suitable for expressing the a-amylase in host cells.
  • exemplary promoters are from B. licheniformis amylase (LAT), B. subtilis (AmyE or AprE), and
  • Streptomyces CelA Such a nucleic acid can also be linked to other coding sequences, e.g., to encode a chimeric polypeptide. 3. Production of Variant Amylases
  • the present variant amylases can be produced in host cells, for example, by secretion or intracellular expression.
  • a cultured cell material ⁇ e.g., a whole-cell broth) comprising a variant amylase can be obtained following secretion of the variant amylase into the cell medium.
  • the variant amylase can be isolated from the host cells, or even isolated from the cell broth, depending on the desired purity of the final variant amylase.
  • a gene encoding a variant amylase can be cloned and expressed according to methods well known in the art.
  • Suitable host cells include bacterial, fungal (including yeast and filamentous fungi), and plant cells (including algae). Particularly useful host cells include Aspergillus niger, Aspergillus oryzae or
  • Trichoderma reesei Other host cells include bacterial cells, e.g., Bacillus subtilis or B.
  • the host cell further may express a nucleic acid encoding a homologous or heterologous glucoamylase, i.e., a glucoamylase that is not the same species as the host cell, or one or more other enzymes.
  • the glucoamylase may be a variant glucoamylase, such as one of the glucoamylase variants disclosed in U.S. Patent No. 8,058,033 (Danisco US Inc.), for example.
  • the host may express one or more accessory enzymes, proteins, peptides. These may benefit liquefaction, saccharification, fermentation, SSF, etc processes.
  • the host cell may produce biochemicals in addition to enzymes used to digest the various feedstock(s). Such host cells may be useful for fermentation or simultaneous saccharification and fermentation processes to reduce or eliminate the need to add enzymes.
  • a DNA construct comprising a nucleic acid encoding variant amylases can be constructed to be expressed in a host cell.
  • Representative nucleic acids that encode variant amylases include SEQ ID NO: 4. Because of the well-known degeneracy in the genetic code, variant polynucleotides that encode an identical amino acid sequence can be designed and made with routine skill. It is also well known in the art to optimize codon use for a particular host cell. Nucleic acids encoding variant amylases can be incorporated into a vector. Vectors can be transferred to a host cell using well-known transformation techniques, such as those disclosed below.
  • the vector may be any vector that can be transformed into and replicated within a host cell.
  • a vector comprising a nucleic acid encoding a variant amylase can be transformed and replicated in a bacterial host cell as a means of propagating and amplifying the vector.
  • the vector also may be transformed into an expression host, so that the encoding nucleic acids can be expressed as a functional amylase.
  • Host cells that serve as expression hosts can include filamentous fungi, for example.
  • the Fungal Genetics Stock Center (FGSC) Catalogue of Strains lists suitable vectors for expression in fungal host cells. See FGSC, Catalogue of Strains, University of Missouri, at www.fgsc.net (last modified January 17, 2007).
  • pJG153 a promoterless Cre expression vector that can be replicated in a bacterial host. See Harrison et al. (June 2011) Applied Environ. Microbiol. 77: 3916-22.
  • pJG153can be modified with routine skill to comprise and express a nucleic acid encoding an amylase variant.
  • a nucleic acid encoding a variant amylase can be operably linked to a suitable promoter, which allows transcription in the host cell.
  • the promoter may be any DNA sequence that shows transcriptional activity in the host cell of choice and may be derived from genes encoding proteins either homologous or heterologous to the host cell.
  • Exemplary promoters for directing the transcription of the DNA sequence encoding a variant amylase, especially in a bacterial host are the promoter of the lac operon of E. coli, the Streptomyces coelicolor agarase gene dagA or celA promoters, the promoters of the Bacillus licheniformis a-amylase gene
  • myL the promoters of the Bacillus stearothermophilus maltogenic amylase gene (amyM), the promoters of the Bacillus amyloliquefaciens a-amylase (amyQ), the promoters of the Bacillus subtilis xylA and xylB genes etc.
  • useful promoters are those derived from the gene encoding Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral a-amylase, A. niger acid stable a-amylase, A.
  • a suitable promoter can be selected, for example, from a bacteriophage promoter including a T7 promoter and a phage lambda promoter.
  • Suitable promoters for the expression in a yeast species include but are not limited to the Gal 1 and Gal 10 promoters of Saccharomyces cerevisiae and the Pichia pastoris AOXl or AOX2 promoters, cbhl is an endogenous, inducible promoter from T. reesei. See Liu et al. (2008) "Improved heterologous gene expression in Trichoderma reesei by cellobiohydrolase I gene (cbhl) promoter optimization," Acta Biochim. Biophys. Sin (Shanghai) 40(2): 158-65.
  • the coding sequence can be operably linked to a signal sequence.
  • the DNA encoding the signal sequence may be the DNA sequence naturally associated with the amylase gene to be expressed or from a different Genus or species.
  • a signal sequence and a promoter sequence comprising a DNA construct or vector can be introduced into a fungal host cell and can be derived from the same source.
  • the signal sequence is the cbhl signal sequence that is operably linked to a cbhl promoter.
  • An expression vector may also comprise a suitable transcription terminator and, in eukaryotes, polyadenylation sequences operably linked to the DNA sequence encoding a variant amylase. Termination and polyadenylation sequences may suitably be derived from the same sources as the promoter.
  • the vector may further comprise a DNA sequence enabling the vector to replicate in the host cell.
  • a DNA sequence enabling the vector to replicate in the host cell. Examples of such sequences are the origins of replication of plasmids pUC19, pACYC177, pUBHO, pE194, pAMBl, and pLJ702.
  • the vector may also comprise a selectable marker, e.g., a gene the product of which complements a defect in the isolated host cell, such as the dal genes from B. subtilis or B.
  • a selectable marker e.g., a gene the product of which complements a defect in the isolated host cell, such as the dal genes from B. subtilis or B.
  • the vector may comprise Aspergillus selection markers such as amdS, argB, niaD and xxsC, a marker giving rise to hygromycin resistance, or the selection may be accomplished by co-transformation, such as known in the art. See e.g., International PCT Application WO 91/17243.
  • Intracellular expression may be advantageous in some respects, e.g., when using certain bacteria or fungi as host cells to produce large amounts of amylase for subsequent enrichment or purification.
  • the expression vector typically includes the components of a cloning vector, such as, for example, an element that permits autonomous replication of the vector in the selected host organism and one or more phenotypically detectable markers for selection purposes.
  • the expression vector normally comprises control nucleotide sequences such as a promoter, operator, ribosome binding site, translation initiation signal and optionally, a repressor gene or one or more activator genes.
  • the expression vector may comprise a sequence coding for an amino acid sequence capable of targeting the amylase to a host cell organelle such as a peroxisome, or to a particular host cell compartment.
  • a targeting sequence includes but is not limited to the sequence, SKL.
  • the nucleic acid sequence of the amylase is operably linked to the control sequences in proper manner with respect to expression.
  • An isolated cell is advantageously used as a host cell in the recombinant production of an amylase.
  • the cell may be transformed with the DNA construct encoding the enzyme, conveniently by integrating the DNA construct (in one or more copies) in the host chromosome.
  • This integration is generally considered to be an advantage, as the DNA sequence is more likely to be stably maintained in the cell. Integration of the DNA constructs into the host chromosome may be performed according to conventional methods, e.g., by homologous or heterologous recombination.
  • the cell may be transformed with an expression vector as described above in connection with the different types of host cells.
  • suitable bacterial host organisms are Gram positive bacterial species such as Bacillaceae including Bacillus subtilis, Bacillus licheniformis, Bacillus lentus, Bacillus brevis, Geobacillus (formerly Bacillus) stearothermophilus, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus coagulans, Bacillus lautus, Bacillus megaterium, and Bacillus thuringiensis; Streptomyces species such as Streptomyces murinus; lactic acid bacterial species including Lactococcus sp. such as Lactococcus lactis; Lactobacillus sp.
  • Bacillaceae including Bacillus subtilis, Bacillus licheniformis, Bacillus lentus, Bacillus brevis, Geobacillus (formerly Bacillus) stearothermophilus, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus coagulans,
  • strains of a Gram negative bacterial species belonging to Enterobacteriaceae including E. coli, or to Pseudomonadaceae can be selected as the host organism.
  • a suitable yeast host organism can be selected from the biotechnologically relevant yeasts species such as but not limited to yeast species such as Pichia sp., Hansenula sp., or Kluyveromyces, Yarrowinia, Schizosaccharomyces species or a species of Saccharomyces, including Saccharomyces cerevisiae or a species belonging to Schizosaccharomyces such as, for example, S. pombe species.
  • a strain of the methylotrophic yeast species, Pichia pastoris can be used as the host organism.
  • the host organism can be a Hansenula species.
  • Suitable host organisms among filamentous fungi include species of Aspergillus, e.g.,
  • Aspergillus nidulans strains of a Fusarium species, e.g., Fusarium oxysporum or of a Rhizomucor species such as Rhizomucor miehei can be used as the host organism. Other suitable strains include Thermomyces and Mucor species.
  • Trichoderma sp. can be used as a host.
  • a suitable procedure for transformation of Aspergillus host cells includes, for example, that described in EP 238023.
  • An amylase expressed by a fungal host cell can be glycosylated, i.e., will comprise a glycosyl moiety.
  • the glycosylation pattern can be the same or different as present in the wild-type amylase.
  • the type and/or degree of glycosylation may impart changes in enzymatic and/or biochemical properties.
  • Gene inactivation may be accomplished by complete or partial deletion, by insertional inactivation or by any other means that renders a gene nonfunctional for its intended purpose, such that the gene is prevented from expression of a functional protein.
  • Any gene from a Trichoderma sp. or other filamentous fungal host that has been cloned can be deleted, for example, cbhl, cbh2, egll, and egl2 genes.
  • Gene deletion may be accomplished by inserting a form of the desired gene to be inactivated into a plasmid by methods known in the art.
  • Introduction of a DNA construct or vector into a host cell includes techniques such as transformation; electroporation; nuclear microinjection; transduction; transfection, e.g., lipofection mediated and DEAE-Dextrin mediated transfection; incubation with calcium phosphate DNA precipitate; high velocity bombardment with DNA-coated microprojectiles; and protoplast fusion.
  • General transformation techniques are known in the art. See, e.g., Sambrook et al. (2001), supra.
  • the expression of heterologous protein in Trichoderma is described, for example, in U.S. Patent No. 6,022,725. Reference is also made to Cao et al. (2000) Science 9:991-1001 for transformation of Aspergillus strains.
  • Trichoderma sp. for transformation may involve the preparation of protoplasts from fungal mycelia. See Campbell et al. (1989) Curr. Genet. 16: 53- 56.
  • the mycelia can be obtained from germinated vegetative spores.
  • the mycelia are treated with an enzyme that digests the cell wall, resulting in protoplasts.
  • the protoplasts are protected by the presence of an osmotic stabilizer in the suspending medium. These stabilizers include sorbitol, mannitol, potassium chloride, magnesium sulfate, and the like.
  • stabilizers include sorbitol, mannitol, potassium chloride, magnesium sulfate, and the like.
  • concentration of these stabilizers varies between 0.8 M and 1.2 M, e.g., a 1.2 M solution of sorbitol can be used in the suspension medium.
  • Uptake of DNA into the host Trichoderma sp. strain depends upon the calcium ion concentration. Generally, between about 10-50 mM CaCl 2 is used in an uptake solution.
  • Suitable compounds include a buffering system, such as TE buffer (10 mM Tris, pH 7.4; 1 mM EDTA) or 10 mM MOPS, pH 6.0 and polyethylene glycol.
  • TE buffer 10 mM Tris, pH 7.4; 1 mM EDTA
  • MOPS 10 mM MOPS
  • polyethylene glycol The polyethylene glycol is believed to fuse the cell membranes, thus permitting the contents of the medium to be delivered into the cytoplasm of the Trichoderma sp. strain. This fusion frequently leaves multiple copies of the plasmid DNA integrated into the host chromosome.
  • TE buffer 10 mM Tris, pH 7.4; 1 mM EDTA
  • MOPS 10 mM MOPS
  • polyethylene glycol polyethylene glycol
  • the polyethylene glycol is believed to fuse the cell membranes, thus permitting the contents of the medium to be delivered into the cytoplasm of the Trichoderma sp. strain. This fusion frequently leaves multiple copies of the plasmid DNA integrated into
  • a volume of 100 of these protoplasts or cells in an appropriate solution ⁇ e.g., 1.2 M sorbitol and 50 mM CaCl 2 ) may be mixed with the desired DNA.
  • an appropriate solution ⁇ e.g., 1.2 M sorbitol and 50 mM CaCl 2
  • a high concentration of PEG is added to the uptake solution.
  • From 0.1 to 1 volume of 25% PEG 4000 can be added to the protoplast suspension; however, it is useful to add about 0.25 volumes to the protoplast suspension.
  • Additives, such as dimethyl sulfoxide, heparin, spermidine, potassium chloride and the like, may also be added to the uptake solution to facilitate transformation.
  • a method of producing an amylase may comprise cultivating a host cell as described above under conditions conducive to the production of the enzyme and recovering the enzyme from the cells and/or culture medium.
  • the medium used to cultivate the cells may be any conventional medium suitable for growing the host cell in question and obtaining expression of an amylase. Suitable media and media components are available from commercial suppliers or may be prepared according to published recipes (e.g., as described in catalogues of the American Type Culture Collection).
  • An enzyme secreted from the host cells can be used in a whole broth preparation.
  • the preparation of a spent whole fermentation broth of a recombinant microorganism can be achieved using any cultivation method known in the art resulting in the expression of an a-amylase. Fermentation may, therefore, be understood as comprising shake flask cultivation, small- or large-scale fermentation (including continuous, batch, fed-batch, or solid state fermentations) in laboratory or industrial fermenters performed in a suitable medium and under conditions allowing the amylase to be expressed or isolated.
  • the term "spent whole fermentation broth” is defined herein as unfractionated contents of fermentation material that includes culture medium, extracellular proteins (e.g. , enzymes), and cellular biomass.
  • spent whole fermentation broth also encompasses cellular biomass that has been lysed or permeabilized using methods well known in the art.
  • An enzyme secreted from the host cells may conveniently be recovered from the culture medium by well-known procedures, including separating the cells from the medium by centrifugation or filtration, and precipitating proteinaceous components of the medium by means of a salt such as ammonium sulfate, followed by the use of chromatographic procedures such as ion exchange chromatography, affinity chromatography, or the like.
  • the polynucleotide encoding an amylase in a vector can be operably linked to a control sequence that is capable of providing for the expression of the coding sequence by the host cell, i.e. the vector is an expression vector.
  • the control sequences may be modified, for example by the addition of further transcriptional regulatory elements to make the level of transcription directed by the control sequences more responsive to transcriptional modulators.
  • the control sequences may in particular comprise promoters.
  • Host cells may be cultured under suitable conditions that allow expression of an amylase. Expression of the enzymes may be constitutive such that they are continually produced, or inducible, requiring a stimulus to initiate expression. In the case of inducible expression, protein production can be initiated when required by, for example, addition of an inducer substance to the culture medium, for example dexamethasone or IPTG or Sophorose. Polypeptides can also be produced recombinantly in an in vitro cell-free system, such as the TNTTM (Promega) rabbit reticulocyte system.
  • An expression host also can be cultured in the appropriate medium for the host, under aerobic conditions.
  • Shaking or a combination of agitation and aeration can be provided, with production occurring at the appropriate temperature for that host, e.g., from about 25°C to about 75°C (e.g., 30°C to 45°C), depending on the needs of the host and production of the desired variant amylase. Culturing can occur from about 12 to about 100 hours or greater (and any hour value there between, e.g., from 24 to 72 hours).
  • the culture broth is at a pH of about 4.0 to about 8.0, again depending on the culture conditions needed for the host relative to production of an amylase.
  • assays can measure the expressed protein, corresponding mRNA, or a-amylase activity.
  • suitable assays include Northern blotting, reverse transcriptase polymerase chain reaction, and in situ hybridization, using an appropriately labeled hybridizing probe.
  • Suitable assays also include measuring amylase activity in a sample, for example, by assays directly measuring reducing sugars such as glucose in the culture media. For example, glucose concentration may be determined using glucose reagent kit No. 15-UV (Sigma Chemical Co.) or an instrument, such as Technicon Autoanalyzer.
  • a- Amylase activity also may be measured by any known method, such as the PAHBAH or ABTS assays, described below.
  • Fermentation, separation, and concentration techniques are well known in the art and conventional methods can be used in order to prepare a concentrated a variant a-amylase polypeptide-containing solution.
  • a fermentation broth is obtained, the microbial cells and various suspended solids, including residual raw fermentation materials, are removed by conventional separation techniques in order to obtain an amylase solution. Filtration, centrifugation, microfiltration, rotary vacuum drum filtration, ultrafiltration, centrifugation followed by ultrafiltration, extraction, or chromatography, or the like, are generally used.
  • the enzyme containing solution is concentrated using conventional concentration techniques until the desired enzyme level is obtained. Concentration of the enzyme containing solution may be achieved by any of the techniques discussed herein. Exemplary methods of enrichment and purification include but are not limited to rotary vacuum filtration and/or ultrafiltration.
  • the enzyme solution is concentrated into a concentrated enzyme solution until the enzyme activity of the concentrated variant ⁇ -amylase polypeptide-containing solution is at a desired level.
  • Concentration may be performed using, e.g., a precipitation agent, such as a metal halide precipitation agent.
  • a precipitation agent such as a metal halide precipitation agent.
  • Metal halide precipitation agents include but are not limited to alkali metal chlorides, alkali metal bromides and blends of two or more of these metal halides.
  • Exemplary metal halides include sodium chloride, potassium chloride, sodium bromide, potassium bromide and blends of two or more of these metal halides.
  • the metal halide precipitation agent, sodium chloride can also be used as a preservative.
  • the metal halide precipitation agent is used in an amount effective to precipitate an amylase.
  • the selection of at least an effective amount and an optimum amount of metal halide effective to cause precipitation of the enzyme, as well as the conditions of the precipitation for maximum recovery including incubation time, pH, temperature and concentration of enzyme, will be readily apparent to one of ordinary skill in the art, after routine testing.
  • metal halide precipitation agent Generally, at least about 5% w/v (weight/volume) to about 25% w/v of metal halide is added to the concentrated enzyme solution, and usually at least 8% w/v. Generally, no more than about 25% w/v of metal halide is added to the concentrated enzyme solution and usually no more than about 20% w/v.
  • concentration of the metal halide precipitation agent will depend, among others, on the nature of the specific variant ⁇ -amylase polypeptide and on its concentration in the concentrated enzyme solution.
  • organic compound precipitating agents include: 4-hydroxybenzoic acid, alkali metal salts of 4-hydroxybenzoic acid, alkyl esters of 4-hydroxybenzoic acid, and blends of two or more of these organic compounds.
  • the addition of the organic compound precipitation agents can take place prior to, simultaneously with or subsequent to the addition of the metal halide precipitation agent, and the addition of both precipitation agents, organic compound and metal halide, may be carried out sequentially or simultaneously.
  • the organic precipitation agents are selected from the group consisting of alkali metal salts of 4-hydroxybenzoic acid, such as sodium or potassium salts, and linear or branched alkyl esters of 4-hydroxybenzoic acid, wherein the alkyl group contains from 1 to 12 carbon atoms, and blends of two or more of these organic compounds.
  • the organic compound precipitation agents can be, for example, linear or branched alkyl esters of 4-hydroxybenzoic acid, wherein the alkyl group contains from 1 to 10 carbon atoms, and blends of two or more of these organic compounds.
  • Exemplary organic compounds are linear alkyl esters of 4- hydroxybenzoic acid, wherein the alkyl group contains from 1 to 6 carbon atoms, and blends of two or more of these organic compounds.
  • Methyl esters of 4-hydroxybenzoic acid, propyl esters of 4-hydroxybenzoic acid, butyl ester of 4-hydroxybenzoic acid, ethyl ester of 4-hydroxybenzoic acid and blends of two or more of these organic compounds can also be used.
  • Additional organic compounds also include but are not limited to 4-hydroxybenzoic acid methyl ester (named methyl PARABEN), 4-hydroxybenzoic acid propyl ester (named propyl PARABEN), which also are both amylase preservative agents.
  • methyl PARABEN 4-hydroxybenzoic acid methyl ester
  • propyl PARABEN 4-hydroxybenzoic acid propyl ester
  • Addition of the organic compound precipitation agent provides the advantage of high flexibility of the precipitation conditions with respect to pH, temperature, variant amylase concentration, precipitation agent concentration, and time of incubation.
  • the organic compound precipitation agent is used in an amount effective to improve precipitation of the enzyme by means of the metal halide precipitation agent.
  • the selection of at least an effective amount and an optimum amount of organic compound precipitation agent, as well as the conditions of the precipitation for maximum recovery including incubation time, pH, temperature and concentration of enzyme, will be readily apparent to one of ordinary skill in the art, in light of the present disclosure, after routine testing.
  • the concentrated polypeptide solution containing the metal halide precipitation agent, and the organic compound precipitation agent, can be adjusted to a pH, which will, of necessity, depend on the enzyme to be enriched or purified.
  • the pH is adjusted at a level near the isoelectric point of the amylase.
  • the pH can be adjusted at a pH in a range from about 2.5 pH units below the isoelectric point (pi) up to about 2.5 pH units above the isoelectric point.
  • the incubation time necessary to obtain an enriched or purified enzyme precipitate depends on the nature of the specific enzyme, the concentration of enzyme, and the specific precipitation agent(s) and its (their) concentration. Generally, the time effective to precipitate the enzyme is between about 1 to about 30 hours; usually it does not exceed about 25 hours. In the presence of the organic compound precipitation agent, the time of incubation can still be reduced to less about 10 hours and in most cases even about 6 hours. [00154] Generally, the temperature during incubation is between about 4°C and about 50°C. Usually, the method is carried out at a temperature between about 10°C and about 45°C (e.g. , between about 20°C and about 40°C). The optimal temperature for inducing precipitation varies according to the solution conditions and the enzyme or precipitation agent(s) used.
  • the overall recovery of enriched or purified enzyme precipitate, and the efficiency with which the process is conducted, is improved by agitating the solution comprising the enzyme, the added metal halide and the added organic compound.
  • the agitation step is done both during addition of the metal halide and the organic compound, and during the subsequent incubation period. Suitable agitation methods include mechanical stirring or shaking, vigorous aeration, or any similar technique.
  • the enriched or purified enzyme is then separated from the dissociated pigment and other impurities and collected by conventional separation techniques, such as filtration, centrifugation, microfiltration, rotary vacuum filtration, ultrafiltration, press filtration, cross membrane microfiltration, cross flow membrane
  • Further enrichment or purification of the enzyme precipitate can be obtained by washing the precipitate with water.
  • the enriched or purified enzyme precipitate is washed with water containing the metal halide precipitation agent, or with water containing the metal halide and the organic compound precipitation agents.
  • a variant a-amylase polypeptide accumulates in the culture broth.
  • the culture broth is centrifuged or filtered to eliminate cells, and the resulting cell-free liquid is used for enzyme enrichment or purification.
  • the cell-free broth is subjected to salting out using ammonium sulfate at about 70% saturation; the 70% saturation-precipitation fraction is then dissolved in a buffer and applied to a column such as a Sephadex G- 100 column, and eluted to recover the enzyme-active fraction.
  • a conventional procedure such as ion exchange chromatography may be used.
  • Enriched or purified enzymes are useful for laundry and cleaning applications. For example, they can be used in laundry detergents and spot removers. They can be made into a final product that is either liquid (solution, slurry) or solid (granular, powder).
  • Streptomyces lividans TK24 culture supernatant was treated with (NH 4 ) 2 S0 4 at 80% saturation.
  • the precipitate was recovered by centrifugation at 10,000 x g (20 min. and 4°C) and re- dissolved in 20 mM Tris/HCl buffer (pH 7.0) containing 5 mM CaCl 2 .
  • the solubilized precipitate was then dialyzed against the same buffer.
  • the dialyzed sample was then applied to a Sephacryl S-200 column, which had previously been equilibrated with 20 mM Tris/HCl buffer, (pH 7.0), 5 mM CaCl 2 , and eluted at a linear flow rate of 7 mL/hr with the same buffer.
  • Tris/HCl buffer pH 7.0 containing 5 mM CaCl 2 and 1.5 M (NH 4 ) 2 S0 4 .
  • the enzyme was eluted with a linear gradient of 1.5 to 0 M (NH 4 ) 2 S0 4 in 20 mM Tris/HCL buffer, pH 7.0 containing 5 mM CaCl 2 .
  • the active fractions were collected, and the enzyme precipitated with (NH 4 ) 2 S0 4 at 80% saturation.
  • the precipitate was recovered, re-dissolved, and dialyzed as described above. The dialyzed sample was then applied to a Mono Q HR5/5 column (Amersham Pharmacia; Cat. No.
  • variant ⁇ -amylase polypeptides can be enriched or partially purified as generally described above by removing cells via flocculation with polymers.
  • the enzyme can be enriched or purified by microfiltration followed by
  • the enzyme does not need to be enriched or purified, and whole broth culture can be lysed and used without further treatment.
  • the enzyme can then be processed, for example, into granules.
  • Variants amylases are useful for a variety of industrial applications.
  • variant amylases are useful in a starch conversion process, particularly in a saccharification process of a starch that has undergone liquefaction.
  • the desired end-product may be any product that may be produced by the enzymatic conversion of the starch substrate.
  • the desired product may be a syrup rich in glucose and maltose, which can be used in other processes, such as the preparation of HFCS, or which can be converted into a number of other useful products, such as ascorbic acid intermediates (e.g.
  • gluconate gluconate; 2-keto-L-gulonic acid; 5- keto-gluconate; and 2,5-diketogluconate); 1,3-propanediol; aromatic amino acids (e.g. , tyrosine, phenylalanine and tryptophan); organic acids (e.g. , lactate, pyruvate, succinate, isocitrate, and oxaloacetate); amino acids (e.g., serine and glycine); antibiotics; antimicrobials; enzymes;
  • aromatic amino acids e.g. , tyrosine, phenylalanine and tryptophan
  • organic acids e.g. , lactate, pyruvate, succinate, isocitrate, and oxaloacetate
  • amino acids e.g., serine and glycine
  • antibiotics e.g., antimicrobials; enzymes;
  • the starch conversion process may be a precursor to, or simultaneous with, a fermentation process designed to produce alcohol for fuel or drinking (i.e. , potable alcohol).
  • a fermentation process designed to produce alcohol for fuel or drinking (i.e. , potable alcohol).
  • One skilled in the art is aware of various fermentation conditions that may be used in the production of these end-products.
  • Variant amylases are also useful in compositions and methods of food preparation. These various uses of variant amylases are described in more detail below.
  • a useful starch substrate may be obtained from tubers, roots, stems, legumes, cereals or whole grain. More specifically, the granular starch may be obtained from corn, cobs, wheat, barley, rye, triticale, milo, sago, millet, cassava, tapioca, sorghum, rice, peas, bean, banana, or potatoes. Corn contains about 60-68% starch; barley contains about 55-65% starch; millet contains about 75-80% starch; wheat contains about 60-65% starch; and polished rice contains 70-72% starch.
  • starch substrates are corn starch and wheat starch.
  • the starch from a grain may be ground or whole and includes corn solids, such as kernels, bran and/or cobs.
  • the starch may also be highly refined raw starch or feedstock from starch refinery processes.
  • starches also are commercially available.
  • corn starch is available from Cerestar, Sigma, and Katayama Chemical Industry Co. (Japan); wheat starch is available from Sigma; sweet potato starch is available from Wako Pure Chemical Industry Co. (Japan); and potato starch is available from Nakaari Chemical Pharmaceutical Co. (Japan).
  • the starch substrate can be a crude starch from milled whole grain, which contains non-starch fractions, e.g., germ residues and fibers.
  • Milling may comprise either wet milling or dry milling or grinding.
  • wet milling whole grain is soaked in water or dilute acid to separate the grain into its component parts, e.g., starch, protein, germ, oil, kernel fibers.
  • Wet milling efficiently separates the germ and meal (i.e., starch granules and protein) and is especially suitable for production of syrups.
  • whole kernels are ground into a fine powder and often processed without fractionating the grain into its component parts. In some cases, oils from the kernels are recovered.
  • Dry ground grain thus will comprise significant amounts of non-starch carbohydrate compounds, in addition to starch. Dry grinding of the starch substrate can be used for production of ethanol and other biochemicals.
  • the starch to be processed may be a highly refined starch quality, for example, at least 90%, at least 95%, at least 97%, or at least 99.5% pure.
  • the term "liquefaction” or “liquefy” means a process by which starch is converted to less viscous and shorter chain dextrins. Generally, this process involves gelatinization of starch simultaneously with or followed by the addition of an a-amylase, although additional liquefaction-inducing enzymes optionally may be added.
  • the starch substrate prepared as described above is slurried with water.
  • the starch slurry may contain starch as a weight percent of dry solids of about 10-55%, about 20-45%, about 30-45%, about 30-40%, or about 30-35%.
  • a-Amylase (EC 3.2.1.1) may be added to the slurry, with a metering pump, for example.
  • the a-amylase typically used for this application is a thermally stable, bacterial a-amylase, such as a Geobacillus stearothermophilus a-amylase.
  • the ⁇ -amylase is usually supplied, for example, at about 1500 units per kg dry matter of starch.
  • the pH of the slurry typically is adjusted to about pH 5.5-6.5 and about 1 mM of calcium (about 40 ppm free calcium ions) can also be added.
  • Geobacillus stearothermophilus variants or other a- amylases may require different conditions.
  • Bacterial ⁇ -amylase remaining in the slurry following liquefaction may be deactivated via a number of methods, including lowering the pH in a subsequent reaction step or by removing calcium from the slurry in cases where the enzyme is dependent upon calcium.
  • the slurry of starch plus the a-amylase may be pumped continuously through a jet cooker, which is steam heated to 105°C. Gelatinization occurs rapidly under these conditions, and the enzymatic activity, combined with the significant shear forces, begins the hydrolysis of the starch substrate. The residence time in the jet cooker is brief.
  • the partly gelatinized starch may be passed into a series of holding tubes maintained at 105-110°C and held for 5-8 min.
  • primary liquefaction Hydrolysis to the required DE is completed in holding tanks at 85-95°C or higher temperatures for about 1 to 2 hours (“secondary liquefaction”). These tanks may contain baffles to discourage back mixing.
  • minutes of secondary liquefaction refers to the time that has elapsed from the start of secondary liquefaction to the time that the Dextrose Equivalent (DE) is measured. The slurry is then allowed to cool to room temperature. This cooling step can be 30 minutes to 180 minutes, e.g. 90 minutes to 120 minutes.
  • the liquefied starch typically is in the form of a slurry having a dry solids content (w/w) of about 10-50%; about 10-45%; about 15-40%; about 20-40%; about 25-40%; or about 25-35%.
  • Liquefaction with variant amylases advantageously can be conducted at low pH, eliminating the requirement to adjust the pH to about pH 5.5-6.5.
  • Variants amylases can be used for liquefaction at a pH range of 2 to 7, e.g., pH 3.0 - 7.5, pH 4.0 - 6.0, or pH 4.5 - 5.8.
  • Variant amylases can maintain liquefying activity at a temperature range of about 85°C - 95°C, e.g., 85°C, 90°C, or 95°C.
  • liquefaction can be conducted with 800 ⁇ g an amylase in a solution of 25% DS corn starch for 10 min at pH 5.8 and 85°C, or pH 4.5 and 95°C, for example.
  • Liquefying activity can be assayed using any of a number of known viscosity assays in the art.
  • the liquefied starch can be saccharified into a syrup rich in lower DP (e.g., DPI + DP2) saccharides, using variant amylases, optionally in the presence of another enzyme(s).
  • DP e.g., DPI + DP2
  • variant amylases optionally in the presence of another enzyme(s).
  • the exact composition of the products of saccharification depends on the combination of enzymes used, as well as the type of granular starch processed.
  • the syrup obtainable using the provided variant amylases may contain a weight percent of DP2 of the total oligosaccharides in the saccharified starch exceeding 30%, e.g., 45% - 65% or 55% - 65%.
  • the weight percent of (DPI + DP2) in the saccharified starch may exceed about 70%, e.g., 75% - 85% or 80% - 85%.
  • the present amylases also produce a relatively high yield of glucose, e.g., DPI > 20%, in the syrup product.
  • Saccharification typically is most effective at temperatures of about 60-65°C and a pH of about 4.0-4.5, e.g., pH 4.3, necessitating cooling and adjusting the pH of the liquefied starch.
  • Saccharification may be performed, for example, at a temperature between about 40°C, about 50°C, or about 55°C to about 60°C or about 65°C. Saccharification is normally conducted in stirred tanks, which may take several hours to fill or empty. Enzymes typically are added either at a fixed ratio to dried solids as the tanks are filled or added as a single dose at the commencement of the filling stage. A saccharification reaction to make a syrup typically is run over about 24-72 hours, for example, 24-48 hours. When a maximum or desired DE has been attained, the reaction is stopped by heating to 85°C for 5 min., for example.
  • saccharification optimally is conducted at a temperature range of about 30°C to about 75°C, e.g., 45°C - 75°C or 47°C - 74°C.
  • the saccharifying may be conducted over a pH range of about pH 3 to about pH 7, e.g., pH 3.0 - pH 7.5, pH 3.5 - pH 5.5, pH 3.5, pH 3.8, or pH 4.5.
  • An amylase may be added to the slurry in the form of a composition.
  • Amylase can be added to a slurry of a granular starch substrate in an amount of about 0.6 - 10 ppm ds, e.g., 2 ppm ds.
  • An amylase can be added as a whole broth, clarified, enriched, partially purified, or purified enzyme.
  • the specific activity of the amylase may be about 300 U/mg of enzyme, for example, measured with the PAHBAH assay.
  • the amylase also can be added as a whole broth product.
  • An amylase may be added to the slurry as an isolated enzyme solution.
  • an amylase can be added in the form of a cultured cell material produced by host cells expressing an amylase.
  • An amylase may also be secreted by a host cell into the reaction medium during the fermentation or SSF process, such that the enzyme is provided continuously into the reaction.
  • the host cell producing and secreting amylase may also express an additional enzyme, such as a glucoamylase.
  • U.S. Patent No. 5,422,267 discloses the use of a glucoamylase in yeast for production of alcoholic beverages.
  • a host cell e.g., Trichoderma reesei or Aspergillus niger
  • a host cell may be engineered to co-express an amylase and a glucoamylase, e.g., HgGA, TrGA, or a TrGA variant, during saccharification.
  • the host cell can be genetically modified so as not to express its endogenous glucoamylase and/or other enzymes, proteins or other materials.
  • the host cell can be engineered to express a broad spectrum of various saccharolytic enzymes.
  • the recombinant yeast host cell can comprise nucleic acids encoding a glucoamylase, an alpha-glucosidase, an enzyme that utilizes pentose sugar, an a-amylase, a pullulanase, an isoamylase, and/or an isopullulanase. See, e.g., WO 2011/153516 A2.
  • HFSS high fructose starch-based syrup
  • HFCS high fructose corn syrup
  • Suitable isomerases include Sweetzyme®, ⁇ (Novozymes A/S); G-zyme® IMGI, and G-zyme® G993, Ketomax®, G-zyme® G993, G-zyme® G993 liquid, and GenSweet® IGI. Following isomerization, the mixture typically contains about 40-45% fructose, e.g., 42% fructose.
  • the soluble starch hydrolysate can be fermented by contacting the starch hydrolysate with a fermenting organism typically at a temperature around 32°C, such as from 30°C to 35°C for alcohol-producing yeast.
  • a fermenting organism typically at a temperature around 32°C, such as from 30°C to 35°C for alcohol-producing yeast.
  • the temperature and pH of the fermentation will depend upon the fermenting organism.
  • EOF products include metabolites, such as citric acid, lactic acid, succinic acid, mono sodium glutamate, gluconic acid, sodium gluconate, calcium gluconate, potassium gluconate, itaconic acid and other carboxylic acids, glucono delta-lactone, sodium erythorbate, lysine and other amino acids, omega 3 fatty acid, butanol, isoprene, 1,3-propanediol and other biomaterials.
  • metabolites such as citric acid, lactic acid, succinic acid, mono sodium glutamate, gluconic acid, sodium gluconate, calcium gluconate, potassium gluconate, itaconic acid and other carboxylic acids, glucono delta-lactone, sodium erythorbate, lysine and other amino acids, omega 3 fatty acid, butanol, isoprene, 1,3-propanediol and other biomaterials.
  • Ethanologenic microorganisms include yeast, such as Saccharomyces cerevisiae and bacteria, e.g., Zymomonas moblis, expressing alcohol dehydrogenase and pyruvate
  • the ethanologenic microorganism can express xylose reductase and xylitol dehydrogenase, which convert xylose to xylulose. Improved strains of ethanologenic microorganisms, which can withstand higher temperatures, for example, are known in the art and can be used. See Liu et al. (2011) Sheng Wu Gong Cheng Xue Bao 27(7): 1049-56.
  • yeast Commercial sources of yeast include ETHANOL RED® (LeSaffre); Thermosacc®
  • Microorganisms that produce other metabolites, such as citric acid and lactic acid, by fermentation are also known in the art. See, e.g., Papagianni (2007) "Advances in citric acid fermentation by Aspergillus niger. biochemical aspects, membrane transport and modeling," Biotechnol. Adv. 25(3): 244-63; John et al. (2009) “Direct lactic acid fermentation: focus on simultaneous saccharification and lactic acid production,” Biotechnol. Adv. 27(2): 145-52.
  • the saccharification and fermentation processes may be carried out as an SSF process. Fermentation may comprise subsequent enrichment purification, and recovery of ethanol, for example. During the fermentation, the ethanol content of the broth or "beer" may reach about 8-18% v/v, e.g., 14-15% v/v. The broth may be distilled to produce enriched, e.g., 96% pure, solutions of ethanol. Further, C0 2 generated by fermentation may be collected with a C0 2 scrubber, compressed, and marketed for other uses, e.g., carbonating beverage or dry ice production. Solid waste from the fermentation process may be used as protein-rich products, e.g., livestock feed.
  • an SSF process can be conducted with fungal cells that express and secrete amylase continuously throughout SSF.
  • the fungal cells expressing amylase also can be the fermenting microorganism, e.g., an ethanologenic microorganism. Ethanol production thus can be carried out using a fungal cell that expresses sufficient amylase so that less or no enzyme has to be added exogenously.
  • the fungal host cell can be from an appropriately engineered fungal strain. Fungal host cells that express and secrete other enzymes, in addition to amylase, also can be used.
  • Such cells may express glucoamylase and/or a pullulanase, phytase, ⁇ / ⁇ -glucosidase, isoamylase, beta-amylase cellulase, xylanase, other hemicellulases, protease, beta-glucosidase, pectinase, esterase, redox enzymes, transferase, or other enzyme.
  • a variation on this process is a "fed-batch fermentation" system, where the substrate is added in increments as the fermentation progresses. Fed-batch systems are useful when catabolite repression may inhibit the metabolism of the cells and where it is desirable to have limited amounts of substrate in the medium.
  • the actual substrate concentration in fed-batch systems is estimated by the changes of measurable factors such as pH, dissolved oxygen and the partial pressure of waste gases, such as C0 2 . Batch and fed-batch fermentations are common and well known in the art.
  • Continuous fermentation is an open system where a defined fermentation medium is added continuously to a bioreactor, and an equal amount of conditioned medium is removed simultaneously for processing.
  • Continuous fermentation generally maintains the cultures at a constant high density where cells are primarily in log phase growth.
  • Continuous fermentation permits modulation of cell growth and/or product concentration. For example, a limiting nutrient such as the carbon source or nitrogen source is maintained at a fixed rate and all other parameters are allowed to moderate. Because growth is maintained at a steady state, cell loss due to medium being drawn off should be balanced against the cell growth rate in the fermentation.
  • Variant amylases may be combined with a glucoamylase (EC 3.2.1.3), e.g., a Trichoderma glucoamylase or variant thereof.
  • a glucoamylase is Trichoderma reesei glucoamylase (TrGA) and variants thereof that possess superior specific activity and thermal stability. See U.S. Published Applications Nos. 2006/0094080, 2007/0004018, and 2007/0015266 (Danisco US Inc.).
  • Suitable variants of TrGA include those with glucoamylase activity and at least 80%, at least 90%, or at least 95% sequence identity to wild-type TrGA.
  • Variant amylases advantageously increase the yield of glucose produced in a saccharification process catalyzed by TrGA.
  • the glucoamylase may be another glucoamylase derived from plants (including algae), fungi, or bacteria.
  • the glucoamylases may be Aspergillus niger Gl or G2 glucoamylase or its variants ⁇ e.g., Boel et al. (1984) EMBO J. 3: 1097-1102; WO 92/00381; WO 00/04136 (Novo Nordisk A/S)); and A. awamori glucoamylase ⁇ e.g., WO 84/02921 (Cetus Corp.)).
  • Aspergillus glucoamylase include variants with enhanced thermal stability, e.g., G137A and G139A (Chen et al. (1996) Prot. Eng. 9: 499-505); D257E and D293E/Q (Chen et al. (1995) Prot. Eng. 8: 575-582); N182 (Chen et al. (1994) Biochem. J. 301: 275-281); A246C (Fierobe et al. (1996) Biochemistry, 35: 8698-8704); and variants with Pro residues in positions A435 and S436 (Li et al. (1997) Protein Eng. 10: 1199- 1204).
  • glucoamylases include Talaromyces glucoamylases, in particular derived from T. emersonii ⁇ e.g., WO 99/28448 (Novo Nordisk A/S), T. leycettanus ⁇ e.g., U.S. Patent No. RE 32,153 (CPC International, Inc.)), T. duponti, or T. thermophilus ⁇ e.g., U.S. Patent No. 4,587,215).
  • Contemplated bacterial glucoamylases include glucoamylases from the genus Clostridium, in particular C. thermoamylolyticum ⁇ e.g., EP 135,138 (CPC International, Inc.) and C.
  • thermohydrosulfuricum ⁇ e.g., WO 86/01831 (Michigan Biotechnology Institute)
  • Suitable glucoamylases include the glucoamylases derived from Aspergillus oryzae, such as a glucoamylase shown in SEQ ID NO:2 in WO 00/04136 (Novo Nordisk A/S).
  • glucoamylases such as AMG 200L; AMG 300 L; SANTM SUPER and AMGTM E (Novozymes); OPTIDEX® 300 and OPTIDEX L-400 (Danisco US Inc.); AMIGASETM and AMIGASETM PLUS (DSM); G-ZYME® G900 (Enzyme Bio-Systems); and G-ZYME® G990 ZR ⁇ A. niger glucoamylase with a low protease content).
  • glucoamylases include Aspergillus fumigatus glucoamylase, Talaromyces glucoamylase, Thielavia glucoamylase, Trametes glucoamylase, Thermomyces glucoamylase, Athelia glucoamylase, or Humicola glucoamylase (e.g., HgGA).
  • Glucoamylases typically are added in an amount of about 0.1 - 2 glucoamylase units (GAU)/g ds, e.g., about 0.16 GAU/g ds, 0.23 GAU/g ds, or 0.33 GAU/g ds.
  • GAU glucoamylase units
  • amylase Other suitable enzymes that can be used with amylase include a phytase, protease, pullulanase, ⁇ -amylase, isoamylase, a different a-amylase, alpha-glucosidase, cellulase, xylanase, other hemicellulases, beta-glucosidase, transferase, pectinase, lipase, cutinase, esterase, redox enzymes, or a combination thereof.
  • a debranching enzyme such as an isoamylase (EC 3.2.1.68), may be added in effective amounts well known to the person skilled in the art.
  • a pullulanase (EC 3.2.1.41), e.g., Promozyme®, is also suitable. Pullulanase typically is added at 100 U/kg ds.
  • Further suitable enzymes include proteases, such as fungal and bacterial proteases. Fungal proteases include those obtained from Aspergillus , such as A. niger, A. awamori, A. oryzae; Mucor (e.g., M. miehei); Rhizopus; and Trichoderma.
  • ⁇ -Amylases (EC 3.2.1.2) are exo-acting maltogenic amylases, which catalyze the hydrolysis of 1,4-a-glucosidic linkages into amylopectin and related glucose polymers, thereby releasing maltose.
  • ⁇ -Amylases have been isolated from various plants and microorganisms. See Fogarty et al. (1979) in PROGRESS IN INDUSTRIAL MICROBIOLOGY, Vol. 15, pp. 112-115. These ⁇ -Amylases have optimum temperatures in the range from 40°C to 65°C and optimum pH in the range from about 4.5 to about 7.0.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Mycology (AREA)
  • Nutrition Science (AREA)
  • Food Science & Technology (AREA)
  • Polymers & Plastics (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Detergent Compositions (AREA)
  • Fodder In General (AREA)
  • Bakery Products And Manufacturing Methods Therefor (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

Disclosed are compositions and methods relating to variant alpha-amylases. The variant alpha-amylases are useful, for example, for starch liquefaction and saccharification, for cleaning starchy stains in laundry, dishwashing, and other applications, for textile processing (e.g., desizing), in animal feed for improving digestibility, and for baking and brewing.

Description

ALPHA-AMYLASE VARIANTS DERIVED FROM THE ALPHA AMYLASE OF CYTOPHAGA SP.AMYLASE|(CSPAMY2).
PRIORITY
[001] The present application claims priority to U.S. Provisional Patent Application Serial No. 61/657,501, filed on June 8, 2012, which is hereby incorporated by reference in its entirety.
FIELD OF THE INVENTION
[002] Disclosed are compositions and methods relating to variant a-amylases. The variant a- amylases are useful, for example, for starch liquefaction and saccharification, cleaning starchy stains, textile desizing, baking, and brewing.
BACKGROUND
[003] Starch consists of a mixture of amylose (15-30% w/w) and amylopectin (70-85% w/w). Amylose consists of linear chains of a-l,4-linked glucose units having a molecular weight
(MW) from about 60,000 to about 800,000. Amylopectin is a branched polymer containing a- 1,6 branch points every 24-30 glucose units; its MW may be as high as 100 million.
[004] Sugars from starch, in the form of concentrated dextrose syrups, are currently produced by an enzyme catalyzed process involving: (1) liquefaction (or viscosity reduction) of solid starch with an a-amylase into dextrins having an average degree of polymerization of about 7- 10, and (2) saccharification of the resulting liquefied starch (i.e. starch hydrolysate) with amyloglucosidase (also called glucoamylase or GA). The resulting syrup has a high glucose content. Much of the glucose syrup that is commercially produced is subsequently
enzymatically isomerized to a dextrose/fructose mixture known as isosyrup. The resulting syrup also may be fermented with microorganisms, such as yeast, to produce commercial products including ethanol, citric acid, lactic acid, succinic acid, itaconic acid, monosodium glutamate, gluconates, lysine, other organic acids, other amino acids, and other biochemicals, for example. Fermentation and saccharification can be conducted simultaneously (i.e., an SSF process) to achieve greater economy and efficiency. [005] a-amylases hydrolyze starch, glycogen, and related polysaccharides by cleaving internal a-l,4-glucosidic bonds at random, α-amylases, particularly from Bacilli, have been used for a variety of different purposes, including starch liquefaction and saccharification, textile desizing, starch modification in the paper and pulp industry, brewing, baking, production of syrups for the food industry, production of feedstocks for fermentation processes, and in animal feed to increase digestability. These enzymes can also be used to remove starchy soils and stains during dishwashing and laundry washing.
SUMMARY
[006] The present compositions and methods relate to variant amylase polypeptides, and methods of use, thereof. Aspects and embodiments of the present compositions and methods are summarized in the following separately- numbered paragraphs:
1. A variant α-amylase polypeptide derived from a parental α-amylase polypeptide, comprising at least one combinable mutation at a productive amino acid position; wherein: (i) the combinable mutation is a mutation that improves at least one desirable property of the variant α-amylase compared to the parental a-amylase, while not significantly decreasing either expression, activity, or stability of the variant a-amylase, compared to the parental a-amylase,
(ii) the productive position is an amino acid position that can be substituted with a plurality of different amino acid residues, each of which substitutions result in a variant α-amylase that meets the requirements of (i), and (iii) the combinable mutation is listed in Lists A, B, C, D, E, or F, or in Table D, which uses SEQ ID NO: 1 for numbering.
2. In some embodiments of the variant amylase of paragraph 1, each of the at least one combinable mutations produce a variant amylase wherein the minimum performance indices (PI) relative to the parental amylase for (i) protein expression, (ii) activity, and (iii) detergent stability or thermostability are greater than or equal to 0.9, and the PI for any one of (i), (ii), or
(iii) that is greater than or equal to 1.0.
3. In some embodiments of the variant amylase of paragraph 1, each of the at least one combinable mutations produce a variant amylase wherein the minimum performance indices (PI) relative to the parental amylase for (i) protein expression, (ii) activity, and (iii) detergent stability or thermostability are greater than or equal to 0.8, and the PI for any one of (i), (ii), or (iii) that is greater than or equal to 1.2.
4. In some embodiments of the variant amylase of paragraph 1, each of the at least one combinable mutations produce a variant amylase wherein the minimum performance indices (PI) relative to the parental amylase for (i) protein expression, (ii) activity, and (iii) detergent stability or thermostability are greater than or equal to 0.5, and the PI for any one of (i), (ii), or (iii) that is greater than or equal to 1.5. 5. In some embodiments of the variant amylase of any of the preceding paragraphs, each of the at least one combinable mutations have a suitability score of +++, ++++, or +++++, referring to Table C.
6. In some embodiments of the variant amylase of any of the preceding paragraphs, each of the at least one combinable mutation have a suitability score of ++++, or +++++, referring to
Table C.
7. In some embodiments of the variant amylase of any of the preceding paragraphs, each of the at least one combinable mutation has a suitability score of +++++, referring to Table C.
8. In some embodiments of the variant amylase of any of the preceding paragraphs, each of the at least one combinable mutation has a productivity score of 1 or 2, referring to Table B.
9. The variant amylase of any of the preceding claims, having a plurality of combinable mutations.
10. In some embodiments, the variant amylase of any of the preceding paragraphs further comprises a deletion corresponding to a residue selected from the group consisting of Arg-178, Gly-179, Thr-180, and Gly-181, using SEQ ID NO: 1 for numbering.
11. In some embodiments, the variant amylase of any of the preceding paragraphs further comprises deletions corresponding to residues Arg-178 and Gly-179, using SEQ ID NO: 1 for numbering.
12. In some embodiments of the variant amylase of any of the preceding paragraphs, the parental α-amylase or the variant α-amylase has at least 60% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
13. In some embodiments of the variant amylase of any of the preceding paragraphs, the parental α-amylase or the variant α-amylase has at least 70% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2. 14. In some embodiments of the variant amylase of any of the preceding paragraphs, the parental α-amylase or the variant α-amylase has at least 80% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
15. In some embodiments of the variant amylase of any of the preceding paragraphs, the parental α-amylase or the variant α-amylase has at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2. 16. In another aspect, a composition comprising the variant amylase of any of paragraphs 1-15 is provided.
17. In some embodiments of the composition of paragraph 16, the composition is effective for removing starchy stains from laundry, dishes, or textiles. 18. In some embodiments of the composition of paragraphs 16 or 17, further comprising a surfactant.
19. In some embodiments of the composition of paragraphs 16-18, the composition is a detergent composition.
20. In some embodiments of the composition of paragraphs 16-19, the composition is a laundry detergent or a laundry detergent additive.
21. In some embodiments of the composition of paragraphs 16-20, the composition is a manual or automatic dishwashing detergent.
22. In some embodiments, the composition of paragraphs 16-21 further comprises one or more additional enzymes selected from the group consiting of protease, hemicellulase, cellulase, peroxidase, lipolytic enzyme, metallolipolytic enzyme, xylanase, lipase,
phospholipase, esterase, perhydrolase, cutinase, pectinase, pectate lyase, mannanase, keratinase, reductase, oxidase, phenoloxidase, lipoxygenase, ligninase, pullulanase, tannase, pentosanase, malanase, β-glucanase, arabinosidase, hyaluronidase, chondroitinase, laccase, and an amylase other than the amylase of any one of paragraphs 1-15. 23. In some embodiments, the composition of paragraph 16 is for liquifying starch.
24. In some embodiments, the composition of paragraph 16 is for saccharifying a composition comprising starch, for SSF post liquefaction, or for direct SSF without prior liquefaction.
25. In some embodiments, the composition of paragraph 16 is for producing a fermented beverage.
26. In some embodiments, the composition of paragraph 16 is for producing a baked food product.
27. In some embodiments, the composition of paragraph 16 is for textile desizing.
28. In another aspect, a method for removing a starchy stain or soil from a surface is provided, comprising: contacting the surface in the presence of a aqueous composition comprising an effective amount of the variant amylase of any of the paragraphs 1-15 and, allowing the polypeptide to hydrolyze starch components present in the starchy stain to produce smaller starch-derived molecules that dissolve in the aqueous composition, and rinsing the surface, thereby removing the starchy stain from the surface.
29. In some embodiments of the method of paragraph 28, the aqueous composition further comprises a surfactant.
30. In some embodiments of the method of paragraphs 28-29, the surface is a textile surface.
31. In some embodiments of the method of paragraphs 28-29, the surface is on dishes.
32. In some embodiments of the method of paragraphs 28-29, the surface is a soiled hard surface.
33. In some embodiments of the method of paragraphs 28-32, the composition further comprises at least one additional enzymes selected from the group consiting of protease, hemicellulase, cellulase, peroxidase, lipolytic enzyme, metallolipolytic enzyme, xylanase, lipase, phospholipase, esterase, perhydrolase, cutinase, pectinase, pectate lyase, mannanase, keratinase, reductase, oxidase, phenoloxidase, lipoxygenase, ligninase, pullulanase, tannase, pentosanase, malanase, β-glucanase, arabinosidase, hyaluronidase, chondroitinase, laccase, and an amylase other than the amylase of any one of paragraphs 1-15.
34. In another aspect, a method of saccharifying a composition comprising starch to produce a composition comprising glucose is provided, wherein the method comprises: (i) contacting the solution comprising starch with effective amount of the variant amylase of any of the paragraphs 1-15; and (ii) saccharifying the solution comprising starch to produce the composition comprising glucose; wherein the variant amylase catalyzes the saccharification of the starch solution to glucose.
35. In some embodiments of the method of paragraph 34, the composition comprising starch comprises liquefied starch, gelatinized starch, or granular starch.
36. In some embodiments of the method of paragraphs 34 or 35, saccharification is conducted at a temperature range of about 30°C to about 75°C.
37. In some embodiments of the method of paragraph 36, the temperature range is 47°C-74°C. 38. In some embodiments of the method of any of paragraphs 34-37, saccharification is conducted over a pH range of pH 2.0-7.5. 39. In some embodiments of the method of paragraph 38, the pH range is pH 3.5-5.5.
40. In some embodiments of the method of paragraph 39, the pH range is pH 3.5-4.5.
41. In some embodiments, the method of any of paragraphs 34-40, further comprises fermenting the glucose composition to produce an end of fermentation (EOF) product. 42. In some embodiments of the method of paragraph 41, the fermentation is a simultaneous saccharification and fermentation (SSF) reaction.
43. In some embodiments of the method of paragraphs 41 or 42, the fermentation is conducted for 48-70 hours at pH 2-8 and in a temperature range of 25°C-70°C.
44. In some embodiments of the method of any of paragraphs 41-43, the EOF product comprises ethanol.
45. In some embodiments of the method of any of paragraphs 41-44, the EOF product comprises 8-18% (v/v) ethanol.
46. In some embodiments of the method of paragraphs 41-45, the method further comprises contacting a mash and/or a wort with an amylase. 47. In some embodiments of the method of paragraph 46, the method further comprises:
(a) preparing a mash; (b) filtering the mash to obtain a wort; and (c) fermenting the wort to obtain a fermented beverage, wherein the variant amylase of any one of paragraphs 1-16 and 74- 80 is added to: (i) the mash of step (a) and/or (ii) the wort of step (b) and/or (iii) the wort of step (c).
48. In some embodiments of the method of any of paragraphs 41-47, the EOF product comprises a metabolite.
49. In some embodiments of the method of paragraph 48, the metabolite is citric acid, lactic acid, succinic acid, monosodium glutamate, gluconic acid, sodium gluconate, calcium gluconate, potassium gluconate, glucono delta-lactone, sodium erythorbate, omega 3 fatty acid, butanol, an amino acid, lysine, itaconic acid, 1,3-propanediol, or isoprene.
50. In some embodiments, the method of any of paragraphs 34-49 further comprises adding glucoamylase, hexokinase, xylanase, glucose isomerase, xylose isomerase, phosphatase, phytase, pullulanase, β-amylase, a-amylase that is not the variant a-amylase, protease, cellulase, hemicellulase, lipase, cutinase, isoamylase, redox enzyme, esterase, transferase, pectinase, alpha-glucosidase, beta-glucosidase, or a combination thereof, to the starch solution. 51. In some embodiments of the method of paragraph 50, the glucoamylase is added to 0.1-2 glucoamylase units (GAU)/g ds.
52. In some embodiments of the method of any of paragraphs 34-51, the amylase is expressed and secreted by a host cell. 53. In some embodiments of the method of paragraph 52, the composition comprising starch is contacted with the host cell.
54. In some embodiments of the method of paragraphs 52 or 53, the host cell further expresses and secretes a glucoamylase or other enzyme.
55. In some embodiments of the method of any of paragraphs 52-54, the host cell is capable of fermenting the composition.
56. In another aspect, a composition comprising glucose produced by the method of any one of paragraphs 34-55 is provided.
57. In another aspect, a liquefied starch produced by the method of any one of paragraphs 34-55 is provided. 58. In another aspect, a fermented beverage produced by the method of any one of paragraphs 34-55 is provided.
59. In another aspect, the use of an amylase of any of paragraphs 1-15 in the production of a composition comprising glucose is provided.
60. In another aspect, the use of an amylase of any of paragraphs 1-15 in the production of a liquefied starch is provided.
61. In another aspect, the use of an amylase of any of paragraphs 1-15 in the production of a fermented beverage is provided.
62. In another aspect, the use of an amylase of any of paragraphs 1-15 in cleaning starchy stains is provided. 63. In another aspect, the use of an amylase of any of paragraphs 1-15 in textile desizing is provided.
64. In some embodiments of the method according to any one of paragraphs 34-55, the fermented beverage of paragraph 58, or the use of paragraph 61, the fermented beverage or end of fermentation product is selected from the group consisting of (i) a beer selected from the group consisting of full malted beer, beer brewed under the "Reinheitsgebot", ale, IPA, lager, bitter, Happoshu (second beer), third beer, dry beer, near beer, light beer, low alcohol beer, low calorie beer, porter, bock beer, stout, malt liquor, non-alcoholic beer, and non-alcoholic malt liquor; and (ii) cereal or malt beverages selected from the group consisting of fruit flavoured malt beverages, liquor flavoured malt beverages, and coffee flavoured malt beverages. 65. In another aspect, a method of producing a food composition is provided, comprising combining: (i) one or more food ingredients, and (ii) a variant a- amylase of any of paragraphs 1-15, wherein the variant a- amylase thereof catalyzes the hydrolysis of starch components present in the food ingredients to produce glucose.
66. In some embodiments of the method of paragraph 65, the food composition is selected from the group consisting of a food product, a baking composition, a food additive, an animal food product, a feed product, a feed additive, an oil, a meat, and a lard.
67. In some embodiments of the method of any one of paragraphs 65-66, the one or more food ingredients comprise a baking ingredient or an additive.
68. In some embodiments of the method of any one of paragraphs 65-67, the one or more food ingredients is/are selected from the group consisting of flour; an anti-staling amylase; a phospholipase; a phospholipid; a maltogenic alpha-amylase or a variant, homologue, or mutants thereof which has maltogenic alpha-amylase activity; a bakery xylanase; and a lipase.
69. In some embodiments of the method of paragraph 65, the one or more food ingredients is/are selected from the group consisting of: (i) a maltogenic alpha-amylase from Bacillus stearothermophilus, (ii) a bakery xylanase is from Bacillus, Aspergillus, Thermomyces or Trichoderma, (iii) a glycolipase from Fusarium heterosporum.
70. In some embodiments of the method of any one of paragraphs 65-69, the food composition comprises a dough or a dough product, preferably a processed dough product.
71. In some embodiments, the method of any one of paragraphs 65-70 further comprises baking the food composition to produce a baked good.
72. In some embodiments, the method of any one of paragraphs 65-70, further comprises: (i) providing a starch medium; (ii) adding to the starch medium an amylase; and (iii) applying heat to the starch medium during or after step (b) to produce a bakery product.
73. In another aspect, a method of desizing a textile is provided, comprising contacting a desizing composition with a sized textile for a time sufficient to desize the textile, wherein the desizing composition comprises a variant a-amylase of any one of paragraphs 1-15. 74. In another aspect, an isolated polynucleotide encoding a polypeptide of any of paragraphs 1-15 is provided.
75. In another aspect, an expression vector comprising the polynucleotide of paragraph 74 is provided. 76. In another aspect, a host cell comprising the expression vector of paragraph 75 is provided.
[007] These and other aspects and embodiments of the compositions and methods will be apparent from the present description and drawings.
BRIEF DESCRIPTION OF THE SEQUENCES
[008] SEQ ID NO: 1 sets forth the amino acid sequence of the mature form of Cytophaga sp. amylase (CspAmy2).
[009] SEQ ID NO: 2 sets forth the amino acid sequence of the mature form of a variant Cytophaga sp. amylase (CspAmy2-vl) having deletions of both Arginine 178 and Glycine 179.
[0010] SEQ ID NO: 3 sets forth the amino acid sequence of the immature/precursor form of the variant form of Cytophaga sp. amylase (CspAmy2-vl) having a signal peptide.
[0011] SEQ ID NO: 4 sets forth the nucleotide sequence of a synthetic DNA fragment
(CspAmy2-vl DNA) encoding CspAmy2-vl amylase (SEQ ID NO: 2). DETAILED DESCRIPTION
[0012] Described are compositions and methods relating to variant amylase enzymes. The variants were discovered by a combination of experimental approaches, as detailed in the appended Examples. The approaches include the use of site evaluation libraries (SELs) and structure-based analysis. Exemplary applications for the variant amylase enzymes are for starch liquefaction and saccharification, for cleaning starchy stains in laundry, dishwashing, and other applications, for textile processing (e.g., desizing), in animal feed for improving digestibility, and and for baking and brewing. These and other aspects of the compositions and methods are described in detail, below.
[0013] Prior to describing the various aspects and embodiments of the present compositions and methods, the following definitions and abbreviations are described.
1. Definitions and Abbreviations
[0014] In accordance with this detailed description, the following abbreviations and definitions apply. Note that the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "an enzyme" includes a plurality of such enzymes, and reference to "the dosage" includes reference to one or more dosages and equivalents thereof known to those skilled in the art, and so forth.
[0015] The present document is organized into a number of sections for ease of reading; however, the reader will appreciate that statements made in one section may apply to other sections. In this manner, the headings used for different sections of the disclosure should not be construed as limiting.
[0016] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. The following terms are provided below.
1.1. Abbreviations and Acronyms
[0017] The following abbreviations/acronyms have the following meanings unless otherwise specified:
ABTS 2,2-azino-bis-3-ethylbenzothiazoline-6-sulfonic acid
AE or AEO alcohol ethoxylate
AES or AEOS alcohol ethoxysulfate
AkAA Aspergillus kawachii a-amylase
AnGA Aspergillus niger glucoamylase
AOS a-olefinsulfonate
AS alkyl sulfate
cDNA complementary DNA
CMC carboxymethylcellulose
DE dextrose equivalent
DNA deoxyribonucleic acid
DPn degree of saccharide polymerization having n subunits ds or DS dry solids
DTMPA diethylenetriaminepentaacetic acid
EC Enzyme Commission
EDTA ethylenediaminetetraacetic acid
EO ethylene oxide (polymer fragment)
EOF End of Fermentation
GA glucoamylase
GAU/g ds glucoamylase activity unit/gram dry solids
HFCS high fructose corn syrup
HgGA Humicola grisea glucoamylase
IPTG isopropyl β-D-thiogalactoside
IRS insoluble residual starch
kDa kiloDalton
LAS linear alkylbenzenesulfonate
LAT, BLA B. licheniformis amylase
MW molecular weight
MWU modified Wohlgemuth unit; 1.6xl0"5 mg/MWU = unit of activity
NCBI National Center for Biotechnology Information NOBS nonanoyloxybenzenesulfonate
NTA nitriloacetic acid
OxAm Purastar HP AM 5000L (Danisco US Inc.)
PAHBAH p-hydroxybenzoic acid hydrazide
PEG polyethyleneglycol
pi isoelectric point
PI performance index
ppm parts per million, e.g., μg protein per gram dry solid
PVA poly(vinyl alcohol)
PVP poly(vinylpyrrolidone)
RCF relative centrifugal/centripetal force (i.e., x gravity)
RNA ribonucleic acid
SAS alkanesulfonate
SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis
SSF simultaneous saccharification and fermentation
SSU/g solid soluble starch unit/gram dry solids
sp. species
TAED tetraacetylethylenediamine
Tm melting temperature
TrGA Trichoderma reesei glucoamylase
w/v weight/volume
w/w weight/weight
v/v volume/volume
wt% weight percent
°C degrees Centigrade
H20 water
dH20 or DI deionized water
dffl20 deionized water, Milli-Q filtration
g or gm grams
μ micrograms
mg milligrams
kg kilograms
μL· and μΐ microliters
mL and ml milliliters
mm millimeters
μιη micrometer
M molar
mM millimolar
μΜ micromolar
U units
sec seconds
min(s) minute/minutes
hr(s) hour/hours
DO dissolved oxygen
Ncm Newton centimeter
ETOH ethanol
eq. equivalents
N normal
uPWA variant a-amylase derived from Pyrococcus woesei
PWA a-amylase from Pyrococcus woesei
MWCO molecular weight cut-off SSRL Stanford Synchrotron Radiation Lightsource
PDB Protein Database
CAZy Carbohydrate-Active Enzymes database
Tris-HCl tris(hydroxymethyl)aminomethane hydrochloride
HEPES 4-(2-hydroxyethyl)-l-piperazineethanesulfonic acid
1.2. Definitions
[0018] The terms "amylase" or "amylolytic enzyme" refer to an enzyme that is, among other things, capable of catalyzing the degradation of starch, a- Amylases are hydrolases that cleave the a-D-(l→4) O-glycosidic linkages in starch. Generally, a-amylases (EC 3.2.1.1; a-D-(l→4)- glucan glucanohydrolase) are defined as endo-acting enzymes cleaving a-D-(l→4) O-glycosidic linkages within the starch molecule in a random fashion yielding polysaccharides containing three or more (l-4)-a-linked D-glucose units. In contrast, the exo-acting amylolytic enzymes, such as β-amylases (EC 3.2.1.2; a-D-(l→4)-glucan maltohydrolase) and some product- specific amylases like maltogenic a-amylase (EC 3.2.1.133) cleave the polysaccharide molecule from the non-reducing end of the substrate, β-amylases, a-glucosidases (EC 3.2.1.20; a-D-glucoside glucohydrolase), glucoamylase (EC 3.2.1.3; a-D-(l→4)-glucan glucohydrolase), and product- specific amylases like the maltotetraosidases (EC 3.2.1.60) and the maltohexaosidases (EC 3.2.1.98) can produce malto-oligosaccharides of a specific length or enriched syrups of specific maltooligosaccharides.
[0019] "Enzyme units" herein refer to the amount of product formed per time under the specified conditions of the assay. For example, a "glucoamylase activity unit" (GAU) is defined as the amount of enzyme that produces 1 g of glucose per hour from soluble starch substrate (4% DS) at 60°C, pH 4.2. A "soluble starch unit" (SSU) is the amount of enzyme that produces 1 mg of glucose per minute from soluble starch substrate (4% DS) at pH 4.5, 50°C. DS refers to "dry solids."
[0020] The term "starch" refers to any material comprised of the complex polysaccharide carbohydrates of plants, comprised of amylose and amylopectin with the formula (C6H10O5)x, wherein X can be any number. The term includes plant-based materials such as grains, cereal, grasses, tubers and roots, and more specifically materials obtained from wheat, barley, corn, rye, rice, sorghum, brans, cassava, millet, milo, potato, sweet potato, and tapioca. The term "starch" includes granular starch. The term "granular starch" refers to raw, i.e., uncooked starch, e.g., starch that has not been subject to gelatinization.
[0021] The terms, "wild-type," "parental," or "reference," with respect to a polypeptide, refer to a naturally-occurring polypeptide that does not include a man-made substitution, insertion, or deletion at one or more amino acid positions. Similarly, the terms "wild-type," "parental," or "reference," with respect to a polynucleotide, refer to a naturally-occurring polynucleotide that does not include a man-made nucleoside change. However, note that a polynucleotide encoding a wild-type, parental, or reference polypeptide is not limited to a naturally-occurring
polynucleotide, and encompasses any polynucleotide encoding the wild- type, parental, or reference polypeptide.
[0022] Reference to the wild-type polypeptide is understood to include the mature form of the polypeptide. A "mature" polypeptide or variant, thereof, is one in which a signal sequence is absent, for example, cleaved from an immature form of the polypeptide during or following expression of the polypeptide.
[0023] The term "variant," with respect to a polypeptide, refers to a polypeptide that differs from a specified wild-type, parental, or reference polypeptide in that it includes one or more naturally-occurring or man-made substitutions, insertions, or deletions of an amino acid.
Similarly, the term "variant," with respect to a polynucleotide, refers to a polynucleotide that differs in nucleotide sequence from a specified wild- type, parental, or reference polynucleotide. The identity of the wild-type, parental, or reference polypeptide or polynucleotide will be apparent from context.
[0024] In the case of the present a-amylases, "activity" refers to a-amylase activity, which can be measured as described, herein. [0025] The term "recombinant," when used in reference to a subject cell, nucleic acid, protein or vector, indicates that the subject has been modified from its native state. Thus, for example, recombinant cells express genes that are not found within the native (non-recombinant) form of the cell, or express native genes at different levels or under different conditions than found in nature. Recombinant nucleic acids differ from a native sequence by one or more nucleotides and/or are operably linked to heterologous sequences, e.g., a heterologous promoter in an expression vector. Recombinant proteins may differ from a native sequence by one or more amino acids and/or are fused with heterologous sequences. A vector comprising a nucleic acid encoding an amylase is a recombinant vector.
[0026] "Combinatorial variants" are variants comprising two or more mutations, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, etc., substitutions, deletions, and/or insertions.
[0027] "Combinable mutations" are mutations at any amino acid position that can be used to make combinatorial variants. Combinable mutations improve at least one desired property of the molecule (in this case, an amylase), while not significantly decreasing either expression, activity, or stability. Combinable mutations can be grouped as follows:
[0028] Group A: A mutation that produces a variant wherein the minimum performance indices (PI) relative to a defined parental protein for: (i) protein expression, (ii) CS-28 microswatch activity at pH 8 (25°C) or pHIO (50°C), or activity in Ceralpha assay, or activity in corn flour or corn starch application assays, and (iii) detergent stability or thermostability at pH 5.0 or pH 5.7 is greater than or equal to 0.9, and in addition have a PI for any one of these tests that is greater than or equal to 1.0.
[0029] Group B: A mutation that produces a variant wherein the minimum performance indices (PI) relative to a defined parental protein for: (i) protein expression, (ii) CS-28 microswatch activity at pH 8 (25°C) or pHIO (50°C), or activity in Ceralpha assay, or activity in corn flour or corn starch application assays, and (iii) detergent stability or thermostability at pH 5.0 or pH 5.7 is greater than or equal to 0.8, and in addition have a PI for any one of these tests that is greater than or equal to 1.2.
[0030] Group C: A mutation that produces a variant wherein the minimum performance indices (PI) relative to a defined parental protein for: (i) protein expression, (ii) CS-28 microswatch activity at pH 8 (25°C) or pHIO (50°C), or activity in Ceralpha assay, or activity in corn flour or corn starch application assays, and (iii) detergent stability or thermostability at pH 5.0 or pH 5.7 is greater than or equal to 0.5, and in addition have a PI for any one of these tests that is greater than or equal to 1.5.
[0031] The properties and profiles of combinable mutations are summarized in the following Table.
Table A. Performance properties and profiles for each group of combinable mutations
Figure imgf000016_0001
[0032] Preferred combinable mutations are at "productive positions," as described, below. In the case of the present amylases, "activity" refers to amylase activity, which can be measured as described, herein.
[0033] "Productive positions" are amino acid positions that are tolerant to substitution with different amino acid residues, wherein the resulting variants meet a set of performance criteria for combinability, as set forth above. Productive positions can be assigned a Productivity Score as follows: Positions where less than 15% of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "1." Positions where less than 30%, but greater than, or equal to 15% of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "2." Positions where less than 50%, but greater than, or equal to 30% of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "3." Positions where 50% or more of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "4." Productivity scores are described in the following Table:
Table B. Performance criteria associated with productivity scores
[0034] Preferred productive positions are combinable mutations.
[0035] Suitability score refers to the ability of one or more combinable mutations to be used to make combinatorial variants, based on the performance criteria for combinability (i.e. , A, B, and C, as set forth, above) in which each of the mutations fall. A higher suitability score indicates a mutation or mutations that are more suitable for use in making combinatorial variants. Suitability scores are described in the following Table:
Table C. Definitions of suitability scores
Figure imgf000017_0001
[0036] The terms "recovered," "isolated," and "separated," refer to a compound, protein
(polypeptides), cell, nucleic acid, amino acid, or other specified material or component that is removed from at least one other material or component with which it is naturally associated as found in nature. An "isolated" polypeptides, thereof, includes, but is not limited to, a culture broth containing secreted polypeptide expressed in a heterologous host cell. [0037] The term "purified" refers to material (e.g. , an isolated polypeptide or polynucleotide) that is in a relatively pure state, e.g., at least about 90% pure, at least about 95% pure, at least about 98% pure, or even at least about 99% pure.
[0038] The term "enriched" refers to material (e.g., an isolated polypeptide or polynucleotide) that is in about 50% pure, at least about 60% pure, at least about 70% pure, or even at least about 70% pure.
[0039] The terms "thermostable" and "thermostability," with reference to an enzyme, refer to the ability of the enzyme to retain activity after exposure to an elevated temperature. The thermostability of an enzyme, such as an amylase enzyme, is measured by its half-life (t^) given in minutes, hours, or days, during which half the enzyme activity is lost under defined conditions. The half-life may be calculated by measuring residual a- amylase activity following exposure to (i.e. , challenge by) an elevated temperature. [0040] A "pH range," with reference to an enzyme, refers to the range of pH values under which the enzyme exhibits catalytic activity.
[0041] The terms "pH stable" and "pH stability," with reference to an enzyme, relate to the ability of the enzyme to retain activity over a wide range of pH values for a predetermined period of time (e.g., 15 min., 30 min., 1 hour).
[0042] The term "amino acid sequence" is synonymous with the terms "polypeptide," "protein," and "peptide," and are used interchangeably. Where such amino acid sequences exhibit activity, they may be referred to as an "enzyme." The conventional one-letter or three-letter codes for amino acid residues are used, with amino acid sequences being presented in the standard amino- to-carboxy terminal orientation (i.e., N→C).
[0043] The term "nucleic acid" encompasses DNA, RNA, heteroduplexes, and synthetic molecules capable of encoding a polypeptide. Nucleic acids may be single stranded or double stranded, and may be chemical modifications. The terms "nucleic acid" and "polynucleotide" are used interchangeably. Because the genetic code is degenerate, more than one codon may be used to encode a particular amino acid, and the present compositions and methods encompass nucleotide sequences that encode a particular amino acid sequence. Unless otherwise indicated, nucleic acid sequences are presented in 5'-to-3' orientation.
[0044] "Hybridization" refers to the process by which one strand of nucleic acid forms a duplex with, i.e., base pairs with, a complementary strand, as occurs during blot hybridization techniques and PCR techniques. Stringent hybridization conditions are exemplified by hybridization under the following conditions: 65°C and 0.1X SSC (where IX SSC = 0.15 M NaCl, 0.015 M Na3 citrate, pH 7.0). Hybridized, duplex nucleic acids are characterized by a melting temperature (Tm), where one-half of the hybridized nucleic acids are unpaired with the complementary strand. Mismatched nucleotides within the duplex lower the Tm. A nucleic acid encoding a variant a-amylase may have a Tm reduced by 1°C - 3°C or more compared to a duplex formed between the nucleotide of SEQ ID NO: 2 and its identical complement.
[0045] A "synthetic" molecule is produced by in vitro chemical or enzymatic synthesis rather than by an organism.
[0046] The terms "transformed," "stably transformed," and "transgenic," used with reference to a cell means that the cell contains a non-native (e.g., heterologous) nucleic acid sequence integrated into its genome or carried as an episome that is maintained through multiple generations. [0047] The term "introduced" in the context of inserting a nucleic acid sequence into a cell, means "transfection", "transformation" or "transduction," as known in the art.
[0048] A "host strain" or "host cell" is an organism into which an expression vector, phage, virus, or other DNA construct, including a polynucleotide encoding a polypeptide of interest (e.g. , an amylase) has been introduced. Exemplary host strains are microorganism cells (e.g. , bacteria, filamentous fungi, and yeast) capable of expressing the polypeptide of interest and/or fermenting saccharides. The term "host cell" includes protoplasts created from cells.
[0049] The term "heterologous" with reference to a polynucleotide or protein refers to a polynucleotide or protein that does not naturally occur in a host cell. [0050] The term "endogenous" with reference to a polynucleotide or protein refers to a polynucleotide or protein that occurs naturally in the host cell.
[0051] The term "expression" refers to the process by which a polypeptide is produced based on a nucleic acid sequence. The process includes both transcription and translation.
[0052] A "selective marker" or "selectable marker" refers to a gene capable of being expressed in a host to facilitate selection of host cells carrying the gene. Examples of selectable markers include but are not limited to antimicrobials (e.g. , hygromycin, bleomycin, or chloramphenicol) and/or genes that confer a metabolic advantage, such as a nutritional advantage on the host cell.
[0053] A "vector" refers to a polynucleotide sequence designed to introduce nucleic acids into one or more cell types. Vectors include cloning vectors, expression vectors, shuttle vectors, plasmids, phage particles, cassettes and the like.
[0054] An "expression vector" refers to a DNA construct comprising a DNA sequence encoding a polypeptide of interest, which coding sequence is operably linked to a suitable control sequence capable of effecting expression of the DNA in a suitable host. Such control sequences may include a promoter to effect transcription, an optional operator sequence to control transcription, a sequence encoding suitable ribosome binding sites on the mRNA, enhancers and sequences which control termination of transcription and translation.
[0055] The term "operably linked" means that specified components are in a relationship (including but not limited to juxtaposition) permitting them to function in an intended manner. For example, a regulatory sequence is operably linked to a coding sequence such that expression of the coding sequence is under control of the regulatory sequences. [0056] A "signal sequence" is a sequence of amino acids attached to the N-terminal portion of a protein, which facilitates the secretion of the protein outside the cell. The mature form of an extracellular protein lacks the signal sequence, which is cleaved off during the secretion process.
[0057] "Biologically active" refer to a sequence having a specified biological activity, such an enzymatic activity.
[0058] The term "specific activity" refers to the number of moles of substrate that can be converted to product by an enzyme or enzyme preparation per unit time under specific conditions. Specific activity is generally expressed as units (U)/mg of protein.
[0059] As used herein, "water hardness" is a measure of the minerals (e.g. , calcium and magnesium) present in water.
[0060] A "swatch" is a piece of material such as a fabric that has a stain applied thereto. The material can be, for example, fabrics made of cotton, polyester or mixtures of natural and synthetic fibers. The swatch can further be paper, such as filter paper or nitrocellulose, or a piece of a hard material such as ceramic, metal, or glass. For amylases, the stain is starch based, but can include blood, milk, ink, grass, tea, wine, spinach, gravy, chocolate, egg, cheese, clay, pigment, oil, or mixtures of these compounds.
[0061] A "smaller swatch" is a section of the swatch that has been cut with a single hole punch device, or has been cut with a custom manufactured 96-hole punch device, where the pattern of the multi-hole punch is matched to standard 96-well microtiter plates, or the section has been otherwise removed from the swatch. The swatch can be of textile, paper, metal, or other suitable material. The smaller swatch can have the stain affixed either before or after it is placed into the well of a 24-, 48- or 96-well microtiter plate. The smaller swatch can also be made by applying a stain to a small piece of material. For example, the smaller swatch can be a stained piece of fabric 5/8" or 0.25" in diameter. The custom manufactured punch is designed in such a manner that it delivers 96 swatches simultaneously to all wells of a 96-well plate. The device allows delivery of more than one swatch per well by simply loading the same 96-well plate multiple times. Multi-hole punch devices can be conceived of to deliver simultaneously swatches to any format plate, including but not limited to 24- well, 48- well, and 96-well plates. In another conceivable method, the soiled test platform can be a bead made of metal, plastic, glass, ceramic, or another suitable material that is coated with the soil substrate. The one or more coated beads are then placed into wells of 96-, 48-, or 24-well plates or larger formats, containing suitable buffer and enzyme. [0062] "A cultured cell material comprising an amylase" or similar language, refers to a cell lysate or supernatant (including media) that includes an amylase as a component. The cell material may be from a heterologous host that is grown in culture for the purpose of producing the amylase. [0063] "Percent sequence identity" means that a particular sequence has at least a certain percentage of amino acid residues identical to those in a specified reference sequence, when aligned using the CLUSTAL W algorithm with default parameters. See Thompson et al. (1994) Nucleic Acids Res. 22:4673-4680. Default parameters for the CLUSTAL W algorithm are:
Gap opening penalty: 10.0
Gap extension penalty: 0.05
Protein weight matrix: BLOSUM series
DNA weight matrix: IUB
Delay divergent sequences %: 40
Gap separation distance: 8
DNA transitions weight: 0.50
List hydrophilic residues: GPSNDQEKR
Use negative matrix: OFF
Toggle Residue specific penalties: ON
Toggle hydrophilic penalties: ON
Toggle end gap separation penalty OFF.
[0064] Deletions are counted as non-identical residues, compared to a reference sequence. Deletions occurring at either termini are included. For example, a variant with five amino acid deletions of the C-terminus of the mature CspAmy2 polypeptide of SEQ ID NO: 1 would have a percent sequence identity of 99% (612 / 617 identical residues x 100, rounded to the nearest whole number) relative to the mature polypeptide. Such a variant would be encompassed by a variant having "at least 99% sequence identity" to a mature amylase polypeptide.
[0065] "Fused" polypeptide sequences are connected, i.e. , operably linked, via a peptide bond between two subject polypeptide sequences.
[0066] The term "filamentous fungi" refers to all filamentous forms of the subdivision
Eumycotina, particulary Pezizomycotina species.
[0067] The term "degree of polymerization" (DP) refers to the number (n) of anhydro- glucopyranose units in a given saccharide. Examples of DPI are the monosaccharides glucose and fructose. Examples of DP2 are the disaccharides maltose and sucrose. The term "DE," or "dextrose equivalent," is defined as the percentage of reducing sugar, i.e., D-glucose, as a fraction of total carbohydrate in a syrup. [0068] The term "dry solids content" (ds) refers to the total solids of a slurry in a dry weight percent basis. The term "slurry" refers to an aqueous mixture containing insoluble solids.
[0069] The phrase "simultaneous saccharification and fermentation (SSF)" refers to a process in the production of biochemicals in which a microbial organism, such as an ethanologenic microorganism, and at least one enzyme, such as an amylase, are present during the same process step. SSF includes the contemporaneous hydrolysis of starch substrates (granular, liquefied, or solubilized) to saccharides, including glucose, and the fermentation of the saccharides into alcohol or other biochemical or biomaterial in the same reactor vessel.
[0070] An "ethanologenic microorganism" refers to a microorganism with the ability to convert a sugar or oligosaccharide to ethanol.
[0071] The term "fermented beverage" refers to any beverage produced by a method comprising a fermentation process, such as a microbial fermentation, e.g., a bacterial and/or fungal fermentation. "Beer" is an example of such a fermented beverage, and the term "beer" is meant to comprise any fermented wort produced by fermentation/brewing of a starch-containing plant material. Often, beer is produced exclusively from malt or adjunct, or any combination of malt and adjunct. Examples of beers include: full malted beer, beer brewed under the
"Reinheitsgebot," ale, India pale ale, lager, pilsner, bitter, Happoshu (second beer), third beer, dry beer, near beer, light beer, low alcohol beer, low calorie beer, porter, bock, dopplebock, stout, porter, malt liquor, non-alcoholic beer, non-alcoholic malt liquor and the like, but also alternative cereal and malt beverages such as fruit flavored malt beverages, e.g., citrus flavored, such as lemon-, orange-, lime-, or berry-flavored malt beverages, liquor flavored malt beverages, e.g., vodka-, rum-, or tequila- flavored malt liquor, or coffee flavored malt beverages, such as caffeine-flavored malt liquor, and the like.
[0072] The term "malt" refers to any malted cereal grain, such as malted barley or wheat. [0073] The term "adjunct" refers to any starch and/or sugar containing plant material that is not malt, such as barley or wheat malt. Examples of adjuncts include common corn grits, refined corn grits, brewer's milled yeast, rice, sorghum, refined corn starch, barley, barley starch, dehusked barley, wheat, wheat starch, torrified cereal, cereal flakes, rye, oats, potato, tapioca, cassava and syrups, such as corn syrup, sugar cane syrup, inverted sugar syrup, barley and/or wheat syrups, and the like.
[0074] The term "mash" refers to an aqueous slurry of any starch and/or sugar containing plant material, such as grist, e.g., comprising crushed barley malt, crushed barley, and/or other adjunct or a combination thereof, mixed with water later to be separated into wort and spent grains. [0075] The term "wort" refers to the unfermented liquor run-off following extracting the grist during mashing.
[0076] "Iodine-positive starch" or "IPS" refers to (1) amylose that is not hydrolyzed after liquefaction and saccharification, or (2) a retrograded starch polymer. When saccharified starch or saccharide liquor is tested with iodine, the high DPn amylose or the retrograded starch polymer binds iodine and produces a characteristic blue color. The saccharide liquor is thus termed "iodine-positive saccharide," "blue saccharide," or "blue sac."
[0077] The terms "retrograded starch" or "starch retro gradation" refer to changes that occur spontaneously in a starch paste or gel on ageing. [0078] The term "about" refers to + 15% to the referenced value.
2. a-Amylase variants
[0079] An aspect of the present compositions and methods is variant amylase enzymes discovered using a combination of experimental approaches, including the use of site evaluation libraries (SELs) and structure-based analysis. 2.1 a-Amylase variants based on an SEL library of Cytophaga sp. a-amylase
[0080] An a-amylase from Cytophaga sp. (herein, CspAmy2 amylase") has been previously described (Jeang,C-L et al. (2002) Applied and Environmental Microbiology, 68:3651-54). The amino acid sequence of the mature CspAmy2 amylase polypeptide is shown, below (SEQ ID NO: 1):
AATNGTMMQY FEWYVPNDGQ QWNRLRTDAP YLSSVGITAV WTPPAYKGTS
QADVGYGPYD LYDLGEFNQK GTVRTKYGTK GELKSAVNTL HSNGIQVYGD
VVMNHKAGAD YTENVTAVEV NPSNRNQETS GEYNIQAWTG FNFPGRGTTY
SNFKWQWFHF DGTDWDQSRS LSRIFKFRGT GKAWDWEVSS ENGNYDYLMY
ADIDYDHPDV VNEMKKWGVW YANEVGLDGY RLDAVKHIKF SFLKDWVDNA
RAATGKEMFT VGEYWQNDLG ALNNYLAKVN YNQSLFDAPL HYNFYAASTG
GGYYDMR IL NNTLVASNPT KAVTLVENHD TQPGQSLEST VQPWFKPLAY
AFILTRSGGY PSVFYGDMYG TKGTTTREIP ALKSKIEPLL KARKDYAYGT
QRDYIDNPDV IGWTREGDST KAKSGLATVI TDGPGGSKRM YVGTSNAGEI
WYDLTGNRTD KITIGSDGYA TFPVNGGSVS VWVQQ
[0081] In SEQ ID NO: 1, Arginine 178 and Glycine 179 are underlined. A variant of the
Cytophaga sp. α-amylase having a deletion of both Arginine 178 and Glycine 179 (herein, CspAmy2-vl) has also been described (Shiau, R-J. et al. (2003) Applied and Environmental Microbiology, 69:2383-85). The amino acid sequence of the mature CspAmy2-vl amylase polypeptide is shown, below, as SEQ ID NO: 2:
AATNGTMMQY FEWYVPNDGQ QWNRLRTDAP YLSSVGITAV WTPPAYKGTS
QADVGYGPYD LYDLGEFNQK GTVRTKYGTK GELKSAVNTL HSNGIQVYGD
VVMNHKAGAD YTENVTAVEV NPSNRNQETS GEYNIQAWTG FNFPGRGTTY
SNFKWQWFHF DGTDWDQSRS LSRIFKFTGK AWDWEVSSEN GNYDYLMYAD
IDYDHPDVVN EMKKWGVWYA NEVGLDGYRL DAVKHIKFSF LKDWVDNARA
ATGKEMFTVG EYWQNDLGAL NNYLAKVNYN QSLFDAPLHY NFYAASTGGG
YYDMR ILNN TLVASNPTKA VTLVENHDTQ PGQSLESTVQ PWFKPLAYAF
ILTRSGGYPS VFYGDMYGTK GTTTREIPAL KSKIEPLLKA RKDYAYGTQR
DYIDNPDVIG WTREGDSTKA KSGLATVITD GPGGSKRMYV GTSNAGEIWY
DLTGNRTDKI TIGSDGYATF PVNGGSVSVW VQQ
[0082] a-amylase variants that include combinable mutations were identified by making a site evaluation library (SEL) based on CspAmy2-vl and testing the resulting variants for corn flour and corn starch hydrolysis, thermostability assay, cleaning performance, detergent stability, activity in a standardized amylases assay, and expression levels, the detailed procedures for which are described in the Examples or otherwise known. Each variant was assayed for the different enzymatic and biochemical properties, and characterized by a performance index (PI) value, which compared the relative performance of the variant to CspAmy2-vl amylase for each performance criteria. A PI that is greater than 1 (i.e., PI>1) indicated improved performance by a variant as compared to CspAmy2-vl, while a PI of 1 (i.e., PI=1) indicated a variant that performed the same as the CspAmy2-vl, and a PI that is less than 1 (i.e., PI<1) idicated a variant that performed worse than the CspAmy2-vl. PI values were then used to identify combinable mutations and productive positions.
[0083] Combinable mutations are mutations at any amino acid position that improve at least one desired property of the molecule, while not significantly decreasing expression, activity, or stability. Combinable mutations are assigned to one of three Groups (i.e., A, B, or C), as set forth, herein. Preferred combinable mutations are at productive positions. Productive positions are amino acid positions that are tolerant to substitution with different amino acid residues, wherein the resulting variants meet a set of performance criteria for combinability, as set forth herein.
[0084] Combinable mutations and productive positions are not to be confused with previously- identified, single-site mutations, some of which have subsequently been found by trial and error to work in combination with other mutations. Previously- identified, single- site mutations are invariably "winners" with respect to improving any one performance or stability feature. While this makes them attractive mutations to include in varient amylases, these "winners" tend to adversly affect other performance or stability features of the variants, which often requires making additional mutations to correct the defects.
[0085] In contrast, combinable mutations may be only incrementally beneficial in improving any one performance or stability feature of an variant amylase. However, they are carefully selected to be minimally detrimental to other desired performance or stability features, making them well suited for use in combination with other combinable mutations to contract variant amylases having desired improved enzymatic and biochemical properties without being crippled in others, resulting in robust variants having a good balance of performance, stability, and expression potential.
[0086] Further based on measured enzymatic and biochemical properties of the variant amylases, the suitability scores of the different mutations for making combinatorial variants were determined. The suitabilty score refers to the ability of one or more combinable mutations to be used to make combinatorial variants, based on the performance criteria for combinability (i.e., A, B, and C, as set forth, above), in which each of the mutations fall.
[0087] The suitability scores of individual substitutions in CspAmy2-vl are shown in Table D. The position numbering is based on the amino acid sequence of the mature CspAmy2 polypeptide (SEQ ID NO: 1). Wild-type residues at the indicated postitions are given a suitability score of +++. Substitutions more likely to be combinable with other mutations are given a suitability score of ++++, or even +++++. In general, preferred suitabilty scores are +++, ++++, or +++++, ++++ or +++++, or even +++++.
Figure imgf000025_0001
Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+) (++) (+++)* (++++) (+++++)
MNPQRSTVY
MI
MF
F Y
VN ILS CT
QE
QLW T
DF NSWY AEHKMQTV
RK
TDEFGHIKL MNQSWY R
DAEN
PHT ACFLRWY DEGKNS
M YEKR FHW
SDEGHNQR K
VHIMN
TS DN
AS
VI
TACILMV
APS
YFMT
A G
M CGHY TS ADEFIKLNV
SEK D
QS
AFGHIKNQS TW
RS G VLQ C D IN AET Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+) (++) (+++)* (++++) (+++++)
K G
P C
NACEFMSY
NW R K
GAN
H TGS
VT
C T
GIPTV ADFHKLMNSY EQRW
EQ
LF
KIQV
SACDEHKM NQR L
I V
NADEQRT H
TCDEHMNQ RSV
L SAMRV
DT NM
GN
I Q
VI
W YF
VI
MV I
D N
A IV K
G A Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE OS (+) (++) (+++)* (++++) (+++++)
108 KR GAS
109 AP
ACDGHKLNQRST
111 M YW V F
112 TFGIVW ACDELMPQRY
113 Y ED
114 NG
115 A V IM
ACDEGHIKLMNS
116 T VW
117 C AS
118 Q LM VACFIKNS R
119 s E
120 V C
121 S NKR
122 T P AKQR
123 S ACEGHKNQTY R
124 ND
126 Y N
127 CY QAM HIKRTV E
128 ES GKVY I
129 AFG TQY HIKLRSV
130 AIRV ST GH
131 FM GT AHIKNW PQ
132 ENS ACGHILMRTVY PQ
133 FN YE ADHLTV K
134 NCFY DGHMPQST
135 HR M IV Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE OS (+) (++) (+++)* (++++) (+++++)
136 W QY AFGHIK NT
137 V A
138 PR GV W AFKLMQSTY DH
GCEFHILTV
140 M D Y S KN
141 H F W
142 CV NEY FGHIKLQRW ADMST
144 DQ F PCHM AGKLNRY IT
145 LWY IMV GEQT AHKNRS
147 GCLV EHKNQR I
TAGHIKLSW
148 Y
TACDEHIKM
149 NRSWY L
150 DPQ GM Y FHW I
151 SD
152 F NW ACEGHLMRSTV DQ
153 F H WY
154 KAEHNRST F
156 FGILMV QDSTY H K
157 N W
158 P FADEIRY LNSV CGHTW
160 C F
CMNQ
163 F V T DLS
164 F DN
165 P H WF
166 ACGKM D Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE OS (+) (++) (+++)* (++++) (+++++)
167 Q ACDGHKNRSTVY
168 C SRW DEGIKMNTV L
169 EQW RDMT CHKLY A
170 S CGHNRT
171 L FGIMRVWY HKNQS
SACDEHKNR
172 T
173 RK W
174 L I
175 AD S FLMV HWY
176 L K
177 G FH
182 H K
183 AE K R
187 E V P
189 A SC D
190 S P
191 EACLMNT I
192 S M NR FHY
193 GACFIKST HRV
195 D Y
198 CG L A
200 EL Y
201 L A
203 HNQ A I CV FLMY
206 I CY DM AQ
207 AKR HF DEMSY N
PAEHKLNQR
208 ST D Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE OS (+) (++) (+++)* (++++) (+++++)
209 CIK D G
210 s V
211 FS V CEIMNT DLQ
212 NY ACDEHILMV GQRST
215 LY KRT EFMNQ
216 KR
219 VEL I
222 T A
225 VL
226 C GKQ E
227 LY
232 L R V
235 LT VA C
238 M I LQR P
239 M Q K C
240 D F
ACDEGHIKL
241 T SFR P NQVWY
242 E Y FV I
243 LAST IM
244 Y KT ACHMNQRS
245 DE
246 WF
248 A DQ N
249 NKR ACDEFGMST QW
250 AS
ADKLMN
251 QST R
252 ACDFHMR
253 ACDELMNQ RV Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE OS (+) (++) (+++)* (++++) (+++++)
ST
254 F TILM
256 KR
257 ACGRVY FHK E LQS
258 MCI FLY
259 P F
260 Y T S AL
262 G A
266 EK HLN Q CFGMRW ADIST
267 ND
269 A V LI
270 CIQV G ADFHKPRSWY
271 ACS
273 NDEILMQS HK
275 YF
276 LM
277 D ACNW FHILMQTY EK
280 NCY ADGHKLQT E
281 G YA D
283 QT HV
284 EF SHY KMRW
285 LA
286 L F M
288 A V
295 YLQ H
FIMQS
296 T ADHKR E
299 TEI R
300 Q GAKL R Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE OS (+) (++) (+++)* (++++) (+++++)
301 GT AFHKMQRSY
302 S G
303 F Y IW ARTV
307 RQS
308 NV ADGLQTY CEFHMRS
310 LDET
311 E NDHKQSV
312 NDG
313 AS T
316 AKQS
317 W A SDGLT CEMQY HK
318 NFILVW ACDEKMQRSY H
320 PV M TCGKY AHNQRW DE
321 KHR
325 LFIMV
327 ED
335 G Q
336 SAD
339 Q S
342 QEL
343 AMW P
348 LCGS Q
349 W AS G
SACDELMN
357 Y V Q
358 GDEQS
360 CEHV YI F L
362 EQT S AC IV
363 VL I Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE OS (+) (++) (+++)* (++++) (+++++)
368 MLWY
372 KADHMNR
374 TAKNPQS
375 TS
376 H TAGNQSY K
377 ILMV C R H ADGKSTY
378 E Q
384 D SEGN HP
385 KAE
388 L PCDKRS I
390 LC I
391 KFTVY EL
392 AG
394 E KHM
395 IKS DC EFMQRWY
396 YCFK
397 AS
400 T ACDEMNQRSWY HKLV
401 QM
402 RFKLSTVWY Q
403 DS
404 YW
405 IL
NACDEGHQ
407 S
408 S Y PEHMQR KVW
409 N D
410 E VIKLMRSY
414 TAS Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE OS (+) (++) (+++)* (++++) (+++++)
416 MT E CFHKLNRSV DGQ
DACEFGHIK LMNQRSTW
418 Y
SAEGKPQRT
419 VY
ACDEGHPQRSVW
420 TFI Y L
KACFGHILR
421 SWY N
EIKLMNPQRSTV
422 A WY CD
423 P KV ACEFGMNQWY DS
424 SA
426 LC
427 A C GS
429 VC LM
430 C IL EM
431 D TA
433 HS A GN
434 M PNR DQS
435 I GACEQRSTY LNV
SADEFHKLQ
437 Y
YCKLNQRS
441 W
442 L VAIT
TAEFHIKLM
444 NPQVY Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE OS (+) (++) (+++)* (++++) (+++++)
SACDHMRT
445 VW
447 AGKQRSTV
448 GEL AFHKNQTY DW
449 EQ
450 IDLP ACFHKQRTV N
452 YAILMSVW
454 LAEFHKS CIMQTVY
455 TIV ACLMS
ACDEFHKLMNRS
456 G TWY
458 RDEFSW ACIN MY
TACDFGLSV
459 W
460 DEHN
KADGILMNP
461 SY
462 IV
TCEFIKLMN
463 VY
464 IV
465 GAMNPQ
466 SCFN ADEHILMRVWY KT
467 DN
469 YCFISV L
470 AG
TADEFGHIN
471 K PQW
474 VC Table D: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
POS (+) (++) (+++)* (++++) (+++++)
475 NFIP ADGHKLMSTV
ACHKNPQRS
476 DE G TVY
ADEHIKQRST
477 P G VY
479 VCHW
480 SG
481 VACIL
482 WY
483 VI
484 AHK Q
ADEHIKLMNPTV
485 QFR Y
The first listed amino acid residue is the wild-type residue.
[0088] While evaluating mutations based on suitabilility score represents one refined aspect of the present compositions and methods, the identification of productive positions, which are tolerant to substitution with different amino acid residues, represents a number of significant embodiments.
[0089] Each productive position identified in the following lists with specified criteria, and each substitution identified in parenthesis following the numerical position identifier in each of these lists, represents a mutation, identified by experimental data, that either directly contributes to the performance of an amylase variant, or is determined to be combinable with other mutations to produce a amylase variant with improved performance.
[0090] The productive positions in CspAmy2-vl that fall within the previously described Productivity Scores of "1," "2," "3," and "4," and the substitutions within those positions that are combinable, are listed below. The position numbering is based on mature CspAmy2 polypeptide (SEQ ID NO: 1).
LIST A:
1(A,E,G,I,K,N,Q,R,T,V,Y); 2(A,E,G,H,K,N,P,Q,R,S,Y); 3(T,A,D,F,G,M,P,Q,R,S); 4(N,Q,T); 5(G,A,C,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,Y); 7(M,I); 8(M,F); 11(F,Y); 15(V,C,I,L,N,S,T); 20(Q,E); 21(Q,L,T,W); 23(N,A,D,E,F,H,K,M,Q,S,T,V,W,Y); 26(R,K);
27(T,D,E,F,G,H,I,K,L,M,N,Q,R,S,W,Y); 28(D,A,E,N);
30(P,A,C,D,E,F,G,H,K,L,N,R,S,T,W,Y); 31(Y,E,F,H,K,M,R,W); 33(S,D,E,G,H,K,N,Q,R); 35(V,H,I,M,N); 38(T,D,N,S); 39(A,S); 40(V,I); 42(T,A,C,I,L,M,V); 45(A,P,S); 46(Y,F,M,T); 48(G,A); 49(T,A,C,D,E,F,G,H,I,K,L,M,N,S,V,Y); 50(S,D,E,K); 51(Q,S);
52(A,F,G,H,I,K,N,Q,S,T,W); 54(V,A,C,D,E,G,I,L,N,Q,R,S,T); 57(G,K); 58(P,C);
68(N,A,C,E,F,M,S,Y); 70(K,N,R,W); 71(G,A,N); 72(T,G,H,S); 73(V,T); 75(T,C);
81(G,A,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 82(E,Q); 83(L,F); 84(K,I,Q,V);
85(S,A,C,D,E,H,K,L,M,N,Q,R); 87(V,I); 88(N,A,D,E,H,Q,R,T); 89(T,C,D,E,H,M,N,Q,R,S,V); 92(S,A,L,M,R,V); 93(N,D,M,T); 94(G,N); 96(Q,I); 97(V,I); 98(Y,F,W); 101(V,I); 103(M,I,V); 104(N,D); 106(K,A,I,V); 107(A,G); 108(G,A,K,R,S); 109(A,P);
111(Y,A,C,D,F,G,H,K,L,M,N,Q,R,S,T,V,W); 112(T,A,C,D,E,F,G,I,L,M,P,Q,R,V,W,Y);
113(E,D,Y); 114(N,G); 115(V,Ai,M); 116(T,A,C,D,E,G,H,I,K,L,M,N,S,V,W); 117(A,C,S);
118(V,A,C,F,I,K,L,M,N,Q,R,S); 119(E,S); 120(V,C); 121(N,K,R,S); 122(P,A,K,Q,R,T);
123(S,A,C,E,G,H,K,N,Q,R,T,Y); 124(N,D); 126(N,Y); 127(Q,A,C,E,H,I,K,M,R,T,V,Y);
128(E,G,I,K,S,V,Y); 129(T,A,F,G,H,I,K,L,Q,R,S,V,Y); 130(S,A,G,H,I,R,T,V);
131(G,A,F,H,I,K,M,N,P,Q,T,W); 132(E,A,C,G,H,I,L,M,N,P,Q,R,S,T,V,Y);
133(Y,A,D,E,F,H,K,L,N,T,V); 134(N,C,D,F,G,H,M,P,Q,S,T,Y); 135(I,H,M,R,V);
136(Q,A,F,G,H,I,K,N,T,W,Y); 137(A,V); 138(W,A,D,F,G,H,K,L,M,P,Q,R,S,T,V,Y);
140(G,C,D,E,F,H,I,K,L,M,N,S,T,V,Y); 141(F,H,W);
142(N,A,C,D,E,F,G,H,I,K,L,M,Q,R,S,T,V,W,Y); 144(P,A,C,D,F,G,H,I,K,L,M,N,Q,R,T,Y);
145(G,A,E,H,I,K,L,M,N,Q,R,S,T,V,W,Y); 147(G,C,E,H,I,K,L,N,Q,R,V);
148(T,A,G,H,I,K,L,S,W,Y); 149(T,A,C,D,E,H,I,K,L,M,N,R,S,W,Y);
150(Y,D,F,G,H,I,M,P,Q,W); 151(S,D); 152(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,W);
153(F,H,W,Y); 154(K,A,E,F,H,N,R,S,T); 156(Q,D,F,G,H,I,K,L,M,S,T,V,Y); 157(W,N);
158(F,A,C,D,E,G,H,I,L,N,P,R,S,T,V,W,Y); 160(F,C); 163(T,C,D,F,L,M,N,Q,S,V); 164(D,F,N);
165(W,F,H,P); 166(D,A,C,G,K,M); 167(Q,A,C,D,G,H,K,N,R,S,T,V,Y);
168(S,C,D,E,G,I,K,L,M,N,R,T,V,W); 169(R,A,C,D,E,H,K,L,M,Q,T,W,Y);
170(S,C,G,H,N,R,T); 171(L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T);
173(R,K,W); 174(I,L); 175(F,A,D,H,L,M,S,V,W,Y); 176(K,L); 177(F,G,H); 182(K,H);
183(A,E,K,R); 187(E,P,V); 189(S,A,C,D); 190(S,P); 191(E,A,C,I,L,M,N,T);
192(N,F,H,M,R,S,Y); 193(G,A,C,F,H,I,K,R,S,T,V); 195(Y,D); 198(L,A,C,G); 200(Y,E,L);
201(A,L); 203(I,A,C,F,H,L,M,N,Q,V,Y); 206(D,A,C,I,M,Q,Y); 207(H,A,D,E,F,K,M,N,R,S,Y);
208(P,A,D,E,H,K,L,N,Q,R,S,T); 209(D,C,G,I,K); 210(V,S); 211(V,C,D,E,F,I,L,M,N,Q,S,T); 212(N,A,C,D,E,G,H,I,L,M,Q,R,ST,V,Y); 215(K,E,F,L,M,N,Q,R,T,Y); 216(K,R); 219(V,E,I,L);
222(A,T); 225(V,L); 226(G,C,E,K,Q); 227(L,Y); 232(L,R,V); 235(V,A,C,L,T);
238(I,L,M,P,Q,R); 239(K,C,M,Q); 240(F,D); 241(S,A,C,D,E,F,G,H,I,K,L,N,P,Q,R,T,V,W,Y);
242(F,E,I,V,Y); 243(L,A,I,M,S,T); 244(K,A,C,H,M,N,Q,R,S,T,Y); 245(D,E); 246(W,F);
248(D,A,N,Q); 249(N,A,C,D,E,F,G,K,M,Q,R,S,T,W); 250(A,S); 251(R,A,D,K,L,M,N,Q,S,T);
252(A,C,D,F,H,M,R); 253(A,C,D,E,L,M,N,Q,R,S,T,V); 254(T,F,I,L,M); 256(K,R);
257(E,A,C,F,G,H,K,L,Q,R,S,V,Y); 258(M,C,F,I,L,Y); 259(F,P); 260(T,A,L,S,Y); 262(G,A);
266(Q,A,C,D,E,F,G,H,I,K,L,M,N,R,S,T,W); 267(N,D); 269(L,AJ,V);
270(G,A,C,D,F,H,I,K,P,Q,R,S,V,W,Y); 271(A,C,S); 273(N,D,E,H,I,K,L,M,Q,S); 275(Y,F); 276(L,M); 277(A,C,D,E,F,H,I,K,L,M,N,Q,T,W,Y); 280(N,A,C,D,E,G,H,K,L,Q,T,Y);
281(Y,A,D,G); 283(Q,H,T,V); 284(S,E,F,H,K,M,R,W,Y); 285(L,A); 286(F,L,M); 288(A,V);
295(Y,H,L,Q); 296(A,D,E,F,H,I,K,M,Q,R,S,T); 299(T,E,I,R); 300(G,A,K,L,Q,R);
301(G,A,F,H,K,M,Q,R,S,T,Y); 302(G,S); 303(Y,A,F,I,R,T,V,W); 307(R,Q,S);
308(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,Y); 310(L,D,E,T); 311(N,D,E,H,K,Q,S,V); 312(N,D,G); 313(T,A,S); 316(A,K,Q,S); 317(S,A,C,D,E,G,H,K,L,M,Q,T,W,Y);
318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y); 320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y);
321(K,H,R); 325(L,F,I,M,V); 327(E,D); 335(Q,G); 336(S,A,D); 339(S,Q); 342(Q,E,L);
343(P,A,M,W); 348(L,C,G,Q,S); 349(A,G,S,W); 357(S,A,C,D,E,L,M,N,Q,V,Y);
358(G,D,E,Q,S); 360(Y,C,E,F,H,I,L,V); 362(S,A,C,E,I,Q,T,V); 363(V,I,L); 368(M,L,W,Y); 372(K,A,D,H,M,N,R); 374(T,A,K,N,P,Q,S); 375(T,S); 376(T,A,G,H,K,N,Q,S,Y);
377(R,A,C,D,G,H,I,K,L,M,S,T,V,Y); 378(E,Q); 384(S,D,E,G,H,N,P); 385(K,A,E);
388(P,C,D,I,K,L,R,S); 390(L,C,I); 391(K,E,F,L,T,V,Y); 392(A,G); 394(K,E,H,M);
395(D,C,E,F,I,K,M,Q,R,S,W,Y); 396(Y,C,F,K); 397(A,S);
400(T,A,C,D,E,H,K,L,M,N,Q,R,S,V,W,Y); 401(Q,M); 402(R,F,K,L,Q,S,T,V,W,Y); 403(D,S); 404(Y,W); 405(I,L); 407(N,A,C,D,E,G,H,Q,S); 408(P,E,H,K,M,Q,R,S,V,W,Y); 409(D,N);
410(V,E,I,K,L,M,R,S,Y); 414(T,A,S); 416(E,C,D,F,G,H,K,L,M,N,Q,R,S,T,V);
418(D,A,C,E,F,G,H,I,K,L,M,N,Q,R,S,T,W,Y); 419(S,A,E,G,K,P,Q,R,T,V,Y);
420(T,A,C,D,E,F,G,H,I,L,P,Q,R,S,V,W,Y); 421(K,A,C,F,G,H,I,L,N,R,S,W,Y);
422(A,C,D,E,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 423(K,A,C,D,E,F,G,M,N,P,Q,S,V,W,Y);
424(S,A); 426(L,C); 427(A,C,G,S); 429(V,C,L,M); 430(I,C,E,L,M); 431(T,A,D);
433(G,A,H,N,S); 434(P,D,M,N,Q,R,S); 435(G,A,C,E,I,L,N,Q,R,S,T,V,Y);
437(S,A,D,E,F,H,K,L,Q,Y); 441(Y,C,K,L,N,Q,R,S,W); 442(V,A,I,L,T);
444(T,A,E,F,H,I,K,L,M,N,P,Q,V,Y); 445(S,A,C,D,H,M,R,T,V,W); 447(A,G,K,Q,R,S,T,V);
448(G,A,D,E,F,H,K,L,N,Q,T,W,Y); 449(E,Q); 450(I,A,C,D,F,H,K,L,N,P,Q,R,T,V); 452(Y,A,I,L,M,S,V,W); 454(L,A,C,E,F,H,I,K,M,Q,S,T,V,Y); 455(T,A,C,I,L,M,S,V);
456(G,A,C,D,E,F,H,K,L,M,N,R,S,T,W,Y); 458(R,A,C,D,E,F,I,M,N,S,W,Y);
459(T,A,C,D,F,G,L,S,V,W); 460(DE,H,N); 461(K,A,D,G,I,L,M,N,P,S,Y); 462(1, V);
463(T,C,E,F,I,K,L,M,N,V,Y); 464(I,V); 465(G,A,M,N,P,Q);
466(S,A,C,D,E,F,H,I,K,L,M,N,R,T,V,W,Y); 467(D,N); 469(Y,C,F,I,L,S,V); 470(A,G);
471(T,A,D,E,F,G,H,I,K,N,P,Q,W); 474(V,C); 475(N,A,D,F,G,H,I,K,L,M,P,S,T,V);
476(G,A,C,D,E,H,K,N,P,Q,R,S,T,V,Y); 477(G,A,D,E,H,I,K,P,Q,R,S,T,V,Y); 479(V,C,H,W); 480(S,G); 481(VA,C,I,L); 482(W,Y); 483(V,I); 484(Q,A,H,K); and
485(Q,A,D,E,F,H,I,K,L,M,N,P,R,T,V,Y)
[0091] The productive positions in CspAmy2-vl that fall within the previously described Productivity Scores of "2," "3," and "4," and the substitutions within those positions that are combinable, are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1.
LIST B:
[0092] 1(A,E,G,I,K,N,Q,R,T,V,Y); 2(A,E,G,H,K,N,P,Q,R,S,Y); 3(T,A,D,F,G,M,P,Q,R,S);
5(G,A,C,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,Y); 15(V,C,I,L,N,S,T); 21(Q,L,T,W);
23(N,A,D,E,F,H,K,M,Q,S,T,V,W,Y); 27(T,D,E,F,G,H,I,K,L,M,N,Q,R,S,W,Y); 28(D,A,E,N);
30(P,A,C,D,E,F,G,H,K,L,N,R,S,T,W,Y); 31(Y,E,F,H,K,M,R,W); 33(S,D,E,G,H,K,N,Q,R);
35(V,H,I,M,N); 38(T,D,N,S); 42(T,A,C,I,L,M,V); 46(Y,F,M,T);
49(T,A,C,D,E,F,G,H,I,K,L,M,N,S,V,Y); 50(S,D,E,K); 52(A,F,G,H,I,K,N,Q,S,T,W);
54(V,A,C,D,E,G,I,L,N,Q,R,S,T); 68(N,A,C,E,F,M,S,Y); 70(K,N,R,W); 72(T,G,H,S);
81(G,A,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 84(K,I,Q,V); 85(S,A,C,D,E,H,K,L,M,N,Q,R);
88(N,A,D,E,H,Q,R,T); 89(T,C,D,E,H,M,N,Q,R,S,V); 92(S,A,L,M,R,V); 93(N,D,M,T);
106(K,A,I,V); 108(G,A,K,R,S); 111(Y,A,C,D,F,G,H,K,L,M,N,Q,R,S,T,V,W);
112(T,A,C,D,E,F,G,I,L,M,P,Q,R,V,W,Y); 115(V,A,I,M);
116(T,A,C,D,E,G,H,I,K,L,M,N,S,V,W); 118(V,A,C,F,I,K,L,M,N,Q,R,S); 121(N,K,R,S);
122(P,A,K,Q,R,T); 123(S,A,C,E,G,H,K,N,Q,R,T,Y); 127(Q,A,C,E,H,I,K,M,R,T,V,Y);
128(E,G,I,K,S,V,Y); 129(T,A,F,G,H,I,K,L,Q,R,S,V,Y); 130(S,A,G,H,I,R,T,V);
131(G,A,F,H,I,K,M,N,P,Q,T,W); 132(E,A,C,G,H,I,L,M,N,P,Q,R,S,T,V,Y);
133(Y,A,D,E,F,H,K,L,N,T,V); 134(N,C,D,F,G,H,M,P,Q,S,T,Y); 135(I,H,M,R,V);
136(Q,A,F,G,H,I,K,N,T,W,Y); 138(W,A,D,F,G,H,K,L,M,P,Q,R,S,T,V,Y);
140(G,C,D,E,F,H,I,K,L,M,N,S,T,V,Y); 142(N,A,C,D,E,F,G,H,I,K,L,M,Q,R,S,T,V,W,Y);
144(P,A,C,D,F,G,H,I,K,L,M,N,Q,R,T,Y); 145(G,A,E,H,I,K,L,M,N,Q,R,S,T,V,W,Y);
147(G,C,E,H,I,K,L,N,Q,R,V); 148(T,A,G,H,I,K,L,S,W,Y); 149(T,A,C,D,E,H,I,K,L,M,N,R,S,W,Y); 150(Y,D,F,G,H,I,M,P,Q,W);
152(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,W); 153(F,H,W,Y); 154(K,A,E,F,H,N,R,S,T);
156(Q,D,F,G,H,I,K,L,M,S,T,V,Y); 158(F,A,C,D,E,G,H,I,L,N,P,R,S,T,V,W,Y);
163(T,C,D,F,L,M,N,Q,S,V); 165(W,F,H,P); 166(D,A,C,G,K,M);
167(Q,A,C,D,G,H,K,N,R,S,T,V,Y); 168(S,C,D,E,G,I,K,L,M,N,R,T,V,W);
169(R,A,C,D,E,H,K,L,M,Q,T,W,Y); 170(S,C,G,H,N,R,T);
171(L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T);
175(F,A,D,H,L,M,S,V,W,Y); 183(A,E,K,R); 189(S,A,C,D); 191(E,A,C,I,L,M,N,T);
192(N,F,H,M,R,S,Y); 193(G,A,C,F,H,I,K,R,S,T,V); 198(L,A,C,G);
203(I,A,C,F,H,L,M,N,Q,V,Y); 206(D,A,C,I,M,Q,Y); 207(H,A,D,E,F,K,M,N,R,S,Y);
208(P,A,D,E,H,K,L,N,Q,R,S,T); 209(D,C,G,I,K); 211(V,C,D,E,F,I,L,M,N,Q,S,T);
212(N,A,C,D,E,G,H,I,L,M,Q,R,ST,V,Y); 215(K,E,F,L,M,N,Q,R,T,Y); 219(V,E,I,L);
226(G,C,E,K,Q); 235(V,A,C,L,T); 238(I,L,M,P,Q,R); 239(K,C,M,Q);
241(S,A,C,D,E,F,G,H,I,K,L,N,P,Q,R,T,V,W,Y); 242(F,E,I,V,Y); 243(L,A,I,M,S,T);
244(K,A,C,H,M,N,Q,R,S,T,Y); 248(D,A,N,Q); 249(N,A,C,D,E,F,G,K,M,Q,R,S,T,W);
251(R,A,D,K,L,M,N,Q,S,T); 252(A,C,D,F,H,M,R); 253(A,C,D,E,L,M,N,Q,R,S,T,V);
254(T,F,I,L,M); 257(E,A,C,F,G,H,K,L,Q,R,S,V,Y); 258(M,C,F,I,L,Y); 260(T,A,L,S,Y);
266(Q,A,C,D,E,F,G,H,I,K,L,M,N,R,S,T,W); 269(L,A,I,V);
270(G,A,C,D,F,H,I,K,P,Q,R,S,V,W,Y); 273(N,D,E,H,I,K,L,M,Q,S);
277(A,C,D,E,F,H,I,K,L,M,N,Q,T,W,Y); 280(N,A,C,D,E,G,H,K,L,Q,T,Y); 281(Y,A,D,G);
283(Q,H,T,V); 284(S,E,F,H,K,M,R,W,Y); 295(Y,H,L,Q); 296(A,D,E,F,H,I,K,M,Q,R,S,T);
299(T,E,I,R); 300(G,A,K,L,Q,R); 301(G,A,F,H,K,M,Q,R,S,T,Y); 303(Y,A,F,I,R,T,V,W);
308(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,Y); 310(L,D,E,T); 311(N,D,E,H,K,Q,S,V);
316(A,K,Q,S); 317(S,A,C,D,E,G,H,K,L,M,Q,T,W,Y);
318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y); 320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y);
321(K,H,R); 325(L,F,I,M,V); 343(P,A,M,W); 348(L,C,G,Q,S); 349(A,G,S,W);
357(S,A,C,D,E,L,M,N,Q,V,Y); 358(G,D,E,Q,S); 360(Y,C,E,F,H,I,L,V); 362(S,A,C,E,I,Q,T,V);
368(M,L,W,Y); 372(K,A,D,H,M,N,R); 374(T,A,K,N,P,Q,S); 376(T,A,G,H,K,N,Q,S,Y);
377(R,A,C,D,G,H,I,K,L,M,S,T,V,Y); 384(S,D,E,G,H,N,P); 385(K,A,E); 388(P,C,D,I,K,L,R,S); 391(K,E,F,L,T,V,Y); 394(K,E,H,M); 395(D,C,E,F,I,K,M,Q,R,S,W,Y); 396(Y,C,F,K);
400(T,A,C,D,E,H,K,L,M,N,Q,R,S,V,W,Y); 402(R,F,K,L,Q,S,T,V,W,Y);
407(N,A,C,D,E,G,H,Q,S); 408(P,E,H,K,M,Q,R,S,V,W,Y); 410(V,E,I,K,L,M,R,S,Y);
416(E,C,D,F,G,H,K,L,M,N,Q,R,S,T,V); 418(D,A,C,E,F,G,H,I,K,L,M,N,Q,R,S,T,W,Y);
419(S,A,E,G,K,P,Q,R,T,V,Y); 420(T,A,C,D,E,F,G,H,I,L,P,Q,R,S,V,W,Y); 421(K,A,C,F,G,H,I,L,N,R,S,W,Y); 422(A,C,D,E,I,K,L,M,N,P,Q,R,S,T,V,W,Y);
423(K,A,C,D,E,F,G,M,N,P,Q,S,V,W,Y); 427(A,C,G,S); 429(V,C,L,M); 430(I,C,E,L,M);
433(G,A,H,N,S); 434(P,D,M,N,Q,R,S); 435(G,A,C,E,I,L,N,Q,R,S,T,V,Y);
437(S,A,D,E,F,H,K,L,Q,Y); 441(Y,C,K,L,N,Q,R,S,W); 442(V,A,I,L,T);
444(T,A,E,F,H,I,K,L,M,N,P,Q,V,Y); 445(S,A,C,D,H,M,R,T,V,W); 447(A,G,K,Q,R,S,T,V);
448(G,A,D,E,F,H,K,L,N,Q,T,W,Y); 450(I,A,C,D,F,H,K,L,N,P,Q,R,T,V);
452(Y,A,I,L,M,S,V,W); 454(L,A,C,E,F,H,I,K,M,Q,S,T,V,Y); 455(T,A,C,I,L,M,S,V);
456(G,A,C,D,E,F,H,K,L,M,N,R,S,T,W,Y); 458(R,A,C,D,E,F,I,M,N,S,W,Y);
459(T,A,C,D,F,G,L,S,V,W); 460(DE,H,N); 461 (K,A,D,G,I,L,M,N,P,S,Y);
463(T,C,E,F,I,K,L,M,N,V,Y); 465(G,A,M,N,P,Q); 466(S,A,C,D,E,F,H,I,K,L,M,N,R,T,V,W,Y);
469(Y,C,F,I,L,S,V); 471(T,A,D,E,F,G,H,I,K,N,P,Q,W); 475(N,A,D,F,G,H,I,K,L,M,P,S,T,V);
476(G,A,C,D,E,H,K,N,P,Q,R,S,T,V,Y); 477(G,A,D,E,H,I,K,P,Q,R,S,T,V,Y); 479(V,C,H,W);
481(VA,C,I,L); 484(Q,A,H,K); and 485(Q,A,D,E,F,H,I,K,L,M,N,P,R,T,V,Y)
[0093] The productive positions in CspAmy2-vl that fall within the previously described Productivity Scores of "3" and "4," and the substitutions within those positions that are combinable, are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1.
LIST C:
1(A,E,G,I,K,N,Q,R,T,V,Y); 2(A,E,G,H,K,N,P,Q,R,S,Y); 3(T,A,D,F,G,M,P,Q,R,S);
5(G,A,C,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,Y); 15(V,C,I,L,N,S,T);
23(N,A,D,E,F,H,K,M,Q,S,T,V,W,Y); 27(T,D,E,F,G,H,I,K,L,M,N,Q,R,S,W,Y);
30(P,A,C,D,E,F,G,H,K,L,N,R,S,T,W,Y); 31(Y,E,F,H,K,M,R,W); 33(S,D,E,G,H,K,N,Q,R);
42(T,A,C,I,L,M,V); 49(T,A,C,D,E,F,G,H,I,K,L,M,N,S,V,Y); 52(A,F,G,H,I,K,N,Q,S,T,W);
54(V,A,C,D,E,G,I,L,N,Q,R,S,T); 68(N,A,C,E,F,M,S,Y);
81(G,A,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 85(S,A,C,D,E,H,K,L,M,N,Q,R);
88(N,A,D,E,H,Q,R,T); 89(T,C,D,E,H,M,N,Q,R,S,V); 92(S,A,L,M,R,V);
111(Y,A,C,D,F,G,H,K,L,M,N,Q,R,S,T,V,W); 112(T,A,C,D,E,F,G,I,L,M,P,Q,R,V,W,Y);
116(T,A,C,D,E,G,H,I,K,L,M,N,S,V,W); 118(V,A,C,F,I,K,L,M,N,Q,R,S); 122(P,A,K,Q,R,T);
123(S,A,C,E,G,H,K,N,Q,R,T,Y); 127(Q,A,C,E,H,I,K,M,R,T,V,Y); 128(E,G,I,K,S,V,Y);
129(T,A,F,G,H,I,K,L,Q,R,S,V,Y); 130(S,A,G,H,I,R,T,V); 131(G,A,F,H,I,K,M,N,P,Q,T,W);
132(E,A,C,G,H,I,L,M,N,P,Q,R,S,T,V,Y); 133(Y,A,D,E,F,H,K,L,N,T,V);
134(N,C,D,F,G,H,M,P,Q,S,T,Y); 136(Q,A,F,G,H,I,K,N,T,W,Y);
138(W,A,D,F,G,H,K,L,M,P,Q,R,S,T,V,Y); 140(G,C,D,E,F,H,I,K,L,M,N,S,T,V,Y);
142(N,A,C,D,E,F,G,H,I,K,L,M,Q,R,S,T,V,W,Y); 144(P,A,C,D,F,G,H,I,K,L,M,N,Q,R,T,Y); 145(G,A,E,H,I,K,L,M,N,Q,R,S,T,V,W,Y); 147(G,C,E,H,I,K,L,N,Q,R,V);
148(T,A,G,H,I,K,L,S,W,Y); 149(T,A,C,D,E,H,I,K,L,M,N,R,S,W,Y);
150(Y,D,F,G,H,I,M,P,Q,W); 152(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,W);
154(K,A,E,F,H,N,R,S,T); 156(Q,D,F,G,H,I,K,L,M,S,T,V,Y);
158(F,A,C,D,E,G,H,I,L,N,P,R,S,T,V,W,Y); 163(T,C,D,F,L,M,N,Q,S,V); 166(D,A,C,G,K,M);
167(Q,A,C,D,G,H,K,N,R,S,T,V,Y); 168(S,C,D,E,G,I,K,L,M,N,R,T,V,W);
169(R,A,C,D,E,H,K,L,M,Q,T,W,Y); 170(S,C,G,H,N,R,T);
171(L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T);
175(F,A,D,H,L,M,S,V,W,Y); 191(E,A,C,I,L,M,N,T); 192(N,F,H,M,R,S,Y);
193(G,A,C,F,H,I,K,R,S,T,V); 203(I,A,C,F,H,L,M,N,Q,V,Y); 206(D,A,C,I,M,Q,Y);
207(H,A,D,E,F,K,M,N,R,S,Y); 208(P,A,D,E,H,K,L,N,Q,R,S,T); 209(D,C,G,I,K);
211(V,C,D,E,F,I,L,M,N,Q,S,T); 212(N,A,C,D,E,G,H,I,L,M,Q,R,ST,V,Y);
215(K,E,F,L,M,N,Q,R,T,Y); 241(S,A,C,D,E,F,G,H,I,K,L,N,P,Q,R,T,V,W,Y);
244(K,A,C,H,M,N,Q,R,S,T,Y); 249(N,A,C,D,E,F,G,K,M,Q,R,S,T,W);
251(R,A,D,K,L,M,N,Q,S,T); 252(A,C,D,F,H,M,R); 253(A,C,D,E,L,M,N,Q,R,S,T,V);
257(E,A,C,F,G,H,K,L,Q,R,S,V,Y); 258(M,C,F,I,L,Y);
266(Q,A,C,D,E,F,G,H,I,K,L,M,N,R,S,T,W); 270(G,A,C,D,F,H,I,K,P,Q,R,S,V,W,Y);
273(N,D,E,H,I,K,L,M,Q,S); 277(A,C,D,E,F,H,I,K,L,M,N,Q,T,W,Y);
280(N,A,C,D,E,G,H,K,L,Q,T,Y); 284(S,E,F,H,K,M,R,W,Y); 296(A,D,E,F,H,I,K,M,Q,R,S,T); 301(G,A,F,H,K,M,Q,R,S,T,Y); 303(Y,A,F,I,R,T,V,W);
308(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,Y); 311(N,D,E,H,K,Q,S,V);
317(S,A,C,D,E,G,H,K,L,M,Q,T,W,Y); 318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y);
320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y); 357(S,A,C,D,E,L,M,N,Q,V,Y);
360(Y,C,E,F,H,I,L,V); 362(S,A,C,E,I,Q,T,V); 372(K,A,D,H,M,N,R); 374(T,A,K,N,P,Q,S); 376(T,A,G,H,K,N,Q,S,Y); 377(R,A,C,D,G,H,I,K,L,M,S,T,V,Y); 384(S,D,E,G,H,N,P);
388(P,C,D,I,K,L,R,S); 391(K,E,F,L,T,V,Y); 395(D,C,E,F,I,K,M,Q,R,S,W,Y); 396(Y,C,F,K);
400(T,A,C,D,E,H,K,L,M,N,Q,R,S,V,W,Y); 402(R,F,K,L,Q,S,T,V,W,Y);
407(N,A,C,D,E,G,H,Q,S); 408(P,E,H,K,M,Q,R,S,V,W,Y); 410(V,E,I,K,L,M,R,S,Y);
416(E,C,D,F,G,H,K,L,M,N,Q,R,S,T,V); 418(D,A,C,E,F,G,H,I,K,L,M,N,Q,R,S,T,W,Y);
419(S,A,E,G,K,P,Q,R,T,V,Y); 420(T,A,C,D,E,F,G,H,I,L,P,Q,R,S,V,W,Y);
421(K,A,C,F,G,H,I,L,N,R,S,W,Y); 422(A,C,D,E,I,K,L,M,N,P,Q,R,S,T,V,W,Y);
423(K,A,C,D,E,F,G,M,N,P,Q,S,V,W,Y); 434(P,D,M,N,Q,R,S);
435(G,A,C,E,I,L,N,Q,R,S,T,V,Y); 437(S,A,D,E,F,H,K,L,Q,Y); 441(Y,C,K,L,N,Q,R,S,W); 444(T,A,E,F,H,I,K,L,M,N,P,Q,V,Y); 445(S,A,C,D,H,M,R,T,V,W); 447(A,G,K,Q,R,S,T,V); 448(G,A,D,E,F,H,K,L,N,Q,T,W,Y); 450(I,A,C,D,F,H,K,L,N,P,Q,R,T,V);
452(Y,A,I,L,M,S,V,W); 454(L,A,C,E,F,H,I,K,M,Q,S,T,V,Y); 455(T,A,C,I,L,M,S,V);
456(G,A,C,D,E,F,H,K,L,M,N,R,S,T,W,Y); 458(R,A,C,D,E,F,I,M,N,S,W,Y);
459(T,A,C,D,F,G,L,S,V,W); 461 (K,A,D,G,I,L,M,N,P,S,Y); 463(T,C,E,F,I,K,L,M,N,V,Y); 465(G,A,M,N,P,Q); 466(S,A,C,D,E,F,H,I,K,L,M,N,R,T,V,W,Y); 469(Y,C,F,I,L,S,V);
471(T,A,D,E,F,G,H,I,K,N,P,Q,W); 475(N,A,D,F,G,H,I,K,L,M,P,S,T,V);
476(G,A,C,D,E,H,K,N,P,Q,R,S,T,V,Y); 477(G,A,D,E,H,I,K,P,Q,R,S,T,V,Y); and
485(Q,A,D,E,F,H,I,K,L,M,N,P,R,T,V,Y)
[0094] The productive positions in CspAmy2-vl that fall within the previously described Productivity Scores of "4," and the substitutions within those positions that are combinable, are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1.
LIST D:
1(A,E,G,I,K,N,Q,R,T,V,Y); 2(A,E,G,H,K,N,P,Q,R,S,Y); 3(T,A,D,F,G,M,P,Q,R,S);
5(G,A,C,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,Y); 23(N,A,D,E,F,H,K,M,Q,S,T,V,W,Y);
27(T,D,E,F,G,H,I,K,L,M,N,Q,R,S,W,Y); 30(P,A,C,D,E,F,G,H,K,L,N,R,S,T,W,Y);
49(T,A,C,D,E,F,G,H,I,K,L,M,N,S,V,Y); 52(A,F,G,H,I,K,N,Q,S,T,W);
54(V,A,C,D,E,G,I,L,N,Q,R,S,T); 68(N,A,C,E,F,M,S,Y);
81(G,A,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 85(S,A,C,D,E,H,K,L,M,N,Q,R);
89(T,C,D,E,H,M,N,Q,R,S,V); 111(Y,A,C,D,F,G,H,K,L,M,N,Q,R,S,T,V,W);
112(T,A,C,D,E,F,G,I,L,M,P,Q,R,V,W,Y); 116(T,A,C,D,E,G,H,I,K,L,M,N,S,V,W);
118(V,A,C,F,I,K,L,M,N,Q,R,S); 123(S,A,C,E,G,H,K,N,Q,R,T,Y);
127(Q,A,C,E,H,I,K,M,R,T,V,Y); 128(E,G,I,K,S,V,Y); 129(T,A,F,G,H,I,K,L,Q,R,S,V,Y);
131(G,A,F,H,I,K,M,N,P,Q,T,W); 132(E,A,C,G,H,I,L,M,N,P,Q,R,S,T,V,Y);
133(Y,A,D,E,F,H,K,L,N,T,V); 134(N,C,D,F,G,H,M,P,Q,S,T,Y); 136(Q,A,F,G,H,I,K,N,T,W,Y);
138(W,A,D,F,G,H,K,L,M,P,Q,R,S,T,V,Y); 140(G,C,D,E,F,H,I,K,L,M,N,S,T,V,Y);
142(N,A,C,D,E,F,G,H,I,K,L,M,Q,R,S,T,V,W,Y); 144(P,A,C,D,F,G,H,I,K,L,M,N,Q,R,T,Y);
145(G,A,E,H,I,K,L,M,N,Q,R,S,T,V,W,Y); 147(G,C,E,H,I,K,L,N,Q,R,V);
148(T,A,G,H,I,K,L,S,W,Y); 149(T,A,C,D,E,H,I,K,L,M,N,R,S,W,Y);
150(Y,D,F,G,H,I,M,P,Q,W); 152(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,W);
156(Q,D,F,G,H,I,K,L,M,S,T,V,Y); 158(F,A,C,D,E,G,H,I,L,N,P,R,S,T,V,W,Y);
163(T,C,D,F,L,M,N,Q,S,V); 167(Q,A,C,D,G,H,K,N,R,S,T,V,Y);
168(S,C,D,E,G,I,K,L,M,N,R,T,V,W); 169(R,A,C,D,E,H,K,L,M,Q,T,W,Y);
171 (L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T); 193(G,A,C,F,H,I,K,R,S,T,V); 203(I,A,C,F,H,L,M,N,Q,V,Y); 207(H,A,D,E,F,K,M,N,R,S,Y); 208(P,A,D,E,H,K,L,N,Q,R,S,T); 211(V,C,D,E,F,I,L,M,N,Q,S,T);
212(N,A,C,D,E,G,H,I,L,M,Q,R,ST,V,Y); 215(K,E,F,L,M,N,Q,R,T,Y);
241(S,A,C,D,E,F,G,H,I,K,L,N,P,Q,R,T,V,W,Y); 244(K,A,C,H,M,N,Q,R,S,T,Y);
249(N,A,C,D,E,F,G,K,M,Q,R,S,T,W); 251(R,A,D,K,L,M,N,Q,S,T);
253(A,C,D,E,L,M,N,Q,R,S,T,V); 257(E,A,C,F,G,H,K,L,Q,R,S,V,Y);
266(Q,A,C,D,E,F,G,H,I,K,L,M,N,R,S,T,W); 270(G,A,C,D,F,H,I,K,P,Q,R,S,V,W,Y);
273(N,D,E,H,I,K,L,M,Q,S); 277(A,C,D,E,F,H,I,K,L,M,N,Q,T,W,Y);
280(N,A,C,D,E,G,H,K,L,Q,T,Y); 284(S,E,F,H,K,M,R,W,Y); 296(A,D,E,F,H,I,K,M,Q,R,S,T); 301(G,A,F,H,K,M,Q,R,S,T,Y); 308(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,Y);
317(S,A,C,D,E,G,H,K,L,M,Q,T,W,Y); 318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y);
320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y); 357(S,A,C,D,E,L,M,N,Q,V,Y);
360(Y,C,E,F,H,I,L,V); 377(R,A,C,D,G,H,I,K,L,M,S,T,V,Y); 384(S,D,E,G,H,N,P);
388(P,C,D,I,K,L,R,S); 395(D,C,E,F,I,K,M,Q,R,S,W,Y);
400(T,A,C,D,E,H,K,L,M,N,Q,R,S,V,W,Y); 408(P,E,H,K,M,Q,R,S,V,W,Y);
416(E,C,D,F,G,H,K,L,M,N,Q,R,S,T,V); 418(D,A,C,E,F,G,H,I,K,L,M,N,Q,R,S,T,W,Y);
419(S,A,E,G,K,P,Q,R,T,V,Y); 420(T,A,C,D,E,F,G,H,I,L,P,Q,R,S,V,W,Y);
421(K,A,C,F,G,H,I,L,N,R,S,W,Y); 422(A,C,D,E,I,K,L,M,N,P,Q,R,S,T,V,W,Y);
423(K,A,C,D,E,F,G,M,N,P,Q,S,V,W,Y); 434(P,D,M,N,Q,R,S);
435(G,A,C,E,I,L,N,Q,R,S,T,V,Y); 437(S,A,D,E,F,H,K,L,Q,Y);
444(T,A,E,F,H,I,K,L,M,N,P,Q,V,Y); 445(S,A,C,D,H,M,R,T,V,W);
448(G,A,D,E,F,H,K,L,N,Q,T,W,Y); 450(I,A,C,D,F,H,K,L,N,P,Q,R,T,V);
454(L,A,C,E,F,H,I,K,M,Q,S,T,V,Y); 456(G,A,C,D,E,F,H,K,L,M,N,R,S,T,W,Y);
458(R,A,C,D,E,F,I,M,N,S,W,Y); 459(T,A,C,D,F,G,L,S,V,W); 461(K,A,D,G,I,L,M,N,P,S,Y); 463(T,C,E,F,I,K,L,M,N,V,Y); 466(S,A,C,D,E,F,H,I,K,L,M,N,R,T,V,W,Y);
471(T,A,D,E,F,G,H,I,K,N,P,Q,W); 475(N,A,D,F,G,H,I,K,L,M,P,S,T,V);
476(G,A,C,D,E,H,K,N,P,Q,R,S,T,V,Y); 477(G,A,D,E,H,I,K,P,Q,R,S,T,V,Y); and
485(Q,A,D,E,F,H,I,K,L,M,N,P,R,T,V,Y)
[0095] The productive positions in CspAmy2-vl suitable for charge or hydrophobicity modifications are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1.
LIST E:
1, 5, 15, 23, 30, 31, 49, 68, 111, 112, 116, 123, 127, 128, 129, 131, 132, 134, 140, 142, 144, 147, 150, 152, 153, 168, 170, 171, 183, 187, 192, 203, 207, 209, 211, 212, 232, 241, 243, 244, 253, 266, 277, 280, 300, 301, 308, 320, 357, 362, 377, 388, 400, 402, 408, 416, 420, 423, 448, 450, 454, 455, 456, 458, 466, 475, and 485
[0096] The productive positions and the substitutions within those positions in CspAmy2-vl suitable for charge or hydrophobicity modifications are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1.
LIST F:
1(A,K,V,Y); 5(G,F,V); 15(V,S); 23(N,K); 30(P,E,K,L,W); 31(Y,F,K,W); 49(T,I); 68(N,Y); 111(Y,D,Q,S,T,W); 112(T,I,W); 116(T,L); 123(S,K); 127(Q,I); 128(E,I,V); 129(T,I);
131(G,H,K); 132(E,G,H,I,M,P,R,T,V,Y); 134(N,D,F,M,Y); 140(G,E,F,H,K); 142(N,D,I,R); 144(P,G,K,L); 147(G,C,E,H,L,R,V); 150(Y,W); 152(N,D,E,L,R); 153(F,H,Y); 168(S,L);
170(S,R); 171(L,H,N,Q,R); 183(A,K); 187(E,P); 192(N,F,Y); 203(I,C); 207(H,E,F); 209(D,G); 211(V,D,E,N,Q); 212(N,D,E); 232(L,R); 241(S,D,E,I,L,W,Y); 243(L,S); 244(K,C); 253(A,R); 266(Q,I,R,W); 277(A,F,L,Y); 280(N,L); 300(G,R); 301(G,H); 308(N,D,E,F,L,R,V,Y);
320(T,E,W); 357(S,E); 362(S,I,V); 377(R,G,H); 388(P,K); 400(T,E,K,L,W,Y); 402(R,F);
408(P,E,R,W); 416(E,C,F,G,H,K,L,N,R,S,V); 420(T,D,E,I,L,R,W);
423(K,E,F,G,M,N,Q,S,V,Y); 448(G,F,H,K,W); 450(I,K,R,T); 454(L,C); 455(T,L,M);
456(G,F,W); 458(R,A,C,D,E,F,I,S); 466(S,I,L); 475(N,D); and 485(Q,E,K,L,Y,Y)
[0097] Although the foregoing mutations were identified using an SEL library based on
CspAmy2-vl (SEQ ID NO: 2), it is known that many bacterial (and other) a-amylases share the same fold, and often share significant amino acid sequence identity, and often benfit from the same mutations. In the present case, corresponding amino acid positions in other a-amylases can readily be identified by amino acid sequence alignment with CspAmy2 (SEQ ID NO: 1) or CspAmy2-vl (SEQ ID NO: 2), using Clustal W with default parameters, α-amylases in which the foregoing mutations are likely to produce a performance benefit include those having a similar fold and/or having 60% or greater amino acid sequence identity to any of the well-known Bacillus amylases (e.g., from fi. lichenifomis, B. stearothermophilus, and B. amyloliquifaciens), Carbohydrate- Active Enzymes database (CAZy) Family 13 amylases, or any amylase that has heretofore been referred to by the descriptive term, "Termamyl-like." The reader will appreciate that where an a-amylase naturally has a mutation listed above (i.e., where the wild- type a- amylase already comprised a residue identified as a mutation), then that particular mutation does not apply to that a-amylase. However, other described mutations may work in combination with the naturally occuring residue at that position.
[0098] In some embodiments, the present α-amylase variants have at least one combinable mutation at a productive position corresponding to the combinable mutations at productive positions described, above, in Lists A, B, C, D, E, and/or F, and/or a combinable mutation as described in Table D (which use SEQ ID NO: 1 for numbering) and a defined degree of amino acid sequence homology/identity to SEQ ID NO: 1 or SEQ ID NO: 2, for example, at least 60%, at least 65%, at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or even at least 99% amino acid sequence homology/identity, and have at least combinable mutation as set forth above. In some embodiments, the suitability score of the at least one mutation is +++, ++++, or +++++. In some embodiments, the suitability score of the at least one mutation is ++++, or +++++. In some embodiments, the suitability score of the at least one mutation is +++++. In some embodiments, the variants have a plurality (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, or more) combinable mutations.
[0099] In some embodiments, the present a-amylase variants have at least one combinable mutation at a productive position corresponding to the combinable mutations at productive positions described, above, in Lists A, B, C, D, E, and/or F, and/or a combinable mutation as described in Table D (which use SEQ ID NO: 1 for numbering) and are derived from a parental amylase having a defined degree of amino acid sequence homology/identity to SEQ ID NO: 1 or SEQ ID NO: 2, for example, at least 60%, at least 65%, at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or even at least 99% amino acid sequence homology/identity. In some embodiments, the suitability score of the at least one mutation is +++, ++++, or +++++. In some embodiments, the suitability score of the at least one mutation is ++++, or +++++. In some embodiments, the suitability score of the at least one mutation is +++++. In some embodiments, the variants have, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more combinable mutations.
[00100] In some embodiments, the present a-amylase variants have a mutation in the calcium binding loop based on the work of Suzuki et al. (1989) J. Biol. Chem. 264: 18933-938.
Exemplary mutations include a deletion or substitution at one or more residues corresponding to Arg-178, Gly-179, Thr-180, or Gly-181 in SEQ ID NO: 1. In particular embodiments, the mutation corresponds to the deletion of Arg-178 and Gly-179 or Thr-180 and Gly-181 (using SEQ ID NO: 1 numbering). Homologous residues in other amylases can be determined by structural alignment, or by primary structure alignment, as illustrated by Figure 6. In some embodiments, the mutation(s) in the calcium binding loop are combined with any of the aforementioned combinable mutations and mutations at productive positions.
2.2 Additional mutations
[00101] In some embodiments, in addition to one or more of the mutations described above (e.g., in Sections 2.1, 2.2, and 2.3), the present amylases further include one or more mutations that provide a further performance or stability benefit. Exemplary performance benfits include but are not limited to increased hydrolysis of a starch substrate, increased grain, cereal or other starch substrate liquifaction performance, increased cleaning performance, increased thermal stability, increased storage stability, increased solubility, an altered pH profile, decreased calcium dependence, increased specific activity, modified substrate specificity, modified substrate binding, modified pH-dependent activity, modified pH-dependent stability, increased oxidative stability, and increased expression. In some cases, the performance benefit is realized at a relatively low temperature. In some cases, the performance benefit is realized at relatively high temperature.
[00102] Furthermore, the present amylases may include any number of conservative amino acid substitutions. Exemplary conservative amino acid substitutions are listed in the Table E
Table E. Conservative amino acid substitutions
Figure imgf000048_0001
Threonine T D-Thr, Ser, D-Ser, allo-Thr, Met,
D-Met, Met(O), D-Met(O), Val, D-Val
Tyrosine Y D-Tyr, Phe, D-Phe, L-Dopa, His, D-His
Valine V D-Val, Leu, D-Leu, He, D-Ile, Met, D-Met
[00103] The reader will appreciate that some of the above mentioned conservative mutations can be produced by genetic manpulation, while others are produced by introducing synthetic amino acids into a polypeptide by genetic or other means.
[00104] The present amylase may be "precursor," "immature," or "full-length," in which case they include a signal sequence, or "mature," in which case they lack a signal sequence. Mature forms of the polypeptides are generally the most useful. Unless otherwise noted, the amino acid residue numbering used herein refers to the mature forms of the respective amylase
polypeptides. The present amylase polypeptides may also be truncated to remove the N or C- termini, so long as the resulting polypeptides retain amylase activity.
[00105] The present amylase may be a "chimeric" or "hybrid" polypeptide, in that it includes at least a portion of a first amylase polypeptide, and at least a portion of a second amylase polypeptide (such chimeric amylases have recently been "rediscovered" as domain-swap amylases). The present amylases may further include heterologous signal sequence, an epitope to allow tracking or purification, or the like. Exemplary heterologous signal sequences are from B. licheniformis amylase (LAT), B. subtilis (AmyE or AprE), and Streptomyces CelA.
2.3. Nucleotides encoding variant amylase polypeptides
[00106] In another aspect, nucleic acids encoding a variant amylase polypeptide are provided. The nucleic acid may encode a particular amylase polypeptide, or an amylase having a specified degree of amino acid sequence identity to the particular amylase.
[00107] In one example, the nucleic acid encodes an amylase having at least 60%, at least 65%, at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or even at least 99%
homology/identity to SEQ ID NO: 1 or SEQ ID NO: 2 (excluding the portion of the nucleic acid that encodes the signal sequence). It will be appreciated that due to the degeneracy of the genetic code, a plurality of nucleic acids may encode the same polypeptide.
[00108] In another example, the nucleic acid hybridizes under stringent or very stringent conditions to a nucleic acid encoding (or complementary to a nucleic acid encoding) an amylase having at least 60%, at least 65%, at least 70%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or even at least 99% homology/identity to SEQ ID NO: 1 or SEQ ID NO: 2 (excluding the portion of the nucleic acid that encodes the signal sequence). Such hybridization conditions are described herein but are also well known in the art.
[00109] Nucleic acids may encode a "full-length" ("fl" or "FL") amylase, which includes a signal sequence, only the mature form of an amylase, which lacks the signal sequence, or a truncated form of an amylase, which lacks the N or C-terminus of the mature form.
[00110] A nucleic acid that encodes a a-amylase can be operably linked to various promoters and regulators in a vector suitable for expressing the a-amylase in host cells. Exemplary promoters are from B. licheniformis amylase (LAT), B. subtilis (AmyE or AprE), and
Streptomyces CelA. Such a nucleic acid can also be linked to other coding sequences, e.g., to encode a chimeric polypeptide. 3. Production of Variant Amylases
[00111] The present variant amylases can be produced in host cells, for example, by secretion or intracellular expression. A cultured cell material {e.g., a whole-cell broth) comprising a variant amylase can be obtained following secretion of the variant amylase into the cell medium. Optionally, the variant amylase can be isolated from the host cells, or even isolated from the cell broth, depending on the desired purity of the final variant amylase. A gene encoding a variant amylase can be cloned and expressed according to methods well known in the art. Suitable host cells include bacterial, fungal (including yeast and filamentous fungi), and plant cells (including algae). Particularly useful host cells include Aspergillus niger, Aspergillus oryzae or
Trichoderma reesei. Other host cells include bacterial cells, e.g., Bacillus subtilis or B.
licheniformis, as well as Streptomyces.
[00112] The host cell further may express a nucleic acid encoding a homologous or heterologous glucoamylase, i.e., a glucoamylase that is not the same species as the host cell, or one or more other enzymes. The glucoamylase may be a variant glucoamylase, such as one of the glucoamylase variants disclosed in U.S. Patent No. 8,058,033 (Danisco US Inc.), for example. Additionally, the host may express one or more accessory enzymes, proteins, peptides. These may benefit liquefaction, saccharification, fermentation, SSF, etc processes. Furthermore, the host cell may produce biochemicals in addition to enzymes used to digest the various feedstock(s). Such host cells may be useful for fermentation or simultaneous saccharification and fermentation processes to reduce or eliminate the need to add enzymes.
3.1. Vectors
[00113] A DNA construct comprising a nucleic acid encoding variant amylases can be constructed to be expressed in a host cell. Representative nucleic acids that encode variant amylases include SEQ ID NO: 4. Because of the well-known degeneracy in the genetic code, variant polynucleotides that encode an identical amino acid sequence can be designed and made with routine skill. It is also well known in the art to optimize codon use for a particular host cell. Nucleic acids encoding variant amylases can be incorporated into a vector. Vectors can be transferred to a host cell using well-known transformation techniques, such as those disclosed below.
[00114] The vector may be any vector that can be transformed into and replicated within a host cell. For example, a vector comprising a nucleic acid encoding a variant amylase can be transformed and replicated in a bacterial host cell as a means of propagating and amplifying the vector. The vector also may be transformed into an expression host, so that the encoding nucleic acids can be expressed as a functional amylase. Host cells that serve as expression hosts can include filamentous fungi, for example. The Fungal Genetics Stock Center (FGSC) Catalogue of Strains lists suitable vectors for expression in fungal host cells. See FGSC, Catalogue of Strains, University of Missouri, at www.fgsc.net (last modified January 17, 2007). A
representative vector is pJG153, a promoterless Cre expression vector that can be replicated in a bacterial host. See Harrison et al. (June 2011) Applied Environ. Microbiol. 77: 3916-22.
pJG153can be modified with routine skill to comprise and express a nucleic acid encoding an amylase variant.
[00115] A nucleic acid encoding a variant amylase can be operably linked to a suitable promoter, which allows transcription in the host cell. The promoter may be any DNA sequence that shows transcriptional activity in the host cell of choice and may be derived from genes encoding proteins either homologous or heterologous to the host cell. Exemplary promoters for directing the transcription of the DNA sequence encoding a variant amylase, especially in a bacterial host, are the promoter of the lac operon of E. coli, the Streptomyces coelicolor agarase gene dagA or celA promoters, the promoters of the Bacillus licheniformis a-amylase gene
(amyL), the promoters of the Bacillus stearothermophilus maltogenic amylase gene (amyM), the promoters of the Bacillus amyloliquefaciens a-amylase (amyQ), the promoters of the Bacillus subtilis xylA and xylB genes etc. For transcription in a fungal host, examples of useful promoters are those derived from the gene encoding Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral a-amylase, A. niger acid stable a-amylase, A. niger glucoamylase, Rhizomucor miehei lipase, A. oryzae alkaline protease, A. oryzae triose phosphate isomerase, or A. nidulans acetamidase. When a gene encoding an amylase is expressed in a bacterial species such as E. coli, a suitable promoter can be selected, for example, from a bacteriophage promoter including a T7 promoter and a phage lambda promoter. Examples of suitable promoters for the expression in a yeast species include but are not limited to the Gal 1 and Gal 10 promoters of Saccharomyces cerevisiae and the Pichia pastoris AOXl or AOX2 promoters, cbhl is an endogenous, inducible promoter from T. reesei. See Liu et al. (2008) "Improved heterologous gene expression in Trichoderma reesei by cellobiohydrolase I gene (cbhl) promoter optimization," Acta Biochim. Biophys. Sin (Shanghai) 40(2): 158-65.
[00116] The coding sequence can be operably linked to a signal sequence. The DNA encoding the signal sequence may be the DNA sequence naturally associated with the amylase gene to be expressed or from a different Genus or species. A signal sequence and a promoter sequence comprising a DNA construct or vector can be introduced into a fungal host cell and can be derived from the same source. For example, the signal sequence is the cbhl signal sequence that is operably linked to a cbhl promoter.
[00117] An expression vector may also comprise a suitable transcription terminator and, in eukaryotes, polyadenylation sequences operably linked to the DNA sequence encoding a variant amylase. Termination and polyadenylation sequences may suitably be derived from the same sources as the promoter.
[00118] The vector may further comprise a DNA sequence enabling the vector to replicate in the host cell. Examples of such sequences are the origins of replication of plasmids pUC19, pACYC177, pUBHO, pE194, pAMBl, and pLJ702.
[00119] The vector may also comprise a selectable marker, e.g., a gene the product of which complements a defect in the isolated host cell, such as the dal genes from B. subtilis or B.
licheniformis, or a gene that confers antibiotic resistance such as, e.g., ampicillin, kanamycin, chloramphenicol or tetracycline resistance. Furthermore, the vector may comprise Aspergillus selection markers such as amdS, argB, niaD and xxsC, a marker giving rise to hygromycin resistance, or the selection may be accomplished by co-transformation, such as known in the art. See e.g., International PCT Application WO 91/17243. [00120] Intracellular expression may be advantageous in some respects, e.g., when using certain bacteria or fungi as host cells to produce large amounts of amylase for subsequent enrichment or purification. Extracellular secretion of amylase into the culture medium can also be used to make a cultured cell material comprising the isolated amylase. [00121] The expression vector typically includes the components of a cloning vector, such as, for example, an element that permits autonomous replication of the vector in the selected host organism and one or more phenotypically detectable markers for selection purposes. The expression vector normally comprises control nucleotide sequences such as a promoter, operator, ribosome binding site, translation initiation signal and optionally, a repressor gene or one or more activator genes. Additionally, the expression vector may comprise a sequence coding for an amino acid sequence capable of targeting the amylase to a host cell organelle such as a peroxisome, or to a particular host cell compartment. Such a targeting sequence includes but is not limited to the sequence, SKL. For expression under the direction of control sequences, the nucleic acid sequence of the amylase is operably linked to the control sequences in proper manner with respect to expression.
[00122] The procedures used to ligate the DNA construct encoding an amylase, the promoter, terminator and other elements, respectively, and to insert them into suitable vectors containing the information necessary for replication, are well known to persons skilled in the art (see, e.g., Sambrook et al, MOLECULAR CLONING: A LABORATORY MANUAL, 2ND ed., Cold Spring Harbor, 1989, and 3RD ed., 2001).
3.2. Transformation and Culture of Host Cells
[00123] An isolated cell, either comprising a DNA construct or an expression vector, is advantageously used as a host cell in the recombinant production of an amylase. The cell may be transformed with the DNA construct encoding the enzyme, conveniently by integrating the DNA construct (in one or more copies) in the host chromosome. This integration is generally considered to be an advantage, as the DNA sequence is more likely to be stably maintained in the cell. Integration of the DNA constructs into the host chromosome may be performed according to conventional methods, e.g., by homologous or heterologous recombination.
Alternatively, the cell may be transformed with an expression vector as described above in connection with the different types of host cells.
[00124] Examples of suitable bacterial host organisms are Gram positive bacterial species such as Bacillaceae including Bacillus subtilis, Bacillus licheniformis, Bacillus lentus, Bacillus brevis, Geobacillus (formerly Bacillus) stearothermophilus, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus coagulans, Bacillus lautus, Bacillus megaterium, and Bacillus thuringiensis; Streptomyces species such as Streptomyces murinus; lactic acid bacterial species including Lactococcus sp. such as Lactococcus lactis; Lactobacillus sp. including Lactobacillus reuteri; Leuconostoc sp.; Pediococcus sp.; and Streptococcus sp. Alternatively, strains of a Gram negative bacterial species belonging to Enterobacteriaceae including E. coli, or to Pseudomonadaceae can be selected as the host organism.
[00125] A suitable yeast host organism can be selected from the biotechnologically relevant yeasts species such as but not limited to yeast species such as Pichia sp., Hansenula sp., or Kluyveromyces, Yarrowinia, Schizosaccharomyces species or a species of Saccharomyces, including Saccharomyces cerevisiae or a species belonging to Schizosaccharomyces such as, for example, S. pombe species. A strain of the methylotrophic yeast species, Pichia pastoris, can be used as the host organism. Alternatively, the host organism can be a Hansenula species.
Suitable host organisms among filamentous fungi include species of Aspergillus, e.g.,
Aspergillus niger, Aspergillus oryzae, Aspergillus tubigensis, Aspergillus awamori, or
Aspergillus nidulans. Alternatively, strains of a Fusarium species, e.g., Fusarium oxysporum or of a Rhizomucor species such as Rhizomucor miehei can be used as the host organism. Other suitable strains include Thermomyces and Mucor species. In addition, Trichoderma sp. can be used as a host. A suitable procedure for transformation of Aspergillus host cells includes, for example, that described in EP 238023. An amylase expressed by a fungal host cell can be glycosylated, i.e., will comprise a glycosyl moiety. The glycosylation pattern can be the same or different as present in the wild-type amylase. The type and/or degree of glycosylation may impart changes in enzymatic and/or biochemical properties.
[00126] It is advantageous to delete genes from expression hosts, where the gene deficiency can be cured by the transformed expression vector. Known methods may be used to obtain a fungal host cell having one or more inactivated genes. Gene inactivation may be accomplished by complete or partial deletion, by insertional inactivation or by any other means that renders a gene nonfunctional for its intended purpose, such that the gene is prevented from expression of a functional protein. Any gene from a Trichoderma sp. or other filamentous fungal host that has been cloned can be deleted, for example, cbhl, cbh2, egll, and egl2 genes. Gene deletion may be accomplished by inserting a form of the desired gene to be inactivated into a plasmid by methods known in the art.
[00127] Introduction of a DNA construct or vector into a host cell includes techniques such as transformation; electroporation; nuclear microinjection; transduction; transfection, e.g., lipofection mediated and DEAE-Dextrin mediated transfection; incubation with calcium phosphate DNA precipitate; high velocity bombardment with DNA-coated microprojectiles; and protoplast fusion. General transformation techniques are known in the art. See, e.g., Sambrook et al. (2001), supra. The expression of heterologous protein in Trichoderma is described, for example, in U.S. Patent No. 6,022,725. Reference is also made to Cao et al. (2000) Science 9:991-1001 for transformation of Aspergillus strains. Genetically stable transformants can be constructed with vector systems whereby the nucleic acid encoding an amylase is stably integrated into a host cell chromosome. Transformants are then selected and purified by known techniques. [00128] The preparation of Trichoderma sp. for transformation, for example, may involve the preparation of protoplasts from fungal mycelia. See Campbell et al. (1989) Curr. Genet. 16: 53- 56. The mycelia can be obtained from germinated vegetative spores. The mycelia are treated with an enzyme that digests the cell wall, resulting in protoplasts. The protoplasts are protected by the presence of an osmotic stabilizer in the suspending medium. These stabilizers include sorbitol, mannitol, potassium chloride, magnesium sulfate, and the like. Usually the
concentration of these stabilizers varies between 0.8 M and 1.2 M, e.g., a 1.2 M solution of sorbitol can be used in the suspension medium.
[00129] Uptake of DNA into the host Trichoderma sp. strain depends upon the calcium ion concentration. Generally, between about 10-50 mM CaCl2 is used in an uptake solution.
Additional suitable compounds include a buffering system, such as TE buffer (10 mM Tris, pH 7.4; 1 mM EDTA) or 10 mM MOPS, pH 6.0 and polyethylene glycol. The polyethylene glycol is believed to fuse the cell membranes, thus permitting the contents of the medium to be delivered into the cytoplasm of the Trichoderma sp. strain. This fusion frequently leaves multiple copies of the plasmid DNA integrated into the host chromosome. [00130] Usually transformation of Trichoderma sp. uses protoplasts or cells that have been subjected to a permeability treatment, typically at a density of 10 5 to 107 /mL, particularly 2xl06/mL. A volume of 100
Figure imgf000055_0001
of these protoplasts or cells in an appropriate solution {e.g., 1.2 M sorbitol and 50 mM CaCl2) may be mixed with the desired DNA. Generally, a high concentration of PEG is added to the uptake solution. From 0.1 to 1 volume of 25% PEG 4000 can be added to the protoplast suspension; however, it is useful to add about 0.25 volumes to the protoplast suspension. Additives, such as dimethyl sulfoxide, heparin, spermidine, potassium chloride and the like, may also be added to the uptake solution to facilitate transformation.
Similar procedures are available for other fungal host cells. See, e.g., U.S. Patent No. 6,022,725. 3.3. Expression
[00131] A method of producing an amylase may comprise cultivating a host cell as described above under conditions conducive to the production of the enzyme and recovering the enzyme from the cells and/or culture medium. [00132] The medium used to cultivate the cells may be any conventional medium suitable for growing the host cell in question and obtaining expression of an amylase. Suitable media and media components are available from commercial suppliers or may be prepared according to published recipes (e.g., as described in catalogues of the American Type Culture Collection).
[00133] An enzyme secreted from the host cells can be used in a whole broth preparation. In the present methods, the preparation of a spent whole fermentation broth of a recombinant microorganism can be achieved using any cultivation method known in the art resulting in the expression of an a-amylase. Fermentation may, therefore, be understood as comprising shake flask cultivation, small- or large-scale fermentation (including continuous, batch, fed-batch, or solid state fermentations) in laboratory or industrial fermenters performed in a suitable medium and under conditions allowing the amylase to be expressed or isolated. The term "spent whole fermentation broth" is defined herein as unfractionated contents of fermentation material that includes culture medium, extracellular proteins (e.g. , enzymes), and cellular biomass. It is understood that the term "spent whole fermentation broth" also encompasses cellular biomass that has been lysed or permeabilized using methods well known in the art. [00134] An enzyme secreted from the host cells may conveniently be recovered from the culture medium by well-known procedures, including separating the cells from the medium by centrifugation or filtration, and precipitating proteinaceous components of the medium by means of a salt such as ammonium sulfate, followed by the use of chromatographic procedures such as ion exchange chromatography, affinity chromatography, or the like. [00135] The polynucleotide encoding an amylase in a vector can be operably linked to a control sequence that is capable of providing for the expression of the coding sequence by the host cell, i.e. the vector is an expression vector. The control sequences may be modified, for example by the addition of further transcriptional regulatory elements to make the level of transcription directed by the control sequences more responsive to transcriptional modulators. The control sequences may in particular comprise promoters.
[00136] Host cells may be cultured under suitable conditions that allow expression of an amylase. Expression of the enzymes may be constitutive such that they are continually produced, or inducible, requiring a stimulus to initiate expression. In the case of inducible expression, protein production can be initiated when required by, for example, addition of an inducer substance to the culture medium, for example dexamethasone or IPTG or Sophorose. Polypeptides can also be produced recombinantly in an in vitro cell-free system, such as the TNT™ (Promega) rabbit reticulocyte system. [00137] An expression host also can be cultured in the appropriate medium for the host, under aerobic conditions. Shaking or a combination of agitation and aeration can be provided, with production occurring at the appropriate temperature for that host, e.g., from about 25°C to about 75°C (e.g., 30°C to 45°C), depending on the needs of the host and production of the desired variant amylase. Culturing can occur from about 12 to about 100 hours or greater (and any hour value there between, e.g., from 24 to 72 hours). Typically, the culture broth is at a pH of about 4.0 to about 8.0, again depending on the culture conditions needed for the host relative to production of an amylase.
3.4. Identification of Amylase Activity
[00138] To evaluate the expression of an amylase in a host cell, assays can measure the expressed protein, corresponding mRNA, or a-amylase activity. For example, suitable assays include Northern blotting, reverse transcriptase polymerase chain reaction, and in situ hybridization, using an appropriately labeled hybridizing probe. Suitable assays also include measuring amylase activity in a sample, for example, by assays directly measuring reducing sugars such as glucose in the culture media. For example, glucose concentration may be determined using glucose reagent kit No. 15-UV (Sigma Chemical Co.) or an instrument, such as Technicon Autoanalyzer. a- Amylase activity also may be measured by any known method, such as the PAHBAH or ABTS assays, described below.
3.5. Methods for Enriching and Purifying Variants Amylases
[00139] Fermentation, separation, and concentration techniques are well known in the art and conventional methods can be used in order to prepare a concentrated a variant a-amylase polypeptide-containing solution.
[00140] After fermentation, a fermentation broth is obtained, the microbial cells and various suspended solids, including residual raw fermentation materials, are removed by conventional separation techniques in order to obtain an amylase solution. Filtration, centrifugation, microfiltration, rotary vacuum drum filtration, ultrafiltration, centrifugation followed by ultrafiltration, extraction, or chromatography, or the like, are generally used. [00141] It is desirable to concentrate a variant a-amylase polypeptide-containing solution in order to optimize recovery. Use of unconcentrated solutions requires increased incubation time in order to collect the enriched or purified enzyme precipitate.
[00142] The enzyme containing solution is concentrated using conventional concentration techniques until the desired enzyme level is obtained. Concentration of the enzyme containing solution may be achieved by any of the techniques discussed herein. Exemplary methods of enrichment and purification include but are not limited to rotary vacuum filtration and/or ultrafiltration.
[00143] The enzyme solution is concentrated into a concentrated enzyme solution until the enzyme activity of the concentrated variant α-amylase polypeptide-containing solution is at a desired level.
[00144] Concentration may be performed using, e.g., a precipitation agent, such as a metal halide precipitation agent. Metal halide precipitation agents include but are not limited to alkali metal chlorides, alkali metal bromides and blends of two or more of these metal halides.
Exemplary metal halides include sodium chloride, potassium chloride, sodium bromide, potassium bromide and blends of two or more of these metal halides. The metal halide precipitation agent, sodium chloride, can also be used as a preservative.
[00145] The metal halide precipitation agent is used in an amount effective to precipitate an amylase. The selection of at least an effective amount and an optimum amount of metal halide effective to cause precipitation of the enzyme, as well as the conditions of the precipitation for maximum recovery including incubation time, pH, temperature and concentration of enzyme, will be readily apparent to one of ordinary skill in the art, after routine testing.
[00146] Generally, at least about 5% w/v (weight/volume) to about 25% w/v of metal halide is added to the concentrated enzyme solution, and usually at least 8% w/v. Generally, no more than about 25% w/v of metal halide is added to the concentrated enzyme solution and usually no more than about 20% w/v. The optimal concentration of the metal halide precipitation agent will depend, among others, on the nature of the specific variant α-amylase polypeptide and on its concentration in the concentrated enzyme solution.
[00147] Another alternative way to precipitate the enzyme is to use organic compounds. Exemplary organic compound precipitating agents include: 4-hydroxybenzoic acid, alkali metal salts of 4-hydroxybenzoic acid, alkyl esters of 4-hydroxybenzoic acid, and blends of two or more of these organic compounds. The addition of the organic compound precipitation agents can take place prior to, simultaneously with or subsequent to the addition of the metal halide precipitation agent, and the addition of both precipitation agents, organic compound and metal halide, may be carried out sequentially or simultaneously.
[00148] Generally, the organic precipitation agents are selected from the group consisting of alkali metal salts of 4-hydroxybenzoic acid, such as sodium or potassium salts, and linear or branched alkyl esters of 4-hydroxybenzoic acid, wherein the alkyl group contains from 1 to 12 carbon atoms, and blends of two or more of these organic compounds. The organic compound precipitation agents can be, for example, linear or branched alkyl esters of 4-hydroxybenzoic acid, wherein the alkyl group contains from 1 to 10 carbon atoms, and blends of two or more of these organic compounds. Exemplary organic compounds are linear alkyl esters of 4- hydroxybenzoic acid, wherein the alkyl group contains from 1 to 6 carbon atoms, and blends of two or more of these organic compounds. Methyl esters of 4-hydroxybenzoic acid, propyl esters of 4-hydroxybenzoic acid, butyl ester of 4-hydroxybenzoic acid, ethyl ester of 4-hydroxybenzoic acid and blends of two or more of these organic compounds can also be used. Additional organic compounds also include but are not limited to 4-hydroxybenzoic acid methyl ester (named methyl PARABEN), 4-hydroxybenzoic acid propyl ester (named propyl PARABEN), which also are both amylase preservative agents. For further descriptions, see, e.g., U.S. Patent No. 5,281,526.
[00149] Addition of the organic compound precipitation agent provides the advantage of high flexibility of the precipitation conditions with respect to pH, temperature, variant amylase concentration, precipitation agent concentration, and time of incubation.
[00150] The organic compound precipitation agent is used in an amount effective to improve precipitation of the enzyme by means of the metal halide precipitation agent. The selection of at least an effective amount and an optimum amount of organic compound precipitation agent, as well as the conditions of the precipitation for maximum recovery including incubation time, pH, temperature and concentration of enzyme, will be readily apparent to one of ordinary skill in the art, in light of the present disclosure, after routine testing.
[00151] Generally, at least about 0.01 w/v of organic compound precipitation agent is added to the concentrated enzyme solution and usually at least about 0.02% w/v. Generally, no more than about 0.3% w/v of organic compound precipitation agent is added to the concentrated enzyme solution and usually no more than about 0.2% w/v.
[00152] The concentrated polypeptide solution, containing the metal halide precipitation agent, and the organic compound precipitation agent, can be adjusted to a pH, which will, of necessity, depend on the enzyme to be enriched or purified. Generally, the pH is adjusted at a level near the isoelectric point of the amylase. The pH can be adjusted at a pH in a range from about 2.5 pH units below the isoelectric point (pi) up to about 2.5 pH units above the isoelectric point.
[00153] The incubation time necessary to obtain an enriched or purified enzyme precipitate depends on the nature of the specific enzyme, the concentration of enzyme, and the specific precipitation agent(s) and its (their) concentration. Generally, the time effective to precipitate the enzyme is between about 1 to about 30 hours; usually it does not exceed about 25 hours. In the presence of the organic compound precipitation agent, the time of incubation can still be reduced to less about 10 hours and in most cases even about 6 hours. [00154] Generally, the temperature during incubation is between about 4°C and about 50°C. Usually, the method is carried out at a temperature between about 10°C and about 45°C (e.g. , between about 20°C and about 40°C). The optimal temperature for inducing precipitation varies according to the solution conditions and the enzyme or precipitation agent(s) used.
[00155] The overall recovery of enriched or purified enzyme precipitate, and the efficiency with which the process is conducted, is improved by agitating the solution comprising the enzyme, the added metal halide and the added organic compound. The agitation step is done both during addition of the metal halide and the organic compound, and during the subsequent incubation period. Suitable agitation methods include mechanical stirring or shaking, vigorous aeration, or any similar technique. [00156] After the incubation period, the enriched or purified enzyme is then separated from the dissociated pigment and other impurities and collected by conventional separation techniques, such as filtration, centrifugation, microfiltration, rotary vacuum filtration, ultrafiltration, press filtration, cross membrane microfiltration, cross flow membrane
microfiltration, or the like. Further enrichment or purification of the enzyme precipitate can be obtained by washing the precipitate with water. For example, the enriched or purified enzyme precipitate is washed with water containing the metal halide precipitation agent, or with water containing the metal halide and the organic compound precipitation agents.
[00157] During fermentation, a variant a-amylase polypeptide accumulates in the culture broth. For the isolation, enrichment, or purification of the desired variant a-amylase, the culture broth is centrifuged or filtered to eliminate cells, and the resulting cell-free liquid is used for enzyme enrichment or purification. In one embodiment, the cell-free broth is subjected to salting out using ammonium sulfate at about 70% saturation; the 70% saturation-precipitation fraction is then dissolved in a buffer and applied to a column such as a Sephadex G- 100 column, and eluted to recover the enzyme-active fraction. For further enrichment or purification, a conventional procedure such as ion exchange chromatography may be used.
[00158] Enriched or purified enzymes are useful for laundry and cleaning applications. For example, they can be used in laundry detergents and spot removers. They can be made into a final product that is either liquid (solution, slurry) or solid (granular, powder).
[00159] A more specific example of enrichment or purification, is described in Sumitani et al. (2000) "New type of starch-binding domain: the direct repeat motif in the C-terminal region of Bacillus sp. 195 a-amylase contributes to starch binding and raw starch degrading," Biochem. J. 350: 477-484, and is briefly summarized here. The enzyme obtained from 4 liters of a
Streptomyces lividans TK24 culture supernatant was treated with (NH4)2S04 at 80% saturation. The precipitate was recovered by centrifugation at 10,000 x g (20 min. and 4°C) and re- dissolved in 20 mM Tris/HCl buffer (pH 7.0) containing 5 mM CaCl2. The solubilized precipitate was then dialyzed against the same buffer. The dialyzed sample was then applied to a Sephacryl S-200 column, which had previously been equilibrated with 20 mM Tris/HCl buffer, (pH 7.0), 5 mM CaCl2, and eluted at a linear flow rate of 7 mL/hr with the same buffer.
Fractions from the column were collected and assessed for activity as judged by enzyme assay and SDS-PAGE. The protein was further purified as follows. A Toyopearl HW55 column (Tosoh Bioscience, Montgomeryville, PA; Cat. No. 19812) was equilibrated with 20 mM
Tris/HCl buffer (pH 7.0) containing 5 mM CaCl2 and 1.5 M (NH4)2S04. The enzyme was eluted with a linear gradient of 1.5 to 0 M (NH4)2S04 in 20 mM Tris/HCL buffer, pH 7.0 containing 5 mM CaCl2. The active fractions were collected, and the enzyme precipitated with (NH4)2S04 at 80% saturation. The precipitate was recovered, re-dissolved, and dialyzed as described above. The dialyzed sample was then applied to a Mono Q HR5/5 column (Amersham Pharmacia; Cat. No. 17-5167-01) previously equilibrated with 20 mM Tris/HCl buffer (pH 7.0) containing 5 mM CaCl2, at a flow rate of 60 mL/hour. The active fractions are collected and added to a 1.5 M (NH4)2S04 solution. The active enzyme fractions were re-chromatographed on a Toyopearl HW55 column, as before, to yield a homogeneous enzyme as determined by SDS-PAGE. See Sumitani et al. (2000) Biochem. J. 350: 477-484, for general discussion of the method and variations thereon. [00160] For production scale recovery, variant α-amylase polypeptides can be enriched or partially purified as generally described above by removing cells via flocculation with polymers. Alternatively, the enzyme can be enriched or purified by microfiltration followed by
concentration by ultrafiltration using available membranes and equipment. However, for some applications, the enzyme does not need to be enriched or purified, and whole broth culture can be lysed and used without further treatment. The enzyme can then be processed, for example, into granules.
4. Compositions and Uses of Variant Amylases [00161] Variants amylases are useful for a variety of industrial applications. For example, variant amylases are useful in a starch conversion process, particularly in a saccharification process of a starch that has undergone liquefaction. The desired end-product may be any product that may be produced by the enzymatic conversion of the starch substrate. For example, the desired product may be a syrup rich in glucose and maltose, which can be used in other processes, such as the preparation of HFCS, or which can be converted into a number of other useful products, such as ascorbic acid intermediates (e.g. , gluconate; 2-keto-L-gulonic acid; 5- keto-gluconate; and 2,5-diketogluconate); 1,3-propanediol; aromatic amino acids (e.g. , tyrosine, phenylalanine and tryptophan); organic acids (e.g. , lactate, pyruvate, succinate, isocitrate, and oxaloacetate); amino acids (e.g., serine and glycine); antibiotics; antimicrobials; enzymes;
vitamins; and hormones.
[00162] The starch conversion process may be a precursor to, or simultaneous with, a fermentation process designed to produce alcohol for fuel or drinking (i.e. , potable alcohol). One skilled in the art is aware of various fermentation conditions that may be used in the production of these end-products. Variant amylases are also useful in compositions and methods of food preparation. These various uses of variant amylases are described in more detail below.
4.1. Preparation of Starch Substrates
[00163] Those of general skill in the art are well aware of available methods that may be used to prepare starch substrates for use in the processes disclosed herein. For example, a useful starch substrate may be obtained from tubers, roots, stems, legumes, cereals or whole grain. More specifically, the granular starch may be obtained from corn, cobs, wheat, barley, rye, triticale, milo, sago, millet, cassava, tapioca, sorghum, rice, peas, bean, banana, or potatoes. Corn contains about 60-68% starch; barley contains about 55-65% starch; millet contains about 75-80% starch; wheat contains about 60-65% starch; and polished rice contains 70-72% starch. Specifically contemplated starch substrates are corn starch and wheat starch. The starch from a grain may be ground or whole and includes corn solids, such as kernels, bran and/or cobs. The starch may also be highly refined raw starch or feedstock from starch refinery processes.
Various starches also are commercially available. For example, corn starch is available from Cerestar, Sigma, and Katayama Chemical Industry Co. (Japan); wheat starch is available from Sigma; sweet potato starch is available from Wako Pure Chemical Industry Co. (Japan); and potato starch is available from Nakaari Chemical Pharmaceutical Co. (Japan).
[00164] The starch substrate can be a crude starch from milled whole grain, which contains non-starch fractions, e.g., germ residues and fibers. Milling may comprise either wet milling or dry milling or grinding. In wet milling, whole grain is soaked in water or dilute acid to separate the grain into its component parts, e.g., starch, protein, germ, oil, kernel fibers. Wet milling efficiently separates the germ and meal (i.e., starch granules and protein) and is especially suitable for production of syrups. In dry milling or grinding, whole kernels are ground into a fine powder and often processed without fractionating the grain into its component parts. In some cases, oils from the kernels are recovered. Dry ground grain thus will comprise significant amounts of non-starch carbohydrate compounds, in addition to starch. Dry grinding of the starch substrate can be used for production of ethanol and other biochemicals. The starch to be processed may be a highly refined starch quality, for example, at least 90%, at least 95%, at least 97%, or at least 99.5% pure.
4.2. Gelatinization and Liquefaction of Starch
[00165] As used herein, the term "liquefaction" or "liquefy" means a process by which starch is converted to less viscous and shorter chain dextrins. Generally, this process involves gelatinization of starch simultaneously with or followed by the addition of an a-amylase, although additional liquefaction-inducing enzymes optionally may be added. In some embodiments, the starch substrate prepared as described above is slurried with water. The starch slurry may contain starch as a weight percent of dry solids of about 10-55%, about 20-45%, about 30-45%, about 30-40%, or about 30-35%. a-Amylase (EC 3.2.1.1) may be added to the slurry, with a metering pump, for example. The a-amylase typically used for this application is a thermally stable, bacterial a-amylase, such as a Geobacillus stearothermophilus a-amylase. The α-amylase is usually supplied, for example, at about 1500 units per kg dry matter of starch. To optimize α-amylase stability and activity, the pH of the slurry typically is adjusted to about pH 5.5-6.5 and about 1 mM of calcium (about 40 ppm free calcium ions) can also be added. Geobacillus stearothermophilus variants or other a- amylases may require different conditions. Bacterial α-amylase remaining in the slurry following liquefaction may be deactivated via a number of methods, including lowering the pH in a subsequent reaction step or by removing calcium from the slurry in cases where the enzyme is dependent upon calcium. [00166] The slurry of starch plus the a-amylase may be pumped continuously through a jet cooker, which is steam heated to 105°C. Gelatinization occurs rapidly under these conditions, and the enzymatic activity, combined with the significant shear forces, begins the hydrolysis of the starch substrate. The residence time in the jet cooker is brief. The partly gelatinized starch may be passed into a series of holding tubes maintained at 105-110°C and held for 5-8 min. to complete the gelatinization process ("primary liquefaction"). Hydrolysis to the required DE is completed in holding tanks at 85-95°C or higher temperatures for about 1 to 2 hours ("secondary liquefaction"). These tanks may contain baffles to discourage back mixing. As used herein, the term "minutes of secondary liquefaction" refers to the time that has elapsed from the start of secondary liquefaction to the time that the Dextrose Equivalent (DE) is measured. The slurry is then allowed to cool to room temperature. This cooling step can be 30 minutes to 180 minutes, e.g. 90 minutes to 120 minutes. The liquefied starch typically is in the form of a slurry having a dry solids content (w/w) of about 10-50%; about 10-45%; about 15-40%; about 20-40%; about 25-40%; or about 25-35%. [00167] Liquefaction with variant amylases advantageously can be conducted at low pH, eliminating the requirement to adjust the pH to about pH 5.5-6.5. Variants amylases can be used for liquefaction at a pH range of 2 to 7, e.g., pH 3.0 - 7.5, pH 4.0 - 6.0, or pH 4.5 - 5.8. Variant amylases can maintain liquefying activity at a temperature range of about 85°C - 95°C, e.g., 85°C, 90°C, or 95°C. For example, liquefaction can be conducted with 800 μg an amylase in a solution of 25% DS corn starch for 10 min at pH 5.8 and 85°C, or pH 4.5 and 95°C, for example. Liquefying activity can be assayed using any of a number of known viscosity assays in the art.
4.3. Saccharification
[00168] The liquefied starch can be saccharified into a syrup rich in lower DP (e.g., DPI + DP2) saccharides, using variant amylases, optionally in the presence of another enzyme(s). The exact composition of the products of saccharification depends on the combination of enzymes used, as well as the type of granular starch processed. Advantageously, the syrup obtainable using the provided variant amylases may contain a weight percent of DP2 of the total oligosaccharides in the saccharified starch exceeding 30%, e.g., 45% - 65% or 55% - 65%. The weight percent of (DPI + DP2) in the saccharified starch may exceed about 70%, e.g., 75% - 85% or 80% - 85%. The present amylases also produce a relatively high yield of glucose, e.g., DPI > 20%, in the syrup product. [00169] Whereas liquefaction is generally run as a continuous process, saccharification is often conducted as a batch process. Saccharification typically is most effective at temperatures of about 60-65°C and a pH of about 4.0-4.5, e.g., pH 4.3, necessitating cooling and adjusting the pH of the liquefied starch. Saccharification may be performed, for example, at a temperature between about 40°C, about 50°C, or about 55°C to about 60°C or about 65°C. Saccharification is normally conducted in stirred tanks, which may take several hours to fill or empty. Enzymes typically are added either at a fixed ratio to dried solids as the tanks are filled or added as a single dose at the commencement of the filling stage. A saccharification reaction to make a syrup typically is run over about 24-72 hours, for example, 24-48 hours. When a maximum or desired DE has been attained, the reaction is stopped by heating to 85°C for 5 min., for example. Further incubation will result in a lower DE, eventually to about 90 DE, as accumulated glucose re-polymerizes to isomaltose and/or other reversion products via an enzymatic reversion reaction and/or with the approach of thermodynamic equilibrium. When using an amylase,
saccharification optimally is conducted at a temperature range of about 30°C to about 75°C, e.g., 45°C - 75°C or 47°C - 74°C. The saccharifying may be conducted over a pH range of about pH 3 to about pH 7, e.g., pH 3.0 - pH 7.5, pH 3.5 - pH 5.5, pH 3.5, pH 3.8, or pH 4.5.
[00170] An amylase may be added to the slurry in the form of a composition. Amylase can be added to a slurry of a granular starch substrate in an amount of about 0.6 - 10 ppm ds, e.g., 2 ppm ds. An amylase can be added as a whole broth, clarified, enriched, partially purified, or purified enzyme. The specific activity of the amylase may be about 300 U/mg of enzyme, for example, measured with the PAHBAH assay. The amylase also can be added as a whole broth product.
[00171] An amylase may be added to the slurry as an isolated enzyme solution. For example, an amylase can be added in the form of a cultured cell material produced by host cells expressing an amylase. An amylase may also be secreted by a host cell into the reaction medium during the fermentation or SSF process, such that the enzyme is provided continuously into the reaction. The host cell producing and secreting amylase may also express an additional enzyme, such as a glucoamylase. For example, U.S. Patent No. 5,422,267 discloses the use of a glucoamylase in yeast for production of alcoholic beverages. For example, a host cell, e.g., Trichoderma reesei or Aspergillus niger, may be engineered to co-express an amylase and a glucoamylase, e.g., HgGA, TrGA, or a TrGA variant, during saccharification. The host cell can be genetically modified so as not to express its endogenous glucoamylase and/or other enzymes, proteins or other materials. The host cell can be engineered to express a broad spectrum of various saccharolytic enzymes. For example, the recombinant yeast host cell can comprise nucleic acids encoding a glucoamylase, an alpha-glucosidase, an enzyme that utilizes pentose sugar, an a-amylase, a pullulanase, an isoamylase, and/or an isopullulanase. See, e.g., WO 2011/153516 A2.
4.4. Isomerization [00172] The soluble starch hydrolysate produced by treatment with amylase can be converted into high fructose starch-based syrup (HFSS), such as high fructose corn syrup (HFCS). This conversion can be achieved using a glucose isomerase, particularly a glucose isomerase immobilized on a solid support. The pH is increased to about 6.0 to about 8.0, e.g., pH 7.5 (depending on the isomerase), and Ca2+ is removed by ion exchange. Suitable isomerases include Sweetzyme®, ΓΓ (Novozymes A/S); G-zyme® IMGI, and G-zyme® G993, Ketomax®, G-zyme® G993, G-zyme® G993 liquid, and GenSweet® IGI. Following isomerization, the mixture typically contains about 40-45% fructose, e.g., 42% fructose.
4.5. Fermentation
[00173] The soluble starch hydrolysate, particularly a glucose rich syrup, can be fermented by contacting the starch hydrolysate with a fermenting organism typically at a temperature around 32°C, such as from 30°C to 35°C for alcohol-producing yeast. The temperature and pH of the fermentation will depend upon the fermenting organism. EOF products include metabolites, such as citric acid, lactic acid, succinic acid, mono sodium glutamate, gluconic acid, sodium gluconate, calcium gluconate, potassium gluconate, itaconic acid and other carboxylic acids, glucono delta-lactone, sodium erythorbate, lysine and other amino acids, omega 3 fatty acid, butanol, isoprene, 1,3-propanediol and other biomaterials.
[00174] Ethanologenic microorganisms include yeast, such as Saccharomyces cerevisiae and bacteria, e.g., Zymomonas moblis, expressing alcohol dehydrogenase and pyruvate
decarboxylase. The ethanologenic microorganism can express xylose reductase and xylitol dehydrogenase, which convert xylose to xylulose. Improved strains of ethanologenic microorganisms, which can withstand higher temperatures, for example, are known in the art and can be used. See Liu et al. (2011) Sheng Wu Gong Cheng Xue Bao 27(7): 1049-56.
Commercial sources of yeast include ETHANOL RED® (LeSaffre); Thermosacc®
(Lallemand); RED STAR® (Red Star); FERMIOL® (DSM Specialties); and SUPERSTART® (AUtech). Microorganisms that produce other metabolites, such as citric acid and lactic acid, by fermentation are also known in the art. See, e.g., Papagianni (2007) "Advances in citric acid fermentation by Aspergillus niger. biochemical aspects, membrane transport and modeling," Biotechnol. Adv. 25(3): 244-63; John et al. (2009) "Direct lactic acid fermentation: focus on simultaneous saccharification and lactic acid production," Biotechnol. Adv. 27(2): 145-52.
[00175] The saccharification and fermentation processes may be carried out as an SSF process. Fermentation may comprise subsequent enrichment purification, and recovery of ethanol, for example. During the fermentation, the ethanol content of the broth or "beer" may reach about 8-18% v/v, e.g., 14-15% v/v. The broth may be distilled to produce enriched, e.g., 96% pure, solutions of ethanol. Further, C02 generated by fermentation may be collected with a C02 scrubber, compressed, and marketed for other uses, e.g., carbonating beverage or dry ice production. Solid waste from the fermentation process may be used as protein-rich products, e.g., livestock feed.
[00176] As mentioned above, an SSF process can be conducted with fungal cells that express and secrete amylase continuously throughout SSF. The fungal cells expressing amylase also can be the fermenting microorganism, e.g., an ethanologenic microorganism. Ethanol production thus can be carried out using a fungal cell that expresses sufficient amylase so that less or no enzyme has to be added exogenously. The fungal host cell can be from an appropriately engineered fungal strain. Fungal host cells that express and secrete other enzymes, in addition to amylase, also can be used. Such cells may express glucoamylase and/or a pullulanase, phytase, ί /ια-glucosidase, isoamylase, beta-amylase cellulase, xylanase, other hemicellulases, protease, beta-glucosidase, pectinase, esterase, redox enzymes, transferase, or other enzyme. [00177] A variation on this process is a "fed-batch fermentation" system, where the substrate is added in increments as the fermentation progresses. Fed-batch systems are useful when catabolite repression may inhibit the metabolism of the cells and where it is desirable to have limited amounts of substrate in the medium. The actual substrate concentration in fed-batch systems is estimated by the changes of measurable factors such as pH, dissolved oxygen and the partial pressure of waste gases, such as C02. Batch and fed-batch fermentations are common and well known in the art.
[00178] Continuous fermentation is an open system where a defined fermentation medium is added continuously to a bioreactor, and an equal amount of conditioned medium is removed simultaneously for processing. Continuous fermentation generally maintains the cultures at a constant high density where cells are primarily in log phase growth. Continuous fermentation permits modulation of cell growth and/or product concentration. For example, a limiting nutrient such as the carbon source or nitrogen source is maintained at a fixed rate and all other parameters are allowed to moderate. Because growth is maintained at a steady state, cell loss due to medium being drawn off should be balanced against the cell growth rate in the fermentation. Methods of optimizing continuous fermentation processes and maximizing the rate of product formation are well known in the art of industrial microbiology.
4.6. Compositions Comprising Variants Amylases
[00179] Variant amylases may be combined with a glucoamylase (EC 3.2.1.3), e.g., a Trichoderma glucoamylase or variant thereof. An exemplary glucoamylase is Trichoderma reesei glucoamylase (TrGA) and variants thereof that possess superior specific activity and thermal stability. See U.S. Published Applications Nos. 2006/0094080, 2007/0004018, and 2007/0015266 (Danisco US Inc.). Suitable variants of TrGA include those with glucoamylase activity and at least 80%, at least 90%, or at least 95% sequence identity to wild-type TrGA. Variant amylases advantageously increase the yield of glucose produced in a saccharification process catalyzed by TrGA.
[00180] Alternatively, the glucoamylase may be another glucoamylase derived from plants (including algae), fungi, or bacteria. For example, the glucoamylases may be Aspergillus niger Gl or G2 glucoamylase or its variants {e.g., Boel et al. (1984) EMBO J. 3: 1097-1102; WO 92/00381; WO 00/04136 (Novo Nordisk A/S)); and A. awamori glucoamylase {e.g., WO 84/02921 (Cetus Corp.)). Other contemplated Aspergillus glucoamylase include variants with enhanced thermal stability, e.g., G137A and G139A (Chen et al. (1996) Prot. Eng. 9: 499-505); D257E and D293E/Q (Chen et al. (1995) Prot. Eng. 8: 575-582); N182 (Chen et al. (1994) Biochem. J. 301: 275-281); A246C (Fierobe et al. (1996) Biochemistry, 35: 8698-8704); and variants with Pro residues in positions A435 and S436 (Li et al. (1997) Protein Eng. 10: 1199- 1204). Other contemplated glucoamylases include Talaromyces glucoamylases, in particular derived from T. emersonii {e.g., WO 99/28448 (Novo Nordisk A/S), T. leycettanus {e.g., U.S. Patent No. RE 32,153 (CPC International, Inc.)), T. duponti, or T. thermophilus {e.g., U.S. Patent No. 4,587,215). Contemplated bacterial glucoamylases include glucoamylases from the genus Clostridium, in particular C. thermoamylolyticum {e.g., EP 135,138 (CPC International, Inc.) and C. thermohydrosulfuricum {e.g., WO 86/01831 (Michigan Biotechnology Institute)). Suitable glucoamylases include the glucoamylases derived from Aspergillus oryzae, such as a glucoamylase shown in SEQ ID NO:2 in WO 00/04136 (Novo Nordisk A/S). Also suitable are commercial glucoamylases, such as AMG 200L; AMG 300 L; SAN™ SUPER and AMG™ E (Novozymes); OPTIDEX® 300 and OPTIDEX L-400 (Danisco US Inc.); AMIGASE™ and AMIGASE™ PLUS (DSM); G-ZYME® G900 (Enzyme Bio-Systems); and G-ZYME® G990 ZR {A. niger glucoamylase with a low protease content). Still other suitable glucoamylases include Aspergillus fumigatus glucoamylase, Talaromyces glucoamylase, Thielavia glucoamylase, Trametes glucoamylase, Thermomyces glucoamylase, Athelia glucoamylase, or Humicola glucoamylase (e.g., HgGA). Glucoamylases typically are added in an amount of about 0.1 - 2 glucoamylase units (GAU)/g ds, e.g., about 0.16 GAU/g ds, 0.23 GAU/g ds, or 0.33 GAU/g ds.
[00181] Other suitable enzymes that can be used with amylase include a phytase, protease, pullulanase, β-amylase, isoamylase, a different a-amylase, alpha-glucosidase, cellulase, xylanase, other hemicellulases, beta-glucosidase, transferase, pectinase, lipase, cutinase, esterase, redox enzymes, or a combination thereof. For example, a debranching enzyme, such as an isoamylase (EC 3.2.1.68), may be added in effective amounts well known to the person skilled in the art. A pullulanase (EC 3.2.1.41), e.g., Promozyme®, is also suitable. Pullulanase typically is added at 100 U/kg ds. Further suitable enzymes include proteases, such as fungal and bacterial proteases. Fungal proteases include those obtained from Aspergillus , such as A. niger, A. awamori, A. oryzae; Mucor (e.g., M. miehei); Rhizopus; and Trichoderma. [00182] β-Amylases (EC 3.2.1.2) are exo-acting maltogenic amylases, which catalyze the hydrolysis of 1,4-a-glucosidic linkages into amylopectin and related glucose polymers, thereby releasing maltose. β-Amylases have been isolated from various plants and microorganisms. See Fogarty et al. (1979) in PROGRESS IN INDUSTRIAL MICROBIOLOGY, Vol. 15, pp. 112-115. These β-Amylases have optimum temperatures in the range from 40°C to 65°C and optimum pH in the range from about 4.5 to about 7.0. Contemplated β-amylases include, but are not limited to, β-amylases from barley Spezyme® BBA 1500, Spezyme® DBA, Optimalt™ ME, Optimalt™ BBA (Danisco US Inc.); and Novozym™ WBA (Novozymes A/S) .
[00183] Compositions comprising the present amylases may be aqueous or non-aqueous formulations, granules, powders, gels, slurries, pastes, etc., which may further comprise any one or more of the additional enzymes listed, herein, along with buffers, salts, preservatives, water, co-solvents, surfactants, and the like. Such compositions may work in combination with endogenous enzymes or other ingredients already present in a slurry, water bath, washing machine, food or drink product, etc, for example, endogenous plant (including algal) enzymes, residual enzymes from a prior processing step, and the like. 5. Compositions and Methods for Baking and Food Preparation
[00184] The present invention also relates to a "food composition," including but not limited to a food product, animal feed and/or food/feed additives, comprising an amylase, and methods for preparing such a food composition comprising mixing variant amylase with one or more food ingredients, or uses thereof.
[00185] Furthermore, the present invention relates to the use of an amylase in the preparation of a food composition, wherein the food composition is baked subsequent to the addition of the polypeptide of the invention. As used herein the term "baking composition" means any composition and/or additive prepared in the process of providing a baked food product, including but not limited to bakers flour, a dough, a baking additive and/or a baked product. The food composition or additive may be liquid or solid.
[00186] As used herein, the term "flour" means milled or ground cereal grain. The term "flour" also may mean Sago or tuber products that have been ground or mashed. In some embodiments, flour may also contain components in addition to the milled or mashed cereal or plant matter. An example of an additional component, although not intended to be limiting, is a leavening agent. Cereal grains include wheat, oat, rye, and barley. Tuber products include tapioca flour, cassava flour, and custard powder. The term "flour" also includes ground corn flour, maize-meal, rice flour, whole-meal flour, self -rising flour, tapioca flour, cassava flour, ground rice, enriched flower, and custard powder.
[00187] For the commercial and home use of flour for baking and food production, it is important to maintain an appropriate level of a-amylase activity in the flour. A level of activity that is too high may result in a product that is sticky and/or doughy and therefore unmarketable. Flour with insufficient α-amylase activity may not contain enough sugar for proper yeast function, resulting in dry, crumbly bread, or baked products. Accordingly, an amylase, by itself or in combination with another a-amylase(s), may be added to the flour to augment the level of endogenous α-amylase activity in flour.
[00188] An amylase can further be added alone or in a combination with other amylases to prevent or retard staling, i.e., crumb firming of baked products. The amount of anti-staling amylase will typically be in the range of 0.01-10 mg of enzyme protein per kg of flour, e.g., 0.5 mg/kg ds. Additional anti-staling amylases that can be used in combination with an amylase include an endo-amylase, e.g., a bacterial endo-amylase from Bacillus. The additional amylase can be another maltogenic α-amylase (EC 3.2.1.133), e.g., from Bacillus. Novamyl® is an exemplary maltogenic α-amylase from B. stearothermophilus strain NCIB 11837 and is described in Christophersen et al. (1997) Starch 50: 39-45. Other examples of anti-staling endo- amylases include bacterial a-amylases derived from Bacillus, such as B. licheniformis or B. amyloliquefaciens. The anti-staling amylase may be an exo-amylase, such as β-amylase, e.g., from plant sources, such as soy bean, or from microbial sources, such as Bacillus.
[00189] The baking composition comprising an amylase further can comprise a
phospholipase or enzyme with phospholipase activity. An enzyme with phospholipase activity has an activity that can be measured in Lipase Units (LU). The phospholipase may have A\ or A2 activity to remove fatty acid from the phospholipids, forming a lysophospholipid. It may or may not have lipase activity, i.e., activity on triglyceride substrates. The phospholipase typically has a temperature optimum in the range of 30-90°C, e.g., 30-70°C. The added phospholipases can be of animal origin, for example, from pancreas, e.g., bovine or porcine pancreas, snake venom or bee venom. Alternatively, the phospholipase may be of microbial origin, e.g., from filamentous fungi, yeast or bacteria, for example.
[00190] The phospholipase is added in an amount that improves the softness of the bread during the initial period after baking, particularly the first 24 hours. The amount of
phospholipase will typically be in the range of 0.01-10 mg of enzyme protein per kg of flour, e.g., 0.1-5 mg/kg. That is, phospholipase activity generally will be in the range of 20-1000 LU/kg of flour, where a Lipase Unit is defined as the amount of enzyme required to release 1 μιηοΐ butyric acid per minute at 30°C, pH 7.0, with gum arabic as emulsifier and tributyrin as substrate.
[00191] Compositions of dough generally comprise wheat meal or wheat flour and/or other types of meal, flour or starch such as corn flour, cornstarch, rye meal, rye flour, oat flour, oatmeal, soy flour, sorghum meal, sorghum flour, potato meal, potato flour or potato starch. The dough may be fresh, frozen or par-baked. The dough can be a leavened dough or a dough to be subjected to leavening. The dough may be leavened in various ways, such as by adding chemical leavening agents, e.g., sodium bicarbonate or by adding a leaven, i.e., fermenting dough. Dough also may be leavened by adding a suitable yeast culture, such as a culture of Saccharomyces cerevisiae (baker's yeast), e.g., a commercially available strain of S. cerevisiae.
[00192] The dough may also comprise other conventional dough ingredients, e.g., proteins, such as milk powder, gluten, and soy; eggs {e.g., whole eggs, egg yolks or egg whites); an oxidant, such as ascorbic acid, potassium bromate, potassium iodate, azodicarbonamide (ADA) or ammonium persulfate; an amino acid such as L-cysteine; a sugar; or a salt, such as sodium chloride, calcium acetate, sodium sulfate or calcium sulfate. The dough further may comprise fat, e.g., triglyceride, such as granulated fat or shortening. The dough further may comprise an emulsifier such as mono- or diglycerides, diacetyl tartaric acid esters of mono- or diglycerides, sugar esters of fatty acids, polyglycerol esters of fatty acids, lactic acid esters of monoglycerides, acetic acid esters of monoglycerides, polyoxyethylene stearates, or lysolecithin. In particular, the dough can be made without addition of emulsifiers.
[00193] The dough product may be any processed dough product, including fried, deep fried, roasted, baked, steamed and boiled doughs, such as steamed bread and rice cakes. In one embodiment, the food product is a bakery product. Typical bakery (baked) products include bread - such as loaves, rolls, buns, bagels, pizza bases etc. pastry, pretzels, tortillas, cakes, cookies, biscuits, crackers etc.
[00194] Optionally, an additional enzyme may be used together with the anti-staling amylase and the phospholipase. The additional enzyme may be a second amylase, such as an
amyloglucosidase, a β-amylase, a cyclodextrin glucanotransferase, or the additional enzyme may be a peptidase, in particular an exopeptidase, a transglutaminase, a lipase, a cellulase, a xylanase, a protease, a protein disulfide isomerase, e.g., a protein disulfide isomerase as disclosed in WO 95/00636, for example, a glycosyltransferase, a branching enzyme (1,4-a- glucan branching enzyme), a 4-a-glucanotransferase (dextrin glycosyltransferase) or an oxidoreductase, e.g., a peroxidase, a laccase, a glucose oxidase, a pyranose oxidase, a lipooxygenase, an L-amino acid oxidase or a carbohydrate oxidase. The additional enzyme(s) may be of any origin, including mammalian and plant, and particularly of microbial (bacterial, yeast or fungal) origin and may be obtained by techniques conventionally used in the art. [00195] The xylanase is typically of microbial origin, e.g., derived from a bacterium or fungus, such as a strain of Aspergillus. Xylanases include Pentopan® and Novozym 384®, for example, which are commercially available xylanase preparations produced from Trichoderma reesei. The amyloglucosidase may be an A. niger amyloglucosidase (such as AMG®). Other useful amylase products include Grindamyl® A 1000 or A 5000 (Grindsted Products, Denmark) and Amylase® H or Amylase® P (DSM). The glucose oxidase may be a fungal glucose oxidase, in particular an Aspergillus niger glucose oxidase (such as Gluzyme®). An exemplary protease is Neutrase®.
[00196] The process may be used for any kind of baked product prepared from dough, either of a soft or a crisp character, either of a white, light or dark type. Examples are bread, particularly white, whole-meal or rye bread, typically in the form of loaves or rolls, such as, but not limited to, French baguette-type bread, pita bread, tortillas, cakes, pancakes, biscuits, cookies, pie crusts, crisp bread, steamed bread, pizza and the like. [00197] An amylase may be used in a pre-mix, comprising flour together with an anti-staling amylase, a phospholipase, and/or a phospholipid. The pre-mix may contain other dough- improving and/or bread-improving additives, e.g., any of the additives, including enzymes, mentioned above. An amylase can be a component of an enzyme preparation comprising an anti-staling amylase and a phospholipase, for use as a baking additive.
[00198] The enzyme preparation is optionally in the form of a granulate or agglomerated powder. The preparation can have a narrow particle size distribution with more than 95% (by weight) of the particles in the range from 25 to 500 μιη. Granulates and agglomerated powders may be prepared by conventional methods, e.g., by spraying an amylase onto a carrier in a fluid- bed granulator. The carrier may consist of particulate cores having a suitable particle size. The carrier may be soluble or insoluble, e.g., a salt (such as NaCl or sodium sulfate), a sugar (such as sucrose or lactose), a sugar alcohol (such as sorbitol), starch, rice, corn grits, or soy.
[00199] Enveloped particles, i.e., α-amylase particles, can comprise an amylase. To prepare enveloped α-amylase particles, the enzyme is contacted with a food grade lipid in sufficient quantity to suspend all of the α-amylase particles. Food grade lipids, as used herein, may be any naturally organic compound that is insoluble in water but is soluble in non-polar organic solvents such as hydrocarbon or diethyl ether. Suitable food grade lipids include, but are not limited to, triglycerides either in the form of fats or oils that are either saturated or unsaturated. Examples of fatty acids and combinations thereof which make up the saturated triglycerides include, but are not limited to, butyric (derived from milk fat), palmitic (derived from animal and plant fat), and/or stearic (derived from animal and plant fat). Examples of fatty acids and combinations thereof which make up the unsaturated triglycerides include, but are not limited to, palmitoleic (derived from animal and plant fat), oleic (derived from animal and plant fat), linoleic (derived from plant oils), and/or linolenic (derived from linseed oil). Other suitable food grade lipids include, but are not limited to, monoglycerides and diglycerides derived from the triglycerides discussed above, phospholipids and glycolipids.
[00200] The food grade lipid, particularly in the liquid form, is contacted with a powdered form of the α-amylase particles in such a fashion that the lipid material covers at least a portion of the surface of at least a majority, e.g., 100% of the α-amylase particles. Thus, each a-amylase particle is individually enveloped in a lipid. For example, all or substantially all of the a- amylase particles are provided with a thin, continuous, enveloping film of lipid. This can be accomplished by first pouring a quantity of lipid into a container, and then slurrying the α-amylase particles so that the lipid thoroughly wets the surface of each α-amylase particle. After a short period of stirring, the enveloped a-amylase particles, carrying a substantial amount of the lipids on their surfaces, are recovered. The thickness of the coating so applied to the particles of α-amylase can be controlled by selection of the type of lipid used and by repeating the operation in order to build up a thicker film, when desired. [00201] The storing, handling and incorporation of the loaded delivery vehicle can be accomplished by means of a packaged mix. The packaged mix can comprise the enveloped a-amylase. However, the packaged mix may further contain additional ingredients as required by the manufacturer or baker. After the enveloped α-amylase has been incorporated into the dough, the baker continues through the normal production process for that product. [00202] The advantages of enveloping the α-amylase particles are two-fold. First, the food grade lipid protects the enzyme from thermal denaturation during the baking process for those enzymes that are heat labile. Consequently, while the α-amylase is stabilized and protected during the proving and baking stages, it is released from the protective coating in the final baked good product, where it hydrolyzes the glucosidic linkages in polyglucans. The loaded delivery vehicle also provides a sustained release of the active enzyme into the baked good. That is, following the baking process, active α-amylase is continually released from the protective coating at a rate that counteracts, and therefore reduces the rate of, staling mechanisms.
[00203] In general, the amount of lipid applied to the α-amylase particles can vary from a few percent of the total weight of the α-amylase to many times that weight, depending upon the nature of the lipid, the manner in which it is applied to the α-amylase particles, the composition of the dough mixture to be treated, and the severity of the dough-mixing operation involved.
[00204] The loaded delivery vehicle, i.e., the lipid-enveloped enzyme, is added to the ingredients used to prepare a baked good in an effective amount to extend the shelf-life of the baked good. The baker computes the amount of enveloped a-amylase, prepared as discussed above, that will be required to achieve the desired anti- staling effect. The amount of the enveloped α-amylase required is calculated based on the concentration of enzyme enveloped and on the proportion of α-amylase to flour specified. A wide range of concentrations has been found to be effective, although, as has been discussed, observable improvements in anti-staling do not correspond linearly with the α-amylase concentration, but above certain minimal levels, large increases in α-amylase concentration produce little additional improvement. The a- amylase concentration actually used in a particular bakery production could be much higher than the minimum necessary to provide the baker with some insurance against inadvertent under- measurement errors by the baker. The lower limit of enzyme concentration is determined by the minimum anti-staling effect the baker wishes to achieve.
[00205] A method of preparing a baked good may comprise: a) preparing lipid-coated a- amylase particles, where substantially all of the a-amylase particles are coated; b) mixing a dough containing flour; c) adding the lipid-coated a-amylase to the dough before the mixing is complete and terminating the mixing before the lipid coating is removed from the a-amylase; d) proofing the dough; and e) baking the dough to provide the baked good, where the α-amylase is inactive during the mixing, proofing and baking stages and is active in the baked good.
[00206] The enveloped α-amylase can be added to the dough during the mix cycle, e.g., near the end of the mix cycle. The enveloped α-amylase is added at a point in the mixing stage that allows sufficient distribution of the enveloped α-amylase throughout the dough; however, the mixing stage is terminated before the protective coating becomes stripped from the a-amylase particle(s). Depending on the type and volume of dough, and mixer action and speed, anywhere from one to six minutes or more might be required to mix the enveloped α-amylase into the dough, but two to four minutes is average. Thus, several variables may determine the precise procedure. First, the quantity of enveloped α-amylase should have a total volume sufficient to allow the enveloped α-amylase to be spread throughout the dough mix. If the preparation of enveloped α-amylase is highly concentrated, additional oil may need to be added to the pre-mix before the enveloped α-amylase is added to the dough. Recipes and production processes may require specific modifications; however, good results generally can be achieved when 25% of the oil specified in a bread dough formula is held out of the dough and is used as a carrier for a concentrated enveloped α-amylase when added near the end of the mix cycle. In bread or other baked goods, particularly those having a low fat content, e.g., French-style breads, an enveloped α-amylase mixture of approximately 1% of the dry flour weight is sufficient to admix the enveloped α-amylase properly with the dough. The range of suitable percentages is wide and depends on the formula, finished product, and production methodology requirements of the individual baker. Second, the enveloped α-amylase suspension should be added to the mix with sufficient time for complete mixture into the dough, but not for such a time that excessive mechanical action strips the protective lipid coating from the enveloped α-amylase particles. [00207] In a further aspect of the invention, the food composition is an oil, meat, lard, composition comprising an amylase. In this context the term "[oil/meat/lard] composition" means any composition, based on, made from and/or containing oil, meat or lard, respectively. Another aspect the invention relates to a method of preparing an oil or meat or lard composition and/or additive comprising an amylase, comprising mixing the polypeptide of the invention with a oil/meat/lard composition and/or additive ingredients.
[00208] In a further aspect of the invention, the food composition is an animal feed composition, animal feed additive and/or pet food comprising an amylase and variants thereof. The present invention further relates to a method for preparing such an animal feed composition, animal feed additive composition and/or pet food comprising mixing an amylase and variants thereof with one or more animal feed ingredients and/or animal feed additive ingredients and/or pet food ingredients. Furthermore, the present invention relates to the use of an amylase in the preparation of an animal feed composition and/or animal feed additive composition and/or pet food.
[00209] The term "animal" includes all non-ruminant and ruminant animals. In a particular embodiment, the animal is a non-ruminant animal, such as a horse and a mono-gastric animal. Examples of mono-gastric animals include, but are not limited to, pigs and swine, such as piglets, growing pigs, sows; poultry such as turkeys, ducks, chicken, broiler chicks, layers; fish such as salmon, trout, tilapia, catfish and carps; and crustaceans such as shrimps and prawns. In a further embodiment the animal is a ruminant animal including, but not limited to, cattle, young calves, goats, sheep, giraffes, bison, moose, elk, yaks, water buffalo, deer, camels, alpacas, llamas, antelope, pronghorn and nilgai.
[00210] In the present context, it is intended that the term "pet food" is understood to mean a food for a household animal such as, but not limited to dogs, cats, gerbils, hamsters, chinchillas, fancy rats, guinea pigs; avian pets, such as canaries, parakeets, and parrots; reptile pets, such as turtles, lizards and snakes; and aquatic pets, such as tropical fish and frogs.
[00211] The terms "animal feed composition," "feedstuff and "fodder" are used
interchangeably and may comprise one or more feed materials selected from the group comprising a) cereals, such as small grains (e.g., wheat, barley, rye, oats and combinations thereof) and/or large grains such as maize or sorghum; b) by products from cereals, such as corn gluten meal, Distillers Dried Grain Solubles (DDGS) (particularly corn based Distillers Dried Grain Solubles (cDDGS), wheat bran, wheat middlings, wheat shorts, rice bran, rice hulls, oat hulls, palm kernel, and citrus pulp; c) protein obtained from sources such as soya, sunflower, peanut, lupin, peas, fava beans, cotton, canola, fish meal, dried plasma protein, meat and bone meal, potato protein, whey, copra, sesame; d) oils and fats obtained from vegetable and animal sources; e) minerals and vitamins. 6. Textile Desizing Compositions and Use
[00212] Also contemplated are compositions and methods of treating fabrics (e.g., to desize a textile) using an amylase. Fabric-treating methods are well known in the art (see, e.g., U.S. Patent No. 6,077,316). For example, the feel and appearance of a fabric can be improved by a method comprising contacting the fabric with an amylase in a solution. The fabric can be treated with the solution under pressure.
[00213] An amylase can be applied during or after the weaving of a textile, or during the desizing stage, or one or more additional fabric processing steps. During the weaving of textiles, the threads are exposed to considerable mechanical strain. Prior to weaving on mechanical looms, warp yarns are often coated with sizing starch or starch derivatives to increase their tensile strength and to prevent breaking. An amylase can be applied during or after the weaving to remove these sizing starch or starch derivatives. After weaving, an amylase can be used to remove the size coating before further processing the fabric to ensure a homogeneous and wash-proof result. [00214] An amylase can be used alone or with other desizing chemical reagents and/or desizing enzymes to desize fabrics, including cotton-containing fabrics, as detergent additives, e.g. , in aqueous compositions. An amylase also can be used in compositions and methods for producing a stonewashed look on indigo-dyed denim fabric and garments. For the manufacture of clothes, the fabric can be cut and sewn into clothes or garments, which are afterwards finished. In particular, for the manufacture of denim jeans, different enzymatic finishing methods have been developed. The finishing of denim garment normally is initiated with an enzymatic desizing step, during which garments are subjected to the action of amylolytic enzymes to provide softness to the fabric and make the cotton more accessible to the subsequent enzymatic finishing steps. An amylase can be used in methods of finishing denim garments (e.g., a "bio-stoning process"), enzymatic desizing and providing softness to fabrics, and/or finishing process.
7. Cleaning Compositions
[00215] An aspect of the present compositions and methods is a cleaning composition that includes an amylase as a component. An amylase polypeptide can be used as a component in detergent compositions for hand washing, laundry washing, dishwashing, and other hard-surface cleaning. 7.1. Overview
[00216] Preferably, an amylase is incorporated into detergents at or near a concentration conventionally used for amylase in detergents. For example, an amylase polypeptide may be added in amount corresponding to 0.00001 - 1 mg (calculated as pure enzyme protein) of amylase per liter of wash/dishwash liquor. Exemplary formulations are provided herein, as exemplified by the following:
[00217] An amylase polypeptide may be a component of a detergent composition, as the only enzyme or with other enzymes including other amylolytic enzymes. As such, it may be included in the detergent composition in the form of a non-dusting granulate, a stabilized liquid, or a protected enzyme. Non-dusting granulates may be produced, e.g., as disclosed in U.S. Patent Nos. 4,106,991 and 4,661,452 and may optionally be coated by methods known in the art.
Examples of waxy coating materials are poly(ethylene oxide) products (polyethyleneglycol, PEG) with mean molar weights of 1,000 to 20,000; ethoxylated nonylphenols having from 16 to 50 ethylene oxide units; ethoxylated fatty alcohols in which the alcohol contains from 12 to 20 carbon atoms and in which there are 15 to 80 ethylene oxide units; fatty alcohols; fatty acids; and mono- and di- and triglycerides of fatty acids. Examples of film-forming coating materials suitable for application by fluid bed techniques are given in, for example, GB 1483591. Liquid enzyme preparations may, for instance, be stabilized by adding a polyol such as propylene glycol, a sugar or sugar alcohol, lactic acid or boric acid according to established methods. Other enzyme stabilizers are known in the art. Protected enzymes may be prepared according to the method disclosed in for example EP 238 216. Polyols have long been recognized as stabilizers of proteins, as well as improving protein solubility.
[00218] The detergent composition may be in any useful form, e.g., as powders, granules, pastes, or liquid. A liquid detergent may be aqueous, typically containing up to about 70% of water and 0% to about 30% of organic solvent. It may also be in the form of a compact gel type containing only about 30% water.
[00219] The detergent composition comprises one or more surfactants, each of which may be anionic, nonionic, cationic, or zwitterionic. The detergent will usually contain 0% to about 50% of anionic surfactant, such as linear alkylbenzenesulfonate (LAS); a-olefinsulfonate (AOS); alkyl sulfate (fatty alcohol sulfate) (AS); alcohol ethoxysulfate (AEOS or AES); secondary alkanesulfonates (SAS); a-sulfo fatty acid methyl esters; alkyl- or alkenylsuccinic acid; or soap. The composition may also contain 0% to about 40% of nonionic surfactant such as alcohol ethoxylate (AEO or AE), carboxylated alcohol ethoxylates, nonylphenol ethoxylate, alkylpolyglycoside, alkyldimethylamineoxide, ethoxylated fatty acid monoethanolamide, fatty acid monoethanolamide, or polyhydroxy alkyl fatty acid amide (as described for example in WO 92/06154).
[00220] The detergent composition may additionally comprise one or more other enzymes, such as proteases, another amylolytic enzyme, cutinase, lipase, cellulase, pectate lyase, perhydrolase, xylanase, peroxidase, and/or laccase in any combination.
[00221] The detergent may contain about 1% to about 65% of a detergent builder or complexing agent such as zeolite, diphosphate, triphosphate, phosphonate, citrate, nitrilotriacetic acid (NTA), ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTMPA), alkyl- or alkenylsuccinic acid, soluble silicates or layered silicates (e.g., SKS-6 from Hoechst). The detergent may also be unbuilt, i.e. essentially free of detergent builder. The enzymes can be used in any composition compatible with the stability of the enzyme. Enzymes generally can be protected against deleterious components by known forms of encapsulation, for example, by granulation or sequestration in hydro gels. Enzymes, and specifically amylases, either with or without starch binding domains, can be used in a variety of compositions including laundry and dishwashing applications, surface cleaners, as well as in compositions for ethanol production from starch or biomass.
[00222] The detergent may comprise one or more polymers. Examples include
carboxymethylcellulose (CMC), poly(vinylpyrrolidone) (PVP), polyethyleneglycol (PEG), poly(vinyl alcohol) (PVA), polycarboxylates such as polyacrylates, maleic/acrylic acid copolymers and lauryl methacrylate/acrylic acid copolymers.
[00223] The detergent may contain a bleaching system, which may comprise a H202 source such as perborate or percarbonate, which may be combined with a peracid-forming bleach activator such as tetraacetylethylenediamine (TAED) or nonanoyloxybenzenesulfonate (NOBS). Alternatively, the bleaching system may comprise peroxyacids (e.g., the amide, imide, or sulfone type peroxyacids). The bleaching system can also be an enzymatic bleaching system, for example, perhydrolase, such as that described in International PCT Application WO
2005/056783.
[00224] The enzymes of the detergent composition may be stabilized using conventional stabilizing agents, e.g., a polyol such as propylene glycol or glycerol; a sugar or sugar alcohol; lactic acid; boric acid or a boric acid derivative such as, e.g., an aromatic borate ester; and the composition may be formulated as described in, e.g., WO 92/19709 and WO 92/19708. [00225] The detergent may also contain other conventional detergent ingredients such as e.g. , fabric conditioners including clays, foam boosters, suds suppressors, anti-corrosion agents, soil- suspending agents, anti-soil redeposition agents, dyes, bactericides, tarnish inhibiters, optical brighteners, or perfumes. [00226] The pH (measured in aqueous solution at use concentration) is usually neutral or alkaline, e.g. , pH about 7.0 to about 11.0.
[00227] Particular forms of detergent compositions for inclusion of the present a-amylase are described below.
7.2. Heavy Duty Liquid (HDL) laundry detergent composition [00228] Exemplary HDL laundry detergent compositions includes a detersive surfactant
(10%-40% wt/wt), including an anionic detersive surfactant (selected from a group of linear or branched or random chain, substituted or unsubstituted alkyl sulphates, alkyl sulphonates, alkyl alkoxylated sulphate, alkyl phosphates, alkyl phosphonates, alkyl carboxylates, and/or mixtures thereof), and optionally non-ionic surfactant (selected from a group of linear or branched or random chain, substituted or unsubstituted alkyl alkoxylated alcohol, for example a C8-C18 alkyl ethoxylated alcohol and/or C6-C12 alkyl phenol alkoxylates), wherein the weight ratio of anionic detersive surfactant (with a hydrophilic index (HIc) of from 6.0 to 9) to non-ionic detersive surfactant is greater than 1 : 1. Suitable detersive surfactants also include cationic detersive surfactants (selected from a group of alkyl pyridinium compounds, alkyl quarternary ammonium compounds, alkyl quarternary phosphonium compounds, alkyl ternary sulphonium compounds, and/or mixtures thereof); zwitterionic and/or amphoteric detersive surfactants (selected from a group of alkanolamine sulpho-betaines); ampholytic surfactants; semi-polar non-ionic surfactants and mixtures thereof.
[00229] The composition may optionally include, a surfactancy boosting polymer consisting of amphiphilic alkoxylated grease cleaning polymers (selected from a group of alkoxylated polymers having branched hydrophilic and hydrophobic properties, such as alkoxylated polyalkylenimines in the range of 0.05wt - 10wt ) and/or random graft polymers (typically comprising of hydrophilic backbone comprising monomers selected from the group consisting of: unsaturated C -C carboxylic acids, ethers, alcohols, aldehydes, ketones, esters, sugar units, alkoxy units, maleic anhydride, saturated polyalcohols such as glycerol, and mixtures thereof; and hydrophobic side chain(s) selected from the group consisting of: C4-C25 alkyl group, polypropylene, polybutylene, vinyl ester of a saturated CrC6 mono-carboxylic acid, CrC6 alkyl ester of acrylic or methacrylic acid, and mixtures thereof. [00230] The composition may include additional polymers such as soil release polymers (include anionically end-capped polyesters, for example SRPl, polymers comprising at least one monomer unit selected from saccharide, dicarboxylic acid, polyol and combinations thereof, in random or block configuration, ethylene terephthalate-based polymers and co-polymers thereof in random or block configuration, for example Repel-o-tex SF, SF-2 and SRP6, Texcare
SRA100, SRA300, SRN100, SRN170, SRN240, SRN300 and SRN325, Marloquest SL), anti- redeposition polymers (0.1 wt to 10wt , include carboxylate polymers, such as polymers comprising at least one monomer selected from acrylic acid, maleic acid (or maleic anhydride), fumaric acid, itaconic acid, aconitic acid, mesaconic acid, citraconic acid, methylenemalonic acid, and any mixture thereof, vinylpyrrolidone homopolymer, and/or polyethylene glycol, molecular weight in the range of from 500 to 100,000 Da); cellulosic polymer (including those selected from alkyl cellulose, alkyl alkoxyalkyl cellulose, carboxyalkyl cellulose, alkyl carboxyalkyl cellulose examples of which include carboxymethyl cellulose, methyl cellulose, methyl hydroxyethyl cellulose, methyl carboxymethyl cellulose, and mixures thereof) and polymeric carboxylate (such as maleate/acrylate random copolymer or polyacrylate
homopolymer).
[00231] The composition may further include saturated or unsaturated fatty acid, preferably saturated or unsaturated C12-C24 fatty acid (0 wt to 10 wt ); deposition aids (examples for which include polysaccharides, preferably cellulosic polymers, poly diallyl dimethyl ammonium halides (D ADM AC), and co-polymers of DAD MAC with vinyl pyrrolidone, acrylamides, imidazoles, imidazolinium halides, and mixtures thereof, in random or block configuration, cationic guar gum, cationic cellulose such as cationic hydoxyethyl cellulose, cationic starch, cationic polyacylamides, and mixtures thereof.
[00232] The composition may further include dye transfer inhibiting agents, examples of which include manganese phthalocyanine, peroxidases, polyvinylpyrrolidone polymers, polyamine N-oxide polymers, copolymers of N-vinylpyrrolidone and N-vinylimidazole, polyvinyloxazolidones and polyvinylimidazoles and/or mixtures thereof; chelating agents, examples of which include ethylene-diamine-tetraacetic acid (EDTA), diethylene triamine penta methylene phosphonic acid (DTPMP), hydroxy-ethane diphosphonic acid (HEDP),
ethylenediamine Ν,Ν'-disuccinic acid (EDDS), methyl glycine diacetic acid (MGDA), diethylene triamine penta acetic acid (DTPA), propylene diamine tetracetic acid (PDT A), 2- hydroxypyridine-N-oxide (HPNO), or methyl glycine diacetic acid (MGDA), glutamic acid Ν,Ν-diacetic acid (N,N-dicarboxymethyl glutamic acid tetrasodium salt (GLDA), nitrilotriacetic acid (NTA), 4,5-dihydroxy-m-benzenedisulfonic acid, citric acid and any salts thereof, N- hydroxyethylethylenediaminetri-acetic acid (HEDTA), triethylenetetraaminehexaacetic acid (TTHA), N-hydroxyethyliminodiacetic acid (HEIDA), dihydroxyethylglycine (DHEG), ethylenediaminetetrapropionic acid (EDTP), and derivatives thereof.
[00233] The composition preferably included enzymes (generally about 0.01 wt active enzyme to 0.03wt active enzyme) selected from proteases, amylases, lipases, cellulases, choline oxidases, peroxidases/oxidases, pectate lyases, mannanases, cutinases, laccases, phospholipases, lysophospholipases, acyltransferases, perhydrolases, arylesterases, and any mixture thereof. The composition may include an enzyme stabilizer (examples of which include polyols such as propylene glycol or glycerol, sugar or sugar alcohol, lactic acid, reversible protease inhibitor, boric acid, or a boric acid derivative, e.g., an aromatic borate ester, or a phenyl boronic acid derivative such as 4-formylphenyl boronic acid).
[00234] The composition optionally include silicone or fatty-acid based suds suppressors; heuing dyes, calcium and magnesium cations, visual signaling ingredients, anti-foam (0.00 lwt to about 4.0wt%), and/or structurant/thickener (0.01wt to 5wt , selected from the group consisting of diglycerides and triglycerides, ethylene glycol distearate, microcrystalline cellulose, cellulose based materials, microfiber cellulose, biopolymers, xanthan gum, gellan gum, and mixtures thereof).
[00235] The composition can be any liquid form, for example a liquid or gel form, or any combination thereof. The composition may be in any unit dose form, for example a pouch. 7.3. Heavy Duty Dry/Solid (HDD) laundry detergent composition
[00236] Exemplary HDD laundry detergent compositions includes a detersive surfactant, including anionic detersive surfactants (e.g. , linear or branched or random chain, substituted or unsubstituted alkyl sulphates, alkyl sulphonates, alkyl alkoxylated sulphate, alkyl phosphates, alkyl phosphonates, alkyl carboxylates and/or mixtures thereof), non-ionic detersive surfactant (e.g. , linear or branched or random chain, substituted or unsubstituted Cg-Cig alkyl ethoxylates, and/or C6-C12 alkyl phenol alkoxylates), cationic detersive surfactants (e.g. , alkyl pyridinium compounds, alkyl quaternary ammonium compounds, alkyl quaternary phosphonium
compounds, alkyl ternary sulphonium compounds, and mixtures thereof), zwitterionic and/or amphoteric detersive surfactants (e.g. , alkanolamine sulpho-betaines), ampholytic surfactants, semi-polar non-ionic surfactants, and mixtures thereof; builders including phosphate free builders (for example zeolite builders examples which include zeolite A, zeolite X, zeolite P and zeolite MAP in the range of 0wt to less than 10wt ), phosphate builders (for example sodium tri-polyphosphate in the range of 0wt to less than 10wt ), citric acid, citrate salts and nitrilotriacetic acid, silicate salt (e.g. , sodium or potassium silicate or sodium meta-silicate in the range of 0wt to less than 10wt , or layered silicate (SKS-6)); carbonate salt (e.g., sodium carbonate and/or sodium bicarbonate in the range of 0wt to less than 80wt ); and bleaching agents including photobleaches (e.g., sulfonated zinc phthalocyanines, sulfonated aluminum phthalocyanines, xanthenes dyes, and mixtures thereof) hydrophobic or hydrophilic bleach activators (e.g. , dodecanoyl oxybenzene sulfonate, decanoyl oxybenzene sulfonate, decanoyl oxybenzoic acid or salts thereof, 3,5,5-trimethy hexanoyl oxybenzene sulfonate, tetraacetyl ethylene diamine-TAED, nonanoyloxybenzene sulfonate-NOBS, nitrile quats, and mixtures thereof), sources of hydrogen peroxide (e.g. , inorganic perhydrate salts examples of which include mono or tetra hydrate sodium salt of perborate, percarbonate, persulfate, perphosphate, or persilicate), preformed hydrophilic and/or hydrophobic peracids (e.g. , percarboxylic acids and salts, percarbonic acids and salts, perimidic acids and salts, peroxymono sulfuric acids and salts, and mixtures thereof), and/or bleach catalysts (e.g. , imine bleach boosters (examples of which include iminium cations and polyions), iminium zwitterions, modified amines, modified amine oxides, N-sulphonyl imines, N-phosphonyl imines, N-acyl imines, thiadiazole dioxides, perfluoroimines, cyclic sugar ketones, and mixtures thereof, and metal-containing bleach catalysts (e.g. , copper, iron, titanium, ruthenium, tungsten, molybdenum, or manganese cations along with an auxiliary metal cations such as zinc or aluminum and a sequestrate such as ethylenediaminetetraacetic acid, ethylenediaminetetra(methylenephosphonic acid), and water- soluble salts thereof).
[00237] The composition preferably includes enzymes, e.g. , proteases, amylases, lipases, cellulases, choline oxidases, peroxidases/oxidases, pectate lyases, mannanases, cutinases, laccases, phospholipases, lysophospholipases, acyltransferase, perhydrolase, arylesterase, and any mixture thereof. [00238] The composition may optionally include additional detergent ingredients including perfume microcapsules, starch encapsulated perfume accord, hueing agents, additional polymers, including fabric integrity and cationic polymers, dye-lock ingredients, fabric- softening agents, brighteners (for example C.I. Fluorescent brighteners), flocculating agents, chelating agents, alkoxylated polyamines, fabric deposition aids, and/or cyclodextrin. 7.4. Automatic dishwashing (ADW) detergent composition
[00239] Exemplary ADW detergent composition includes non-ionic surfactants, including ethoxylated non-ionic surfactants, alcohol alkoxylated surfactants, epoxy-capped
poly(oxyalkylated) alcohols, or amine oxide surfactants present in amounts from 0 to 10% by weight; builders in the range of 5-60% including phosphate builders (e.g. , mono-phosphates, diphosphates, tri-polyphosphates, other oligomeric-poylphosphates, sodium tripolyphosphate- STPP) and phosphate-free builders (e.g. , amino acid-based compounds including methyl- glycine-diacetic acid (MGDA) and salts and derivatives thereof, glutamic-N,N-diacetic acid (GLDA) and salts and derivatives thereof, iminodisuccinic acid (IDS) and salts and derivatives thereof, carboxy methyl inulin and salts and derivatives thereof, nitrilotriacetic acid (NTA), diethylene triamine penta acetic acid (DTP A), B-alaninediacetic acid (B-ADA) and their salts, homopolymers and copolymers of poly-carboxylic acids and their partially or completely neutralized salts, monomeric polycarboxylic acids and hydroxycarboxylic acids and their salts in the range of 0.5% to 50% by weight; sulfonated/carboxylated polymers in the range of about 0.1 % to about 50% by weight to to provide dimensional stability; drying aids in the range of about 0.1% to about 10% by weight (e.g. , polyesters, especially anionic polyesters, optionally together with further monomers with 3 to 6 functionalities - typically acid, alcohol or ester functionalities which are conducive to polycondensation, polycarbonate-, polyurethane- and/or polyurea-polyorganosiloxane compounds or precursor compounds, thereof, particularly of the reactive cyclic carbonate and urea type); silicates in the range from about 1% to about 20% by weight (including sodium or potassium silicates for example sodium disilicate, sodium meta- silicate and crystalline phyllosilicates); inorganic bleach (e.g. , perhydrate salts such as perborate, percarbonate, perphosphate, persulfate and persilicate salts) and organic bleach (e.g. , organic peroxyacids, including diacyl and tetraacylperoxides, especially diperoxydodecanedioc acid, diperoxytetradecanedioc acid, and diperoxyhexadecanedioc acid); bleach activators (i.e., organic peracid precursors in the range from about 0.1% to about 10% by weight); bleach catalysts (e.g., manganese triazacyclononane and related complexes, Co, Cu, Mn, and Fe bispyridylamine and related complexes, and pentamine acetate cobalt(III) and related complexes); metal care agents in the range from about 0.1% to 5% by weight (e.g., benzatriazoles, metal salts and complexes, and/or silicates); enzymes in the range from about 0.01 to 5.0 mg of active enzyme per gram of automatic dishwashing detergent composition (e.g., proteases, amylases, lipases, cellulases, choline oxidases, peroxidases/oxidases, pectate lyases, mannanases, cutinases, laccases, phospholipases, lysophospholipases, acyltransferase, perhydrolase, arylesterase, and mixtures thereof); and enzyme stabilizer components (e.g., oligosaccharides, polysaccharides, and inorganic divalent metal salts).
7.5. Additional detergent compositions
[00240] Additional exemplary detergent formulations to which the present amylase can be added are described, below, in the numbered paragraphs. [00241] 1) A detergent composition formulated as a granulate having a bulk density of at least 600 g/L comprising linear alkylbenzenesulfonate (calculated as acid) about 7% to about 12%; alcohol ethoxysulfate (e.g. , C12-18 alcohol, 1-2 ethylene oxide (EO)) or alkyl sulfate (e.g. , C16-18) about 1% to about 4%; alcohol ethoxylate (e.g. , C14-15 alcohol, 7 EO) about 5% to about 9%; sodium carbonate (e.g. , Na2C03) about 14% to about 20%; soluble silicate (e.g. , Na20, 2Si02) about 2 to about 6%; zeolite (e.g. , NaAlSi04) about 15% to about 22%; sodium sulfate (e.g. , Na2S04) 0% to about 6%; sodium citrate/citric acid (e.g. , C6H5Na307/C6H807) about 0% to about 15%; sodium perborate (e.g. , NaB03H20) about 11% to about 18%; TAED about 2% to about 6%; carboxymethylcellulose (CMC) and 0% to about 2%; polymers (e.g. , maleic/acrylic acid, copolymer, PVP, PEG) 0-3%; enzymes (calculated as pure enzyme) 0.0001-0.1% protein; and minor ingredients (e.g. , suds suppressors, perfumes, optical brightener, photobleach) 0-5%.
[00242] 2) A detergent composition formulated as a granulate having a bulk density of at least 600 g/L comprising linear alkylbenzenesulfonate (calculated as acid) about 6% to about 11%; alcohol ethoxysulfate (e.g. , C12-i8 alcohol, 1-2 EO) or alkyl sulfate (e.g., C16-i8) about 1% to about 3%; alcohol ethoxylate (e.g. , C14-15 alcohol, 7 EO) about 5% to about 9%; sodium carbonate (e.g., Na2C03) about 15% to about 21%; soluble silicate (e.g., Na20, 2Si02) about 1% to about 4%; zeolite (e.g., NaAlSi04) about 24% to about 34%; sodium sulfate (e.g,. Na2S04) about 4% to about 10%; sodium citrate/citric acid (e.g., C6H5Na307/ C6H807) 0% to about 15%; carboxymethylcellulose (CMC) 0% to about 2%; polymers (e.g. , maleic/acrylic acid copolymer, PVP, PEG) 1-6%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; minor ingredients (e.g., suds suppressors, perfume) 0-5%.
[00243] 3) A detergent composition formulated as a granulate having a bulk density of at least 600 g/L comprising linear alkylbenzenesulfonate (calculated as acid) about 5% to about 9%; alcohol ethoxylate (e.g. , C12-is alcohol, 7 EO) about 7% to about 14%; Soap as fatty acid (e.g. , C\6-22 fatty acid) about 1 to about 3%; sodium carbonate (as Na2C03) about 10% to about 17%; soluble silicate (e.g. , Na20, 2Si02) about 3% to about 9%; zeolite (as NaAlSi04) about 23% to about 33%; sodium sulfate (e.g. , Na2S04) 0% to about 4%; sodium perborate (e.g., NaB03H20) about 8% to about 16%; TAED about 2% to about 8%; phosphonate (e.g. ,
EDTMPA) 0% to about 1%; carboxymethylcellulose (CMC) 0% to about 2%; polymers (e.g. , maleic/acrylic acid copolymer, PVP, PEG) 0-3%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; minor ingredients (e.g. , suds suppressors, perfume, optical brightener) 0-5%.
[00244] 4) A detergent composition formulated as a granulate having a bulk density of at least 600 g/L comprising linear alkylbenzenesulfonate (calculated as acid) about 8% to about 12%; alcohol ethoxylate (e.g. , C12-15 alcohol, 7 EO) about 10% to about 25%; sodium carbonate (as Na2C03) about 14% to about 22%; soluble silicate (e.g., Na20, 2Si02) about 1% to about 5%; zeolite (e.g. , NaAlSi04) about 25% to about 35%; sodium sulfate (e.g., Na2S04) 0% to about 10%; carboxymethylcellulose (CMC) 0% to about 2%; polymers (e.g. , maleic/acrylic acid copolymer, PVP, PEG) 1-3%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; and minor ingredients (e.g. , suds suppressors, perfume) 0-5%.
[00245] 5) An aqueous liquid detergent composition comprising linear alkylbenzenesulfonate (calculated as acid) about 15% to about 21%; alcohol ethoxylate (e.g. , C12-15 alcohol, 7 EO or C12-15 alcohol, 5 EO) about 12% to about 18%; soap as fatty acid (e.g. , oleic acid) about 3% to about 13%; alkenylsuccinic acid (C12_14) 0% to about 13%; aminoethanol about 8% to about 18%; citric acid about 2% to about 8%; phosphonate 0% to about 3%; polymers (e.g., PVP, PEG) 0% to about 3%; borate (e.g., B407) 0% to about 2%; ethanol 0% to about 3%; propylene glycol about 8% to about 14%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; and minor ingredients (e.g. , dispersants, suds suppressors, perfume, optical brightener) 0-5%. [00246] 6) An aqueous structured liquid detergent composition comprising linear
alkylbenzenesulfonate (calculated as acid) about 15% to about 21%; alcohol ethoxylate (e.g., C12-15 alcohol, 7 EO, or C12_15 alcohol, 5 EO) 3-9%; soap as fatty acid (e.g. , oleic acid) about 3% to about 10%; zeolite (as NaAlSi04) about 14% to about 22%; potassium citrate about 9% to about 18%; borate (e.g., B407) 0% to about 2%; carboxymethylcellulose (CMC) 0% to about 2%; polymers (e.g. , PEG, PVP) 0% to about 3%; anchoring polymers such as, e.g., lauryl methacrylate/acrylic acid copolymer; molar ratio 25: 1, MW 3800) 0% to about 3%;glycerol 0% to about 5%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; and minor ingredients (e.g., dispersants, suds suppressors, perfume, optical brighteners) 0-5%.
[00247] 7) A detergent composition formulated as a granulate having a bulk density of at least 600 g/L comprising fatty alcohol sulfate about 5% to about 10%; ethoxylated fatty acid monoethanolamide about 3% to about 9%; soap as fatty acid 0-3%; sodium carbonate (e.g.,
Na2C03) about 5% to about 10%; Soluble silicate (e.g., Na20, 2Si02) about 1% to about 4%; zeolite (e.g., NaAlSi04) about 20% to about 40%; Sodium sulfate (e.g., Na2S04) about 2% to about 8%; sodium perborate (e.g., NaB03H20) about 12% to about 18%; TAED about 2% to about 7%; polymers (e.g. , maleic/acrylic acid copolymer, PEG) about 1% to about 5%; enzymes
(calculated as pure enzyme protein) 0.0001-0.1%; and minor ingredients (e.g., optical brightener, suds suppressors, perfume) 0-5%. [00248] 8) A detergent composition formulated as a granulate comprising linear alkylbenzenesulfonate (calculated as acid) about 8% to about 14%; ethoxylated fatty acid monoethanolamide about 5% to about 11%; soap as fatty acid 0% to about 3%; sodium carbonate (e.g. , Na2C03) about 4% to about 10%; soluble silicate (Na20, 2Si02) about 1% to about 4%; zeolite (e.g., NaAlSi04) about 30% to about 50%; sodium sulfate (e.g. , Na2S04) about 3% to about 11%; sodium citrate (e.g. , C6l¾Na 07) about 5% to about 12%; polymers (e.g. , PVP, maleic/acrylic acid copolymer, PEG) about 1% to about 5%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; and minor ingredients (e.g. , suds suppressors, perfume) 0- 5%. [00249] 9) A detergent composition formulated as a granulate comprising linear
alkylbenzenesulfonate (calculated as acid) about 6% to about 12%; nonionic surfactant about 1% to about 4%; soap as fatty acid about 2% to about 6%; sodium carbonate (e.g. , Na2C03) about 14% to about 22%; zeolite (e.g. , NaAlSi04) about 18% to about 32%; sodium sulfate (e.g. , Na2S04) about 5% to about 20%; sodium citrate (e.g. , C6H5Na307) about 3% to about 8%; sodium perborate (e.g., NaB03H20) about 4% to about 9%; bleach activator (e.g. , NOBS or
TAED) about 1% to about 5%; carboxymethylcellulose (CMC) 0% to about 2%; polymers (e.g. , polycarboxylate or PEG) about 1% to about 5%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; and minor ingredients (e.g. , optical brightener, perfume) 0-5%.
[00250] 10) An aqueous liquid detergent composition comprising linear
alkylbenzenesulfonate (calculated as acid) about 15% to about 23%; alcohol ethoxysulfate (e.g. , C12-15 alcohol, 2-3 EO) about 8% to about 15%; alcohol ethoxylate (e.g. , C12_15 alcohol, 7 EO, or C12-15 alcohol, 5 EO) about 3% to about 9%; soap as fatty acid (e.g. , lauric acid) 0% to about 3%; aminoethanol about 1% to about 5%; sodium citrate about 5% to about 10%; hydrotrope (e.g. , sodium toluensulfonate) about 2% to about 6%; borate (e.g., B407) 0% to about 2%;
carboxymethylcellulose 0% to about 1%; ethanol about 1% to about 3%; propylene glycol about 2% to about 5%; enzymes (calculated as pure enzyme protein) 0.0001-0.1 %; and minor ingredients (e.g. , polymers, dispersants, perfume, optical brighteners) 0-5%.
[00251] 11) An aqueous liquid detergent composition comprising linear
alkylbenzenesulfonate (calculated as acid) about 20% to about 32%; alcohol ethoxylate (e.g., C12-15 alcohol, 7 EO, or C12_15 alcohol, 5 EO) 6-12%; aminoethanol about 2% to about 6%; citric acid about 8% to about 14%; borate (e.g. , B407) about 1% to about 3%; polymer (e.g. , maleic/acrylic acid copolymer, anchoring polymer such as, e.g. , lauryl methacrylate/acrylic acid copolymer) 0% to about 3%; glycerol about 3% to about 8%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; and minor ingredients (e.g., hydrotropes, dispersants, perfume, optical brighteners) 0-5%.
[00252] 12) A detergent composition formulated as a granulate having a bulk density of at least 600 g/L comprising anionic surfactant (linear alkylbenzenesulfonate, alkyl sulfate, a- olefinsulfonate, a-sulfo fatty acid methyl esters, alkanesulfonates, soap) about 25% to about 40%; nonionic surfactant (e.g., alcohol ethoxylate) about 1% to about 10%; sodium carbonate (e.g. , Na2C03) about 8% to about 25%; soluble silicates (e.g. , Na20, 2Si02) about 5% to about 15%; sodium sulfate (e.g. , Na2S04) 0% to about 5%; zeolite (NaAlSi04) about 15% to about 28%; sodium perborate (e.g., NaB03 4H20) 0% to about 20%; bleach activator (TAED or NOBS) about 0% to about 5%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; minor ingredients (e.g. , perfume, optical brighteners) 0-3%.
[00253] 13) Detergent compositions as described in compositions 1)-12) supra, wherein all or part of the linear alkylbenzenesulfonate is replaced by
Figure imgf000088_0001
alkyl sulfate.
[00254] 14) A detergent composition formulated as a granulate having a bulk density of at least 600 g/L comprising (C^-C^) alkyl sulfate about 9% to about 15%; alcohol ethoxylate about 3% to about 6%; polyhydroxy alkyl fatty acid amide about 1% to about 5%; zeolite (e.g., NaAlSi04) about 10% to about 20%; layered disilicate (e.g. , SK56 from Hoechst) about 10% to about 20%; sodium carbonate (e.g., Na2C03) about 3% to about 12%; soluble silicate (e.g., Na20, 2Si02) 0% to about 6%; sodium citrate about 4% to about 8%; sodium percarbonate about 13% to about 22%; TAED about 3% to about 8%; polymers (e.g. , polycarboxylates and PVP) 0% to about 5%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; and minor ingredients (e.g., optical brightener, photobleach, perfume, suds suppressors) 0-5%.
[00255] 15) A detergent composition formulated as a granulate having a bulk density of at least 600 g/L comprising (C^-C^) alkyl sulfate about 4% to about 8%; alcohol ethoxylate about 11% to about 15%; soap about 1% to about 4%; zeolite MAP or zeolite A about 35% to about 45%; sodium carbonate (as Na2C03) about 2% to about 8%; soluble silicate (e.g. , Na20, 2Si02) 0% to about 4%; sodium percarbonate about 13% to about 22%; TAED 1-8%;
carboxymethylcellulose (CMC) 0% to about 3%; polymers (e.g. , polycarboxylates and PVP) 0% to about 3%; enzymes (calculated as pure enzyme protein) 0.0001-0.1%; and minor ingredients (e.g., optical brightener, phosphonate, perfume) 0-3%.
[00256] 16) Detergent formulations as described in 1)- 15) supra, which contain a stabilized or encapsulated peracid, either as an additional component or as a substitute for already specified bleach systems. [00257] 17) Detergent compositions as described supra in 1), 3), 7), 9), and 12), wherein perborate is replaced by percarbonate.
[00258] 18) Detergent compositions as described supra in 1), 3), 7), 9), 12), 14), and 15), which additionally contain a manganese catalyst. The manganese catalyst for example is one of the compounds described in "Efficient manganese catalysts for low-temperature bleaching," Nature 369: 637-639 (1994).
[00259] 19) Detergent composition formulated as a non-aqueous detergent liquid comprising a liquid nonionic surfactant such as, e.g., linear alkoxylated primary alcohol, a builder system (e.g., phosphate), an enzyme(s), and alkali. The detergent may also comprise anionic surfactant and/or a bleach system.
[00260] As above, the present amylase polypeptide may be incorporated at a concentration conventionally employed in detergents. It is at present contemplated that, in the detergent composition, the enzyme may be added in an amount corresponding to 0.00001-1.0 mg
(calculated as pure enzyme protein) of amylase polypeptide per liter of wash liquor. [00261] The detergent composition may also contain other conventional detergent
ingredients, e.g., deflocculant material, filler material, foam depressors, anti-corrosion agents, soil-suspending agents, sequestering agents, anti-soil redeposition agents, dehydrating agents, dyes, bactericides, fluorescers, thickeners, and perfumes.
[00262] The detergent composition may be formulated as a hand (manual) or machine (automatic) laundry detergent composition, including a laundry additive composition suitable for pre-treatment of stained fabrics and a rinse added fabric softener composition, or be formulated as a detergent composition for use in general household hard surface cleaning operations, or be formulated for manual or automatic dishwashing operations.
[00263] Any of the cleaning compositions described, herein, may include any number of additional enzymes. In general the enzyme(s) should be compatible with the selected detergent, (e.g., with respect to pH-optimum, compatibility with other enzymatic and non-enzymatic ingredients, and the like), and the enzyme(s) should be present in effective amounts. The following enzymes are provided as examples.
[00264] Proteases: Suitable proteases include those of animal, vegetable or microbial origin. Chemically modified or protein engineered mutants are included, as well as naturally processed proteins. The protease may be a serine protease or a metallopro tease, an alkaline microbial protease, a trypsin-like protease, or a chymotrypsin-like protease. Examples of alkaline proteases are subtilisins, especially those derived from Bacillus, e.g., subtilisin Novo, subtilisin Carlsberg, subtilisin 309, subtilisin 147, and subtilisin 168 {see, e.g., WO 89/06279). Examples of trypsin-like proteases are trypsin {e.g., of porcine or bovine origin), and Fusarium proteases {see, e.g., WO 89/06270 and WO 94/25583). Examples of useful proteases also include but are not limited to the variants described in WO 92/19729, WO 98/20115, WO 98/20116, and WO 98/34946. Commercially available protease enzymes include but are not limited to:
ALCALASE®, SAVINASE®, PRIMASE™, DURALASE™, ESPERASE®, KANNASE™, and BLAZE™ (Novo Nordisk A/S and Novozymes A/S); MAXATASE®, MAXACAL™, MAXAPEM™, PROPERASE®, PURAFECT®, PURAFECT OXP™, FN2™, and FN3™ (Danisco US Inc.). Other exemplary proteases include NprE from Bacillus amyloliquifaciens and ASP from Cellulomonas sp. strain 69B4.
[00265] Lipases: Suitable lipases include those of bacterial or fungal origin. Chemically modified, proteolytic ally modified, or protein engineered mutants are included. Examples of useful lipases include but are not limited to lipases from Humicola (synonym Thermomyces), e.g., from H. lanuginosa {T. lanuginosus) {see e.g., EP 258068 and EP 305216), from H.
insolens {see e.g., WO 96/13580); a Pseudomonas lipase {e.g., from P. alcaligenes or P.
pseudoalcaligenes; see, e.g., EP 218 272), P. cepacia {see e.g., EP 331 376), P. stutzeri {see e.g., GB 1,372,034), P. fluorescens, Pseudomonas sp. strain SD 705 {see e.g., WO 95/06720 and WO 96/27002), P. wisconsinensis {see e.g., WO 96/12012); a Bacillus lipase {e.g., from B. subtilis; see e.g., Dartois et al. Biochemica et Biophysica Acta, 1131: 253-360 (1993)), B.
stearothermophilus {see e.g., JP 64/744992), or B. pumilus {see e.g., WO 91/16422). Additional lipase variants contemplated for use in the formulations include those described for example in: WO 92/05249, WO 94/01541, WO 95/35381, WO 96/00292, WO 95/30744, WO 94/25578, WO 95/14783, WO 95/22615, WO 97/04079, WO 97/07202, EP 407225, and EP 260105.
Some commercially available lipase enzymes include LIPOLASE® and LIPOLASE ULTRA™ (Novo Nordisk A/S and Novozymes A/S).
[00266] Poly esterases: Suitable polyesterases can be included in the composition, such as those described in, for example, WO 01/34899, WO 01/14629, and US6933140.
[00267] Amylases: The compositions can be combined with other amylases, such as non- production enhanced amylase. These can include commercially available amylases, such as but not limited to STAINZYME®, NATALASE®, DURAMYL®, TERMAMYL®,
FUNGAMYL® and BAN™ (Novo Nordisk A/S and Novozymes A/S); RAPID ASE®,
POWERASE®, and PURASTAR® (from Danisco US Inc.). [00268] Cellulases: Cellulases can be added to the compositions. Suitable cellulases include those of bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Suitable cellulases include cellulases from the genera Bacillus, Pseudomonas, Humicola, Fusarium, Thielavia, Acremonium, e.g., the fungal cellulases produced from
Humicola insolens, Myceliophthora thermophila and Fusarium oxysporum disclosed for example in U.S. Patent Nos. 4,435,307; 5,648,263; 5,691,178; 5,776,757; and WO 89/09259. Exemplary cellulases contemplated for use are those having color care benefit for the textile. Examples of such cellulases are cellulases described in for example EP 0495257, EP 0531372, WO 96/11262, WO 96/29397, and WO 98/08940. Other examples are cellulase variants, such as those described in WO 94/07998; WO 98/12307; WO 95/24471; PCT/DK98/00299; EP 531315; U.S. Patent Nos. 5,457,046; 5,686,593; and 5,763,254. Commercially available cellulases include CELLUZYME® and CAREZYME® (Novo Nordisk A/S and Novozymes A/S); CLAZINASE® and PURADAX HA® (Danisco US Inc.); and KAC-500(B)™ (Kao Corporation). [00269] Peroxidases/Oxidases: Suitable peroxidases/oxidases contemplated for use in the compositions include those of plant, bacterial or fungal origin. Chemically modified or protein engineered mutants are included. Examples of useful peroxidases include peroxidases from Coprinus, e.g., from C. cinereus, and variants thereof as those described in WO 93/24618, WO 95/10602, and WO 98/15257. Commercially available peroxidases include for example GUARDZYME™ (Novo Nordisk A/S and Novozymes A/S).
[00270] The detergent composition can also comprise 2,6-P-D-fructan hydrolase, which is effective for removal/cleaning of biofilm present on household and/or industrial textile/laundry.
[00271] The detergent enzyme(s) may be included in a detergent composition by adding separate additives containing one or more enzymes, or by adding a combined additive comprising all of these enzymes. A detergent additive, i.e. a separate additive or a combined additive, can be formulated e.g., as a granulate, a liquid, a slurry, and the like. Exemplary detergent additive formulations include but are not limited to granulates, in particular non- dusting granulates, liquids, in particular stabilized liquids or slurries.
[00272] Non-dusting granulates may be produced, e.g., as disclosed in U.S. Patent Nos. 4,106,991 and 4,661,452 and may optionally be coated by methods known in the art. Examples of waxy coating materials are poly(ethylene oxide) products {e.g., polyethyleneglycol, PEG) with mean molar weights of 1,000 to 20,000; ethoxylated nonylphenols having from 16 to 50 ethylene oxide units; ethoxylated fatty alcohols in which the alcohol contains from 12 to 20 carbon atoms and in which there are 15 to 80 ethylene oxide units; fatty alcohols; fatty acids; and mono- and di- and triglycerides of fatty acids. Examples of film-forming coating materials suitable for application by fluid bed techniques are given in, for example, GB 1483591. Liquid enzyme preparations may, for instance, be stabilized by adding a polyol such as propylene glycol, a sugar or sugar alcohol, lactic acid or boric acid according to established methods. Protected enzymes may be prepared according to the method disclosed in EP 238,216.
[00273] The detergent composition may be in any convenient form, e.g. , a bar, a tablet, a powder, a granule, a paste, or a liquid. A liquid detergent may be aqueous, typically containing up to about 70% water, and 0% to about 30% organic solvent. Compact detergent gels containing about 30% or less water are also contemplated. The detergent composition can optionally comprise one or more surfactants, which may be non-ionic, including semi-polar and/or anionic and/or cationic and/or zwitterionic. The surfactants can be present in a wide range, from about 0.1% to about 60% by weight.
[00274] When included therein the detergent will typically contain from about 1% to about 40% of an anionic surfactant, such as linear alkylbenzenesulfonate, a-olefinsulfonate, alkyl sulfate (fatty alcohol sulfate), alcohol ethoxysulfate, secondary alkanesulfonate, a-sulfo fatty acid methyl ester, alkyl- or alkenylsuccinic acid, or soap.
[00275] When included therein, the detergent will usually contain from about 0.2% to about 40% of a non-ionic surfactant such as alcohol ethoxylate, nonylphenol ethoxylate,
alkylpolyglycoside, alkyldimethylamineoxide, ethoxylated fatty acid monoethanolamide, fatty acid monoethanolamide, polyhydroxy alkyl fatty acid amide, or N-acyl-N-alkyl derivatives of glucosamine ("glucamides").
[00276] The detergent may contain 0% to about 65% of a detergent builder or complexing agent such as zeolite, diphosphate, triphosphate, phosphonate, carbonate, citrate, nitrilotriacetic acid, ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid, alkyl- or alkenylsuccinic acid, soluble silicates or layered silicates (e.g. ,SKS-6 from Hoechst).
[00277] The detergent may comprise one or more polymers. Exemplary polymers include carboxymethylcellulose (CMC), poly(vinylpyrrolidone) (PVP), poly(ethylene glycol) (PEG), poly(vinyl alcohol) (PVA), poly(vinylpyridine-N-oxide), poly(vinylimidazole),
polycarboxylates e.g., polyacrylates, maleic/acrylic acid copolymers), and lauryl
methacrylate/acrylic acid copolymers.
[00278] The enzyme(s) of the detergent composition may be stabilized using conventional stabilizing agents, e.g. , as polyol (e.g., propylene glycol or glycerol), a sugar or sugar alcohol, lactic acid, boric acid, or a boric acid derivative (e.g. , an aromatic borate ester), or a phenyl boronic acid derivative (e.g., 4-formylphenyl boronic acid). The composition may be formulated as described in WO 92/19709 and WO 92/19708.
[00279] It is contemplated that in the detergent compositions, in particular the enzyme variants, may be added in an amount corresponding to about 0.01 to about 100 mg of enzyme protein per liter of wash liquor (e.g. , about 0.05 to about 5.0 mg of enzyme protein per liter of wash liquor or 0.1 to about 1.0 mg of enzyme protein per liter of wash liquor).
[00280] Yet additional exemplary detergent formulations to which the present amylase can be added (or is in some cases identified as a component) are listed in the following Tables:
Figure imgf000093_0001
HDD Detergent Compositions
Composition Composition Composition Composition
Ingredient A B C D
Enzyme (Lipase +
other enzymes) 0.8 wt% 0.8 wt% 0.8 wt% 0.8 wt%
Linear alkyl benzene
sulphonate 9 wt% 9 wt% 12 wt% 8 wt%
Alkyl ethoxylated
sulphate having an
average degree of
ethoxylation of from
0.5 to 3 3 wt% 2 wt% 1 wt% 2 wt%
Cationic detersive
surfactant 0.5 wt% 0.5 wt% 0.5 wt% 0.5 wt%
Sodium sulphate 55 wt% 55 wt% 55 wt% 55 wt%
Sodium carbonate 8 wt% 10 wt% 5 wt% 8 wt%
Glycerol carbonate 9 wt% 12 wt% 8 wt% 10 wt%
Oxaziridiniuym- based bleach catalyst 0.005wt 0.005wt 0.005wt 0.005wt
Sodium silicate 3 wt% 0 wt% 3 wt% 0 wt%
Carboxylate polymer 2wt% 2wt% 2wt% 2wt%
Brightener 0.02 wt% 0.02 wt% 0.02 wt% 0.02 wt%
Cellulosic polymer 0.3 wt% 0.3 wt% 0.3 wt% 0.3 wt%
Misc & Moisture to 100 wt% to 100 wt to 100 wt% to 100 wt
Figure imgf000094_0001
Figure imgf000095_0001
Figure imgf000096_0001
Figure imgf000096_0002
Penta Amine Acetato-cobalt(III)
nitrate (1 % active) 0.5 0.5 0.5 0.6
Percarbonate 15 15 15 11
Sulphonated polymer 10 4 3 5.1
Amylase (14.4mg/g active) 1.3 1.8 1.5 0.7
Processing aids, perfume and To To To To sodium sulphate balance balance balance balance
Liquid automatic dis lwashing detergent composition
Dipropylene glycol 45 45 45 25
SLF18 45 45 45 0
Neodoll-9 3 3 3 2.6
Lutensol T07 30
Plurafac LF224 32.4
Amine Oxide 3.6
Glycerine 2 2 2 4
To To To To
Processing aids and Dyes balance balance balance balance
Second Liquid automatic dishwashing detergent composition (part of three compartment unit dose)
Figure imgf000097_0001
Lipase 0.1 - 0.1 - 0.1
Metalloprotease 1 (optional) 0.05 0.3 - 0.5 0.2
Metalloprotease 2 - - 0.08 - -
Protease A (optional) - - - - 0.1
Aldose Oxidase - - 0.3 - 0.003
ZnC12 0.1 0.05 0.05 0.05 0.02
Ca formate 0.05 0.07 0.05 0.06 0.07
DETBCHD - - 0.02 0.01 -
SRP1 (anionically end capped 0.5 0.5 - 0.3 0.3 polyesters)
Boric acid - - - - 2.4
Sodium xylene sulfonate - - 3 - -
Sodium cumene sulfonate - - - 0.3 0.5
DC 3225C 1 1 1 1 1
2-butyl-octanol 0.03 0.04 0.04 0.03 0.03
Brightener 1 0.12 0.1 0.18 0.08 0.1
Balance to 100% perfume / dye and/or water
#1 : Add IN HCl aq. soln to adjust the neat pH of the formula in the range from about
3 to about 5. The pH of Examples above (I)-(II) is about 5 to about 7, and of (III)-(V) is about 7.5 to about 8.5.
Figure imgf000098_0001
Figure imgf000099_0001
Figure imgf000099_0002
Liquid Automatic Dish Washing Detergent Compositions
Compound Formulations
I II III IV V
STPP (sodium 16.00 16.00 18.00 16.00 16.00 tripoly phosphate)
Potassium Sulfate - 10.00 8.00 - 10.00
1,2 propanediol 6.00 0.50 2.00 6.00 0.50
Boric Acid - - - 4.00 3.00
CaCl2 dihydrate 0.04 0.04 0.04 0.04 0.04
Nonionic surfactant 0.50 0.50 0.50 0.50 0.50
Metalloprotease 1 0.10 0.03 - 0.03 - (optional)
Metalloprotease 2 - - 0.05 - 0.06
Protease B - - - 0.01 - (optional)
Amylase 0.02 - 0.02 0.02 -
Aldose Oxidase - 0.15 0.02 - 0.01
Galactose Oxidase - - 0.01 - 0.01 pentaamine acetate 0.01 0.01 cobalt (III) salt
PAAC (bleach
catalyst)
DETBCHD - 0.01 - - 0.01
Balance to 100% perfume / c ye and/or water
Figure imgf000101_0001
High Density Automatic Dish Washing Detergent Compositions
Compound Formu ations
I II III IV V VI
STPP (sodium tripoly - 45 45 - - 40 phosphate)
3Na Citrate 2H20 17 - - 50 40.2 -
Na Carbonate 17.5 14 20 - 8 33.6
Bicarbonate - - - 26 - -
Silicate 15 15 8 - 25 3.6
Metasilicate 2.5 4.5 4.5 - - -
PB1 (sodium perborate - - 4.5 - - - monohydrate)
PB4 (sodium perborate - - - 5 - - tetrahydrate)
Percarbonate - - - - - 4.8
BB1 (3-(3,4- 0.1 0.1 0.5
Dihydroisoquinolinium)propane
sulfonate (DIPS))
BB2 3-(3,4- 0.2 0.05 0.1 0.6
Dihydroisoquinolinium) - decane-2-sulfate
Nonionic detergent 2 1.5 1.5 3 1.9 5.9
HEDP 1 - - - - -
DETPMP 0.6 - - - - - pentaamine acetate cobalt (III) 0.03 0.05 0.02 - - - salt PAAC
Paraffin oil Winog 70 0.5 0.4 0.4 0.6 - -
Metalloprotease 1 (optional) 0.072 0.053 - 0.026 - 0.01
Metalloprotease 2 - - 0.053 - 0.059 -
Protease B (optional) - - - - - 0.01
Amylase 0.012 - 0.012 - 0.021 0.006
Lipase - 0.001 - 0.005 - -
Pectin Lyase 0.001 0.001 0.001 - - -
Aldose Oxidase 0.05 0.05 0.03 0.01 0.02 0.01
BTA (benzotriazole) 0.3 0.2 0.2 0.3 0.3 0.3
Polycarboxylate 6 - - - 4 0.9
Perfume 0.2 0.1 0.1 0.2 0.2 0.2
Balance to 100% Moisture and/or Minors*
*Brightener / dye / SRPl / Na carboxymethylcellulose/ photobleach / MgS04 /
PVPVI/ suds suppressor /high molecular PEG/clay. The pH of Examples (I) through (VI) is from about 9.6 to about 11.3. Tablet Detergent Compositions
Compound Formulations
I II Ill IV V VI VII VIII
STPP (sodium tripoly - 48.8 44.7 38.2 - 42.4 46.1 46 phosphate)
3Na Citrate 2H20 20 - - - 35.9 - - -
Na Carbonate 20 5 14 15.4 8 23 20 -
Silicate 15 14.8 15 12.6 23.4 2.9 4.3 4.2
Lipase 0.001 - 0.01 - 0.02 - - -
Protease B 0.01 - - - - - - -
Protease C - - - - - 0.01 - -
Metalloprotease 1 (optional) 0.01 0.08 - 0.04 - 0.023 - 0.05
Metalloprotease 2 - - 0.05 - 0.052 - 0.023 -
Amylase 0.012 0.012 0.012 - 0.015 - 0.017 0.002
Pectin Lyase 0.005 - - 0.002 - - - -
Aldose Oxidase - 0.03 - 0.02 0.02 - 0.03 -
PB1 (sodium perborate - - 3.8 - 7.8 - - 4.5 monohydrate)
Percarbonate 6 - - 6 - 5 - -
BB1 (3-(3,4- 0.2 - 0.5 - 0.3 0.2 - -
Dihydroisoquinolinium)propane
sulfonate (DIPS))
BB2 3-(3,4- - 0.2 - 0.5 - - 0.1 0.2
Dihydroisoquinolinium) - decane-2-sulfate
Nonionic surfactant 1.5 2 2 2.2 1 4.2 4 6.5 pentaamine acetate cobalt (III) 0.01 0.01 0.02 - - - - - salt PAAC
DETBCHD - - - 0.02 0.02 - - -
TAED - - - - - 2.1 - 1.6
HEDP 1 - - 0.9 - 0.4 0.2 -
DETPMP 0.7 - - - - - - -
Paraffin oil Winog 70 0.4 0.5 0.5 0.5 - - 0.5 -
BTA (benzotriazole) 0.2 0.3 0.3 0.3 0.3 0.3 0.3 -
Polycarboxylate 4 - - - 4.9 0.6 0.8 -
PEG 400-30,000 - - - - - 2 - 2
Glycerol - - - - - 0.4 - 0.5
Perfume - - - 0.05 0.2 0.2 0.2 0.2
Balance to 100% Moisture and/or Minors*
*Brightener / SRPl / Na carboxymethylcellulose/ photobleach / MgS04 / PVPVI/ suds suppressor /high molecular PEG/clay.
The pH of Examples (I) through (VII) is from about 10 to about 11.5; pH of (VIII) is from 8-10. The tablet weight of Examples (I) through (VIII) is from about 20 grams to about 30 grams.
Figure imgf000104_0001
The pH of Examples (I) through (VII) is from about 7.4 to about 9.5. HDL Detergent Compositions
Composition
Ingredient (wt% of composition)
1 2 3 4
Alkylethoxy(1.8)sulfate 14.7 11.6 16.31
C11.8 Alkylbenzene sulfonate 4.3 11.6 8.3 7.73
C16-17 Branched alkyl sulfate 1.7 1.29 3.09
Ci2-i4 Alkyl -9-ethoxylate 0.9 1.07 1.31
C12 dimethylamine oxide 0.6 0.64 1.03
Citric acid 3.5 0.65 3 0.66
C12-18 fatty acid 1.5 2.32 3.6 1.52
Sodium Borate (Borax) 2.5 2.46 1.2 2.53
Sodium C12-14 alkyl ethoxy 3
sulfate 2.9
C14-15 alkyl 7-ethoxylate 4.2
C12- 14 Alkyl -7-ethoxylate 1.7
Ca formate 0.09 0.09 0.09
A compound having the
following general structure:
bis((C2H50)(C2H40)n)(CH3)- N+-CxH2x-N+-(CH3)- bis((C2H50)(C2H40)n),
wherein n = from 20 to 30,
and x = from 3 to 8, or
sulphated or sulphonated
variants thereof 1.2
Random graft co-polymer1 1.46 0.5
Ethoxylated
Polyethylenimine 2 1.5 1.29 1.44
Diethylene triamine
pentaacetic acid 0.34 0.64 0.34
Diethylene triamine
penta(methylene phosphonic
acid) 0.3
Tinopal AMS-GX 0.06
Tinopal CBS-X 0.2 0.17 0.29
Amphiphilic alkoxylated
grease cleaning polymer 3 1.28 1 0.4 1.93
Ethanol 2 1.58 1.6 5.4
Propylene Glycol 3.9 3.59 1.3 4.3
Diethylene glycol 1.05 1.54 1.15
Polyethylene glycol 0.06 0.04 0.1
Monoethanolamine 3.05 2.41 0.4 1.26
NaOH 2.44 1.8 3.01
Sodium Cumene Sulphonate 1
Sodium Formate 0.11 0.09
Water, Aesthetics (Dyes,
perfumes) and Minors
(Enzymes, solvents,
structurants) balance balance balance balance
1 Random graft copolymer is a polyviny acetate grafted
polyethylene oxide copolymer having a r ralyethylene oxide backbone and multiple polyvinyl acetate side chains. The molecular weight of the polyethylene oxide backbone is about 6000 and the weight ratio of the polyethylene oxide to polyvinyl acetate is about 40 to 60 and no more than 1 grafting point per 50 ethylene oxide units.
2 Polyethylenimine (MW = 600) with 20 ethoxylate groups per -NH.
3 Amphiphilic alkoxylated grease cleaning polymer is a
polyethylenimine (MW = 600) with 24 ethoxylate groups per -NH and 16 propoxylate groups per -NH.
Figure imgf000106_0001
Liquid laundry detergent compositions suitable for front-loading automatic washing machines
Composition
Ingredient (wt% of composition)
1 2 3 4 5 6 7 8
Alkylbenzene sulfonic acid 7 11 4.5 1.2 1.5 12.5 5.2 4
Sodium C12-14 alkyl ethoxy 3 sulfate 2.3 3.5 4.5 4.5 7 18 1.8 2
Ci4_i5 alkyl 8-ethoxylate 5 8 2.5 2.6 4.5 4 3.7 2
C12 alkyl dimethyl amine oxide - - 0.2 - - - - -
C12-14 alkyl hydroxyethyl dimethyl - - - 0.5 - - - - ammonium chloride
C12-18 Fatty acid 2.6 4 4 2.6 2.8 11 2.6 1.5
Citric acid 2.6 3 1.5 2 2.5 3.5 2.6 2
Protease * 0.05 0.03 0.04 0.03 0.04 0.03 0.03 0.02
Amylase 0.1 0.2 0.15 - 0.05 0.5 0.1 0.2
Mannanase 0.05 0.1 0.05 - - 0.1 0.04 -
Random graft co-polymer1 1 0.2 1 0.4 0.5 2.7 0.3 1
A compound having the following 0.4 2 0.4 0.6 1.5 1.8 0.7 0.3 general structure:
bis((C2H50)(C2H40)n)(CH3)-N+-
CxH2x-N+-(C¾)- bis((C2H50)(C2H40)n), wherein n =
from 20 to 30, and x = from 3 to 8, or
sulphated or sulphonated variants
thereof
Ethoxylated Polyethylenimine 2 - - - - - 0.5 - -
Amphiphilic alkoxylated grease 0.1 0.2 0.1 0.2 0.3 0.3 0.2 0.3 cleaning polymer 3
Di ethoxylated poly (1,2 propylene - - - - - - 0.3 - terephthalate)
Diethylenetriaminepenta(methylene- 0.2 0.3 - - 0.2 - 0.2 0.3 phosphonic) acid
Hydroxyethane diphosphonic acid - - 0.45 - - 1.5 - 0.1
FWA (fluorescent whitening agent) 0.1 0.2 0.1 - - 0.2 0.05 0.1
Solvents (1,2 propanediol, ethanol), 3 4 1.5 1.5 2 4.3 2 1.5
Hydrogenated castor oil derivative 0.4 0.4 0.3 0.1 0.3 - 0.4 0.5
Boric acid 1.5 2.5 1.5 1.5 0.5 1.5 1.5
Na formate - - - 1 - - - -
Reversible protease inhibitor4 - - 0.002 - - - - -
Perfume 0.5 0.7 0.5 0.5 0.8 1.5 0.5 0.8
Perfume Microcapsules slurry 0.2 0.3 0.7 0.2 0.05 0.4 0.9 0.7
(30%am)
Ethoxylated thiophene Hueing Dyes 0.005 0.007 0.01 0.008 0.008 0.007 0.007 0.008
Buffers (sodium hydroxide, To pH 8.2
Monoethanolamine)
Water and minors (antifoam, To 100%
aesthetics)
Figure imgf000108_0001
Figure imgf000108_0002
Random graft copolymer1 0.4 0.2 1 0.5 0.6 1 0.8 1
Diethylene triamine
pentaacetic acid 0.4 0.4 0.4 0.4 0.2 0.3 0.8
Tinopal AMS-GX
(brightener) 0.2 0.2 0.2 0.2 0.2 0.3 0.1
Tinopal CBS-X
(brightener) 0.1 0.2
Amphiphilic alkoxylated
grease cleaning polymer 3 1 1.3 1.3 1.4 1 1.1 1 1
Texcare 240N (Clariant) 1
Ethanol 2.6 2.6 2.6 2.6 1.8 3 1.3
Propylene Glycol 4.6 4.6 4.6 4.6 3 4 2.5
Diethylene glycol 3 3 3 3 3 2.7 3.6
Polyethylene glycol 0.2 0.2 0.2 0.2 0.1 0.3 0.1 1.4
Monoethanolamine 2.7 2.7 2.7 2.7 4.7 3.3 1.7 0.4
Triethanolamine 0.9 to pH to pH to pH to pH to pH
NaOH 8.3 8.3 8.3 8.3 to pH 8.3 to pH 8.3 8.3 to pH 8.5
Suds suppressor
Dye 0.01 0.01 0.01 0.01 0.01 0.01 0
Perfume 0.5 0.5 0.5 0.5 0.7 0.7 0.8 0.6
Perfume Microcapsules 0.2 0.5 0.2 0.3 0.1 0.3 0.9 1 slurry (30%am)
Ethoxylated thiophene
Hueing Dye5 0.003 0.002 0.002 0.005 0.002 0.004 0.004 0.003
BalBalBalBalBal¬
Water ance ance ance ance Balance Balance ance Balance
1 Random graft copolymer is a polyvinyl acetate grafted polyethylene oxide copolymer having a polyethylene oxide backbone and multiple polyvinyl acetate side chains. The molecular weight of the polyethylene oxide backbone is about 6000 and the weight ratio of the polyethylene oxide to polyvinyl acetate is about 40 to 60 and no more than 1 grafting point per 50 ethylene oxide units.
Amphiphilic alkoxylated g rease cleaning polymer is a polyethylenimine (MW = 600) with 24 ethoxylate groups per -NH and 16 propoxylate groups per -NH
sEthoxylated thiophene Hueing Dye is as described in US 7,208,459 B2.
* Remark: all enzyme levels expressed as % enzyme raw material, except for protease which is expressed as
% of active protein added to the product. .
Figure imgf000110_0001
5Ethoxylated thiophene Hueing Dye is as described in US 7,208,459 B2.
Figure imgf000111_0001
5Ethoxylated thiophene Hueing Dye is as described in US 7,208,459 B2.
Figure imgf000112_0001
Granular Laundry Deter, ¾ent Compositions and Their Components
Deterg ent Composition
Component 7 8 9 10 11
Suds suppressor granule 0.25 0.07 0.04
Hydrophobically modified
carboxy methyl cellulose
(Finnifix® SH-1) 0.019 0.028
Bentonite 8.35
Miscellaneous (Dyes, perfumes,
process aids, moisture and
sodium sulphate) Balance Balance Balance Balance Balance
Figure imgf000113_0001
Figure imgf000114_0001
Solvents (1,2 propanediol, ethanol) To 100%
Figure imgf000114_0002
Figure imgf000115_0001
Figure imgf000115_0002
Liquid laundry detergent compositions suitable for top-loading automatic washing machines (1 &2) and front loading washing machines (3).
Ingredient Composition
(wt% of composition)
1 2 3
C12-15 Alkylethoxy(1.8)sulfate 14.7 11.6
Cii.8 Alkylbenzene sulfonate 4.3 11.6 8.3
C16-17 Branched alkyl sulfate 1.7 1.29
Ci2-i4 Alkyl -9-ethoxylate 0.9 1.07
Ci2 dimethylamine oxide 0.6 0.64
Citric acid 3.5 0.65 3
C12-18 fatty acid 1.5 2.32 3.6
Sodium Borate (Borax) 2.5 2.46 1.2
Sodium C12-14 alkyl ethoxy 3 sulfate 2.9
Ci4_i5 alkyl 7-ethoxylate 4.2
C12- 14 Alkyl -7-ethoxylate 1.7
Ca formate 0.09 0.09
A compound having the following general structure:
bis((C2H50)(C2H40)n)(CH3)-N+-CxH2x-N+-(CH3)- bis((C2H50)(C2H40)n), wherein n = from 20 to 30, and x =
from 3 to 8, or sulphated or sulphonated variants thereof 1.2
Random graft co-polymer1 1.46 0.5
Ethoxylated Polyethylenimine 2 1.5 1.29
Diethylene triamine pentaacetic acid 0.34 0.64
Diethylene triamine penta(methylene phosphonic acid) 0.3
Tinopal AMS-GX 0.06
Tinopal CBS-X 0.2 0.17
Amphiphilic alkoxylated grease cleaning polymer 3 1.28 1 0.4
Ethanol 2 1.58 1.6
Propylene Glycol 3.9 3.59 1.3
Diethylene glycol 1.05 1.54
Polyethylene glycol 0.06 0.04
Monoethanolamine 3.05 2.41 0.4
NaOH 2.44 1.8
Sodium Cumene Sulphonate 1
Sodium Formate 0.11
Water, Aesthetics (Dyes, perfumes) and Minors (Enzymes,
solvents, structurants) balance balance balance
1 Random graft copolymer is a polyvinyl acetate grafted polyethylene oxide copo ymer having a polyethylene oxide backbone and multiple polyvinyl acetate side chains The molecular weight of the polyethylene oxide backbone is about 6000 and the weig it ratio of the polyethylene oxide to polyvinyl acetate is about 40 to 60 and no more than 1 grafting point per 50 ethylene oxide units.
2 Polyethylenimine (MW = 600) with 20 ethoxylate groups per -NH.
3 Amphiphilic alkoxylated grease cleaning polymer is a polyethylenimine (MW = 600) with 24 ethoxylate groups per -NH and 16 propoxylate groups per -NH
Figure imgf000117_0001
Terephthalate polymer 0.23
Polyethylene glycol/vinyl acetate
random graft co polymer 0.89 0.89 0.91
Photobleach- zinc phthalocyanine
tetrasulfonate 0.005 0.001 0.002
C.I.Fluorescent Brightener 260 0.11 0.15 0.04 0.23 0.15
C.I.Fluorescent Brightener 351
(Tinopal ® CBS) 0.1
Suds suppressor granule 0.25 0.07 0.04
Hyrdophobically modified carboxy
methyl cellulose (Finnifix ® SH-1) 0.019 0.028
Bentonite 8.35
Miscellaneous (Dyes, perfumes,
process aids, moisture and sodium
sulphate) Balance Balance Balance Balance Balance
Granular Laundry Detergent Compositions and Their Components. The present amylase is separately added to these formulations.
Detergent Composition
Component Surfactants A B C D E F G H I J K L M N
Cio Nonionic 0.1843 0.1142 0.2894 0.1885 0.1846 0.1885 0.1979 0.1979 0.1979 0.1979
C 16-17 Branched alkyl
sulfate 3.53 3.53 3.53
C 12-14 alkyl sulphate
Sodium linear
alkylbenzenesulfonate with
aliphatic chain length Cn-
Cl2 8.98 8.98 8.98 13.58 14.75 12.94 15.69 9.01 8.42 9.51 8.92 8.92 11.5 11.5
Sodium C wis alcohol
ethoxy - 3 - sulfate 1.28 1.28 1.28 1.62 1.62 1.125 1.125
Sodium C wis alkyl
sulphate 2.36 2.36 2.36
C 12/14 alcohol ethoxylate
with average 7 moles of
ethoxylation 2.9
C 12/14 alcohol ethoxylate
with average 3 moles of
ethoxylation 2.44
C 14/15 alcohol ethoxylate
with average 7 moles of
ethoxylation 0.97 1.17 0.97 1 1 1.5 1.5 mono-Cg-io alkyl mono- hydroxyethyl di-methyl
quaternary ammonium
chloride 0.45
Di methyl hydroxyl ethyl
lauryl ammonium chloride 0.1803 0.195 0.45
Zeolite A 15.31 15.31 15.31 4.47 2.01 0.39 1.83 2.58 0.59 1.63 1.63 2 2
Bentonite 8.35
Sodium Silicate 1.6.ratio 0.16 4.53 5.62 4.53 4.75 4.75 4.75 4.75
Sodium Silicate 2.0.rafio 3.72 3.72 3.72 8.41 10.1 0.06 0.06
Sodium Silicate 2.35. ratio 7.05
Citric Acid 0.0066 1.4 1.84 1 1.1 1.1 1.1 1.1
Sodium tripolyphosphate 5.06 5.73
Sodium Carbonate 26.1 26.18 26.1 15.9 29 12.65 15.93 21 27.31 20.2 23.3 23.3 23.3 23.3
Granular Laundry Detergent Compositions and Their Components. The present amylase is separately added to these formulations.
Detergent Composition
Component Surfactants A B C D E F G H I J K L M N
Nonanoyl oxybenzene
suplhonate 5.78 5.78 5.78 1.17 1.86 1.73
Oxaziridinium-based
bleach booster 0.037 0.037 0.037 0.0168 0.0333 0.024 0.021 0.021 0.015 0.015
Tetrasodium S,S, -ethylene
diaminedisuccinate 0.26 0.26 0.26 0.26
Diethylenetriamine penta
(methylene phosphonic
acid), heptasodium salt 0.62 0.62 0.62 0.327 0.3272
Hydroxyethane
dimethylene phosphonic
acid 0.45 0.2911 0.45 0.47 0.47 0.47 0.47
Ethylene diamine
tetraacetate 0.2701 0.28 0.1957
MgS04 0.056 0.056 0.056 0.47 0.54 0.79 0.6494 0.793 0.83 0.83 0.82 0.82
Sodium Percarbonate 7.06 7.06 3.64 19.1 15.85 22.5 19.35 19.35 19.35 19.35
Tetra Acetyl Ethylene
Diamine 4.554 3.71 5.24 4.51 4.51 4.51 4.51
Sodium Perborate
Monohydrate 1.47 5.55
Carboxymethyl cellulose
(e.g. Finnfix BDA ex
CPKelco) 0.38 0.38 0.38 0.173 0.62 0.21 0.23 1.07 0.2622 1.01 1.01 1.01 1.01
Sodium Acrylic
acid/maleic acid copolymer (70/30) 3.79 3.78 3.79 3.64 0.4 2.61 2.5 2 1.75 1.84 1.84 1.84 1.84
Sodium polyacrylate
(Sokalan PA30 CL) 3.78 3.78 3.78 0.842 0.0055 0.01 1 0.008 0.007 0.007 0.005 0.005
Terephthalate polymer 0.231 0.179 0.179 0.179 0.179
Polyethylene glycol/ vinyl
acetate random graft co
polymer 0.89 0.55 1.4 0.91 1 0.8924 0.91 1 0.96 0.96 0.96 0.96
Photobleach- zinc
phthalocyanine
tetrasulfonate
Granular Laundry Detergent Compositions and Their Components. The present amylase is separately added to these formulations.
Detergent Composition
Component Surfactants A B C D E F G H I J K L M N
C.I. Fluorescent Brightener
260 0.1125 0.1125 0.1125 0.043 0.15 0.1174 0.048 0.1455 0.2252 0.1455 0.153 0.153 0.171 0.171
C.I. Fluorescent Brightener
351 (Tinopal ® CBS) 0.0952 0.1049
Suds suppressor granule 0.015 0.015 0.015 0.031 0.04 0.0658 0.04 0.042 0.042 0.042 0.042
Hyrdophobically modified
carboxy methyl cellulose
(Finnifix ® SH-1)
Bentonite
Miscellaneous (Dyes,
perfumes, process aids,
moisture and sodium BalBalBalBalBalBalBalBalBalBalBalBalBalBalsulphate) ance ance ance ance ance ance ance ance ance ance ance ance ance ance
Dishwas tiing Detergent Gel Compositions
Ingredients 1 2 3 4 5
(wt%) (wt%) (wt%) (wt%) (wt%)
Polytergent ® SLF-18 1 1.3 0.8 1 0.9
Sodium Benzoate (33%
active) 0.61 0.61 0.61 0.6 0.6
Xanthan gum 1 0.8 1.2 1 1.1
Sodium Sulphate 10 10 10 8 10
Perfume 0.03 0.05 0.03 0.06 0.1
Sodium Silicate 2
Citric Acid (50% active) 12.5 12
GLDA 7 8
Protease 1 (44 mg
active/g 0.7 0.3
4-Formyl -Phenyl
BoronicAcid 0.05
Protease 2 (10 mg/g)
encapsulated 2 0.6
Protease 3 (48 mg
active/g) 0.5
Protease 4 (123 mg
active/g)
Ethanol 0.3
Potassium Hydroxide
(45% active) 14.6 14.6 14.6 14
Calcium Chloride (25%
active) 1.8 1.8 1.8 1.1 0.4
Dye 0.05 0.05 0.05 0.05 0.02
Proxcel GXL™ (19%
active) 0.05 0.05 0.05 0.05 0.05
Acusol™ 8209 0.34 0.34 0.3 0.35 0.3
Acusol™ 425N (50%
active) 3 3 3.5 2.5 2
Amylases (25 mg/g
active) 0.2 0.5 0.4 0.3 0.1
Water & other adjunct Balance Balance Balance Balance Balance ingredients to 100% to 100% to 100% to 100% to 100%
Figure imgf000123_0001
Figure imgf000124_0001
Powder and Liquid Dishwashing Composition with Cleaning Surfactant System
Ingredients Wt%
Nonionic surfactant 0-1.5%
Octadecyl dimethylamine N-oxide
dihydrate 0-5%
80:20 wt C18/C16 blend of octadecyl
dimethylamine N-oxide dihydrate and
hexadecyldimethyl amine Noxide
dehydrate 0-4%
70:30 wt C18/C16 blend ofoctadecyl
bis (hydroxyethyl)amine N-oxide
anhydrous and hexadecyl bis
(hydroxyethyl) amine N-oxide
anhydrous 0-5%
C13-C1S alkyl ethoxysulfate with an
average degree of ethoxylation of 3 0-10%
C12-C1S alkyl ethoxysulfate with an
average degree of ethoxylation of 3 0-5%
C13-C1S ethoxylated alcohol with an
average degree of ethoxylation of 12 0-5%
A blend of C 12-C IS ethoxylated
alcohols with an average degree of
ethoxylation of 9 0-6.5%
A blend of C 13-C IS ethoxylated
alcohols with an average degree of
ethoxylation of 30 0-4%
Sodium disilicate 0-33%
Sodium tripolyphosphate 0-46%
Sodium citrate 0-28%
Citric acid 0-29%
Sodium carbonate 0-20%
Sodium perborate monohydrate 0-11.5%
Tetraacetyl ethylene diamine (TAED) 0-4%
Maleic acid/acrylic acid copolymer 0-7.5%
Sodium sulfate 0-12.5%
0.0001-0.1
Enzymes %
Non- Aqueous Liquid Automatic Dishwashing Composition
Ingredients Wt%
Liquid nonionic surfactant (e.g.
alcohol ethoxylates) 2.0-10.0%
Alkali metal silicate 3.0-15.0%
Alkali metal phosphate 0-40.0%
Liquid carrier selected from
higher glycols, poly glycols,
poly oxides, glycol ethers 25.0-45.0%
Stabilizer (e.g. a partial ester of
phosphoric acid and a C16-C18
alkanol) 0.5-7.0%
Foam suppressor (e.g. silicone) 0-1.5%
0.0001-0.1
Enzymes %
Figure imgf000126_0001
Thixotropic Liquid Automatic
Dishwashing Composition
Ingredients Wt%
C 12-C 14 fatty acid 0-0.5%
Block co-polymer surfactant 1.5-15.0%
Sodium citrate 0-12%
Sodium tripolyphosphate 0-15%
Sodium carbonate 0-8%
Aluminium tristearate 0-0.1%
Sodium cumene sulfonate 0-1.7%
Polyacrylate thickener 1.32-2.5%
Sodium polyacrylate 2.4-6.0%
Boric acid 0-4.0%
Sodium formate 0-0.45%
Calcium formate 0-0.2%
Sodium n-decydiphenyl oxide
disulfonate 0-4.0%
Monoethanol amine (MEA) 0-1.86%
Sodium hydroxide (50%) 1.9-9.3%
1,2-Propanediol 0-9.4%
0.0001-
Enzymes 0.1%
Suds suppressor, dye,
perfumes, water Balance
Liquid Automatic
Dishwashing Composition
Ingredients Wt%
Alcohol
ethoxylate 0-20%
Fatty acid ester
sulfonate 0-30%
Sodium
dodecyl sulfate 0-20%
Alkyl
polyglycoside 0-21%
Oleic acid 0-10%
Sodium
disilicate
monohydrate 0-33%
Sodium citrate
dihydrate 0-33%
Sodium stearate 0-2.5%
Sodium
perborate
monohydrate 0-13%
Tetraacetyl
ethylene
diamine
(TAED) 0-8%
Maleic
acid/acrylic
acid copolymer 4-8%
0.0001-
Enzymes 0.1%
Figure imgf000128_0001
Figure imgf000129_0001
Figure imgf000129_0002
tetrasodium salt (from
Solutia)
Sodium lauryl ether 10 5 5 5 5 5 5 5 sulfate with 2 EO
Monoethanolarnine 3 3 3 3 3 3 3 3
Ci2-i8-fatty acid 7.5 7.5 7.5 7.5 7.5 7.5 7.5 7.5
Propylene glycol 6.5 6.5 6.5 6.5 6.5 6.5 6.5
Sodium cumene sulfonate 2 2 2 2 2 2 2
Enzymes, dyes, + + + + + + + + stabilizers
Microcapsules with about 0.5 0.5 0.5 0.5 0.5 0.5 0.5 0.5
2000 μιη diameter
Water To To To To To To To To
100 100 100 100 100 100 100 100
Flow limit (Pas) 0.58 1.16 1.16 no no no yes no
Figure imgf000130_0001
Figure imgf000131_0001
Figure imgf000131_0002
Compositions of a Clear Aqueous Detergent and Cleaning Agent having a flow limit
Figure imgf000132_0001
Figure imgf000133_0001
Water To 100
Figure imgf000133_0002
Figure imgf000134_0001
Figure imgf000134_0002
Figure imgf000135_0001
Figure imgf000135_0002
Figure imgf000135_0003
Copolymer comprising
i) monomers from the group of mono- or polyunsaturated carboxylic acids
ii) monomers of the general formula R'(R2)C=C(R3)-X-R4, in which R1 to R3 mutually independently denote -H, -CH3 or -C2H5, X denotes an optionally present spacer group which is selected from -CH2-,-C(0)0- and -C(0)-NH-, and R4 denotes a straight chain or branched saturated alkyl residue with 2 to 22 carbon atoms or denotes an unsaturated, preferably aromatic residue with 6 to 22 carbon atoms
iii) optionally further monomers
2Nonionic surfactant of the general formula R1-CH(OH)CH20-(AO)w-(A,0)x-(A"0)y-(A,"0)z-R2, in which R1 denotes a straight-chain or branched, saturated or mono- or polyunsaturated C6 -24 alkyl or alkenyl residue; R2 denotes a linear or branched hydrocarbon residue with 2 to 26 carbon atoms; A, A', A" and A'" mutually independently denote a residue from the group comprising— CH2CH2, - CH2CH2— CH2,— CH2CH2-CH(CH3), CH2-CH2-CH2CH2, -CH2-CH-(CH3)-CH2-, -CH2-CH(CH2- CH3), w, x, y and z denote values between 0.5 and 120, wherein x, y and/or z may also be 0.
Figure imgf000136_0001
Figure imgf000136_0002
Example detergent compositions for application to a substrate
Weight Percent (actives %)
Ingredients Dl D2 D3 D4 D5
Sodium dodecyl benzene sulfonate 26.09 17.30 15.60 17.70 16.70
Sodium alkyl Ci4_i5/ 7EO ether 13.80 - - - - sulfate
Linear alcohol ethoxylate C14.15/ 13.44 5.4 14.6 5.5 5.2 7EO
Polyethylene glycol PEG 75 2 1.4 1.3 1.4 1.4
Polyoxyethylene (100) stearyl ether 21.99 15.6 14.1 15.9 15.1
Sodium silicate Si02/Na20 ratio 3.72 16.6 15 17 16 1.6-1.8
Sodium Silicate (Britesil ® C24) 7 - - - -
Sodium Carbonate - 6.5 5.9 6.7 6.3
Sodium tetraborate decahydrate - 11.9 10.8 12.2 11.5
Sodium polyacrylate -4500 MW - 1.8 1.7 - 5.2
EDTA-tetrasodium salt - 0.1 0.1 0.1 0.1
Optical brightener (Tinopal ® CBS- 0.15 0.1 0.09 0.1 0.1 X)
Dyes and fragrances 0.9 0.9 0.81 1.01 0.91
Water 10.92 22.10 19.90 22.4 21.5
Figure imgf000137_0001
Figure imgf000137_0002
Additional Exemplary Automatic Dishwashing Agents
Ingredient Wt %
Formula 1 Formula 2 Formula 3 Formula 4
Citrate 12-50 15-40 12-50 15-40
Dicarboxylic acid 1-18 1-18 2-16 4-16
Carbonate 5-50 10-40 5-50 10-40
Phosphate - - - -
Bleaching Agent - - - -
Misc To 100 To 100 To 100 To 100
Figure imgf000138_0001
Preferred Automatic Dishwashing Agents
Ingredient Wt %
Formula 1 Formula 2 Formula 3 Formula 4
Citrate 12-50 15-40 12-50 15-40
Dicarboxylic acid 1-18 1-18 2-16 4-12
Carbonate 0-50 0-30 0-30 0-30
Phosphonate 0-8 0-8 0-8 0-8
Non-ionic 0.1-15 0.1-15 0.5-8 0.5-8 surfactant
Phosphate - - - -
Bleaching Agent - - - -
Misc To 100 To 100 To 100 To 100
Additional Preferred Automatic Dishwashing Agents
Ingredient Wt %
Formula 1 Formula 2 Formula 3 Formula 4
Citrate 12-50 15-40 12-50 15-40
Maleic acid 1-18 1-18 2-16 4-12
Carbonate 5-50 10-30 5-50 10-30
Phosphonate 1-8 1-8 1.2-6 1.2-6
Non-ionic 0.1-15 0.1-15 0.5-8 0.5-8 surfactant
Phosphate - - - -
Bleaching Agent - - - -
Misc To 100 To 100 To 100 To 100
Preferred Automatic Dishwashing Agents
Ingredient Wt %
Formula 1 Formula 2 Formula 3 Formula 4
Citrate 12-50 15-40 12-50 15-40
Dicarboxylic acid 1-18 1-18 2-16 4-12
Carbonate 0-50 0-30 0-30 0-30
Phosphonate 0-8 0-8 0-8 0-8
Sulfo copolymer 0-20 0-20 0-20 0-20
Non-ionic 0-15 0-15 0-8 0-8 surfactant
Enzyme 0.1-12 0.1-12 0.5-8 0.5-8 preparations
Phosphate - - - -
Bleaching Agent - - - -
Misc To 100 To 100 To 100 To 100 Additional Preferred Automatic Dishwashing Agents
Ingredient Wt %
Formula 1 Formula 2 Formula 3 Formula 4
Citrate 12-50 15-40 12-50 15-40
Maleic acid 1-18 1-18 2-16 4-12
Carbonate 5-50 10-30 5-50 10-30
Phosphonate 1-8 1-8 1.2-6 1.2-6
Sulfo copolymer 0-20 0-20 0-20 0-20
Non-ionic 0.1-15 0.1-15 0.5-8 0.5-8 surfactant
Enzyme 0.1-12 0.1-12 0.5-8 0.5-8 preparations
Phosphate - - - -
Bleaching Agent - - - -
Misc To 100 To 100 To 100 To 100
Figure imgf000140_0001
Automatic Dishwashing Agents
Ingredient Wt %
C 1 E 1
Sodium citrate 9 9
Potassium
hydroxide 7 7
Sodium carbonate 14 14
Maleic acid - 1
Sulfo polymer 4.2 4.2
HEDP 1.5 1.5
Non-ionic
surfactant 2 2
Protease
preparation 2 2
Amylase
preparation 0.8 0.8
Alkanolamine 1.5 1.5
Thickener 2 2
Water, misc To 100 To 100
Manual Dishwashing Agents
Ingredient Wt %
Invention Invention Invention Invention Invention Invention Invention
1 2 3 4 5 6 7
Fatty alcohol ether
sulfate 10 13.33 12 12 13.3 13.3 13.3
Cocamidopropylbetaine 2.5 3.33 3.1 3.1 3 3 3
See. Alkanesulfonate 2.5 3.33 2.9 2.9 3.7 3.7 3.7
Fatty alcohol
ethoxylate 9 6 - - - - -
Sodium chloride 24 24 22 24 20 24 20
Ethanol - - 2 2 2.5 2.5 4
Perfume 0.2 0.3 0.3 0.3 0.3 0.3 0.3
Colorant 0.2 0.2 0.2 0.2 0.2 0.2 0.2
Water 51.60 49.51 57.5 55.5 57 53 55.5
Figure imgf000143_0001
Detergent containing anti-grey agent
Ingredients Ml (wt%)
C9-13 alkylbenzenesulfonate sodium salt 10
Sodium lauryl ether sulfate with 2EO 5
C12-18 fatty alcohol with 7EO 10
C12-14 alkyl polyglycoside 2
C12-18 fatty acid sodium salt 8
Glycerol 5
Trisodium citrate 1
Polyacrylate 2
Active ingredient (anti-grey agent-a polycarbonate-, polyurethane-, 1 and/or polyurea-polyorganosiloxane compound or a precursor compound
use in the production thereof)
Enzyme, dye, optical brightener +
Water To 100
Figure imgf000144_0001
Example enzyme containing compositions for application to a substrate
Ingredients Weight Percent (actives %)
El E2 E3 E4 E5
Polyethylene Glycol PEG- 98.60 99.10
75
Fatty acid based matrix 1 98.9 99.10
Fatty acid based matrix 2 98.80
Protease 0.10 0.10 0.12 0.10 0.10
Mannanase 0.02 0.02 0.02
Amylase 0.12 0.25 0.1 0.12 0.25
Cellulase 0.08 0.1 0.08
Lipase 0.08 0.08
Pectate Lyase 0.05
Enzyme Stabilizers 1.00 0.55 0.75 0.75 0.55
Fatty acid based matrix 1 is comprised of 20 wt. % of the sodium salt of coconut fatty acid, 50 wt. % of non polymeric polyols (sorbitol, glycerin, propylene glycol, sucrose and glucose), 15 wt.% of anionic and nonionic surfactants, and 15 wt. % of water.
Fatty acid based matrix 2 is comprised of 20 wt.% of the sodium salt of stearic acid, 3 wt.% of the sodium salt of lauric acid, 3 wt.% of the sodium salt of myristic acid, 50 wt.% of non polymeric polyols (sorbitol, glycerin, and propylene glycol), 2 wt.% of lauric acid, 2 wt.% of stearic acid, 10 wt.% of anionic surfactant, and 10 wt.% of water.
Table 1 Detergent Composition
Ingredients ( by weight)
Soap (saturated Cn-24 fatty acid soaps and oleic acid soap) 5.42
Sodium C12-14 alkyl benzenesulfonate 22.67
Sodium C14-16 fatty alcohol sulfate 4.59
C12-18 fatty alcohol.5EO 0.81
Sodium carbonate 4.55
Zeolite A 29.86
Sodium silicate 8.00
Acrylic acid/maleic acid copolymer 16.16
Opt. brightener 0.45
Phosphonate 2.30
NaOH, 50% 0.63
Water 3.88
Other salts 0.68
Table 2
Detergent composition 59.5%
Coated bleaching agent (Na percarbonate) 23.3%
Coated bleach activator (TAED) 7%
Citric acid monohydrate 10.2%
Figure imgf000146_0001
Detergent composition A
9 % anionic detergent
1 % nonionic detergent
21.5 % sodium tripolyphosphate
7 % sodium perborate
0.6 % Savinase (a proteolytic enzyme)
balance sodium sulphate + minor ingredients Detergent composition B
9 % anionic detergent
4 % nonionic detergent
28% zeolite
4.5% nitrilotriacetate
5.5% sodium perborate
3.5% tetraacetylethylenediamine
0.5% Savinase
balance sodium sulphate + minor ingredients
Figure imgf000147_0001
Figure imgf000147_0002
Laundry detergent composition
Ingredients Parts by weight
Sodium dodecyl benzene sulphonate 8.5
C12-C15 primary alcohol, condensed with 7 moles of ethylene
oxide 4
Sodium-hardened rapeseed oil soap 1.5
Sodium triphosphate 33
Sodium carbonate 5
Sodium silicate 6
Sodium sulphate 20
Water 9
Fluorescers, soil-suspending agents, dyes, perfumes minor amount
Sodium perborate 12
Tetraacetyl ethylene diamine (TAED) (granules) 2
Proteolytic enzyme (Savinase ex NOVO) 0.4
Laundry detergent compositions
A B C D
sodium
dodecylbenzene
sulphonate 9 9 9 9
C13-C15 linear
primary alcohol,
condensed with 7
moles of ethylene
oxide (e.g.
Synperonic A7) 1 4 4 1
C13-C15 linear
primary alcohol,
condensed with 3
moles of ethylene
oxide (e.g.
Synperonic A3) 3 0 0 3 sodium
tripolyphosphate 23 23 0 0 zeolite type 4A 0 0 24 24 copolymer of acrylic
acid with maleic
anhydride 4 4 sodium polyacrylate 2 2 0 0 alkaline silicate 5 5
fluorescer 0.25 0.25 0.16 0.16
EDTA 0.15 0.15 0.18 0.18
SCMC 0.5 0.5 0.55 0.55 salt 2 2
sodium sulphate 26.8 26.8 22.31 22.31 sodium carbonate 0 0 10.3 10.3 moisture 10 10 11 11
TAED 3 3 3.3 3.3 sodium perborate
monohydrate 10 10 8 8 calcium Dequest® 2047 0.7 0.7 0.3 0.3 foam depressor 3 3 2.5 2.5 perfume 0.2 0.2 0 0 alkaline protease
(Savinase (A) 6T) 0.4 0.4 0.4 0.4
Figure imgf000150_0001
7.6. Methods of Assessing Amylase Activity in Detergent Compositions
[00281] Numerous a-amylase cleaning assays are known in the art, including swatch and micro-swatch assays. The appended Examples describe only a few such assays.
[00282] In order to further illustrate the compositions and methods, and advantages thereof, the following specific examples are given with the understanding that they are illustrative rather than limiting.
8. Brewing Compositions
[00283] The present variant amylase may be a component of a brewing composition used in a process of brewing, i.e., making a fermented malt beverage. Non-fermentable carbohydrates form the majority of the dissolved solids in the final beer. This residue remains because of the inability of malt amylases to hydrolyze the alpha- 1,6-linkages of the starch. The non- fermentable carbohydrates contribute about 50 calories per 12 ounces of beer, an amylase, in combination with a glucoamylase and optionally a pullulanase and/or isoamylase, assist in converting the starch into dextrins and fermentable sugars, lowering the residual non- fermentable carbohydrates in the final beer.
[00284] The principal raw materials used in making these beverages are water, hops and malt. In addition, adjuncts such as common corn grits, refined corn grits, brewer's milled yeast, rice, sorghum, refined corn starch, barley, barley starch, dehusked barley, wheat, wheat starch, torrified cereal, cereal flakes, rye, oats, potato, tapioca, and syrups, such as corn syrup, sugar cane syrup, inverted sugar syrup, barley and/or wheat syrups, and the like may be used as a source of starch.
[00285] For a number of reasons, the malt, which is produced principally from selected varieties of barley, has the greatest effect on the overall character and quality of the beer. First, the malt is the primary flavoring agent in beer. Second, the malt provides the major portion of the fermentable sugar. Third, the malt provides the proteins, which will contribute to the body and foam character of the beer. Fourth, the malt provides the necessary enzymatic activity during mashing. Hops also contribute significantly to beer quality, including flavoring. In particular, hops (or hops constituents) add desirable bittering substances to the beer. In addition, the hops act as protein precipitants, establish preservative agents and aid in foam formation and stabilization.
[00286] Grains, such as barley, oats, wheat, as well as plant components, such as corn, hops, and rice, also are used for brewing, both in industry and for home brewing. The components used in brewing may be unmalted or may be malted, i.e., partially germinated, resulting in an increase in the levels of enzymes, including a-amylase. For successful brewing, adequate levels of α-amylase enzyme activity are necessary to ensure the appropriate levels of sugars for fermentation, an amylase, by itself or in combination with another a-amylase(s), accordingly may be added to the components used for brewing.
[00287] As used herein, the term "stock" means grains and plant components that are crushed or broken. For example, barley used in beer production is a grain that has been coarsely ground or crushed to yield a consistency appropriate for producing a mash for fermentation. As used herein, the term "stock" includes any of the aforementioned types of plants and grains in crushed or coarsely ground forms. The methods described herein may be used to determine a-amylase activity levels in both flours and stock.
[00288] Processes for making beer are well known in the art. See, e.g., Wolfgang Kunze (2004) "Technology Brewing and Malting," Research and Teaching Institute of Brewing, Berlin (VLB), 3rd edition. Briefly, the process involves: (a) preparing a mash, (b) filtering the mash to prepare a wort, and (c) fermenting the wort to obtain a fermented beverage, such as beer.
Typically, milled or crushed malt is mixed with water and held for a period of time under controlled temperatures to permit the enzymes present in the malt to convert the starch present in the malt into fermentable sugars. The mash is then transferred to a mash filter where the liquid is separated from the grain residue. This sweet liquid is called "wort," and the left over grain residue is called "spent grain." The mash is typically subjected to an extraction, which involves adding water to the mash in order to recover the residual soluble extract from the spent grain. The wort is then boiled vigorously to sterilizes the wort and help develop the color, flavor and odor. Hops are added at some point during the boiling. The wort is cooled and transferred to a fermentor. [00289] The wort is then contacted in a fermentor with yeast. The fermentor may be chilled to stop fermentation. The yeast flocculates and is removed. Finally, the beer is cooled and stored for a period of time, during which the beer clarifies and its flavor develops, and any material that might impair the appearance, flavor and shelf life of the beer settles out. The beer usually contains from about 2% to about 10% v/v alcohol, although beer with a higher alcohol content, e.g., 18% v/v, may be obtained. Prior to packaging, the beer is carbonated and, optionally, filtered and pasteurized.
[00290] The brewing composition comprising an amylase, in combination with a
glucoamylase and optionally a pullulanase and/or isoamylase, may be added to the mash of step (a) above, i.e., during the preparation of the mash. Alternatively, or in addition, the brewing composition may be added to the mash of step (b) above, i.e., during the filtration of the mash. Alternatively, or in addition, the brewing composition may be added to the wort of step (c) above, i.e., during the fermenting of the wort. [00291] A fermented beverage, such as a beer, can be produced by one of the methods above. The fermented beverage can be a beer, such as full malted beer, beer brewed under the
"Reinheitsgebot," ale, IPA, lager, bitter, Happoshu (second beer), third beer, dry beer, near beer, light beer, low alcohol beer, low calorie beer, porter, bock beer, stout, malt liquor, non-alcoholic beer, non-alcoholic malt liquor and the like, but also alternative cereal and malt beverages such as fruit flavored malt beverages, e.g., citrus flavored, such as lemon-, orange-, lime-, or berry- flavored malt beverages, liquor flavored malt beverages, e.g., vodka-, rum-, or tequila- flavored malt liquor, or coffee flavored malt beverages, such as caffeine-flavored malt liquor, and the like.
9. Reduction of Iodine-Positive Starch [00292] Variant amylases may reduce the iodine-positive starch (IPS), when used in a method of liquefaction and/or saccharification. One source of IPS is from amylose that escapes hydrolysis and/or from retrograded starch polymer. Starch retro gradation occurs spontaneously in a starch paste, or gel on ageing, because of the tendency of starch molecules to bind to one another followed by an increase in crystallinity. Solutions of low concentration become increasingly cloudy due to the progressive association of starch molecules into larger articles. Spontaneous precipitation takes place and the precipitated starch appears to be reverting to its original condition of cold-water insolubility. Pastes of higher concentration on cooling set to a gel, which on ageing becomes steadily firmer due to the increasing association of the starch molecules. This arises because of the strong tendency for hydrogen bond formation between hydroxy groups on adjacent starch molecules. See J.A. Radley, ed., STARCH AND ITS
DERIVATIVES 194-201 (Chapman and Hall, London (1968)).
[00293] The presence of IPS in saccharide liquor negatively affects final product quality and represents a major issue with downstream processing. IPS plugs or slows filtration system, and fouls the carbon columns used for purification. When IPS reaches sufficiently high levels, it may leak through the carbon columns and decrease production efficiency. Additionally, it may results in hazy final product upon storage, which is unacceptable for final product quality. The amount of IPS can be reduced by isolating the saccharification tank and blending the contents back. IPS nevertheless will accumulate in carbon columns and filter systems, among other things. The use of variant amylases is expected to improve overall process performance by reducing the amount of IPS.
[00294] All references cited herein are herein incorporated by reference in their entirety for all purposes. In order to further illustrate the compositions and methods, and advantages thereof, the following specific examples are given with the understanding that they are illustrative rather than limiting.
EXAMPLES Example 1
Assays
[00295] Various assays used herein are set forth, below, for ease in reading. Any deviations from the protocols in later Examples are indicated in the relevant sections. In these experiments, a spectrophotometer was used to measure the absorbance of the products formed after the completion of the reactions. All assays were performed with culture supernatants treated with chelex beads.
A. Chelex bead treatment of culture supernatants
[00296] 96-well microtiter plates (MTPs) containing growing cultures were removed from incubators and Enzyscreen lids were replaced with disposable plastic sealers (Nunc cat. #
236366; Rochester, NY, USA). Cells were separated from culture supernatant via centrifugation (1118 RCF, 5 minutes). 150 μΐ^ supernatant was removed from each well and transferred to filter plates (Millipore Multiscreen HTS,Billerica, MA, USA) containing Chelex beads prepared as described below. Plates were shaken vigorously for 5 minutes and supernatant from 3 replicate growth plates were collected into a single deep-well microtiter plate (Axygen, PDW-
11-C) using a vacuum manifold device. Plates containing supernatants were sealed and stored at 4°C.
Chelex-100 beads, 200-400 mesh (BioRad, Hercules, CA, USA) were washed twice with 2 bed- volumes of 1 M HCl followed by 5 bed- volumes of ultrapure water on a sintered glass filter apparatus. 2 bed- volumes of 1 M KOH were used to wash the beads followed by another 5 bed- volume wash with ultrapure water. Filtered beads were transferred to a beaker and suspended with enough ultrapure water to produce slurry capable of mixing. The pH of the slurry was adjusted to 8-8.5 using HCl. The liquid was removed and the beads were dried using a scintered glass filter. A slurry of beads (40% w/v) was prepared in ultra pure water and its pH was adjusted to 8.0 using KOH/HC1. A slurry having a constant consistency was maintained by vigorous mixing. A bubble paddle reservoir device (V&P Scientific, San Diego, CA, USA) was used to transfer 100 μΐ^ of slurry to all wells of filter plates. Liquid was removed using a vacuum manifold device.
B. Protein Determination Assay
[00297] Protein determination assays were performed using chelex bead-treated culture supernatant from cultures grown in 96- well micro-titer plates (MTPs) over 3 days at 37 °C with shaking at 300 rpm and 80% humidity. A fresh 96-well round-bottom MTP containing 25 μΐ^ supernatant per well was used for the High Performance Liquid Chromatography (HPLC) protein determination method. Supematants were diluted four fold into 25 mM sodium acetate pH 5.5, and 10 μΐ^ of each diluted sample was analyzed. An Agilent 1200 (Hewlett Packard) HPLC equipped with a Poroshell 300SB-C8 (Agilent Technologies Santa Clara, CA, USA) column was used. Sample was bound to the column using 25 mM sodium acetate pH 5.5 and eluted over a gradient up to 70% acetonitrile. Absorbance was measured at 220 nm, integrated using ChemStation software (Agilent Technologies) and the protein concentration of samples was determined based on a standard curve of purified CspAmy2-vl protein. C. Ceralpha a- Amylase Activity Assay
[00298] The Ceralpha a-amylase assay was performed using the Ceralpha Kit (Megazyme, Wicklow, Ireland). The assay involves incubating culture supernatant with a substrate mixture under defined conditions, and the reaction is terminated (and color developed) by the addition of borate buffer (200 mM Boric acid/NaOH buffer, pH 10). The substrate is a mixture of the defined oligosaccharide "nonreducing-end blocked p-nitrophenyl maltoheptaoside" (BPNPG7) and excess levels of a-glucosidase (which has no action on the native substrate due to the presence of the "blocking group"). On hydrolysis of the oligosaccharide by endoacting a- amylase, the excess quantities of a-glucosidase present in the mixture give instantaneous and quantitative hydrolysis of the p-nitrophenyl malto saccharide fragment to glucose and free p- nitrophenol. The absorbance at 405 nm was measured, which relates directly to the level of amylase in the sample analyzed.
[00299] The equipment used for this assay included a Biomek FX Robot (Beckman Coulter Brea, CA, USA); a SpectraMAX MTP Reader (type 340-Molecular Devices, Sunnyvale, CA, USA) and iEMS incubator/shaker (Thermo Scientific, Rockford, IL, USA). The reagent and solutions used were:
1) /7-nitrophenyl maltoheptaoside (BPNPG7) substrate (Megazyme Ceralpha HR kit);
2) 50 mM Malate buffer, 0.005% TWEEN® 80, pH 5.6 or 50 mM MOPS, 0.005%
TWEEN® 80, pH 7 (dilution buffers); and
3) 200 mM Boric acid / NaOH buffer, pH 10 (STOP buffer).
[00300] A vial containing 54.5 mg BPNPG7 substrate was dissolved in 10 mL of MilliQ water and then diluted into 30 mL of dilution buffer to make up 40 mL of the working substrate (1.36 mg/mL). The amylase samples (fermentation supernatant) were diluted 40X with dilution buffer. The assay was performed by adding 5μί of diluted amylase solution into the wells of a MTP followed by the addition of 55 μΐ^ of diluted BPNPG7 working substrate solution. The solutions were mixed and the MTP was sealed with a plate seal and placed in an
incubator/shaker (iEMS- Thermo Scientific) for 4 minutes at 25°C. The reaction was terminated by adding 70 μΐ^ STOP buffer and the absorbance was read at wavelength 400 nm in an MTP- Reader. A non-enzyme control was used to correct for background absorbance values.
D. Thermostability Assay
[00301] The thermostability of CspAmy2-vl and variants was measured by determining the amylase activity using the Ceralpha a-amylase assay. The equipment used for this assay included a Biomek FX Robot (Beckman Coulter); a SpectraMAX MTP Reader (type 340- Molecular Devices), a Tetrad2DNA Engine PCR machine (Biorad), and iEMS incubator/shaker (Thermo Scientific). The reagent solutions used were (* not in all assays):
1) Heat stress buffers
a) 50 mM KOAc pH 4.5 (5 ppm CaCl2, 50 ppm NaCl)*,
b) 50 mM KOAc pH 5.0 (10 ppm CaCl2, 10 mM NaCl)
c) 50 mM KOAc pH 5.7 (5 ppm CaCl2, 50 ppm NaCl),
d) 50 mM KOAc pH 5.7 (no salt condition)*,
2) p-nitrophenyl maltoheptaoside (BPNPG7) substrate (Megazyme Ceralpha HR kit):
3) 50 mM Malate buffer, 0.005% TWEEN® 80, pH 5.6 (dilution buffer); and
4) 200 mM Boric acid / NaOH, pH 10 (STOP buffer).
5) Amylase culture supernatant: 1: 10 master dilution enzyme plates were diluted 1: 10 in each of the four heat stress buffers in a PCR plate
[00302] 5 μΐ^ of the diluted enzyme samples were added to a 96-well PCR plate containing 55 μL· of diluted BPNPG7 working substrate solution and the initial amylase activity of the samples was determined using the Ceralpha a-amylase assay as described in Section C. The samples were subjected to heat stress for 3-6 minutes in a PCR thermocycler as follows: Buffers (a) 50°C, (b) 59°-60°C, (c) 65°-70°C, and (d) 65°C. The heat stressed samples were cooled immediately to room temperature and 5 μΐ^ aliquots were assayed for amylase acitivity using the Ceralpha a-amylase assay as described in Section C. For each variant, the ratio of the initial and residual amylase activities was used to calculate the thermostability as follows: Thermostability = [tresiduai value] / [tibial value], so the heat stability activity ratio was calculated based on enzyme activity after heat incubation divided by enzyme activity before heat incubation. For each sample (variants) the performance index (PI) is calculated. The performance index for thermostability stability is determined by comparing the thermostability of the variant enzyme with that of the similarly treated CspAmy2-vl enzyme (SEQ ID NO: 3).
E. Starch Hydrolysis Assays (Corn Flour and Corn Starch Application assays)
[00303] Starch hydrolysis of corn flour and corn starch were used to measure specific activity of CspAmy2-vl and variants. Activity was measured as reducing ends generated by the enzymatic breakdown of corn flour or corn starch. The reducing ends generated during the incubation with either substrate were quantified using a PAHBAH (p-hydroxybenzoic acid hydrazide) assay. The equipment used for the assay included a Biomek FX Robot (Beckman Coulter); a SpectraMAX MTP Reader (type 340-Molecular Devices), a Tetrad2DNA Engine PCR machine (Biorad), and iEMS incubator/shaker (Thermo Scientific), and a Bubble Paddle Reservoir.
[00304] Azure Farms Organic Corn Flour (Norco, CA) was ground to a fine powder using a consumer coffee grinder and then sifted to obtain a < 250 micron fraction. The sifted corn flour was washed extensively with MilliQ water by repeated suspension and centrifugation. Cargill Farms Organic Corn Starch material was also washed extensively with MilliQ water by repeated suspension and centrifugation.
[00305] Both corn flour and corn starch washed fractions were suspended in MilliQ water containing 0.005% sodium azide as 20% (w/w) stock solutions. The stock solutions were further diluted with a 20X stock buffer solution to 10.9% w/v corn flour and corn starch solutions (final buffer concentration: 55 mM KOAc, pH 5).
[00306] 55 μΐ^ of the diluted corn flour and corn starch substrates were added to PCR micro titer plates along with 5 μΐ^ of 1: 10 diluted enzyme samples using a bubble paddle reservoir. The plates were sealed and placed at 83°C for 5 minutes followed by a ramp down to 45°C. The starch hydrolysis reaction was terminated by addition of 70 μΐ^ 0.1 N NaOH. The plates were sealed and centrifuged for 3 minutes at 1610 RCF. The starch hydrolysis reaction products from both reactions were analyzed by the PAHBAH assay as described below.
[00307] PAHBAH assay: Aliquots of 80 μΐ. of 0.5 N NaOH were added to all wells of an empty PCR plate (a "PAHBAH reaction plate"), followed by 20
Figure imgf000158_0001
of PAHBAH reagent (5% w/v p-hydroxybenzoic acid hydrazide (Sigma # H9882, St. Luois, MO), dissolved in 0.5 N HC1). The solutions were mixed by pipetting up and down. 20
Figure imgf000158_0002
of the starch hydrolysis reaction supematants were added to each well of the PAHBAH reaction plate. The plates were sealed and placed in a thermocycler, programmed for 2 minutes at 95 °C to develop color, and then cooled to 20°C. Samples of 80
Figure imgf000158_0003
of the developed PAHBAH reaction mixtures were transferred to a fresh plate, and absorbance was measured at 450 nm in a spectrophotometer.
F. CS-28 Rice Starch Microswatch Assay
[00308] The principle of this amylase assay is the liberation of an orange-dye due to the hydrolysis of rice starch incorporated in a cotton microswatch. The absorbance at 488 nm of the wash liquid is measured and this relates to the level of amylase activity in the sample analyzed at the desired conditions (pH, temperature, and buffer).
[00309] The equipment used for this assay included a Biomek FX Robot (Beckman Coulter), a SpectraMAX MTP Reader (type 340-Molecular Devices) and iEMS incubator/shaker (Thermo Scientific). The reagent and solutions used were:
1) CS-28 Microswatches (rice starch, colored);
2) 10 mM HEPES, 2 mM CaCl2, 0.005% TWEEN 80 buffer, pH 8.0, conductivity lmS/cm;
3) 25 mM CAPS, 2 mM CaCl2, 0.005% TWEEN 80 buffer, pH 10.0; conductivity 5mS/cm (adjusted with 5M NaCl); and
4) 10 mM NaCl, 0.1 mM CaCl2, 0.005% TWEEN 80.
5) 50 mM MOPS pH7.15, 0.1mM CaCl2.
[00310] CS-28 microswatches of 5.5 mm circular diameter were provided by the Center for Testmaterials (CFT, Vlaardingen, The Netherlands). Two microswatches were placed in each well of a 96-well Coming 9017 flat bottomed polystyrene MTP. The culture supematants were diluted eight fold in 50 mM MOPS pH7.15, 0.1 mM CaCl2, and subsequently in 10 mM NaCl, 0.1 mM CaCl2, 0.005% TWEEN®80 solution to approximately lppm, final enzyme
concentration. [00311] The incubator/shaker was set at the desired temperature, 25°C (ambient temperature) or 50°C. 174 μL· or 177 μL· of either HEPES or CAPS buffer, respectively, was added to each well of microswatch containing MTP and subsequently 6 μΐ^ or 3 μΐ^ of diluted enzyme solution was added to each well resulting in a total volume of 180
Figure imgf000159_0001
The MTP was sealed with a plate seal and placed in the iEMS incubator/shaker and incubated for 15 minutes at 1150 rpm at 25°C for cleaning at pH 8, low conductivity (1 mS/cm), or 15 minutes at 1150 rpm at 50°C for cleaning at pH 10, high conductivity (5 mS/cm). Following incubation under the appropriate conditions, 100 μΐ^ of solution from each well was transferred to a new MTP, and the absorbance at 488 nm was measured using a MTP- spectrophotometer. Controls containing two microswatches and buffer but no enzyme were included for subtraction of background cleaning performance.
[00312] Each absorbance value was corrected by subtracting the blank (obtained after incubation of microswatches in the absence of enzyme), and the resulting absorbance provided a measure of the hydrolytic activity. A performance index (PI) was calculated for each sample.
[00313] For calculation of the wash performance indices (PI), the Langmuir equation was used to fit the data based on the CspAmy2-vl enzyme (SEQ ID NO: 3) control. Using the protein concentration of the variants, the expected performance based on the curve-fit was calculated. The observed performance was divided by the calculated performance. This value was then divided by the performance of the CspAmy2-vl enzyme (SEQ ID NO: 3).
G. Detergent Stability Assay
[00314] The stability of the reference amylase (CspAmy2-vlenzyme (SEQ ID NO: 3)) and variants thereof was determined by measuring their activity after incubation under defined conditions, in the presence of a 10% detergent mixture (commercially purchased Persil Color Gel detergent, Henkel (Dusseldorf, Germany), purchased in 2011). The detergent was heat- inactivated before use, and the initial and residual amylase activities were determined using the Ceralpha a-amylase assay as described in section C, above.
[00315] The equipment used for this assay included a Biomek FX Robot (Beckman Coulter); a SpectraMAX MTP Reader (type 340-Molecular Devices), a Tetrad2DNA Engine PCR machine (Biorad), and iEMS incubator/shaker (Thermo Scientific). The reagent solutions used were:
1) p-nitrophenyl maltoheptaoside (BPNPG7) substrate (Megazyme Ceralpha HR kit):
2) Liquid detergent (Persil color gel, enzyme inactivated by heating for 2 hrs at 80°C); 3) 50 niM MOPS, 0.1 niM CaCl2, 0.005% TWEEN®80 buffer, pH 7 (dilution buffer);
4) 10% detergent solution diluted in dilution buffer;
5) 200 mM Boric acid / NaOH buffer, pH 10 (STOP buffer)
6) Amylase culture supernatants diluted eight fold in 50 mM MOPS pH7.15, 0.1 mM CaCl2 containing 0-100 μg/mL protein
[00316] 85 μΐ^ of a 10% detergent solution was added to a 96-well PCR plate and mixed with 15 μΐ^ of the diluted culture supernatant. A sample from the PCR plate was diluted 3X in dilution buffer and a 5 μΐ^ aliquot of this dilution was used to determine initial amylase activity. The PCR plate was incubated in a Tetrad PCR block at 80.5°C for 5 minutes. After incubation, detergent-enzyme mix was diluted 3X in dilution buffer and residual activity was measured. Initial (tibial) and residual (tresiduai) amylase activity was determined by the Ceralpha a-amylase assay as described above in Section C using a 5 μΐ^ sample.
[00317] For each variant, the ratio of the residual and initial amylase activities was used to calculate the detergent stability as follows: Detergent stability = [tresiduai value] / [t^iai value] .
[00318] For each sample (variants) the performance index (PI) was calculated. The performance index for detergent stability is determined by comparing the detergent stability of the variant enzyme with that of the similarly treated CspAmy2-vl enzyme (SEQ ID NO: 3). H. Performance index
[00319] The performance index (PI) compares the performance or stability of the variant and the parent enzyme (CspAmy2-vl) at the same protein concentration. In addition, the theoretical values can be calculated, using the parameters of the Langmuir equation of the standard enzyme. A performance index (PI) that is greater than 1 (PI>1) indicates improved performance by a variant as compared to the parent (e.g. , CspAmy2-vl, SEQ ID NO: 3), while a PI of 1 (PI=1) identifies a variant that performs the same as the parent, and a PI that is less than 1 (PI<1) identifies a variant that performs worse than the parent.
Example 2
Generation of B. subtilis strains expressing CspAmy2-vl and variants thereof
[00320] In this example, the construction of Bacillus subtilis strains expressing CspAmy2-vl amylase and variants, thereof, are described. CspAmy2-vl is a variant of CspAmy2 wild type (CspAmy2 wt) amylase having a deletion of both Arginine 178 and Glycine 179. CspAmy2 wt is an amylase from a Cytophaga sp., for which the nucleotide sequence was described by Chii- Ling et al. (2002) Appl. Environ. Microbiol. 68(7): 3651-3654. The CspAmy2-vl amylase was described as having increased thermostability over the CspAmy2 wt amylase by Rong-Jen et al. (2003) Appl. Environ. Microbiol. 69(4): 2383-2385.
[00321] A synthetic DNA fragment (SEQ ID NO: 4, herein referred to as "CspAmy2-vl DNA") encoding CspAmy2-vl (SEQ ID NO: 2) amylase was produced by GeneArt AG
(Regensburg, Germany) and served as template DNA for the construction of Bacillus subtilis strains expressing CspAmy2-vl amylase and variants, thereof.
[00322] SEQ ID NO:4 includes a codon-modified nucleotide sequence encoding the mature form of CspAmy2-vl amylase adjacent to a sequence encoding the LAT signal peptide
(underlined):
ATGAAACAACAAAAACGGCTTTACGCCCGATTGCTGACGCTGTTATTTGCGCTCATC
TTCTTGCTGCCTCATTCTGCAGCTAGCGCAGCAGCGACAAACGGAACAATGATGCA
GTATTTCGAGTGGTATGTACCTAACGACGGCCAGCAATGGAACAGACTGAGAACAG ATGCCCCTTACTTGTC ATCTGTTGGTATTAC AGCAGTATGGAC ACCGCCGGCTTATA AGGGCACGTCTCAAGCAGATGTGGGGTACGGCCCGTACGATCTGTATGATTTAGGC GAGTTTAATCAAAAAGGTACAGTCAGAACGAAGTATGGCACAAAAGGAGAACTTA AATCTGCTGTTAACACGCTGCATTCAAATGGAATCCAAGTGTATGGTGATGTCGTGA TGAATCATAAAGCAGGTGCTGATTATACAGAAAACGTAACGGCGGTGGAGGTGAAT CCGTCTAATAGAAATCAGGAAACGAGCGGCGAATATAATATTCAGGCATGGACAGG CTTCAACTTTCCGGGCAGAGGAACAACGTATTCTAACTTCAAATGGCAGTGGTTCCA TTTTGATGGAACGGATTGGGACCAGAGCAGAAGCCTCTCTAGAATCTTCAAATTCA CGGGAAAGGCGTGGGACTGGGAGGTTTCTTCAGAAAACGGAAATTATGACTATCTG ATGTACGCGGACATTGATTATGACCATCCGGATGTCGTGAATGAAATGAAAAAGTG GGGCGTCTGGTATGCCAACGAAGTTGGGTTAGATGGATACAGACTTGACGCGGTCA AACATATTAAATTTAGCTTTCTCAAAGACTGGGTGGATAACGCAAGAGCAGCGACG GGAAAAGAAATGTTTACGGTTGGCGAATATTGGCAAAATGATTTAGGGGCCCTGAA TAACTACCTGGCAAAGGTAAATTACAACCAATCTCTTTTTGATGCGCCGTTGCATTA CAACTTTTACGCTGCCTCAACAGGGGGTGGATATTACGATATGAGAAATATTCTTAA TAACACGTTAGTCGCAAGCAATCCGACAAAGGCTGTTACGTTAGTTGAGAATCATG ACACACAGCCTGGACAATCACTGGAATCAACAGTCCAACCGTGGTTTAAACCGTTA GCCTACGCGTTTATTCTCACGAGAAGCGGAGGCTATCCTTCTGTATTTTATGGAGAT ATGTACGGTACAAAAGGAACGACAACAAGAGAGATCCCTGCTCTTAAATCTAAAAT CGAACCTTTGCTTAAGGCTAGAAAAGACTATGCTTATGGAACACAGAGAGACTATA TTGATAACCCGGATGTCATTGGCTGGACGAGAGAAGGGGACTCAACGAAAGCCAA GAGCGGTCTGGCCACAGTGATTACAGATGGGCCGGGCGGTTCAAAAAGAATGTATG TTGGCACGAGCAATGCGGGTGAAATCTGGTATGATTTGACAGGGAATAGAACAGAT AAAATCACGATTGGAAGCGATGGCTATGCAACATTTCCTGTCAATGGGGGCTCAGT TTCAGTATGGGTGCAGCAA
[00323] The precursor form of the CspAmy2-vl polypeptide produced from the pHPLT02- CspAmy2-vl vector is shown, below, as SEQ ID NO: 3. The LAT signal peptide is underlined: MKOOKRLYARLLTLLFALIFLLPHSAASAAATNGTMMQYFEWYVPNDGOOWNRLRTD APYLSSVGITAVWTPPAYKGTSQADVGYGPYDLYDLGEFNQKGTVRTKYGTKGELKS AVNTLHSNGIQVYGDVVMNHKAGADYTENVTAVEVNPSNRNQETSGEYNIQAWTGFN FPGRGTTYSNFKWQWFHFDGTDWDQSRSLSRIFKFTGKAWDWEVSSENGNYDYLMY ADIDYDHPDVVNEMKKWGVWYANEVGLDGYRLDAVKHIKFSFLKDWVDNARAATG KEMFTVGEYWQNDLGALNNYLAKVNYNQSLFDAPLHYNFYAASTGGGYYDMRNILN NTLVASNPTKAVTLVENHDTQPGQSLESTVQPWFKPLAYAFILTRSGGYPSVFYGDMY GTKGTTTREIPALKSKIEPLLKARKDYAYGTQRDYIDNPDVIGWTREGDSTKAKSGLAT VITDGPGGSKRMYVGTSNAGEIWYDLTGNRTDKITIGSDGYATFPVNGGSVSVWVQQ [00324] The mature form of the CspAmy2-vl polypeptide produced from the pHPLT02- CspAmy2-vl vector is shown, below, as SEQ ID NO: 2.
AATNGTMMQYFEWYVPNDGQQWNRLRTDAPYLSSVGITAVWTPPAYKGTSQADVGY GPYDLYDLGEFNQKGTVRTKYGTKGELKSAVNTLHSNGIQVYGDVVMNHKAGADYT ENVTAVEVNPSNRNQETSGEYNIQAWTGFNFPGRGTTYSNFKWQWFHFDGTDWDQSR SLSRIFKFTGKAWDWEVSSENGNYDYLMYADIDYDHPDVVNEMKKWGVWYANEVGL DGYRLDAVKHIKFSFLKDWVDNARAATGKEMFTVGEYWQNDLGALNNYLAKVNYN QSLFDAPLHYNFYAASTGGGYYDMRNILNNTLVASNPTKAVTLVENHDTQPGQSLEST VQPWFKPLAYAFILTRSGGYPSVFYGDMYGTKGTTTREIPALKSKIEPLLKARKDYAYG TQRDYIDNPDVIGWTREGDSTKAKSGLATVITDGPGGSKRMYVGTSNAGEr YDLTGN RTDKITIGSDGYATFPVNGGSVSVWVQQ
[00325] To express CspAmy2-vl, the CspAmy2-vl DNA fragment was cloned into the pHPLT02 vector, a modified version of the pHPLT vector (Solingen et al. (2001) Extremophiles 5:333-341) by GeneArt and fused in-frame to the AmyL (LAT) signal peptide using the unique Nhel and Xhol restriction sites, resulting in plasmid pHPLT02-CspAmy2-vl. The pHPLT expression vector contains the B. licheniformis LAT promoter (Plat) and additional elements from pUBHO (McKenzie et al. (1986) Plasmid, 15: 93-103) including a replicase gene
(reppUB), a neomycin/kanamycin resistance gene (neo) and a bleomycin resistance marker
(bleo). Site-directed mutagenesis (Stratagene) was used to change the nucleotides 5 '-TCA-3 ' of Serine 28 of the AmyL signal peptide to nucleotides 5 '-AGC-3 ' in order to introduce the unique Nhel restriction site.
[00326] A suitable B. subtilis strain was transformed with pHPLT02-CspAmy2-vl plasmid DNA using a method known in the art (WO 02/14490). The B. subtilis transformants were selected on agar plates containing heart infusion agar (Difco, Catalog No. 244400,Lawrence, KS, USA and 10 mg/L neomycin sulfate (Sigma, Catalog No. N-1876; contains 732 μg neomycin per mg, St. Louis, Missouri, USA). Selective growth of B. subtilis transformants harboring the pHPLT02-CspAmy2-vl plasmid was performed in shake flasks at 37 °C for ~65h in MBD medium (enriched semi-defined medium based on MOPs buffer, with urea as major nitrogen source, glucose as the main carbon source, and supplemented with 1% soytone for robust cell growth) containing 5 mM CaCl2 and 10 ppm neomycin. Growth resulted in the production of secreted CspAmy2-vl amylase with starch hydrolyzing activity. Example 3
Generation of CspAmy2-vl Site Evaluation Libraries
[00327] The construction of a CspAmy2-vl site evaluation library (SEL) was performed by GeneArt using their technology platform for gene optimization, gene synthesis, and library generation (see, e.g., European Patent Nos. 0 200 362 and 0 201 184, US Patent Nos. 4,683,195, 4,683,202, and 6,472,184, and international patent application number WO 2004/059556A3). The pHPLT02-CspAmy2-vl plasmid DNA served as template to produce SELs at each of the sites in the mature region of CspAmy2-vl protein (SEQ ID NO: 3). GeneArt was commissioned to create the SELs at the positions using their standard protocols. The corresponding codons for each site were each substituted with codons for at least 10 (out of a possible 19) different amino acids. The codon-mutagenized pHPLT02-CspAmy2-vl mixtures were used to transform competent B. subtilis cells as known in the art (WO 2002/014490) to generate the CspAmy2-vl SELs. Transformation mixtures were plated on HI- agar plates (Heart Infusion agar) containing 10 mg/L neomycin sulfate. For each library, single bacterial colonies were picked and grown in TSB (tryptone and soy-based broth) liquid medium with 10 mg/ml neomycin selection for subsequent DNA isolation and gene sequence analysis. Sequence analysis data revealed a maximum of 19 Cs7?Amy2-vl mature variants per library. To generate CspAmy2-vl and variant enzyme samples for biochemical characterization, selective growth of the variants was performed in 96 well MTPs at 37°C for -65 hours with 70% humidity in MBD medium. A total of 7870 out of the 9139 possible variants were obtained for 478 out of the 481 positions mutagenized.
Example 4
Identification of Combinable and Productive Mutations
[00328] Performance index (PI) values were determined for all the CspAmy2-vl amylase variants tested using the assays described in Example 1: Corn flour and corn starch application assays, thermostability assay (at pH 5.0 and pH 5.7), CS-28 microswatch assay (at pH 8 and pH 10), detergent stability assay, Ceralpha activity assay, and protein determination.
Productive positions are described as those positions within a molecule that are most useful for making combinatorial variants exhibiting an improved characteristic, where each production position allows for at least one combinable mutation. Combinable mutations are mutations at any amino acid position that can be used to make combinatorial variants. Combinable mutations improve at least one desired property of the molecule, while not significantly decreasing expression, activity, or stability. Combinable mutations can be grouped as follows:
Group A: A mutation that produces a variant wherein the minimum performance indices (PI) relative to a defined parental protein for: (i) protein expression, (ii) CS-28 microswatch activity at pH 8 (25°C) or pHIO (50°C), or activity in Ceralpha assay, or activity in corn flour or corn starch application assays, and (iii) detergent stability or thermostability at pH 5.0 or pH 5.7 is greater than or equal to 0.9, and in addition have a PI for any one of these tests that is greater than or equal to 1.0.
Group B: A mutation that produces a variant wherein the minimum performance indices (PI) relative to a defined parental protein for: (i) protein expression, (ii) CS-28 microswatch activity at pH 8 (25°C) or pHIO (50°C), or activity in Ceralpha assay, or activity in corn flour or corn starch application assays, and (iii) detergent stability or thermostability at pH 5.0 or pH 5.7 is greater than or equal to 0.8, and in addition have a PI for any one of these tests that is greater than or equal to 1.2.
Group C: A mutation that produces a variant wherein the minimum performance indices (PI) relative to a defined parental protein for: (i) protein expression, (ii) CS-28 microswatch activity at pH 8 (25°C) or pHIO (50°C), or activity in Ceralpha assay, or activity in corn flour or corn starch application assays, and (iii) detergent stability or thermostability at pH 5.0 or pH 5.7 is greater than or equal to 0.5, and in addition have a PI for any one of these tests that is greater than or equal to 1.5.
[00329] The properties of combinable mutations are summarized in Table 4.1.
Table 4.1. Properties for each group of combinable mutations
Figure imgf000165_0001
[00330] Preferred combinable mutations are at "productive positions," as described, below. In the case of the present amylases, "activity" refers to a-amylase activity, which can be measured as described, herein.
[00331] Productive positions are amino acid positions that are tolerant to substitution with different amino acid residues, wherein the resulting variants meet a set of performance criteria for combinability, as set forth above. Productive positions can be assigned a Productivity Score as follows: Positions where less than 15% of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "1". Positions where less than 30%, but greater than, or equal to 15% of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "2". Positions where less than 50%, but greater than, or equal to 30% of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "3". Positions where 50% or more of the substitutions at a given position fall within groups A, B, or C are given a Productivity Score of "4".
[00332] Suitability score refers to the ability of one or more combinable mutations to be used to make combinatorial variants, based on the performance criteria for combinability, (i.e., A, B, and C, as set forth, above) in which each of the mutations fall. A higher suitability score indicates a mutation or mutations that are more suitable for use in making combinatorial variants. Suitability scores are described in Table 4.2. Table 4.2. Definitions of suitability scores
Figure imgf000166_0001
[00333] Suitability scores of individual substitutions in CspAmy2-vl are shown in Table 4.3. For each CspAmy2-vl protein position, variants are listed according to the suitability score they received (+, ++, +++, ++++, or +++++). Position numbering is based on the mature CspAmy2 polypeptide (SEQ ID NO: 1).
Figure imgf000166_0002
Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++)
AA 1ST
DF NSWY AEHKMQTV
RK
TDEFGHIKL MNQSWY R
DAEN
PHT ACFLRWY DEGKNS
M YEKR FHW
SDEGHNQR K
VHIMN
TS DN
AS
VI
TACILMV
APS
YFMT
A G
M CGHY TS ADEFIKLNV
SEK D
QS
AFGHIKNQS TW
RS G VLQ C D IN AET
K G
P C
NACEFMSY
NW R K
GAN
H TGS
VT Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
75 C T
81 GIPTV ADFHKLMNSY EQRW
82 EQ
83 LF
84 KIQV
SACDEHKM
85 NQR L
87 I V
88 NADEQRT H
TCDEHMNQ
89 RSV
92 L SAMRV
93 DT NM
94 GN
96 I Q
97 VI
98 W YF
101 VI
103 MV I
104 D N
106 A IV K
107 G A
108 KR GAS
109 AP
ACDGHKLNQRST
111 M YW V F
112 TFGIVW ACDELMPQRY
113 Y ED Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
114 NG
115 A V IM
ACDEGHIKLMNS
116 T VW
117 C AS
118 Q LM VACFIKNS R
119 s E
120 V C
121 S NKR
122 T P AKQR
123 S ACEGHKNQTY R
124 ND
126 Y N
127 CY QAM HIKRTV E
128 ES GKVY I
129 AFG TQY HIKLRSV
130 AIRV ST GH
131 FM GT AHIKNW PQ
132 ENS ACGHILMRTVY PQ
133 FN YE ADHLTV K
134 NCFY DGHMPQST
135 HR M IV
136 W QY AFGHIK NT
137 V A
138 PR GV W AFKLMQSTY DH
GCEFHILTV
140 M D Y S KN
141 H F W Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
142 CV NEY FGHIKLQRW ADMST
144 DQ F PCHM AGKLNRY IT
145 LWY IMV GEQT AHKNRS
147 GCLV EHKNQR I
TAGHIKLSW
148 Y
TACDEHIKM
149 NRSWY L
150 DPQ GM Y FHW I
151 SD
152 F NW ACEGHLMRSTV DQ
153 F H WY
154 KAEHNRST F
156 FGILMV QDSTY H K
157 N W
158 P FADEIRY LNSV CGHTW
160 C F
CMNQ
163 F V T DLS
164 F DN
165 P H WF
166 ACGKM D
167 Q ACDGHKNRSTVY
168 C SRW DEGIKMNTV L
169 EQW RDMT CHKLY A
170 S CGHNRT
171 L FGIMRVWY HKNQS Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
SACDEHKNR
172 T
173 RK W
174 L I
175 AD S FLMV HWY
176 L K
177 G FH
182 H K
183 AE K R
187 E V P
189 A SC D
190 S P
191 EACLMNT I
192 S M NR FHY
193 GACFIKST HRV
195 D Y
198 CG L A
200 EL Y
201 L A
203 HNQ A I CV FLMY
206 I CY DM AQ
207 AKR HF DEMSY N
PAEHKLNQR
208 ST D
209 CIK D G
210 S V
211 FS V CEIMNT DLQ
212 NY ACDEHILMV GQRST
215 LY KRT EFMNQ Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
216 KR
219 VEL I
222 T A
225 VL
226 C GKQ E
227 LY
232 L R V
235 LT VA C
238 M I LQR P
239 M Q K C
240 D F
ACDEGHIKL
241 T SFR P NQVWY
242 E Y FV I
243 LAST IM
244 Y KT ACHMNQRS
245 DE
246 WF
248 A DQ N
249 NKR ACDEFGMST QW
250 AS
ADKLMN
251 QST R
252 ACDFHMR
ACDELMNQ
253 ST RV
254 F TILM
256 KR
257 ACGRVY FHK E LQS Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
258 MCI FLY
259 P F
260 Y T S AL
262 G A
266 EK HLN Q CFGMRW ADIST
267 ND
269 A V LI
270 CIQV G ADFHKPRSWY
271 ACS
273 NDEILMQS HK
275 YF
276 LM
277 D ACNW FHILMQTY EK
280 NCY ADGHKLQT E
281 G YA D
283 QT HV
284 EF SHY KMRW
285 LA
286 L F M
288 A V
295 YLQ H
FIMQS
296 T ADHKR E
299 TEI R
300 Q GAKL R
301 GT AFHKMQRSY
302 s G
303 F Y IW ARTV
307 RQS Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
308 NV ADGLQTY CEFHMRS
310 LDET
311 E NDHKQSV
312 NDG
313 AS T
316 AKQS
317 W A SDGLT CEMQY HK
318 NFILVW ACDEKMQRSY H
320 PV M TCGKY AHNQRW DE
321 KHR
325 LFIMV
327 ED
335 G Q
336 SAD
339 Q S
342 QEL
343 AMW P
348 LCGS Q
349 W AS G
SACDELMN
357 Y V Q
358 GDEQS
360 CEHV YI F L
362 EQT S AC IV
363 VL I
368 MLWY
372 KADHMNR
374 TAKNPQS
375 TS Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
376 H TAGNQSY K
377 ILMV C R H ADGKSTY
378 E Q
384 D SEGN HP
385 KAE
388 L PCDKRS I
390 LC I
391 KFTVY EL
392 AG
394 E KHM
395 IKS DC EFMQRWY
396 YCFK
397 AS
400 T ACDEMNQRSWY HKLV
401 QM
402 RFKLSTVWY Q
403 DS
404 YW
405 IL
NACDEGHQ
407 S
408 S Y PEHMQR KVW
409 N D
410 E VIKLMRSY
414 TAS
416 MT E CFHKLNRSV DGQ
DACEFGHIK LMNQRSTW
418 Y Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
SAEGKPQRT
419 VY
ACDEGHPQRSVW
420 TFI Y L
KACFGHILR
421 SWY N
EIKLMNPQRSTV
422 A WY CD
423 P KV ACEFGMNQWY DS
424 SA
426 LC
427 A C GS
429 VC LM
430 C IL EM
431 D TA
433 HS A GN
434 M PNR DQS
435 I GACEQRSTY LNV
SADEFHKLQ
437 Y
YCKLNQRS
441 W
442 L VAIT
TAEFHIKLM
444 NPQVY
SACDHMRT
445 VW
447 AGKQRSTV
448 GEL AFHKNQTY DW Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++) OS AA 1ST
449 EQ
450 IDLP ACFHKQRTV N
452 YAILMSVW
454 LAEFHKS CIMQTVY
455 TIV ACLMS
ACDEFHKLMNRS
456 G TWY
458 RDEFSW ACIN MY
TACDFGLSV
459 W
460 DEHN
KADGILMNP
461 SY
462 IV
TCEFIKLMN
463 VY
464 IV
465 GAMNPQ
466 SCFN ADEHILMRVWY KT
467 DN
469 YCFISV L
470 AG
TADEFGHIN
471 K PQW
474 VC
475 NFIP ADGHKLMSTV
ACHKNPQRS
476 DE G TVY Table 4.3: Suitability scores of individual substitutions in CspAmy2-vl
VARIANTS SUITABILITY SCORE
(+++) WT
(+) (++) (++++) (+++++)
POS AA 1ST
ADEHIKQRST
477 P G VY
479 VCHW
480 SG
481 VACIL
482 WY
483 VI
484 AHK Q
ADEHIKLMNPTV
485 QFR Y
[00334] The productive positions in CspAmy2-vl that fall within the previously described Productivity Scores of "1," "2," "3," and "4," and the substitutions within those positions that are combinable, are listed below. Each position identified in the list, and each substitution identified in parenthesis following the numerical position identifier, represents a mutation that has been determined, based on experimental data, to contribute to the performance of an amylase variant, particularly a variant comprising more than one of the described mutations. The position numbering is based on mature CspAmy2 polypeptide ( SEQ ID NO: 1).
[00335] The productive positions in CspAmy2-vl that fall within the previously described Productivity Scores of "1," "2," "3," and "4," and the substitutions within those positions that are combinable, are listed below. The position numbering is based on mature CspAmy2 polypeptide (SEQ ID NO: 1).
LIST A:
1(A,E,G,I,K,N,Q,R,T,V,Y); 2(A,E,G,H,K,N,P,Q,R,S,Y); 3(T,A,D,F,G,M,P,Q,R,S); 4(N,Q,T); 5(G,A,C,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,Y); 7(M,I); 8(M,F); 11(F,Y); 15(V,C,I,L,N,S,T); 20(Q,E); 21(Q,L,T,W); 23(N,A,D,E,F,H,K,M,Q,S,T,V,W,Y); 26(R,K);
27(T,D,E,F,G,H,I,K,L,M,N,Q,R,S,W,Y); 28(D,A,E,N);
30(P,A,C,D,E,F,G,H,K,L,N,R,S,T,W,Y); 31(Y,E,F,H,K,M,R,W); 33(S,D,E,G,H,K,N,Q,R); 35(V,H,I,M,N); 38(T,D,N,S); 39(A,S); 40(V,I); 42(T,A,C,I,L,M,V); 45(A,P,S); 46(Y,F,M,T); 48(G,A); 49(T,A,C,D,E,F,G,H,I,K,L,M,N,S,V,Y); 50(S,D,E,K); 51(Q,S); 52(A,F,G,H,I,K,N,Q,S,T,W); 54(V,A,C,D,E,G,I,L,N,Q,R,S,T); 57(G,K); 58(P,C); 68(N,A,C,E,F,M,S,Y); 70(K,N,R,W); 71(G,A,N); 72(T,G,H,S); 73(V,T); 75(T,C);
81(G,A,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 82(E,Q); 83(L,F); 84(K,I,Q,V);
85(S,A,C,D,E,H,K,L,M,N,Q,R); 87(V,I); 88(N,A,D,E,H,Q,R,T); 89(T,C,D,E,H,M,N,Q,R,S,V); 92(S,A,L,M,R,V); 93(N,D,M,T); 94(G,N); 96(Q,I); 97(V,I); 98(Y,F,W); 101(V,I); 103(M,I,V); 104(N,D); 106(K,A,I,V); 107(A,G); 108(G,A,K,R,S); 109(A,P);
111(Y,A,C,D,F,G,H,K,L,M,N,Q,R,S,T,V,W); 112(T,A,C,D,E,F,G,I,L,M,P,Q,R,V,W,Y);
113(E,D,Y); 114(N,G); 115(V,A,I,M); 116(T,A,C,D,E,G,H,I,K,L,M,N,S,V,W); 117(A,C,S);
118(V,A,C,F,I,K,L,M,N,Q,R,S); 119(E,S); 120(V,C); 121(N,K,R,S); 122(P,A,K,Q,R,T);
123(S,A,C,E,G,H,K,N,Q,R,T,Y); 124(N,D); 126(N,Y); 127(Q,A,C,E,H,I,K,M,R,T,V,Y);
128(E,G,I,K,S,V,Y); 129(T,A,F,G,H,I,K,L,Q,R,S,V,Y); 130(S,A,G,H,I,R,T,V);
131(G,A,F,H,I,K,M,N,P,Q,T,W); 132(E,A,C,G,H,I,L,M,N,P,Q,R,S,T,V,Y);
133(Y,A,D,E,F,H,K,L,N,T,V); 134(N,C,D,F,G,H,M,P,Q,S,T,Y); 135(I,H,M,R,V);
136(Q,A,F,G,H,I,K,N,T,W,Y); 137(A,V); 138(W,A,D,F,G,H,K,L,M,P,Q,R,S,T,V,Y);
140(G,C,D,E,F,H,I,K,L,M,N,S,T,V,Y); 141(F,H,W);
142(N,A,C,D,E,F,G,H,I,K,L,M,Q,R,S,T,V,W,Y); 144(P,A,C,D,F,G,H,I,K,L,M,N,Q,R,T,Y);
145(G,A,E,H,I,K,L,M,N,Q,R,S,T,V,W,Y); 147(G,C,E,H,I,K,L,N,Q,R,V);
148(T,A,G,H,I,K,L,S,W,Y); 149(T,A,C,D,E,H,I,K,L,M,N,R,S,W,Y);
150(Y,D,F,G,H,I,M,P,Q,W); 151(S,D); 152(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,W);
153(F,H,W,Y); 154(K,A,E,F,H,N,R,S,T); 156(Q,D,F,G,H,I,K,L,M,S,T,V,Y); 157(W,N);
158(F,A,C,D,E,G,H,I,L,N,P,R,S,T,V,W,Y); 160(F,C); 163(T,C,D,F,L,M,N,Q,S,V); 164(D,F,N);
165(W,F,H,P); 166(D,A,C,G,K,M); 167(Q,A,C,D,G,H,K,N,R,S,T,V,Y);
168(S,C,D,E,G,I,K,L,M,N,R,T,V,W); 169(R,A,C,D,E,H,K,L,M,Q,T,W,Y);
170(S,C,G,H,N,R,T); 171(L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T);
173(R,K,W); 174(I,L); 175(F,A,D,H,L,M,S,V,W,Y); 176(K,L); 177(F,G,H); 182(K,H);
183(A,E,K,R); 187(E,P,V); 189(S,A,C,D); 190(S,P); 191(E,A,C,I,L,M,N,T);
192(N,F,H,M,R,S,Y); 193(G,A,C,F,H,I,K,R,S,T,V); 195(Y,D); 198(L,A,C,G); 200(Y,E,L);
201(A,L); 203(I,A,C,F,H,L,M,N,Q,V,Y); 206(D,A,C,I,M,Q,Y); 207(H,A,D,E,F,K,M,N,R,S,Y);
208(P,A,D,E,H,K,L,N,Q,R,S,T); 209(D,C,G,I,K); 210(V,S); 211(V,C,D,E,F,I,L,M,N,Q,S,T); 212(N,A,C,D,E,G,H,I,L,M,Q,R,ST,V,Y); 215(K,E,F,L,M,N,Q,R,T,Y); 216(K,R); 219(V,E,I,L);
222(A,T); 225(V,L); 226(G,C,E,K,Q); 227(L,Y); 232(L,R,V); 235(V,A,C,L,T);
238(I,L,M,P,Q,R); 239(K,C,M,Q); 240(F,D); 241(S,A,C,D,E,F,G,H,I,K,L,N,P,Q,R,T,V,W,Y);
242(F,E,I,V,Y); 243(L,A,I,M,S,T); 244(K,A,C,H,M,N,Q,R,S,T,Y); 245(D,E); 246(W,F);
248(D,A,N,Q); 249(N,A,C,D,E,F,G,K,M,Q,R,S,T,W); 250(A,S); 251(R,A,D,K,L,M,N,Q,S,T); 252(A,C,D,F,H,M,R); 253(A,C,D,E,L,M,N,Q,R,S,T,V); 254(T,F,I,L,M); 256(K,R);
257(E,A,C,F,G,H,K,L,Q,R,S,V,Y); 258(M,C,F,I,L,Y); 259(F,P); 260(T,A,L,S,Y); 262(G,A);
266(Q,A,C,D,E,F,G,H,I,K,L,M,N,R,S,T,W); 267(N,D); 269(L,AJ,V);
270(G,A,C,D,F,H,I,K,P,Q,R,S,V,W,Y); 271(A,C,S); 273(N,D,E,H,I,K,L,M,Q,S); 275(Y,F); 276(L,M); 277(A,C,D,E,F,H,I,K,L,M,N,Q,T,W,Y); 280(N,A,C,D,E,G,H,K,L,Q,T,Y);
281(Y,A,D,G); 283(Q,H,T,V); 284(S,E,F,H,K,M,R,W,Y); 285(L,A); 286(F,L,M); 288(A,V);
295(Y,H,L,Q); 296(A,D,E,F,H,I,K,M,Q,R,S,T); 299(T,E,I,R); 300(G,A,K,L,Q,R);
301(G,A,F,H,K,M,Q,R,S,T,Y); 302(G,S); 303(Y,A,F,I,R,T,V,W); 307(R,Q,S);
308(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,Y); 310(L,D,E,T); 311(N,D,E,H,K,Q,S,V); 312(N,D,G); 313(T,A,S); 316(A,K,Q,S); 317(S,A,C,D,E,G,H,K,L,M,Q,T,W,Y);
318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y); 320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y);
321(K,H,R); 325(L,F,I,M,V); 327(E,D); 335(Q,G); 336(S,A,D); 339(S,Q); 342(Q,E,L);
343(P,A,M,W); 348(L,C,G,Q,S); 349(A,G,S,W); 357(S,A,C,D,E,L,M,N,Q,V,Y);
358(G,D,E,Q,S); 360(Y,C,E,F,H,I,L,V); 362(S,A,C,E,I,Q,T,V); 363(V,I,L); 368(M,L,W,Y); 372(K,A,D,H,M,N,R); 374(T,A,K,N,P,Q,S); 375(T,S); 376(T,A,G,H,K,N,Q,S,Y);
377(R,A,C,D,G,H,I,K,L,M,S,T,V,Y); 378(E,Q); 384(S,D,E,G,H,N,P); 385(K,A,E);
388(P,C,D,I,K,L,R,S); 390(L,C,I); 391(K,E,F,L,T,V,Y); 392(A,G); 394(K,E,H,M);
395(D,C,E,F,I,K,M,Q,R,S,W,Y); 396(Y,C,F,K); 397(A,S);
400(T,A,C,D,E,H,K,L,M,N,Q,R,S,V,W,Y); 401(Q,M); 402(R,F,K,L,Q,S,T,V,W,Y); 403(D,S); 404(Y,W); 405(I,L); 407(N,A,C,D,E,G,H,Q,S); 408(P,E,H,K,M,Q,R,S,V,W,Y); 409(D,N);
410(V,E,I,K,L,M,R,S,Y); 414(T,A,S); 416(E,C,D,F,G,H,K,L,M,N,Q,R,S,T,V);
418(D,A,C,E,F,G,H,I,K,L,M,N,Q,R,S,T,W,Y); 419(S,A,E,G,K,P,Q,R,T,V,Y);
420(T,A,C,D,E,F,G,H,I,L,P,Q,R,S,V,W,Y); 421(K,A,C,F,G,H,I,L,N,R,S,W,Y);
422(A,C,D,E,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 423(K,A,C,D,E,F,G,M,N,P,Q,S,V,W,Y);
424(S,A); 426(L,C); 427(A,C,G,S); 429(V,C,L,M); 430(I,C,E,L,M); 431(T,A,D);
433(G,A,H,N,S); 434(P,D,M,N,Q,R,S); 435(G,A,C,E,I,L,N,Q,R,S,T,V,Y);
437(S,A,D,E,F,H,K,L,Q,Y); 441(Y,C,K,L,N,Q,R,S,W); 442(V,A,I,L,T);
444(T,A,E,F,H,I,K,L,M,N,P,Q,V,Y); 445(S,A,C,D,H,M,R,T,V,W); 447(A,G,K,Q,R,S,T,V);
448(G,A,D,E,F,H,K,L,N,Q,T,W,Y); 449(E,Q); 450(I,A,C,D,F,H,K,L,N,P,Q,R,T,V);
452(Y,A,I,L,M,S,V,W); 454(L,A,C,E,F,H,I,K,M,Q,S,T,V,Y); 455(T,A,C,I,L,M,S,V);
456(G,A,C,D,E,F,H,K,L,M,N,R,S,T,W,Y); 458(R,A,C,D,E,F,I,M,N,S,W,Y);
459(T,A,C,D,F,G,L,S,V,W); 460(DE,H,N); 461(K,A,D,G,I,L,M,N,P,S,Y); 462(1, V);
463(T,C,E,F,I,K,L,M,N,V,Y); 464(I,V); 465(G,A,M,N,P,Q);
466(S,A,C,D,E,F,H,I,K,L,M,N,R,T,V,W,Y); 467(D,N); 469(Y,C,F,I,L,S,V); 470(A,G); 471(T,A,D,E,F,G,H,I,K,N,P,Q,W); 474(V,C); 475(N,A,D,F,G,H,I,K,L,M,P,S,T,V);
476(G,A,C,D,E,H,K,N,P,Q,R,S,T,V,Y); 477(G,A,D,E,H,I,K,P,Q,R,S,T,V,Y); 479(V,C,H,W); 480(S,G); 481(VA,C,I,L); 482(W,Y); 483(V,I); 484(Q,A,H,K); and
485(Q,A,D,E,F,H,I,K,L,M,N,P,R,T,V,Y)
[00336] The productive positions in CspAmy2-vl that fall within the previously described Productivity Scores of "2," "3," and "4," and the substitutions within those positions that are combinable, are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1.
LIST B:
1(A,E,G,I,K,N,Q,R,T,V,Y); 2(A,E,G,H,K,N,P,Q,R,S,Y); 3(T,A,D,F,G,M,P,Q,R,S);
5(G,A,C,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,Y); 15(V,C,I,L,N,S,T); 21(Q,L,T,W);
23(N,A,D,E,F,H,K,M,Q,S,T,V,W,Y); 27(T,D,E,F,G,H,I,K,L,M,N,Q,R,S,W,Y); 28(D,A,E,N);
30(P,A,C,D,E,F,G,H,K,L,N,R,S,T,W,Y); 31(Y,E,F,H,K,M,R,W); 33(S,D,E,G,H,K,N,Q,R);
35(V,H,I,M,N); 38(T,D,N,S); 42(T,A,C,I,L,M,V); 46(Y,F,M,T);
49(T,A,C,D,E,F,G,H,I,K,L,M,N,S,V,Y); 50(S,D,E,K); 52(A,F,G,H,I,K,N,Q,S,T,W);
54(V,A,C,D,E,G,I,L,N,Q,R,S,T); 68(N,A,C,E,F,M,S,Y); 70(K,N,R,W); 72(T,G,H,S);
81(G,A,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 84(K,I,Q,V); 85(S,A,C,D,E,H,K,L,M,N,Q,R);
88(N,A,D,E,H,Q,R,T); 89(T,C,D,E,H,M,N,Q,R,S,V); 92(S,A,L,M,R,V); 93(N,D,M,T);
106(K,A,I,V); 108(G,A,K,R,S); 111(Y,A,C,D,F,G,H,K,L,M,N,Q,R,S,T,V,W);
112(T,A,C,D,E,F,G,I,L,M,P,Q,R,V,W,Y); 115(V,A,I,M);
116(T,A,C,D,E,G,H,I,K,L,M,N,S,V,W); 118(V,A,C,F,I,K,L,M,N,Q,R,S); 121(N,K,R,S);
122(P,A,K,Q,R,T); 123(S,A,C,E,G,H,K,N,Q,R,T,Y); 127(Q,A,C,E,H,I,K,M,R,T,V,Y);
128(E,G,I,K,S,V,Y); 129(T,A,F,G,H,I,K,L,Q,R,S,V,Y); 130(S,A,G,H,I,R,T,V);
131(G,A,F,H,I,K,M,N,P,Q,T,W); 132(E,A,C,G,H,I,L,M,N,P,Q,R,S,T,V,Y);
133(Y,A,D,E,F,H,K,L,N,T,V); 134(N,C,D,F,G,H,M,P,Q,S,T,Y); 135(I,H,M,R,V);
136(Q,A,F,G,H,I,K,N,T,W,Y); 138(W,A,D,F,G,H,K,L,M,P,Q,R,S,T,V,Y);
140(G,C,D,E,F,H,I,K,L,M,N,S,T,V,Y); 142(N,A,C,D,E,F,G,H,I,K,L,M,Q,R,S,T,V,W,Y);
144(P,A,C,D,F,G,H,I,K,L,M,N,Q,R,T,Y); 145(G,A,E,H,I,K,L,M,N,Q,R,S,T,V,W,Y);
147(G,C,E,H,I,K,L,N,Q,R,V); 148(T,A,G,H,I,K,L,S,W,Y);
149(T,A,C,D,E,H,I,K,L,M,N,R,S,W,Y); 150(Y,D,F,G,H,I,M,P,Q,W);
152(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,W); 153(F,H,W,Y); 154(K,A,E,F,H,N,R,S,T);
156(Q,D,F,G,H,I,K,L,M,S,T,V,Y); 158(F,A,C,D,E,G,H,I,L,N,P,R,S,T,V,W,Y);
163(T,C,D,F,L,M,N,Q,S,V); 165(W,F,H,P); 166(D,A,C,G,K,M);
167(Q,A,C,D,G,H,K,N,R,S,T,V,Y); 168(S,C,D,E,G,I,K,L,M,N,R,T,V,W); 169(R,A,C,D,E,H,K,L,M,Q,T,W,Y); 170(S,C,G,H,N,R,T);
171(L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T);
175(F,A,D,H,L,M,S,V,W,Y); 183(A,E,K,R); 189(S,A,C,D); 191(E,A,C,I,L,M,N,T);
192(N,F,H,M,R,S,Y); 193(G,A,C,F,H,I,K,R,S,T,V); 198(L,A,C,G);
203(I,A,C,F,H,L,M,N,Q,V,Y); 206(D,A,C,I,M,Q,Y); 207(H,A,D,E,F,K,M,N,R,S,Y);
208(P,A,D,E,H,K,L,N,Q,R,S,T); 209(D,C,G,I,K); 211(V,C,D,E,F,I,L,M,N,Q,S,T);
212(N,A,C,D,E,G,H,I,L,M,Q,R,ST,V,Y); 215(K,E,F,L,M,N,Q,R,T,Y); 219(V,E,I,L);
226(G,C,E,K,Q); 235(V,A,C,L,T); 238(I,L,M,P,Q,R); 239(K,C,M,Q);
241(S,A,C,D,E,F,G,H,I,K,L,N,P,Q,R,T,V,W,Y); 242(F,E,I,V,Y); 243(L,A,I,M,S,T);
244(K,A,C,H,M,N,Q,R,S,T,Y); 248(D,A,N,Q); 249(N,A,C,D,E,F,G,K,M,Q,R,S,T,W);
251(R,A,D,K,L,M,N,Q,S,T); 252(A,C,D,F,H,M,R); 253(A,C,D,E,L,M,N,Q,R,S,T,V);
254(T,F,I,L,M); 257(E,A,C,F,G,H,K,L,Q,R,S,V,Y); 258(M,C,F,I,L,Y); 260(T,A,L,S,Y);
266(Q,A,C,D,E,F,G,H,I,K,L,M,N,R,S,T,W); 269(L,A,I,V);
270(G,A,C,D,F,H,I,K,P,Q,R,S,V,W,Y); 273(N,D,E,H,I,K,L,M,Q,S);
277(A,C,D,E,F,H,I,K,L,M,N,Q,T,W,Y); 280(N,A,C,D,E,G,H,K,L,Q,T,Y); 281(Y,A,D,G);
283(Q,H,T,V); 284(S,E,F,H,K,M,R,W,Y); 295(Y,H,L,Q); 296(A,D,E,F,H,I,K,M,Q,R,S,T);
299(T,E,I,R); 300(G,A,K,L,Q,R); 301(G,A,F,H,K,M,Q,R,S,T,Y); 303(Y,A,F,I,R,T,V,W);
308(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,Y); 310(L,D,E,T); 311(N,D,E,H,K,Q,S,V);
316(A,K,Q,S); 317(S,A,C,D,E,G,H,K,L,M,Q,T,W,Y);
318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y); 320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y);
321(K,H,R); 325(L,F,I,M,V); 343(P,A,M,W); 348(L,C,G,Q,S); 349(A,G,S,W);
357(S,A,C,D,E,L,M,N,Q,V,Y); 358(G,D,E,Q,S); 360(Y,C,E,F,H,I,L,V); 362(S,A,C,E,I,Q,T,V);
368(M,L,W,Y); 372(K,A,D,H,M,N,R); 374(T,A,K,N,P,Q,S); 376(T,A,G,H,K,N,Q,S,Y);
377(R,A,C,D,G,H,I,K,L,M,S,T,V,Y); 384(S,D,E,G,H,N,P); 385(K,A,E); 388(P,C,D,I,K,L,R,S); 391(K,E,F,L,T,V,Y); 394(K,E,H,M); 395(D,C,E,F,I,K,M,Q,R,S,W,Y); 396(Y,C,F,K);
400(T,A,C,D,E,H,K,L,M,N,Q,R,S,V,W,Y); 402(R,F,K,L,Q,S,T,V,W,Y);
407(N,A,C,D,E,G,H,Q,S); 408(P,E,H,K,M,Q,R,S,V,W,Y); 410(V,E,I,K,L,M,R,S,Y);
416(E,C,D,F,G,H,K,L,M,N,Q,R,S,T,V); 418(D,A,C,E,F,G,H,I,K,L,M,N,Q,R,S,T,W,Y);
419(S,A,E,G,K,P,Q,R,T,V,Y); 420(T,A,C,D,E,F,G,H,I,L,P,Q,R,S,V,W,Y);
421(K,A,C,F,G,H,I,L,N,R,S,W,Y); 422(A,C,D,E,I,K,L,M,N,P,Q,R,S,T,V,W,Y);
423(K,A,C,D,E,F,G,M,N,P,Q,S,V,W,Y); 427(A,C,G,S); 429(V,C,L,M); 430(I,C,E,L,M);
433(G,A,H,N,S); 434(P,D,M,N,Q,R,S); 435(G,A,C,E,I,L,N,Q,R,S,T,V,Y);
437(S,A,D,E,F,H,K,L,Q,Y); 441(Y,C,K,L,N,Q,R,S,W); 442(V,A,I,L,T);
444(T,A,E,F,H,I,K,L,M,N,P,Q,V,Y); 445(S,A,C,D,H,M,R,T,V,W); 447(A,G,K,Q,R,S,T,V); 448(G,A,D,E,F,H,K,L,N,Q,T,W,Y); 450(I,A,C,D,F,H,K,L,N,P,Q,R,T,V);
452(Y,A,I,L,M,S,V,W); 454(L,A,C,E,F,H,I,K,M,Q,S,T,V,Y); 455(T,A,C,I,L,M,S,V);
456(G,A,C,D,E,F,H,K,L,M,N,R,S,T,W,Y); 458(R,A,C,D,E,F,I,M,N,S,W,Y);
459(T,A,C,D,F,G,L,S,V,W); 460(DE,H,N); 461 (K,A,D,G,I,L,M,N,P,S,Y);
463(T,C,E,F,I,K,L,M,N,V,Y); 465(G,A,M,N,P,Q); 466(S,A,C,D,E,F,H,I,K,L,M,N,R,T,V,W,Y); 469(Y,C,F,I,L,S,V); 471(T,A,D,E,F,G,H,I,K,N,P,Q,W); 475(N,A,D,F,G,H,I,K,L,M,P,S,T,V); 476(G,A,C,D,E,H,K,N,P,Q,R,S,T,V,Y); 477(G,A,D,E,H,I,K,P,Q,R,S,T,V,Y); 479(V,C,H,W); 481(VA,C,I,L); 484(Q,A,H,K); and 485(Q,A,D,E,F,H,I,K,L,M,N,P,R,T,V,Y)
[00337] The productive positions in CspAmy2-vl that fall within the previously described Productivity Scores of "3" and "4," and the substitutions within those positions that are combinable, are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1.
LIST C:
1(A,E,G,I,K,N,Q,R,T,V,Y); 2(A,E,G,H,K,N,P,Q,R,S,Y); 3(T,A,D,F,G,M,P,Q,R,S);
5(G,A,C,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,Y); 15(V,C,I,L,N,S,T);
23(N,A,D,E,F,H,K,M,Q,S,T,V,W,Y); 27(T,D,E,F,G,H,I,K,L,M,N,Q,R,S,W,Y);
30(P,A,C,D,E,F,G,H,K,L,N,R,S,T,W,Y); 31(Y,E,F,H,K,M,R,W); 33(S,D,E,G,H,K,N,Q,R);
42(T,A,C,I,L,M,V); 49(T,A,C,D,E,F,G,H,I,K,L,M,N,S,V,Y); 52(A,F,G,H,I,K,N,Q,S,T,W);
54(V,A,C,D,E,G,I,L,N,Q,R,S,T); 68(N,A,C,E,F,M,S,Y);
81(G,A,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 85(S,A,C,D,E,H,K,L,M,N,Q,R);
88(N,A,D,E,H,Q,R,T); 89(T,C,D,E,H,M,N,Q,R,S,V); 92(S,A,L,M,R,V);
111(Y,A,C,D,F,G,H,K,L,M,N,Q,R,S,T,V,W); 112(T,A,C,D,E,F,G,I,L,M,P,Q,R,V,W,Y);
116(T,A,C,D,E,G,H,I,K,L,M,N,S,V,W); 118(V,A,C,F,I,K,L,M,N,Q,R,S); 122(P,A,K,Q,R,T);
123(S,A,C,E,G,H,K,N,Q,R,T,Y); 127(Q,A,C,E,H,I,K,M,R,T,V,Y); 128(E,G,I,K,S,V,Y);
129(T,A,F,G,H,I,K,L,Q,R,S,V,Y); 130(S,A,G,H,I,R,T,V); 131(G,A,F,H,I,K,M,N,P,Q,T,W);
132(E,A,C,G,H,I,L,M,N,P,Q,R,S,T,V,Y); 133(Y,A,D,E,F,H,K,L,N,T,V);
134(N,C,D,F,G,H,M,P,Q,S,T,Y); 136(Q,A,F,G,H,I,K,N,T,W,Y);
138(W,A,D,F,G,H,K,L,M,P,Q,R,S,T,V,Y); 140(G,C,D,E,F,H,I,K,L,M,N,S,T,V,Y);
142(N,A,C,D,E,F,G,H,I,K,L,M,Q,R,S,T,V,W,Y); 144(P,A,C,D,F,G,H,I,K,L,M,N,Q,R,T,Y); 145(G,A,E,H,I,K,L,M,N,Q,R,S,T,V,W,Y); 147(G,C,E,H,I,K,L,N,Q,R,V);
148(T,A,G,H,I,K,L,S,W,Y); 149(T,A,C,D,E,H,I,K,L,M,N,R,S,W,Y);
150(Y,D,F,G,H,I,M,P,Q,W); 152(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,W);
154(K,A,E,F,H,N,R,S,T); 156(Q,D,F,G,H,I,K,L,M,S,T,V,Y);
158(F,A,C,D,E,G,H,I,L,N,P,R,S,T,V,W,Y); 163(T,C,D,F,L,M,N,Q,S,V); 166(D,A,C,G,K,M); 167(Q,A,C,D,G,H,K,N,R,S,T,V,Y); 168(S,C,D,E,G,I,K,L,M,N,R,T,V,W);
169(R,A,C,D,E,H,K,L,M,Q,T,W,Y); 170(S,C,G,H,N,R,T);
171(L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T);
175(F,A,D,H,L,M,S,V,W,Y); 191(E,A,C,I,L,M,N,T); 192(N,F,H,M,R,S,Y);
193(G,A,C,F,H,I,K,R,S,T,V); 203(I,A,C,F,H,L,M,N,Q,V,Y); 206(D,A,C,I,M,Q,Y);
207(H,A,D,E,F,K,M,N,R,S,Y); 208(P,A,D,E,H,K,L,N,Q,R,S,T); 209(D,C,G,I,K);
211(V,C,D,E,F,I,L,M,N,Q,S,T); 212(N,A,C,D,E,G,H,I,L,M,Q,R,ST,V,Y);
215(K,E,F,L,M,N,Q,R,T,Y); 241(S,A,C,D,E,F,G,H,I,K,L,N,P,Q,R,T,V,W,Y);
244(K,A,C,H,M,N,Q,R,S,T,Y); 249(N,A,C,D,E,F,G,K,M,Q,R,S,T,W);
251(R,A,D,K,L,M,N,Q,S,T); 252(A,C,D,F,H,M,R); 253(A,C,D,E,L,M,N,Q,R,S,T,V);
257(E,A,C,F,G,H,K,L,Q,R,S,V,Y); 258(M,C,F,I,L,Y);
266(Q,A,C,D,E,F,G,H,I,K,L,M,N,R,S,T,W); 270(G,A,C,D,F,H,I,K,P,Q,R,S,V,W,Y);
273(N,D,E,H,I,K,L,M,Q,S); 277(A,C,D,E,F,H,I,K,L,M,N,Q,T,W,Y);
280(N,A,C,D,E,G,H,K,L,Q,T,Y); 284(S,E,F,H,K,M,R,W,Y); 296(A,D,E,F,H,I,K,M,Q,R,S,T); 301(G,A,F,H,K,M,Q,R,S,T,Y); 303(Y,A,F,I,R,T,V,W);
308(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,Y); 311(N,D,E,H,K,Q,S,V);
317(S,A,C,D,E,G,H,K,L,M,Q,T,W,Y); 318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y);
320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y); 357(S,A,C,D,E,L,M,N,Q,V,Y);
360(Y,C,E,F,H,I,L,V); 362(S,A,C,E,I,Q,T,V); 372(K,A,D,H,M,N,R); 374(T,A,K,N,P,Q,S); 376(T,A,G,H,K,N,Q,S,Y); 377(R,A,C,D,G,H,I,K,L,M,S,T,V,Y); 384(S,D,E,G,H,N,P);
388(P,C,D,I,K,L,R,S); 391(K,E,F,L,T,V,Y); 395(D,C,E,F,I,K,M,Q,R,S,W,Y); 396(Y,C,F,K);
400(T,A,C,D,E,H,K,L,M,N,Q,R,S,V,W,Y); 402(R,F,K,L,Q,S,T,V,W,Y);
407(N,A,C,D,E,G,H,Q,S); 408(P,E,H,K,M,Q,R,S,V,W,Y); 410(V,E,I,K,L,M,R,S,Y);
416(E,C,D,F,G,H,K,L,M,N,Q,R,S,T,V); 418(D,A,C,E,F,G,H,I,K,L,M,N,Q,R,S,T,W,Y);
419(S,A,E,G,K,P,Q,R,T,V,Y); 420(T,A,C,D,E,F,G,H,I,L,P,Q,R,S,V,W,Y);
421(K,A,C,F,G,H,I,L,N,R,S,W,Y); 422(A,C,D,E,I,K,L,M,N,P,Q,R,S,T,V,W,Y);
423(K,A,C,D,E,F,G,M,N,P,Q,S,V,W,Y); 434(P,D,M,N,Q,R,S);
435(G,A,C,E,I,L,N,Q,R,S,T,V,Y); 437(S,A,D,E,F,H,K,L,Q,Y); 441(Y,C,K,L,N,Q,R,S,W); 444(T,A,E,F,H,I,K,L,M,N,P,Q,V,Y); 445(S,A,C,D,H,M,R,T,V,W); 447(A,G,K,Q,R,S,T,V); 448(G,A,D,E,F,H,K,L,N,Q,T,W,Y); 450(I,A,C,D,F,H,K,L,N,P,Q,R,T,V);
452(Y,A,I,L,M,S,V,W); 454(L,A,C,E,F,H,I,K,M,Q,S,T,V,Y); 455(T,A,C,I,L,M,S,V);
456(G,A,C,D,E,F,H,K,L,M,N,R,S,T,W,Y); 458(R,A,C,D,E,F,I,M,N,S,W,Y);
459(T,A,C,D,F,G,L,S,V,W); 461(K,A,D,G,I,L,M,N,P,S,Y); 463(T,C,E,F,I,K,L,M,N,V,Y); 465(G,A,M,N,P,Q); 466(S,A,C,D,E,F,H,I,K,L,M,N,R,T,V,W,Y); 469(Y,C,F,I,L,S,V); 471(T,A,D,E,F,G,H,I,K,N,P,Q,W); 475(N,A,D,F,G,H,I,K,L,M,P,S,T,V);
476(G,A,C,D,E,H,K,N,P,Q,R,S,T,V,Y); 477(G,A,D,E,H,I,K,P,Q,R,S,T,V,Y); and
485(Q,A,D,E,F,H,I,K,L,M,N,P,R,T,V,Y)
[00338] The productive positions in CspAmy2-vl that fall within the previously described Productivity Scores of "4," and the substitutions within those positions that are combinable, are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1.
LIST D:
1(A,E,G,I,K,N,Q,R,T,V,Y); 2(A,E,G,H,K,N,P,Q,R,S,Y); 3(T,A,D,F,G,M,P,Q,R,S);
5(G,A,C,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,Y); 23(N,A,D,E,F,H,K,M,Q,S,T,V,W,Y);
27(T,D,E,F,G,H,I,K,L,M,N,Q,R,S,W,Y); 30(P,A,C,D,E,F,G,H,K,L,N,R,S,T,W,Y);
49(T,A,C,D,E,F,G,H,I,K,L,M,N,S,V,Y); 52(A,F,G,H,I,K,N,Q,S,T,W);
54(V,A,C,D,E,G,I,L,N,Q,R,S,T); 68(N,A,C,E,F,M,S,Y);
81(G,A,D,E,F,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y); 85(S,A,C,D,E,H,K,L,M,N,Q,R);
89(T,C,D,E,H,M,N,Q,R,S,V); 111(Y,A,C,D,F,G,H,K,L,M,N,Q,R,S,T,V,W);
112(T,A,C,D,E,F,G,I,L,M,P,Q,R,V,W,Y); 116(T,A,C,D,E,G,H,I,K,L,M,N,S,V,W);
118(V,A,C,F,I,K,L,M,N,Q,R,S); 123(S,A,C,E,G,H,K,N,Q,R,T,Y);
127(Q,A,C,E,H,I,K,M,R,T,V,Y); 128(E,G,I,K,S,V,Y); 129(T,A,F,G,H,I,K,L,Q,R,S,V,Y);
131(G,A,F,H,I,K,M,N,P,Q,T,W); 132(E,A,C,G,H,I,L,M,N,P,Q,R,S,T,V,Y);
133(Y,A,D,E,F,H,K,L,N,T,V); 134(N,C,D,F,G,H,M,P,Q,S,T,Y); 136(Q,A,F,G,H,I,K,N,T,W,Y);
138(W,A,D,F,G,H,K,L,M,P,Q,R,S,T,V,Y); 140(G,C,D,E,F,H,I,K,L,M,N,S,T,V,Y);
142(N,A,C,D,E,F,G,H,I,K,L,M,Q,R,S,T,V,W,Y); 144(P,A,C,D,F,G,H,I,K,L,M,N,Q,R,T,Y);
145(G,A,E,H,I,K,L,M,N,Q,R,S,T,V,W,Y); 147(G,C,E,H,I,K,L,N,Q,R,V);
148(T,A,G,H,I,K,L,S,W,Y); 149(T,A,C,D,E,H,I,K,L,M,N,R,S,W,Y);
150(Y,D,F,G,H,I,M,P,Q,W); 152(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,W);
156(Q,D,F,G,H,I,K,L,M,S,T,V,Y); 158(F,A,C,D,E,G,H,I,L,N,P,R,S,T,V,W,Y);
163(T,C,D,F,L,M,N,Q,S,V); 167(Q,A,C,D,G,H,K,N,R,S,T,V,Y);
168(S,C,D,E,G,I,K,L,M,N,R,T,V,W); 169(R,A,C,D,E,H,K,L,M,Q,T,W,Y);
171(L,F,G,H,I,K,M,N,Q,R,S,V,W,Y); 172(S,A,C,D,E,H,K,N,R,T);
193(G,A,C,F,H,I,K,R,S,T,V); 203(I,A,C,F,H,L,M,N,Q,V,Y); 207(H,A,D,E,F,K,M,N,R,S,Y);
208(P,A,D,E,H,K,L,N,Q,R,S,T); 211(V,C,D,E,F,I,L,M,N,Q,S,T);
212(N,A,C,D,E,G,H,I,L,M,Q,R,ST,V,Y); 215(K,E,F,L,M,N,Q,R,T,Y);
241(S,A,C,D,E,F,G,H,I,K,L,N,P,Q,R,T,V,W,Y); 244(K,A,C,H,M,N,Q,R,S,T,Y);
249(N,A,C,D,E,F,G,K,M,Q,R,S,T,W); 251(R,A,D,K,L,M,N,Q,S,T); 253(A,C,D,E,L,M,N,Q,R,S,T,V); 257(E,A,C,F,G,H,K,L,Q,R,S,V,Y);
266(Q,A,C,D,E,F,G,H,I,K,L,M,N,R,S,T,W); 270(G,A,C,D,F,H,I,K,P,Q,R,S,V,W,Y);
273(N,D,E,H,I,K,L,M,Q,S); 277(A,C,D,E,F,H,I,K,L,M,N,Q,T,W,Y);
280(N,A,C,D,E,G,H,K,L,Q,T,Y); 284(S,E,F,H,K,M,R,W,Y); 296(A,D,E,F,H,I,K,M,Q,R,S,T); 301(G,A,F,H,K,M,Q,R,S,T,Y); 308(N,A,C,D,E,F,G,H,L,M,Q,R,S,T,V,Y);
317(S,A,C,D,E,G,H,K,L,M,Q,T,W,Y); 318(N,A,C,D,E,F,H,I,K,L,M,Q,R,S,V,W,Y);
320(T,A,C,D,E,G,H,K,M,N,P,Q,R,V,W,Y); 357(S,A,C,D,E,L,M,N,Q,V,Y);
360(Y,C,E,F,H,I,L,V); 377(R,A,C,D,G,H,I,K,L,M,S,T,V,Y); 384(S,D,E,G,H,N,P);
388(P,C,D,I,K,L,R,S); 395(D,C,E,F,I,K,M,Q,R,S,W,Y);
400(T,A,C,D,E,H,K,L,M,N,Q,R,S,V,W,Y); 408(P,E,H,K,M,Q,R,S,V,W,Y);
416(E,C,D,F,G,H,K,L,M,N,Q,R,S,T,V); 418(D,A,C,E,F,G,H,I,K,L,M,N,Q,R,S,T,W,Y);
419(S,A,E,G,K,P,Q,R,T,V,Y); 420(T,A,C,D,E,F,G,H,I,L,P,Q,R,S,V,W,Y);
421(K,A,C,F,G,H,I,L,N,R,S,W,Y); 422(A,C,D,E,I,K,L,M,N,P,Q,R,S,T,V,W,Y);
423(K,A,C,D,E,F,G,M,N,P,Q,S,V,W,Y); 434(P,D,M,N,Q,R,S);
435(G,A,C,E,I,L,N,Q,R,S,T,V,Y); 437(S,A,D,E,F,H,K,L,Q,Y);
444(T,A,E,F,H,I,K,L,M,N,P,Q,V,Y); 445(S,A,C,D,H,M,R,T,V,W);
448(G,A,D,E,F,H,K,L,N,Q,T,W,Y); 450(I,A,C,D,F,H,K,L,N,P,Q,R,T,V);
454(L,A,C,E,F,H,I,K,M,Q,S,T,V,Y); 456(G,A,C,D,E,F,H,K,L,M,N,R,S,T,W,Y);
458(R,A,C,D,E,F,I,M,N,S,W,Y); 459(T,A,C,D,F,G,L,S,V,W); 461(K,A,D,G,I,L,M,N,P,S,Y); 463(T,C,E,F,I,K,L,M,N,V,Y); 466(S,A,C,D,E,F,H,I,K,L,M,N,R,T,V,W,Y);
471(T,A,D,E,F,G,H,I,K,N,P,Q,W); 475(N,A,D,F,G,H,I,K,L,M,P,S,T,V);
476(G,A,C,D,E,H,K,N,P,Q,R,S,T,V,Y); 477(G,A,D,E,H,I,K,P,Q,R,S,T,V,Y); and
485(Q,A,D,E,F,H,I,K,L,M,N,P,R,T,V,Y)
[00339] The productive positions in CspAmy2-vl suitable for charge or hydrophobicity modifications are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1.
LIST E:
1, 5, 15, 23, 30, 31, 49, 68, 111, 112, 116, 123, 127, 128, 129, 131, 132, 134, 140, 142, 144, 147, 150, 152, 153, 168, 170, 171, 183, 187, 192, 203, 207, 209, 211, 212, 232, 241, 243, 244, 253, 266, 277, 280, 300, 301, 308, 320, 357, 362, 377, 388, 400, 402, 408, 416, 420, 423, 448, 450, 454, 455, 456, 458, 466, 475, and 485
[00340] The productive positions and the substitutions within those positions in CspAmy2-vl suitable for charge or hydrophobicity modifications are listed below. The position numbering is based on mature CspAmy2 protein listed in SEQ ID NO: 1 LIST F:
1(A,K,V,Y); 5(G,F,V); 15(V,S); 23(N,K); 30(P,E,K,L,W); 31(Y,F,K,W); 49(T,I); 68(N,Y); 111(Y,D,Q,S,T,W); 112(T,I,W); 116(T,L); 123(S,K); 127(Q,I); 128(E,I,V); 129(T,I);
131(G,H,K); 132(E,G,H,I,M,P,R,T,V,Y); 134(N,D,F,M,Y); 140(G,E,F,H,K); 142(N,D,I,R); 144(P,G,K,L); 147(G,C,E,H,L,R,V); 150(Y,W); 152(N,D,E,L,R); 153(F,H,Y); 168(S,L);
170(S,R); 171(L,H,N,Q,R); 183(A,K); 187(E,P); 192(N,F,Y); 203(I,C); 207(H,E,F); 209(D,G); 211(V,D,E,N,Q); 212(N,D,E); 232(L,R); 241(S,D,E,I,L,W,Y); 243(L,S); 244(K,C); 253(A,R); 266(Q,I,R,W); 277(A,F,L,Y); 280(N,L); 300(G,R); 301(G,H); 308(N,D,E,F,L,R,V,Y);
320(T,E,W); 357(S,E); 362(S,I,V); 377(R,G,H); 388(P,K); 400(T,E,K,L,W,Y); 402(R,F); 408(P,E,R,W); 416(E,C,F,G,H,K,L,N,R,S,V); 420(T,D,E,I,L,R,W);
423(K,E,F,G,M,N,Q,S,V,Y); 448(G,F,H,K,W); 450(I,K,R,T); 454(L,C); 455(T,L,M);
456(G,F,W); 458(R,A,C,D,E,F,I,S); 466(S,I,L); 475(N,D); and 485(Q,E,K,L,Y,Y)

Claims

What is claimed is:
L A variant a-amylase polypeptide derived from a parental a-amylase polypeptide, comprising at least one combinable mutation at a productive amino acid position; wherein:
(i) the combinable mutation is a mutation that improves at least one desirable property of the variant α-amylase compared to the parental a-amylase, while not significantly decreasing either expression, activity, or stability of the variant a-amylase, compared to the parental a- amylase,
(ii) the productive position is an amino acid position that can be substituted with a plurality of different amino acid residues, each of which substitutions result in a variant a- amylase that meets the requirements of (i), and
(iii) the combinable mutation is listed in Lists A, B, C, D, E, or F, or in Table D, which uses SEQ ID NO: 1 for numbering.
2. The variant amylase of claim 1, wherein the combinable mutation produces a variant amylase wherein the minimum performance indices (PI) relative to the parental amylase for (i) protein expression, (ii) activity, and (iii) detergent stability or thermostability are greater than or equal to 0.9, and the PI for any one of (i), (ii), or (iii) that is greater than or equal to 1.0.
3. The variant amylase of claim 1, wherein the combinable mutation produces a variant amylase wherein the minimum performance indices (PI) relative to the parental amylase for (i) protein expression, (ii) activity, and (iii) detergent stability or thermostability are greater than or equal to 0.8, and the PI for any one of (i), (ii), or (iii) that is greater than or equal to 1.2.
4. The variant amylase of claim 1, wherein the combinable mutation produces a variant amylase wherein the minimum performance indices (PI) relative to the parental amylase for (i) protein expression, (ii) activity, and (iii) detergent stability or thermostability are greater than or equal to 0.5, and the PI for any one of (i), (ii), or (iii) that is greater than or equal to 1.5.
5. The variant amylase of any of the preceding claims, wherein the combinable mutation has a sustainability score of +++, ++++, or +++++, referring to Table C.
6. The variant amylase of any of the preceding claims, wherein the combinable mutation has a sustainability score of ++++, or +++++, referring to Table C.
7. The variant amylase of any of the preceding claims, wherein the combinable mutation has a sustainability score of +++++, referring to Table C.
8. The variant amylase of any of the preceding claims, wherein the combinable mutation has a productivity score of 1 or 2, referring to Table B.
9. The variant amylase of any of the preceding claims, having a plurality of combinable mutations.
10. The variant amylase of any of the preceding claims, further comprising a deletion corresponding to a residue selected from the group consisting of Arg-178, Gly-179, Thr-180, and Gly-181, using SEQ ID NO: 1 for numbering.
11. The variant amylase of any of the preceding claims, further comprising deletions corresponding to residues Arg-178 and Gly-179, using SEQ ID NO: 1 for numbering.
12. The variant amylase of any of the preceding claims, wherein the parental a-amylase or the variant a-amylase has at least 60% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
13. The variant amylase of any of the preceding claims, wherein the parental a-amylase or the variant α-amylase has at least 70% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
14. The variant amylase of any of the preceding claims, wherein the parental a-amylase or the variant α-amylase has at least 80% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
15. The variant amylase of any of the preceding claims, wherein the parental a-amylase or the variant α-amylase has at least 90% amino acid sequence identity to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2.
16. A composition comprising the variant amylase of any of claims 1-15.
17. The composition of claim 16, wherein the composition is effective for removing starchy stains from laundry, dishes, or textiles.
18. The composition of claim 16 or 17, further comprising a surfactant.
19. The composition of any of claims 16-18, wherein the composition is a detergent composition.
20. The composition of any of claims 16-19, wherein the composition is a laundry detergent or a laundry detergent additive.
21. The composition of any of claims 16-20, wherein the composition is a manual or automatic dishwashing detergent.
22. The composition of any of claims 16-21, further comprising one or more additional enzymes selected from the group consiting of protease, hemicellulase, cellulase, peroxidase, lipolytic enzyme, metallolipolytic enzyme, xylanase, lipase, phospholipase, esterase, perhydrolase, cutinase, pectinase, pectate lyase, mannanase, keratinase, reductase, oxidase, phenoloxidase, lipoxygenase, ligninase, pullulanase, tannase, pentosanase, malanase, β- glucanase, arabinosidase, hyaluronidase, chondroitinase, laccase, and an amylase other than the amylase of any one of claims 1-15.
23. The composition of claim 16, wherein the composition is for liquifying starch.
24. The composition of claim 16, wherein the composition is for saccharifying a composition comprising starch, for SSF post liquefaction, or for direct SSF without prior liquefaction.
25. The composition of claim 16, wherein the composition is for producing a fermented beverage.
26. The composition of claim 16, wherein the composition is for producing a baked food product.
27. The composition of claim 16, wherein the composition is for textile desizing.
28. A method for removing a starchy stain or soil from a surface, comprising:
contacting the surface in the presence of a aqueous composition comprising an effective amount of the variant amylase of any of the claims 1-15,
allowing the polypeptide to hydrolyze starch components present in the starchy stain to produce smaller starch-derived molecules that dissolve in the aqueous composition, and
rinsing the surface,
thereby removing the starchy stain from the surface.
29. The method of claim 28, wherein the aqueous composition further comprises a surfactant.
30. The method of any of claims 28-29, wherein the surface is a textile surface.
31. The method of any of claims 28-29, wherein the surface is on dishes.
32. The method of any of claims 28-29, wherein the surface is a soiled hard surface.
33. The method of any of claims 28-32, wherein the composition further comprises at least one additional enzymes selected from the group consiting of protease, hemicellulase, cellulase, peroxidase, lipolytic enzyme, metallolipolytic enzyme, xylanase, lipase,
phospholipase, esterase, perhydrolase, cutinase, pectinase, pectate lyase, mannanase, keratinase, reductase, oxidase, phenoloxidase, lipoxygenase, ligninase, pullulanase, tannase, pentosanase, malanase, β-glucanase, arabinosidase, hyaluronidase, chondroitinase, laccase, and an amylase other than the amylase of any one of claims 1-15.
34. A method of saccharifying a composition comprising starch to produce a composition comprising glucose, wherein the method comprises:
(i) contacting the solution comprising starch with effective amount of the variant amylase of any of the claims 1-15; and (ii) saccharifying the solution comprising starch to produce the composition comprising glucose; wherein the variant amylase catalyzes the saccharification of the starch solution to glucose.
35. The method of claim 34, wherein the composition comprising starch comprises liquefied starch, gelatinized starch, or granular starch.
36. The method of any one of claims 34-35, wherein saccharification is conducted at a temperature range of about 30°C to about 75°C.
37. The method of claim 36, wherein the temperature range is 47°C-74°C.
38. The method of any one of claims 34-37, wherein saccharification is conducted over a pH range of pH 2.0-7.5.
39. The method of claim 38, wherein the pH range is pH 3.5-5.5.
40. The method of claim 39, wherein the pH range is pH 3.5-4.5.
41. The method of any one of claims 34-40, further comprising fermenting the glucose composition to produce an end of fermentation (EOF) product.
42. The method of claim 41, wherein the fermentation is a simultaneous
saccharification and fermentation (SSF) reaction.
43. The method of claims 41 or 42, wherein the fermentation is conducted for 48-70 hours at pH 2-8 and in a temperature range of 25°C-70°C.
44. The method of any one of claims 41-43, wherein the EOF product comprises ethanol.
45. The method of any one of claims 41-44, wherein the EOF product comprises 8- 18% (v/v) ethanol.
46. The method of any one of claims 41-45, wherein the method further comprises contacting a mash and/or a wort with an amylase.
47. The method of claim 46, wherein the method further comprises:
(a) preparing a mash;
(b) filtering the mash to obtain a wort; and
(c) fermenting the wort to obtain a fermented beverage,
wherein the variant amylase of any one of claims 1-16 and 74-80 is added to:
(i) the mash of step (a) and/or
(ii) the wort of step (b) and/or
(iii) the wort of step (c).
48. The method of any one of claims 41-47, wherein the EOF product comprises a metabolite.
49. The method of claim 48, wherein the metabolite is citric acid, lactic acid, succinic acid, monosodium glutamate, gluconic acid, sodium gluconate, calcium gluconate, potassium gluconate, glucono delta-lactone, sodium erythorbate, omega 3 fatty acid, butanol, an amino acid, lysine, itaconic acid, 1,3-propanediol, or isoprene.
50. The method of any one of claims 34-49, further comprising adding glucoamylase, hexokinase, xylanase, glucose isomerase, xylose isomerase, phosphatase, phytase, pullulanase, β-amylase, a-amylase that is not the variant a-amylase, protease, cellulase, hemicellulase, lipase, cutinase, isoamylase, redox enzyme, esterase, transferase, pectinase, alpha-glucosidase, beta- glucosidase, or a combination thereof, to the starch solution.
51. The method of claim 50, wherein the glucoamylase is added to 0.1-2 glucoamylase units (GAU)/g ds.
52. The method of any one of claims 34-51, wherein the amylase is expressed and secreted by a host cell.
53. The method of claim 52, wherein the composition comprising starch is contacted with the host cell.
54. The method of claim 52 or 53, wherein the host cell further expresses and secretes a glucoamylase or other enzyme.
55. The method of any one of claims 52-54, wherein the host cell is capable of fermenting the composition.
56. A composition comprising glucose produced by the method of any one of claims 34-55.
57. A liquefied starch produced by the method of any one of claims 34-55.
58. A fermented beverage produced by the method of any one of claims 34-55.
59. Use of an amylase of any of claims 1-15 in the production of a composition comprising glucose.
60. Use of an amylase of any of claims 1-15 in the production of a liquefied starch.
61. Use of an amylase of any of claims 1-15 in the production of a fermented beverage.
62. Use of an amylase of any of claims 1-15 in cleaning starchy stains.
63. Use of an amylase of any of claims 1-15 in textile desizing.
64. The method according to any one of claims 34-55, the fermented beverage of claim 58, or the use of claim 61, wherein the fermented beverage or end of fermentation product is selected from the group consisting of
(i) a beer selected from the group consisting of full malted beer, beer brewed under the "Reinheitsgebot", ale, IPA, lager, bitter, Happoshu (second beer), third beer, dry beer, near beer, light beer, low alcohol beer, low calorie beer, porter, bock beer, stout, malt liquor, non-alcoholic beer, and non-alcoholic malt liquor; and
(ii) cereal or malt beverages selected from the group consisting of fruit flavoured malt beverages, liquor flavoured malt beverages, and coffee flavoured malt beverages.
65. A method of producing a food composition, comprising: combining
(i) one or more food ingredients, and
(ii) a variant a- amylase of any of claims 1-15,
wherein the variant a-amylase thereof catalyzes the hydrolysis of starch components present in the food ingredients to produce glucose.
66. The method of claim 65, wherein the food composition is selected from the group consisting of a food product, a baking composition, a food additive, an animal food product, a feed product, a feed additive, an oil, a meat, and a lard.
67. The method of any one of claims 65-66, wherein the one or more food ingredients comprise a baking ingredient or an additive.
68. The method of any one of claims 65-67, wherein the one or more food ingredients is selected from the group consisting of flour; an anti-staling amylase; a phospholipase; a phospholipid; a maltogenic alpha-amylase or a variant, homologue, or mutants thereof which has maltogenic alpha-amylase activity; a bakery xylanase; and a lipase.
69. The method of claim 65, wherein the one or more food ingredients is/are selected from the group consisting of:
(i) a maltogenic alpha-amylase from Bacillus stearothermophilus,
(ii) a bakery xylanase is from Bacillus, Aspergillus, Thermomyces or Trichoderma,
(iii) a glycolipase from Fusarium heterosporum.
70. The method of any one of claims 65-69, in which the food composition comprises a dough or a dough product, preferably a processed dough product.
71. The method of any one of claims 65-70, further comprising baking the food composition to produce a baked good.
72. The method of any one of claims 65-70, wherein the method further comprises:
(i) providing a starch medium;
(ii) adding to the starch medium an amylase; and (iii) applying heat to the starch medium during or after step (b) to produce a bakery product.
73. A method of desizing a textile comprising contacting a desizing composition with a sized textile for a time sufficient to desize the textile, wherein the desizing composition comprises a variant a- amylase of any one of claims 1-15.
74. An isolated polynucleotide encoding a polypeptide of any of claims 1-15.
75. An expression vector comprising the polynucleotide of claim 74.
76. A host cell comprising the expression vector of claim 75.
WO 2013/184577 lntemPCT/US2013/043897
INTERNATIONAL SEARCH REPORT PCT/US2013/043897
Box No. I Nucleotide and/or amino acid sequence(s) (Continuation of item 1.c of the first sheet)
With regard to any nucleotide and/or amino acid sequence disclosed in the international application and necessary to the claimed invention, the international search was carried out on the basis of:
a. (means)
on paper
in electronic form )
in the international application as filed
together with the international application in electronic form
Figure imgf000197_0001
subsequently to this Authority for the purpose of search
2. I I In addition, in the case that more than one version or copy of a sequence listing and/or table relating thereto has been filed
I X I or furnished, the required statements that the information in the subsequent or additional copies is identical to that in the application as filed or does not go beyond the application as filed, as appropriate, were furnished.
3. Additional comments:
Form PCT/ISA 210 (continuation of first sheet (1)) (July 2009)
PCT/US2013/043897 2012-06-08 2013-06-03 Alpha-amylase variants derived from the alpha amylase of cytophaga sp.amylase|(cspamy2). WO2013184577A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
EP24154279.4A EP4389885A3 (en) 2012-06-08 2013-06-03 Alpha-amylase variants
CN201380030152.XA CN104379738A (en) 2012-06-08 2013-06-03 Alpha-amylase variants derived from the alpha amylase of CYTOPHAGA SP. amylase|(CSPAMY2)
EP13729864.2A EP2859097B9 (en) 2012-06-08 2013-06-03 Alpha-amylase variants derived from the alpha amylase of cytophaga sp. amylasei(cspamy2).
US14/406,494 US20150152401A1 (en) 2012-06-08 2013-06-03 Alpha amylase variants derived from the alpha amylase of cytophaga sp. amylase (cspamy2)
CA2874198A CA2874198A1 (en) 2012-06-08 2013-06-03 Alpha-amylase variants derived from the alpha amylase of cytophaga sp.amylase|(cspamy2).
EP21193640.6A EP3967757B1 (en) 2012-06-08 2013-06-03 Alpha-amylase variants derived from the alpha amylase of cytophaga sp. amylase (cspamy2).
DK13729864.2T DK2859097T3 (en) 2012-06-08 2013-06-03 Alpha-amylase variants derived from the alpha-amylase of Cytophaga sp. amylase | (CspAmy2)
ES13729864T ES2905323T3 (en) 2012-06-08 2013-06-03 Alpha-amylase variants derived from Cytophaga sp. amylasei (CspAmy2)
BR112014030449A BR112014030449A2 (en) 2012-06-08 2013-06-03 alpha-amylase variants derived from cytophaga sp (cspamy2) alpha amylase amylase
US15/288,901 US20170037387A1 (en) 2012-06-08 2016-10-07 Alpha amylase variants derived from the alpha amylase of cytophaga sp. amylase (cspamy2)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261657501P 2012-06-08 2012-06-08
US61/657,501 2012-06-08

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/406,494 A-371-Of-International US20150152401A1 (en) 2012-06-08 2013-06-03 Alpha amylase variants derived from the alpha amylase of cytophaga sp. amylase (cspamy2)
US15/288,901 Continuation US20170037387A1 (en) 2012-06-08 2016-10-07 Alpha amylase variants derived from the alpha amylase of cytophaga sp. amylase (cspamy2)

Publications (1)

Publication Number Publication Date
WO2013184577A1 true WO2013184577A1 (en) 2013-12-12

Family

ID=48626134

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/US2013/042702 WO2014007921A1 (en) 2012-06-08 2013-05-24 Variant alpha amylases with enhanced activity on starch polymers
PCT/US2013/043897 WO2013184577A1 (en) 2012-06-08 2013-06-03 Alpha-amylase variants derived from the alpha amylase of cytophaga sp.amylase|(cspamy2).

Family Applications Before (1)

Application Number Title Priority Date Filing Date
PCT/US2013/042702 WO2014007921A1 (en) 2012-06-08 2013-05-24 Variant alpha amylases with enhanced activity on starch polymers

Country Status (9)

Country Link
US (3) US20150141316A1 (en)
EP (5) EP2825643B1 (en)
CN (2) CN104379737B (en)
BR (1) BR112014030449A2 (en)
CA (2) CA2874061A1 (en)
DK (4) DK2825643T3 (en)
ES (3) ES2909509T3 (en)
HU (3) HUE057894T2 (en)
WO (2) WO2014007921A1 (en)

Cited By (192)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014183921A1 (en) 2013-05-17 2014-11-20 Novozymes A/S Polypeptides having alpha amylase activity
WO2015121134A1 (en) * 2014-02-11 2015-08-20 Novozymes A/S Detergent composition, method and use of detergent composition
WO2015150457A1 (en) 2014-04-01 2015-10-08 Novozymes A/S Polypeptides having alpha amylase activity
WO2015189371A1 (en) 2014-06-12 2015-12-17 Novozymes A/S Alpha-amylase variants and polynucleotides encoding same
WO2016079110A2 (en) 2014-11-19 2016-05-26 Novozymes A/S Use of enzyme for cleaning
WO2016096996A1 (en) 2014-12-16 2016-06-23 Novozymes A/S Polypeptides having n-acetyl glucosamine oxidase activity
WO2016135351A1 (en) 2015-06-30 2016-09-01 Novozymes A/S Laundry detergent composition, method for washing and use of composition
EP3101108A1 (en) 2015-06-04 2016-12-07 The Procter and Gamble Company Hand dishwashing liquid detergent composition
EP3101109A1 (en) 2015-06-04 2016-12-07 The Procter and Gamble Company Hand dishwashing liquid detergent composition
WO2016201040A1 (en) 2015-06-09 2016-12-15 Danisco Us Inc. Water-triggered enzyme suspension
WO2016201069A1 (en) 2015-06-09 2016-12-15 Danisco Us Inc Low-density enzyme-containing particles
WO2016201044A1 (en) 2015-06-09 2016-12-15 Danisco Us Inc Osmotic burst encapsulates
WO2016205755A1 (en) 2015-06-17 2016-12-22 Danisco Us Inc. Bacillus gibsonii-clade serine proteases
WO2016202785A1 (en) 2015-06-17 2016-12-22 Novozymes A/S Container
WO2017046232A1 (en) 2015-09-17 2017-03-23 Henkel Ag & Co. Kgaa Detergent compositions comprising polypeptides having xanthan degrading activity
WO2017046260A1 (en) 2015-09-17 2017-03-23 Novozymes A/S Polypeptides having xanthan degrading activity and polynucleotides encoding same
WO2017079751A1 (en) 2015-11-05 2017-05-11 Danisco Us Inc Paenibacillus sp. mannanases
WO2017079756A1 (en) 2015-11-05 2017-05-11 Danisco Us Inc Paenibacillus and bacillus spp. mannanases
WO2017100720A1 (en) * 2015-12-09 2017-06-15 Danisco Us Inc. Alpha-amylase combinatorial variants
WO2017106676A1 (en) 2015-12-18 2017-06-22 Danisco Us Inc Polypeptides with endoglucanase activity and uses thereof
WO2017129754A1 (en) 2016-01-29 2017-08-03 Novozymes A/S Beta-glucanase variants and polynucleotides encoding same
WO2017144008A1 (en) * 2016-02-26 2017-08-31 南京百斯杰生物工程有限公司 Αlpha amylase variant and use thereof
WO2017174769A2 (en) 2016-04-08 2017-10-12 Novozymes A/S Detergent compositions and uses of the same
WO2017192692A1 (en) 2016-05-03 2017-11-09 Danisco Us Inc Protease variants and uses thereof
WO2017192300A1 (en) 2016-05-05 2017-11-09 Danisco Us Inc Protease variants and uses thereof
WO2017207762A1 (en) 2016-06-03 2017-12-07 Novozymes A/S Subtilase variants and polynucleotides encoding same
WO2017210295A1 (en) 2016-05-31 2017-12-07 Danisco Us Inc. Protease variants and uses thereof
WO2017219011A1 (en) 2016-06-17 2017-12-21 Danisco Us Inc Protease variants and uses thereof
WO2017220422A1 (en) 2016-06-23 2017-12-28 Novozymes A/S Use of enzymes, composition and method for removing soil
WO2018001959A1 (en) 2016-06-30 2018-01-04 Novozymes A/S Lipase variants and compositions comprising surfactant and lipase variant
EP3284805A1 (en) 2016-08-17 2018-02-21 The Procter & Gamble Company Cleaning composition comprising enzymes
WO2018060216A1 (en) 2016-09-29 2018-04-05 Novozymes A/S Use of enzyme for washing, method for washing and warewashing composition
EP3309249A1 (en) 2013-07-29 2018-04-18 Novozymes A/S Protease variants and polynucleotides encoding same
WO2018085524A2 (en) 2016-11-07 2018-05-11 Danisco Us Inc Laundry detergent composition
WO2018099762A1 (en) 2016-12-01 2018-06-07 Basf Se Stabilization of enzymes in compositions
WO2018108865A1 (en) 2016-12-12 2018-06-21 Novozymes A/S Use of polypeptides
WO2018118950A1 (en) 2016-12-21 2018-06-28 Danisco Us Inc. Bacillus gibsonii-clade serine proteases
WO2018118917A1 (en) 2016-12-21 2018-06-28 Danisco Us Inc. Protease variants and uses thereof
WO2018169750A1 (en) 2017-03-15 2018-09-20 Danisco Us Inc Trypsin-like serine proteases and uses thereof
WO2018184004A1 (en) 2017-03-31 2018-10-04 Danisco Us Inc Alpha-amylase combinatorial variants
WO2018178061A1 (en) 2017-03-31 2018-10-04 Novozymes A/S Polypeptides having rnase activity
WO2018177936A1 (en) 2017-03-31 2018-10-04 Novozymes A/S Polypeptides having dnase activity
WO2018183662A1 (en) 2017-03-31 2018-10-04 Danisco Us Inc Delayed release enzyme formulations for bleach-containing detergents
WO2018184873A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Detergent compositions and uses thereof
WO2018185181A1 (en) 2017-04-04 2018-10-11 Novozymes A/S Glycosyl hydrolases
WO2018185152A1 (en) 2017-04-04 2018-10-11 Novozymes A/S Polypeptide compositions and uses thereof
WO2018185280A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Cleaning compositions and uses thereof
WO2018185048A1 (en) 2017-04-03 2018-10-11 Novozymes A/S Recovery process
WO2018185267A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Cleaning compositions and uses thereof
WO2018184816A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Cleaning compositions and uses thereof
WO2018185269A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Cleaning compositions and uses thereof
EP3401385A1 (en) 2017-05-08 2018-11-14 Henkel AG & Co. KGaA Detergent composition comprising polypeptide comprising carbohydrate-binding domain
WO2018206535A1 (en) 2017-05-08 2018-11-15 Novozymes A/S Carbohydrate-binding domain and polynucleotides encoding the same
WO2019006077A1 (en) 2017-06-30 2019-01-03 Danisco Us Inc Low-agglomeration, enzyme-containing particles
WO2019036721A2 (en) 2017-08-18 2019-02-21 Danisco Us Inc Alpha-amylase variants
WO2019057758A1 (en) 2017-09-20 2019-03-28 Novozymes A/S Use of enzymes for improving water absorption and/or whiteness
WO2019086528A1 (en) 2017-11-01 2019-05-09 Novozymes A/S Polypeptides and compositions comprising such polypeptides
WO2019086532A1 (en) 2017-11-01 2019-05-09 Novozymes A/S Methods for cleaning medical devices
WO2019086530A1 (en) 2017-11-01 2019-05-09 Novozymes A/S Polypeptides and compositions comprising such polypeptides
WO2019108599A1 (en) 2017-11-29 2019-06-06 Danisco Us Inc Subtilisin variants having improved stability
WO2019105781A1 (en) 2017-11-29 2019-06-06 Basf Se Storage-stable enzyme preparations, their production and use
WO2019125683A1 (en) 2017-12-21 2019-06-27 Danisco Us Inc Enzyme-containing, hot-melt granules comprising a thermotolerant desiccant
WO2019156670A1 (en) 2018-02-08 2019-08-15 Danisco Us Inc. Thermally-resistant wax matrix particles for enzyme encapsulation
WO2019180111A1 (en) 2018-03-23 2019-09-26 Novozymes A/S Subtilase variants and compositions comprising same
WO2019201793A1 (en) 2018-04-17 2019-10-24 Novozymes A/S Polypeptides comprising carbohydrate binding activity in detergent compositions and their use in reducing wrinkles in textile or fabric.
WO2019206994A1 (en) 2018-04-26 2019-10-31 Basf Se Lipase enzymes
WO2019211143A1 (en) 2018-05-03 2019-11-07 Basf Se Amylase enzymes
WO2019238761A1 (en) 2018-06-15 2019-12-19 Basf Se Water soluble multilayer films containing wash active chemicals and enzymes
WO2019245704A1 (en) 2018-06-19 2019-12-26 Danisco Us Inc Subtilisin variants
WO2019245705A1 (en) 2018-06-19 2019-12-26 Danisco Us Inc Subtilisin variants
WO2020002608A1 (en) 2018-06-29 2020-01-02 Novozymes A/S Detergent compositions and uses thereof
WO2020002604A1 (en) 2018-06-28 2020-01-02 Novozymes A/S Detergent compositions and uses thereof
WO2020002255A1 (en) 2018-06-29 2020-01-02 Novozymes A/S Subtilase variants and compositions comprising same
WO2020007863A1 (en) 2018-07-02 2020-01-09 Novozymes A/S Cleaning compositions and uses thereof
WO2020007875A1 (en) 2018-07-03 2020-01-09 Novozymes A/S Cleaning compositions and uses thereof
WO2020008024A1 (en) 2018-07-06 2020-01-09 Novozymes A/S Cleaning compositions and uses thereof
WO2020028443A1 (en) 2018-07-31 2020-02-06 Danisco Us Inc Variant alpha-amylases having amino acid substitutions that lower the pka of the general acid
EP3611260A1 (en) 2013-07-29 2020-02-19 Novozymes A/S Protease variants and polynucleotides encoding same
WO2020047215A1 (en) 2018-08-30 2020-03-05 Danisco Us Inc Enzyme-containing granules
WO2020068486A1 (en) 2018-09-27 2020-04-02 Danisco Us Inc Compositions for medical instrument cleaning
WO2020070209A1 (en) 2018-10-02 2020-04-09 Novozymes A/S Cleaning composition
WO2020070249A1 (en) 2018-10-03 2020-04-09 Novozymes A/S Cleaning compositions
WO2020070199A1 (en) 2018-10-03 2020-04-09 Novozymes A/S Polypeptides having alpha-mannan degrading activity and polynucleotides encoding same
WO2020070009A1 (en) 2018-10-02 2020-04-09 Novozymes A/S Endonuclease 1 ribonucleases for cleaning
WO2020070063A2 (en) 2018-10-01 2020-04-09 Novozymes A/S Detergent compositions and uses thereof
WO2020070014A1 (en) 2018-10-02 2020-04-09 Novozymes A/S Cleaning composition comprising anionic surfactant and a polypeptide having rnase activity
WO2020069915A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing hydrolases in liquids
WO2020070011A1 (en) 2018-10-02 2020-04-09 Novozymes A/S Cleaning composition
WO2020069914A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing amylases in liquids
WO2020069913A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing hydrolases in liquids
WO2020074545A1 (en) 2018-10-11 2020-04-16 Novozymes A/S Cleaning compositions and uses thereof
WO2020077331A2 (en) 2018-10-12 2020-04-16 Danisco Us Inc Alpha-amylases with mutations that improve stability in the presence of chelants
EP3647397A1 (en) 2018-10-31 2020-05-06 Henkel AG & Co. KGaA Cleaning compositions containing dispersins iv
EP3647398A1 (en) 2018-10-31 2020-05-06 Henkel AG & Co. KGaA Cleaning compositions containing dispersins v
WO2020112599A1 (en) 2018-11-28 2020-06-04 Danisco Us Inc Subtilisin variants having improved stability
WO2020114965A1 (en) 2018-12-03 2020-06-11 Novozymes A/S LOW pH POWDER DETERGENT COMPOSITION
WO2020114968A1 (en) 2018-12-03 2020-06-11 Novozymes A/S Powder detergent compositions
WO2020127796A2 (en) 2018-12-21 2020-06-25 Novozymes A/S Polypeptides having peptidoglycan degrading activity and polynucleotides encoding same
WO2020127775A1 (en) 2018-12-21 2020-06-25 Novozymes A/S Detergent pouch comprising metalloproteases
EP3677676A1 (en) 2019-01-03 2020-07-08 Basf Se Compounds stabilizing amylases in liquids
EP3690037A1 (en) 2014-12-04 2020-08-05 Novozymes A/S Subtilase variants and polynucleotides encoding same
WO2020169564A1 (en) 2019-02-20 2020-08-27 Basf Se Industrial fermentation process for bacillus using defined medium and trace element feed
WO2020169563A1 (en) 2019-02-20 2020-08-27 Basf Se Industrial fermentation process for bacillus using defined medium and magnesium feed
EP3702452A1 (en) 2019-03-01 2020-09-02 Novozymes A/S Detergent compositions comprising two proteases
WO2020188095A1 (en) 2019-03-21 2020-09-24 Novozymes A/S Alpha-amylase variants and polynucleotides encoding same
WO2020193535A2 (en) 2019-03-25 2020-10-01 Basf Se Amylase enzymes
WO2020193532A1 (en) 2019-03-25 2020-10-01 Basf Se Cleaning composition having amylase enzymes
WO2020193534A2 (en) 2019-03-25 2020-10-01 Basf Se Amylase enzymes
EP3134521B1 (en) 2014-04-25 2020-10-28 Basf Se Amylase variants
EP3739029A1 (en) 2014-07-04 2020-11-18 Novozymes A/S Subtilase variants and polynucleotides encoding same
WO2020229480A1 (en) 2019-05-14 2020-11-19 Basf Se Compounds stabilizing hydrolases in liquids
EP3741848A2 (en) 2014-12-19 2020-11-25 Novozymes A/S Protease variants and polynucleotides encoding same
EP3741849A2 (en) 2014-12-19 2020-11-25 Novozymes A/S Protease variants and polynucleotides encoding same
WO2020242858A1 (en) 2019-05-24 2020-12-03 Danisco Us Inc Subtilisin variants and methods of use
WO2020247582A1 (en) 2019-06-06 2020-12-10 Danisco Us Inc Methods and compositions for cleaning
WO2020249546A1 (en) 2019-06-13 2020-12-17 Basf Se Method of recovering a protein from fermentation broth using a divalent cation
WO2021004830A1 (en) 2019-07-05 2021-01-14 Basf Se Industrial fermentation process for microbial cells using a fed-batch pre-culture
WO2021009067A1 (en) 2019-07-12 2021-01-21 Novozymes A/S Enzymatic emulsions for detergents
WO2021032881A1 (en) 2019-08-22 2021-02-25 Basf Se Amylase variants
EP3786269A1 (en) 2013-06-06 2021-03-03 Novozymes A/S Alpha-amylase variants and polynucleotides encoding same
WO2021053127A1 (en) 2019-09-19 2021-03-25 Novozymes A/S Detergent composition
WO2021064068A1 (en) 2019-10-03 2021-04-08 Novozymes A/S Polypeptides comprising at least two carbohydrate binding domains
WO2021074430A1 (en) 2019-10-18 2021-04-22 Basf Se Storage-stable hydrolase containing liquids
WO2021080948A2 (en) 2019-10-24 2021-04-29 Danisco Us Inc Variant maltopentaose/maltohexaose-forming alpha-amylases
WO2021105336A1 (en) 2019-11-29 2021-06-03 Basf Se Compositions comprising polymer and enzyme
WO2021115912A1 (en) 2019-12-09 2021-06-17 Basf Se Formulations comprising a hydrophobically modified polyethyleneimine and one or more enzymes
WO2021122118A1 (en) 2019-12-20 2021-06-24 Henkel Ag & Co. Kgaa Cleaning compositions comprising dispersins vi
WO2021123307A2 (en) 2019-12-20 2021-06-24 Novozymes A/S Polypeptides having proteolytic activity and use thereof
WO2021122120A2 (en) 2019-12-20 2021-06-24 Henkel Ag & Co. Kgaa Cleaning compositions comprising dispersins viii
WO2021122117A1 (en) 2019-12-20 2021-06-24 Henkel Ag & Co. Kgaa Cleaning composition coprising a dispersin and a carbohydrase
WO2021121394A1 (en) 2019-12-20 2021-06-24 Novozymes A/S Stabilized liquid boron-free enzyme compositions
EP3872174A1 (en) 2015-05-13 2021-09-01 Danisco US Inc. Aprl-clade protease variants and uses thereof
EP3872175A1 (en) 2015-06-18 2021-09-01 Novozymes A/S Subtilase variants and polynucleotides encoding same
EP3878960A1 (en) 2014-07-04 2021-09-15 Novozymes A/S Subtilase variants and polynucleotides encoding same
WO2021214059A1 (en) 2020-04-21 2021-10-28 Novozymes A/S Cleaning compositions comprising polypeptides having fructan degrading activity
WO2021239818A1 (en) 2020-05-26 2021-12-02 Novozymes A/S Subtilase variants and compositions comprising same
WO2021259099A1 (en) 2020-06-24 2021-12-30 Novozymes A/S Use of cellulases for removing dust mite from textile
EP3936593A1 (en) 2020-07-08 2022-01-12 Henkel AG & Co. KGaA Cleaning compositions and uses thereof
WO2022008732A1 (en) 2020-07-10 2022-01-13 Basf Se Enhancing the activity of antimicrobial preservatives
EP3957711A2 (en) 2015-10-28 2022-02-23 Novozymes A/S Detergent composition comprising amylase and protease variants
EP3783102A4 (en) * 2018-03-21 2022-02-23 Feed Research Institute, Chinese Academy of Agricultural Sciences Amylase mutant having high specific activity and thermal stability, gene of mutant, and applications thereof
WO2022047149A1 (en) 2020-08-27 2022-03-03 Danisco Us Inc Enzymes and enzyme compositions for cleaning
WO2022043547A1 (en) 2020-08-28 2022-03-03 Novozymes A/S Protease variants with improved solubility
WO2022044629A1 (en) * 2020-08-31 2022-03-03 花王株式会社 α-AMYLASE VARIANT
WO2022063699A1 (en) 2020-09-22 2022-03-31 Basf Se Improved combination of protease and protease inhibitor with secondary enzyme
WO2022063698A1 (en) 2020-09-22 2022-03-31 Basf Se Liquid composition comprising peptide aldehyde
WO2022074037A2 (en) 2020-10-07 2022-04-14 Novozymes A/S Alpha-amylase variants
WO2022084303A2 (en) 2020-10-20 2022-04-28 Novozymes A/S Use of polypeptides having dnase activity
EP4015629A1 (en) 2020-12-18 2022-06-22 Basf Se Polymer mixtures for increasing stability and performance of hydrolase-containing detergents
EP4032966A1 (en) 2021-01-22 2022-07-27 Novozymes A/S Liquid enzyme composition with sulfite scavenger
WO2022165107A1 (en) 2021-01-29 2022-08-04 Danisco Us Inc Compositions for cleaning and methods related thereto
WO2022171872A1 (en) 2021-02-12 2022-08-18 Novozymes A/S Stabilized biological detergents
WO2022171780A2 (en) 2021-02-12 2022-08-18 Novozymes A/S Alpha-amylase variants
EP4047088A1 (en) 2021-02-22 2022-08-24 Basf Se Amylase variants
WO2022175435A1 (en) 2021-02-22 2022-08-25 Basf Se Amylase variants
WO2022189521A1 (en) 2021-03-12 2022-09-15 Novozymes A/S Polypeptide variants
WO2022268885A1 (en) 2021-06-23 2022-12-29 Novozymes A/S Alpha-amylase polypeptides
WO2023278297A1 (en) 2021-06-30 2023-01-05 Danisco Us Inc Variant lipases and uses thereof
WO2023034486A2 (en) 2021-09-03 2023-03-09 Danisco Us Inc. Laundry compositions for cleaning
WO2023039270A2 (en) 2021-09-13 2023-03-16 Danisco Us Inc. Bioactive-containing granules
WO2023114939A2 (en) 2021-12-16 2023-06-22 Danisco Us Inc. Subtilisin variants and methods of use
WO2023114988A2 (en) 2021-12-16 2023-06-22 Danisco Us Inc. Variant maltopentaose/maltohexaose-forming alpha-amylases
WO2023114932A2 (en) 2021-12-16 2023-06-22 Danisco Us Inc. Subtilisin variants and methods of use
WO2023114936A2 (en) 2021-12-16 2023-06-22 Danisco Us Inc. Subtilisin variants and methods of use
WO2023118015A1 (en) 2021-12-21 2023-06-29 Basf Se Environmental attributes for care composition ingredients
EP4206309A1 (en) 2021-12-30 2023-07-05 Novozymes A/S Protein particles with improved whiteness
WO2023165507A1 (en) 2022-03-02 2023-09-07 Novozymes A/S Use of xyloglucanase for improvement of sustainability of detergents
WO2023168234A1 (en) 2022-03-01 2023-09-07 Danisco Us Inc. Enzymes and enzyme compositions for cleaning
WO2023225459A2 (en) 2022-05-14 2023-11-23 Novozymes A/S Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections
WO2023250301A1 (en) 2022-06-21 2023-12-28 Danisco Us Inc. Methods and compositions for cleaning comprising a polypeptide having thermolysin activity
WO2024012894A1 (en) 2022-07-15 2024-01-18 Basf Se Alkanolamine formates for enzyme stabilization in liquid formulations
WO2024033136A1 (en) 2022-08-11 2024-02-15 Basf Se Amylase variants
WO2024033135A2 (en) 2022-08-11 2024-02-15 Basf Se Amylase variants
WO2024050346A1 (en) 2022-09-02 2024-03-07 Danisco Us Inc. Detergent compositions and methods related thereto
WO2024050339A1 (en) 2022-09-02 2024-03-07 Danisco Us Inc. Mannanase variants and methods of use
WO2024050343A1 (en) 2022-09-02 2024-03-07 Danisco Us Inc. Subtilisin variants and methods related thereto
WO2024094732A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024094735A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024094733A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024102698A1 (en) 2022-11-09 2024-05-16 Danisco Us Inc. Subtilisin variants and methods of use
WO2024121070A1 (en) 2022-12-05 2024-06-13 Novozymes A/S Protease variants and polynucleotides encoding same
EP4389864A1 (en) 2022-12-20 2024-06-26 Basf Se Cutinases
WO2024131880A2 (en) 2022-12-23 2024-06-27 Novozymes A/S Detergent composition comprising catalase and amylase
WO2024137248A1 (en) 2022-12-19 2024-06-27 Novozymes A/S Compositions comprising arabinofuranosidases and a xylanase, and use thereof for increasing hemicellulosic fiber solubilization
WO2024137250A1 (en) 2022-12-19 2024-06-27 Novozymes A/S Carbohydrate esterase family 3 (ce3) polypeptides having acetyl xylan esterase activity and polynucleotides encoding same
WO2024137252A1 (en) 2022-12-19 2024-06-27 Novozymes A/S Process for reducing syrup viscosity in the backend of a process for producing a fermentation product
WO2024137246A1 (en) 2022-12-19 2024-06-27 Novozymes A/S Carbohydrate esterase family 1 (ce1) polypeptides having ferulic acid esterase and/or acetyl xylan esterase activity and polynucleotides encoding same
WO2024156628A1 (en) 2023-01-23 2024-08-02 Novozymes A/S Cleaning compositions and uses thereof
EP4410938A1 (en) 2023-02-02 2024-08-07 AMSilk GmbH Automatic dishwashing composition comprising a structural polypeptide
WO2024163584A1 (en) 2023-02-01 2024-08-08 Danisco Us Inc. Subtilisin variants and methods of use
WO2024186819A1 (en) 2023-03-06 2024-09-12 Danisco Us Inc. Subtilisin variants and methods of use
WO2024191711A1 (en) 2023-03-16 2024-09-19 Nutrition & Biosciences USA 4, Inc. Brevibacillus fermentate extracts for cleaning and malodor control and use thereof

Families Citing this family (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1423513B1 (en) 2001-05-15 2009-11-25 Novozymes A/S Alpha-amylase variant with altered properties
CN112662734B (en) 2011-06-30 2024-09-10 诺维信公司 Method for screening alpha-amylase
WO2014164777A1 (en) * 2013-03-11 2014-10-09 Danisco Us Inc. Alpha-amylase combinatorial variants
WO2015032451A1 (en) * 2013-09-09 2015-03-12 Ecolab Usa Inc. Synergistic stain removal through novel chelator combination
ES2666186T3 (en) 2015-06-05 2018-05-03 The Procter & Gamble Company Compacted liquid detergent composition for laundry
EP3101102B2 (en) 2015-06-05 2023-12-13 The Procter & Gamble Company Compacted liquid laundry detergent composition
EP3101107B1 (en) 2015-06-05 2019-04-24 The Procter and Gamble Company Compacted liquid laundry detergent composition
CN105386324B (en) * 2015-12-18 2017-12-12 江南大学 A kind of cotton or the pre-treating method of polyester cotton
EP3257931A1 (en) * 2016-06-17 2017-12-20 The Procter and Gamble Company Detergent composition
CN110114450B (en) * 2016-10-18 2020-07-03 斯特里莱克斯有限责任公司 Ambient moisture activatable surface treatment powders
CA3067218A1 (en) 2017-06-16 2018-12-20 Basf Enzymes Llc Method for increasing oil yield during ethanol production
BR112020008283A2 (en) * 2017-11-09 2020-10-20 Ajinomoto Co., Inc. meat modification composition, method for producing a prepared meat product, prepared meat product, and, meat modification method.
EP3517597B1 (en) * 2018-01-25 2024-03-20 The Procter & Gamble Company Polymer composition
CA3093776A1 (en) * 2018-03-13 2019-09-19 Lallemand Hungary Liquidity Management Llc Yeast expressing thermostable alpha-amylases for hydrolysis of starch
CN112368394A (en) * 2018-05-04 2021-02-12 丹尼斯科美国公司 Simplified process for producing maltodextrins and specialty syrups
CN112391369A (en) * 2020-11-24 2021-02-23 吉林中粮生化有限公司 Compound saccharifying enzyme capable of remarkably improving saccharifying effect, and preparation method and application thereof
WO2024151580A1 (en) * 2023-01-11 2024-07-18 University Of Washington Design of amyloidogenic peptide traps

Citations (86)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1372034A (en) 1970-12-31 1974-10-30 Unilever Ltd Detergent compositions
GB1483591A (en) 1973-07-23 1977-08-24 Novo Industri As Process for coating water soluble or water dispersible particles by means of the fluid bed technique
US4106991A (en) 1976-07-07 1978-08-15 Novo Industri A/S Enzyme granulate composition and process for forming enzyme granulates
US4435307A (en) 1980-04-30 1984-03-06 Novo Industri A/S Detergent cellulase
WO1984002921A2 (en) 1983-01-28 1984-08-02 Cetus Corp Glucoamylase cdna
EP0135138A2 (en) 1983-08-17 1985-03-27 Cpc International Inc. A novel thermostable glucoamylase and method for its production
WO1986001831A1 (en) 1984-09-18 1986-03-27 Michigan Biotechnology Institute Thermostable starch converting enzymes
US4587215A (en) 1984-06-25 1986-05-06 Uop Inc. Highly thermostable amyloglucosidase
USRE32153E (en) 1978-09-01 1986-05-20 Cpc International Inc. Highly thermostable glucoamylaseand process for its production
EP0200362A2 (en) 1985-03-28 1986-11-05 F. Hoffmann-La Roche Ag Process for amplifying, detecting, and/or cloning nucleic acid sequences
EP0201184A2 (en) 1985-03-28 1986-11-12 F. Hoffmann-La Roche Ag Process for amplifying nucleic acid sequences
EP0218272A1 (en) 1985-08-09 1987-04-15 Gist-Brocades N.V. Novel lipolytic enzymes and their use in detergent compositions
US4661452A (en) 1984-05-29 1987-04-28 Novo Industri A/S Enzyme containing granulates useful as detergent additives
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
EP0238023A2 (en) 1986-03-17 1987-09-23 Novo Nordisk A/S Process for the production of protein products in Aspergillus oryzae and a promoter for use in Aspergillus
EP0238216A1 (en) 1986-02-20 1987-09-23 Albright &amp; Wilson Limited Protected enzyme systems
EP0258068A2 (en) 1986-08-29 1988-03-02 Novo Nordisk A/S Enzymatic detergent additive
EP0260105A2 (en) 1986-09-09 1988-03-16 Genencor, Inc. Preparation of enzymes having altered activity
EP0305216A1 (en) 1987-08-28 1989-03-01 Novo Nordisk A/S Recombinant Humicola lipase and process for the production of recombinant humicola lipases
JPS6474992A (en) 1987-09-16 1989-03-20 Fuji Oil Co Ltd Dna sequence, plasmid and production of lipase
WO1989006270A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Enzymatic detergent
WO1989006279A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Mutated subtilisin genes
EP0331376A2 (en) 1988-02-28 1989-09-06 Amano Pharmaceutical Co., Ltd. Recombinant DNA, bacterium of the genus pseudomonas containing it, and process for preparing lipase by using it
WO1989009259A1 (en) 1988-03-24 1989-10-05 Novo-Nordisk A/S A cellulase preparation
EP0407225A1 (en) 1989-07-07 1991-01-09 Unilever Plc Enzymes and enzymatic detergent compositions
WO1991016422A1 (en) 1990-04-14 1991-10-31 Kali-Chemie Aktiengesellschaft Alkaline bacillus lipases, coding dna sequences therefor and bacilli which produce these lipases
WO1991017243A1 (en) 1990-05-09 1991-11-14 Novo Nordisk A/S A cellulase preparation comprising an endoglucanase enzyme
WO1992000381A1 (en) 1990-06-29 1992-01-09 Novo Nordisk A/S Enzymatic hydrolysis of starch to glucose, using a genetically engineered enzyme
WO1992005249A1 (en) 1990-09-13 1992-04-02 Novo Nordisk A/S Lipase variants
WO1992006154A1 (en) 1990-09-28 1992-04-16 The Procter & Gamble Company Polyhydroxy fatty acid amide surfactants to enhance enzyme performance
EP0495257A1 (en) 1991-01-16 1992-07-22 The Procter & Gamble Company Compact detergent compositions with high activity cellulase
WO1992019708A1 (en) 1991-04-30 1992-11-12 The Procter & Gamble Company Liquid detergents with aromatic borate ester to inhibit proteolytic enzyme
WO1992019709A1 (en) 1991-04-30 1992-11-12 The Procter & Gamble Company Built liquid detergents with boric-polyol complex to inhibit proteolytic enzyme
WO1992019729A1 (en) 1991-05-01 1992-11-12 Novo Nordisk A/S Stabilized enzymes and detergent compositions
EP0531315A1 (en) 1990-05-09 1993-03-17 Novo Nordisk As An enzyme capable of degrading cellulose or hemicellulose.
WO1993024618A1 (en) 1992-06-01 1993-12-09 Novo Nordisk A/S Peroxidase variants with improved hydrogen peroxide stability
WO1994001541A1 (en) 1992-07-06 1994-01-20 Novo Nordisk A/S C. antarctica lipase and lipase variants
US5281526A (en) 1992-10-20 1994-01-25 Solvay Enzymes, Inc. Method of purification of amylase by precipitation with a metal halide and 4-hydroxybenzic acid or a derivative thereof
WO1994007998A1 (en) 1992-10-06 1994-04-14 Novo Nordisk A/S Cellulase variants
WO1994025583A1 (en) 1993-05-05 1994-11-10 Novo Nordisk A/S A recombinant trypsin-like protease
WO1994025578A1 (en) 1993-04-27 1994-11-10 Gist-Brocades N.V. New lipase variants for use in detergent applications
WO1995000636A1 (en) 1993-06-28 1995-01-05 Novo Nordisk A/S A fungal protein disulfide isomerase
WO1995006720A1 (en) 1993-08-30 1995-03-09 Showa Denko K.K. Novel lipase, microorganism producing the lipase, process for producing the lipase, and use of the lipase
WO1995010602A1 (en) 1993-10-13 1995-04-20 Novo Nordisk A/S H2o2-stable peroxidase variants
WO1995014783A1 (en) 1993-11-24 1995-06-01 Showa Denko K.K. Lipase gene and variant lipase
US5422267A (en) 1984-05-22 1995-06-06 Robert R. Yocum Industrial yeast comprising an integrated glucoamylase gene
WO1995022615A1 (en) 1994-02-22 1995-08-24 Novo Nordisk A/S A method of preparing a variant of a lipolytic enzyme
WO1995024471A1 (en) 1994-03-08 1995-09-14 Novo Nordisk A/S Novel alkaline cellulases
WO1995030744A2 (en) 1994-05-04 1995-11-16 Genencor International Inc. Lipases with improved surfactant resistance
WO1995035381A1 (en) 1994-06-20 1995-12-28 Unilever N.V. Modified pseudomonas lipases and their use
WO1996000292A1 (en) 1994-06-23 1996-01-04 Unilever N.V. Modified pseudomonas lipases and their use
WO1996011262A1 (en) 1994-10-06 1996-04-18 Novo Nordisk A/S An enzyme and enzyme preparation with endoglucanase activity
WO1996012012A1 (en) 1994-10-14 1996-04-25 Solvay S.A. Lipase, microorganism producing same, method for preparing said lipase and uses thereof
WO1996013580A1 (en) 1994-10-26 1996-05-09 Novo Nordisk A/S An enzyme with lipolytic activity
WO1996027002A1 (en) 1995-02-27 1996-09-06 Novo Nordisk A/S Novel lipase gene and process for the production of lipase with the use of the same
WO1996029397A1 (en) 1995-03-17 1996-09-26 Novo Nordisk A/S Novel endoglucanases
WO1997004079A1 (en) 1995-07-14 1997-02-06 Novo Nordisk A/S A modified enzyme with lipolytic activity
WO1997007202A1 (en) 1995-08-11 1997-02-27 Novo Nordisk A/S Novel lipolytic enzymes
US5648263A (en) 1988-03-24 1997-07-15 Novo Nordisk A/S Methods for reducing the harshness of a cotton-containing fabric
WO1998008940A1 (en) 1996-08-26 1998-03-05 Novo Nordisk A/S A novel endoglucanase
WO1998012307A1 (en) 1996-09-17 1998-03-26 Novo Nordisk A/S Cellulase variants
WO1998015257A1 (en) 1996-10-08 1998-04-16 Novo Nordisk A/S Diaminobenzoic acid derivatives as dye precursors
WO1998020115A1 (en) 1996-11-04 1998-05-14 Novo Nordisk A/S Subtilase variants and compositions
WO1998020116A1 (en) 1996-11-04 1998-05-14 Novo Nordisk A/S Subtilase variants and compositions
WO1998034946A1 (en) 1997-02-12 1998-08-13 Massachusetts Institute Of Technology Daxx, a novel fas-binding protein that activates jnk and apoptosis
WO1999028448A1 (en) 1997-11-26 1999-06-10 Novo Nordisk A/S Thermostable glucoamylase
WO2000004136A1 (en) 1998-07-15 2000-01-27 Novozymes A/S Glucoamylase variants
US6022725A (en) 1990-12-10 2000-02-08 Genencor International, Inc. Cloning and amplification of the β-glucosidase gene of Trichoderma reesei
US6077316A (en) 1995-07-19 2000-06-20 Novo Nordisk A/S Treatment of fabrics
WO2001014629A1 (en) 1999-08-20 2001-03-01 Genencor International, Inc. Enzymatic modification of the surface of a polyester fiber or article
WO2001034899A1 (en) 1999-11-05 2001-05-17 Genencor International, Inc. Enzymes useful for changing the properties of polyester
WO2002014490A2 (en) 2000-08-11 2002-02-21 Genencor International, Inc. Bacillus transformation, transformants and mutant libraries
US6472184B1 (en) 1997-08-22 2002-10-29 Peter Hegemann Method for producing nucleic acid polymers
WO2003014358A2 (en) * 2001-08-07 2003-02-20 Henkel Kommanditgesellschaft Auf Aktien Detergent and cleaning agent with hybrid alpha amylases
US20040091994A1 (en) 2000-10-13 2004-05-13 Carsten Andersen Alpha-amylase variant with altered properties
WO2004059556A2 (en) 2002-12-23 2004-07-15 Geneart Gmbh Method and device for optimizing a nucleotide sequence for the purpose of expression of a protein
WO2005056783A1 (en) 2003-12-05 2005-06-23 Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Catalytic domains of beta(1,4)-galactosyltransferase i having altered metal ion specificity
US20060094080A1 (en) 2004-05-27 2006-05-04 Nigel Dunn-Coleman Trichoderma reesei glucoamylase and homologs thereof
US7498158B2 (en) * 2001-05-15 2009-03-03 Novozymes A/S Alpha-amylase variant with altered properties
US20110033882A1 (en) * 2007-05-30 2011-02-10 Wolfgang Aehle Variants of the bacillus licheniformis alpha-amylase
WO2011080352A1 (en) * 2010-01-04 2011-07-07 Novozymes A/S Alpha-amylases
US8058033B2 (en) 2007-11-20 2011-11-15 Danisco Us Inc. Glucoamylase variants with altered properties
WO2011153516A2 (en) 2010-06-03 2011-12-08 Mascoma Corporation Yeast expressing saccharolytic enzymes for consolidated bioprocessing using starch and cellulose
WO2013001078A1 (en) 2011-06-30 2013-01-03 Novozymes A/S Alpha-amylase variants
WO2013057141A2 (en) 2011-10-17 2013-04-25 Novozymes A/S Alpha-amylase variants and polynucleotides encoding same
WO2013063460A2 (en) * 2011-10-28 2013-05-02 Danisco Us Inc. Variant maltohexaose-forming alpha-amylase variants

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP3678309B2 (en) 1992-07-23 2005-08-03 ノボザイムス アクティーゼルスカブ Mutant α-amylase, detergent, dishwashing agent and liquefying agent
DK154292D0 (en) 1992-12-23 1992-12-23 Novo Nordisk As NEW ENZYM
WO1995010603A1 (en) 1993-10-08 1995-04-20 Novo Nordisk A/S Amylase variants
DK0904360T3 (en) * 1996-04-30 2013-10-14 Novozymes As Alpha-amylasemutanter
KR20010015754A (en) 1997-10-13 2001-02-26 한센 핀 베네드, 안네 제헤르, 웨이콥 마리안느 α-AMYLASE MUTANTS
US6197565B1 (en) 1998-11-16 2001-03-06 Novo-Nordisk A/S α-Amylase variants
WO2001066712A2 (en) 2000-03-08 2001-09-13 Novozymes A/S Variants with altered properties
AU2002210380A1 (en) 2000-10-13 2002-04-22 Novozymes A/S Alpha-amylase variant with altered properties
DK2333099T3 (en) 2001-02-21 2017-11-27 Basf Enzymes Llc Enzymes with alpha-amylase activity and methods for their use
JP3632690B2 (en) 2001-06-22 2005-03-23 東洋ゴム工業株式会社 Vibration isolator
PL1654355T3 (en) * 2003-06-13 2010-09-30 Dupont Nutrition Biosci Aps Variant pseudomonas polypeptides having a non-maltogenic exoamylase activity and their use in preparing food products
DK1781790T3 (en) 2004-07-05 2016-01-18 Novozymes As ALFA-amylase variants WITH CHANGED PROPERTIES
PL2447361T3 (en) * 2008-06-06 2015-03-31 Danisco Us Inc Geobacillus stearothermophilus alpha-amylase (AMYS) variants with improved properties
MX2011010040A (en) 2009-04-01 2011-11-18 Danisco Us Inc Cleaning system comprising an alpha-amylase and a protease.
CN113186178A (en) 2010-02-10 2021-07-30 诺维信公司 Variants and compositions comprising variants with high stability in the presence of chelating agents
CN112662734B (en) 2011-06-30 2024-09-10 诺维信公司 Method for screening alpha-amylase
EP3495479A1 (en) 2011-10-17 2019-06-12 Novozymes A/S Alpha-amylase variants and polynucleotides encoding same
WO2013096305A1 (en) 2011-12-22 2013-06-27 Danisco Us Inc. Variant alpha-amylases and methods of use, thereof
DK3354728T3 (en) * 2012-12-21 2020-07-27 Danisco Us Inc ALPHA-amylase variants

Patent Citations (100)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB1372034A (en) 1970-12-31 1974-10-30 Unilever Ltd Detergent compositions
GB1483591A (en) 1973-07-23 1977-08-24 Novo Industri As Process for coating water soluble or water dispersible particles by means of the fluid bed technique
US4106991A (en) 1976-07-07 1978-08-15 Novo Industri A/S Enzyme granulate composition and process for forming enzyme granulates
USRE32153E (en) 1978-09-01 1986-05-20 Cpc International Inc. Highly thermostable glucoamylaseand process for its production
US4435307A (en) 1980-04-30 1984-03-06 Novo Industri A/S Detergent cellulase
WO1984002921A2 (en) 1983-01-28 1984-08-02 Cetus Corp Glucoamylase cdna
EP0135138A2 (en) 1983-08-17 1985-03-27 Cpc International Inc. A novel thermostable glucoamylase and method for its production
US5422267A (en) 1984-05-22 1995-06-06 Robert R. Yocum Industrial yeast comprising an integrated glucoamylase gene
US4661452A (en) 1984-05-29 1987-04-28 Novo Industri A/S Enzyme containing granulates useful as detergent additives
US4587215A (en) 1984-06-25 1986-05-06 Uop Inc. Highly thermostable amyloglucosidase
WO1986001831A1 (en) 1984-09-18 1986-03-27 Michigan Biotechnology Institute Thermostable starch converting enzymes
EP0200362A2 (en) 1985-03-28 1986-11-05 F. Hoffmann-La Roche Ag Process for amplifying, detecting, and/or cloning nucleic acid sequences
EP0201184A2 (en) 1985-03-28 1986-11-12 F. Hoffmann-La Roche Ag Process for amplifying nucleic acid sequences
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683202B1 (en) 1985-03-28 1990-11-27 Cetus Corp
EP0218272A1 (en) 1985-08-09 1987-04-15 Gist-Brocades N.V. Novel lipolytic enzymes and their use in detergent compositions
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683195B1 (en) 1986-01-30 1990-11-27 Cetus Corp
EP0238216A1 (en) 1986-02-20 1987-09-23 Albright &amp; Wilson Limited Protected enzyme systems
EP0238023A2 (en) 1986-03-17 1987-09-23 Novo Nordisk A/S Process for the production of protein products in Aspergillus oryzae and a promoter for use in Aspergillus
EP0258068A2 (en) 1986-08-29 1988-03-02 Novo Nordisk A/S Enzymatic detergent additive
EP0260105A2 (en) 1986-09-09 1988-03-16 Genencor, Inc. Preparation of enzymes having altered activity
EP0305216A1 (en) 1987-08-28 1989-03-01 Novo Nordisk A/S Recombinant Humicola lipase and process for the production of recombinant humicola lipases
JPS6474992A (en) 1987-09-16 1989-03-20 Fuji Oil Co Ltd Dna sequence, plasmid and production of lipase
WO1989006279A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Mutated subtilisin genes
WO1989006270A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Enzymatic detergent
EP0331376A2 (en) 1988-02-28 1989-09-06 Amano Pharmaceutical Co., Ltd. Recombinant DNA, bacterium of the genus pseudomonas containing it, and process for preparing lipase by using it
US5691178A (en) 1988-03-22 1997-11-25 Novo Nordisk A/S Fungal cellulase composition containing alkaline CMC-endoglucanase and essentially no cellobiohydrolase
WO1989009259A1 (en) 1988-03-24 1989-10-05 Novo-Nordisk A/S A cellulase preparation
US5648263A (en) 1988-03-24 1997-07-15 Novo Nordisk A/S Methods for reducing the harshness of a cotton-containing fabric
US5776757A (en) 1988-03-24 1998-07-07 Novo Nordisk A/S Fungal cellulase composition containing alkaline CMC-endoglucanase and essentially no cellobiohydrolase and method of making thereof
EP0407225A1 (en) 1989-07-07 1991-01-09 Unilever Plc Enzymes and enzymatic detergent compositions
WO1991016422A1 (en) 1990-04-14 1991-10-31 Kali-Chemie Aktiengesellschaft Alkaline bacillus lipases, coding dna sequences therefor and bacilli which produce these lipases
US5457046A (en) 1990-05-09 1995-10-10 Novo Nordisk A/S Enzyme capable of degrading cellullose or hemicellulose
EP0531315A1 (en) 1990-05-09 1993-03-17 Novo Nordisk As An enzyme capable of degrading cellulose or hemicellulose.
EP0531372A1 (en) 1990-05-09 1993-03-17 Novo Nordisk As A cellulase preparation comprising an endoglucanase enzyme.
US5686593A (en) 1990-05-09 1997-11-11 Novo Nordisk A/S Enzyme capable of degrading cellulose or hemicellulose
WO1991017243A1 (en) 1990-05-09 1991-11-14 Novo Nordisk A/S A cellulase preparation comprising an endoglucanase enzyme
US5763254A (en) 1990-05-09 1998-06-09 Novo Nordisk A/S Enzyme capable of degrading cellulose or hemicellulose
WO1992000381A1 (en) 1990-06-29 1992-01-09 Novo Nordisk A/S Enzymatic hydrolysis of starch to glucose, using a genetically engineered enzyme
WO1992005249A1 (en) 1990-09-13 1992-04-02 Novo Nordisk A/S Lipase variants
WO1992006154A1 (en) 1990-09-28 1992-04-16 The Procter & Gamble Company Polyhydroxy fatty acid amide surfactants to enhance enzyme performance
US6022725A (en) 1990-12-10 2000-02-08 Genencor International, Inc. Cloning and amplification of the β-glucosidase gene of Trichoderma reesei
EP0495257A1 (en) 1991-01-16 1992-07-22 The Procter & Gamble Company Compact detergent compositions with high activity cellulase
WO1992019709A1 (en) 1991-04-30 1992-11-12 The Procter & Gamble Company Built liquid detergents with boric-polyol complex to inhibit proteolytic enzyme
WO1992019708A1 (en) 1991-04-30 1992-11-12 The Procter & Gamble Company Liquid detergents with aromatic borate ester to inhibit proteolytic enzyme
WO1992019729A1 (en) 1991-05-01 1992-11-12 Novo Nordisk A/S Stabilized enzymes and detergent compositions
WO1993024618A1 (en) 1992-06-01 1993-12-09 Novo Nordisk A/S Peroxidase variants with improved hydrogen peroxide stability
WO1994001541A1 (en) 1992-07-06 1994-01-20 Novo Nordisk A/S C. antarctica lipase and lipase variants
WO1994007998A1 (en) 1992-10-06 1994-04-14 Novo Nordisk A/S Cellulase variants
US5281526A (en) 1992-10-20 1994-01-25 Solvay Enzymes, Inc. Method of purification of amylase by precipitation with a metal halide and 4-hydroxybenzic acid or a derivative thereof
WO1994025578A1 (en) 1993-04-27 1994-11-10 Gist-Brocades N.V. New lipase variants for use in detergent applications
WO1994025583A1 (en) 1993-05-05 1994-11-10 Novo Nordisk A/S A recombinant trypsin-like protease
WO1995000636A1 (en) 1993-06-28 1995-01-05 Novo Nordisk A/S A fungal protein disulfide isomerase
WO1995006720A1 (en) 1993-08-30 1995-03-09 Showa Denko K.K. Novel lipase, microorganism producing the lipase, process for producing the lipase, and use of the lipase
WO1995010602A1 (en) 1993-10-13 1995-04-20 Novo Nordisk A/S H2o2-stable peroxidase variants
WO1995014783A1 (en) 1993-11-24 1995-06-01 Showa Denko K.K. Lipase gene and variant lipase
WO1995022615A1 (en) 1994-02-22 1995-08-24 Novo Nordisk A/S A method of preparing a variant of a lipolytic enzyme
WO1995024471A1 (en) 1994-03-08 1995-09-14 Novo Nordisk A/S Novel alkaline cellulases
WO1995030744A2 (en) 1994-05-04 1995-11-16 Genencor International Inc. Lipases with improved surfactant resistance
WO1995035381A1 (en) 1994-06-20 1995-12-28 Unilever N.V. Modified pseudomonas lipases and their use
WO1996000292A1 (en) 1994-06-23 1996-01-04 Unilever N.V. Modified pseudomonas lipases and their use
WO1996011262A1 (en) 1994-10-06 1996-04-18 Novo Nordisk A/S An enzyme and enzyme preparation with endoglucanase activity
WO1996012012A1 (en) 1994-10-14 1996-04-25 Solvay S.A. Lipase, microorganism producing same, method for preparing said lipase and uses thereof
WO1996013580A1 (en) 1994-10-26 1996-05-09 Novo Nordisk A/S An enzyme with lipolytic activity
WO1996027002A1 (en) 1995-02-27 1996-09-06 Novo Nordisk A/S Novel lipase gene and process for the production of lipase with the use of the same
WO1996029397A1 (en) 1995-03-17 1996-09-26 Novo Nordisk A/S Novel endoglucanases
WO1997004079A1 (en) 1995-07-14 1997-02-06 Novo Nordisk A/S A modified enzyme with lipolytic activity
US6077316A (en) 1995-07-19 2000-06-20 Novo Nordisk A/S Treatment of fabrics
WO1997007202A1 (en) 1995-08-11 1997-02-27 Novo Nordisk A/S Novel lipolytic enzymes
WO1998008940A1 (en) 1996-08-26 1998-03-05 Novo Nordisk A/S A novel endoglucanase
WO1998012307A1 (en) 1996-09-17 1998-03-26 Novo Nordisk A/S Cellulase variants
WO1998015257A1 (en) 1996-10-08 1998-04-16 Novo Nordisk A/S Diaminobenzoic acid derivatives as dye precursors
WO1998020116A1 (en) 1996-11-04 1998-05-14 Novo Nordisk A/S Subtilase variants and compositions
WO1998020115A1 (en) 1996-11-04 1998-05-14 Novo Nordisk A/S Subtilase variants and compositions
WO1998034946A1 (en) 1997-02-12 1998-08-13 Massachusetts Institute Of Technology Daxx, a novel fas-binding protein that activates jnk and apoptosis
US6472184B1 (en) 1997-08-22 2002-10-29 Peter Hegemann Method for producing nucleic acid polymers
WO1999028448A1 (en) 1997-11-26 1999-06-10 Novo Nordisk A/S Thermostable glucoamylase
WO2000004136A1 (en) 1998-07-15 2000-01-27 Novozymes A/S Glucoamylase variants
WO2001014629A1 (en) 1999-08-20 2001-03-01 Genencor International, Inc. Enzymatic modification of the surface of a polyester fiber or article
WO2001034899A1 (en) 1999-11-05 2001-05-17 Genencor International, Inc. Enzymes useful for changing the properties of polyester
US6933140B1 (en) 1999-11-05 2005-08-23 Genencor International, Inc. Enzymes useful for changing the properties of polyester
WO2002014490A2 (en) 2000-08-11 2002-02-21 Genencor International, Inc. Bacillus transformation, transformants and mutant libraries
US20040091994A1 (en) 2000-10-13 2004-05-13 Carsten Andersen Alpha-amylase variant with altered properties
US7498158B2 (en) * 2001-05-15 2009-03-03 Novozymes A/S Alpha-amylase variant with altered properties
WO2003014358A2 (en) * 2001-08-07 2003-02-20 Henkel Kommanditgesellschaft Auf Aktien Detergent and cleaning agent with hybrid alpha amylases
WO2004059556A2 (en) 2002-12-23 2004-07-15 Geneart Gmbh Method and device for optimizing a nucleotide sequence for the purpose of expression of a protein
WO2005056783A1 (en) 2003-12-05 2005-06-23 Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Catalytic domains of beta(1,4)-galactosyltransferase i having altered metal ion specificity
US20070004018A1 (en) 2004-05-27 2007-01-04 Nigel Dunn-Coleman Trichoderma reesei glucoamylase and homologs thereof
US20070015266A1 (en) 2004-05-27 2007-01-18 Nigel Dunn-Coleman Trichoderma reesei glucoamylase and homologs thereof
US20060094080A1 (en) 2004-05-27 2006-05-04 Nigel Dunn-Coleman Trichoderma reesei glucoamylase and homologs thereof
US20110033882A1 (en) * 2007-05-30 2011-02-10 Wolfgang Aehle Variants of the bacillus licheniformis alpha-amylase
US8058033B2 (en) 2007-11-20 2011-11-15 Danisco Us Inc. Glucoamylase variants with altered properties
WO2011080352A1 (en) * 2010-01-04 2011-07-07 Novozymes A/S Alpha-amylases
WO2011080353A1 (en) 2010-01-04 2011-07-07 Novozymes A/S Stabilization of alpha-amylases towards calcium depletion and acidic ph
WO2011153516A2 (en) 2010-06-03 2011-12-08 Mascoma Corporation Yeast expressing saccharolytic enzymes for consolidated bioprocessing using starch and cellulose
WO2013001078A1 (en) 2011-06-30 2013-01-03 Novozymes A/S Alpha-amylase variants
EP2726607A1 (en) 2011-06-30 2014-05-07 Novozymes A/S Alpha-amylase variants
WO2013057141A2 (en) 2011-10-17 2013-04-25 Novozymes A/S Alpha-amylase variants and polynucleotides encoding same
WO2013063460A2 (en) * 2011-10-28 2013-05-02 Danisco Us Inc. Variant maltohexaose-forming alpha-amylase variants

Non-Patent Citations (33)

* Cited by examiner, † Cited by third party
Title
"Efficient manganese catalysts for low-temperature bleaching", NATURE, vol. 369, 1994, pages 637 - 639
BOEL ET AL., EMBO J., vol. 3, 1984, pages 1097 - 1102
CAMPBELL ET AL., CURR. GENET., vol. 16, 1989, pages 53 - 56
CAO ET AL., SCIENCE, vol. 9, 2000, pages 991 - 1001
CHEN ET AL., BIOCHEM. J., vol. 301, 1994, pages 275 - 281
CHEN ET AL., PROT. ENG., vol. 8, 1995, pages 575 - 582
CHEN ET AL., PROT. ENG., vol. 9, 1996, pages 499 - 505
CHRISTOPHERSEN ET AL., STARCH, vol. 50, 1997, pages 39 - 45
DARTOIS ET AL., BIOCHEMICA ET BIOPHYSICAACTA, vol. 1131, 1993, pages 253 - 360
DATABASE Geneseq [online] 1 September 2011 (2011-09-01), "Cytophaga sp. calcium-sensitive alpha-amylase, SEQ ID 30.", XP055074244, retrieved from EBI accession no. GSP:AZK99874 Database accession no. AZK99874 *
DATABASE Geneseq [online] 10 May 2003 (2003-05-10), "Bacillus alpha-amylase fusion protein ALA34-84 SEQ ID NO 14.", retrieved from EBI accession no. GSP:ABP60493 Database accession no. ABP60493 *
DECLERCK N ET AL: "Probing structural determinants specifying high thermostability in Bacillus licheniformis alpha-amylase", JOURNAL OF MOLECULAR BIOLOGY, ACADEMIC PRESS, UNITED KINGDOM, vol. 301, no. 4, 25 August 2000 (2000-08-25), pages 1041 - 1057, XP004461752, ISSN: 0022-2836, DOI: 10.1006/JMBI.2000.4025 *
FIEROBE ET AL., BIOCHEMISTRY, vol. 35, 1996, pages 8698 - 8704
FOGARTY ET AL., PROGRESS IN INDUSTRIAL MICROBIOLOGY, vol. 15, 1979, pages 112 - 115
HARRISON, APPLIED ENVIRON. MICROBIOL., vol. 77, June 2011 (2011-06-01), pages 3916 - 22
J.A. RADLEY: "STARCH AND ITS DERIVATIVES", 1968, CHAPMAN AND HALL, pages: 194 - 201
JEANG,C-L ET AL., APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 68, 2002, pages 3651 - 54
JOHN ET AL.: "Direct lactic acid fermentation: focus on simultaneous saccharification and lactic acid production", BIOTECHNOL. ADV., vol. 27, no. 2, 2009, pages 145 - 52
LI, PROTEIN ENG., vol. 10, 1997, pages 1199 - 1204
LING ET AL., APPL. ENVIRON. MICROBIOL., vol. 68, no. 7, 2002, pages 3651 - 3654
LIU ET AL., SHENG WU GONG CHENG XUE BAO, vol. 27, no. 7, 2011, pages 1049 - 56
LIU ET AL.: "Improved heterologous gene expression in Trichoderma reesei by cellobiohydrolase I gene (cbhl) promoter optimization", ACTA BIOCHIM. BIOPHYS. SIN (SHANGHAI, vol. 40, no. 2, 2008, pages 158 - 65
MCKENZIE ET AL., PLASMID, vol. 15, 1986, pages 93 - 103
PAPAGIANNI: "Advances in citric acid fermentation by Aspergillus niger: biochemical aspects, membrane transport and modeling", BIOTECHNOL. ADV., vol. 25, no. 3, 2007, pages 244 - 63
RONG-JEN ET AL., APPL. ENVIRON. MICROBIOL., vol. 69, no. 4, 2003, pages 2383 - 2385
SAMBROOK: "MOLECULAR CLONING: A LABORATORY MANUAL, 2d ed.,", 1989, COLD SPRING HARBOR
SHIAU, R-J. ET AL., APPLIED AND ENVIRONMENTAL MICROBIOLOGY, vol. 69, 2003, pages 2383 - 85
SOLINGEN ET AL., EXTREMOPHILES, vol. 5, 2001, pages 333 - 341
SUMITANI ET AL., BIOCHEM. J., vol. 350, 2000, pages 477 - 484
SUMITANI ET AL.: "New type of starch-binding domain: the direct repeat motif in the C-terminal region of Bacillus sp. 195 a-amylase contributes to starch binding and raw starch degrading", BIOCHEM. J., vol. 350, 2000, pages 477 - 484
SUZUKI ET AL., J. BIOL. CHEM., vol. 264, 1989, pages 18933 - 938
THOMPSON ET AL., NUCLEIC ACIDS RES., vol. 22, 1994, pages 4673 - 4680
WOLFGANG KUNZE: "Technology Brewing and Malting, 3rd edition.", 2004, RESEARCH AND TEACHING INSTITUTE OF BREWING

Cited By (229)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014183921A1 (en) 2013-05-17 2014-11-20 Novozymes A/S Polypeptides having alpha amylase activity
EP3786269A1 (en) 2013-06-06 2021-03-03 Novozymes A/S Alpha-amylase variants and polynucleotides encoding same
EP3613853A1 (en) 2013-07-29 2020-02-26 Novozymes A/S Protease variants and polynucleotides encoding same
EP3611260A1 (en) 2013-07-29 2020-02-19 Novozymes A/S Protease variants and polynucleotides encoding same
EP3309249A1 (en) 2013-07-29 2018-04-18 Novozymes A/S Protease variants and polynucleotides encoding same
WO2015121134A1 (en) * 2014-02-11 2015-08-20 Novozymes A/S Detergent composition, method and use of detergent composition
WO2015150457A1 (en) 2014-04-01 2015-10-08 Novozymes A/S Polypeptides having alpha amylase activity
CN106103708A (en) * 2014-04-01 2016-11-09 诺维信公司 There is the polypeptide of alpha amylase activity
EP3134521B1 (en) 2014-04-25 2020-10-28 Basf Se Amylase variants
WO2015189371A1 (en) 2014-06-12 2015-12-17 Novozymes A/S Alpha-amylase variants and polynucleotides encoding same
EP3739029A1 (en) 2014-07-04 2020-11-18 Novozymes A/S Subtilase variants and polynucleotides encoding same
EP3878960A1 (en) 2014-07-04 2021-09-15 Novozymes A/S Subtilase variants and polynucleotides encoding same
WO2016079110A2 (en) 2014-11-19 2016-05-26 Novozymes A/S Use of enzyme for cleaning
EP3690037A1 (en) 2014-12-04 2020-08-05 Novozymes A/S Subtilase variants and polynucleotides encoding same
WO2016096996A1 (en) 2014-12-16 2016-06-23 Novozymes A/S Polypeptides having n-acetyl glucosamine oxidase activity
EP3741848A2 (en) 2014-12-19 2020-11-25 Novozymes A/S Protease variants and polynucleotides encoding same
EP3741849A2 (en) 2014-12-19 2020-11-25 Novozymes A/S Protease variants and polynucleotides encoding same
EP3872174A1 (en) 2015-05-13 2021-09-01 Danisco US Inc. Aprl-clade protease variants and uses thereof
EP4219704A2 (en) 2015-05-13 2023-08-02 Danisco US Inc Aprl-clade protease variants and uses thereof
EP3287513A1 (en) 2015-06-04 2018-02-28 The Procter & Gamble Company Hand dishwashing liquid detergent composition
US10377973B2 (en) 2015-06-04 2019-08-13 The Procter & Gamble Company Hand dishwashing liquid detergent composition
US10377974B2 (en) 2015-06-04 2019-08-13 The Procter & Gamble Company Hand dishwashing liquid detergent composition
EP3101108A1 (en) 2015-06-04 2016-12-07 The Procter and Gamble Company Hand dishwashing liquid detergent composition
EP3101109A1 (en) 2015-06-04 2016-12-07 The Procter and Gamble Company Hand dishwashing liquid detergent composition
WO2016196874A1 (en) 2015-06-04 2016-12-08 The Procter & Gamble Company Hand dishwashing liquid detergent composition
WO2016196872A1 (en) 2015-06-04 2016-12-08 The Procter & Gamble Company Hand dishwashing liquid detergent composition
EP3284811A1 (en) 2015-06-04 2018-02-21 The Procter & Gamble Company Hand dishwashing liquid detergent composition
WO2016201044A1 (en) 2015-06-09 2016-12-15 Danisco Us Inc Osmotic burst encapsulates
WO2016201040A1 (en) 2015-06-09 2016-12-15 Danisco Us Inc. Water-triggered enzyme suspension
WO2016201069A1 (en) 2015-06-09 2016-12-15 Danisco Us Inc Low-density enzyme-containing particles
EP4234693A2 (en) 2015-06-17 2023-08-30 Danisco US Inc Bacillus gibsonii-clade serine proteases
WO2016205755A1 (en) 2015-06-17 2016-12-22 Danisco Us Inc. Bacillus gibsonii-clade serine proteases
WO2016202785A1 (en) 2015-06-17 2016-12-22 Novozymes A/S Container
EP3872175A1 (en) 2015-06-18 2021-09-01 Novozymes A/S Subtilase variants and polynucleotides encoding same
EP4071244A1 (en) 2015-06-18 2022-10-12 Novozymes A/S Subtilase variants and polynucleotides encoding same
WO2016135351A1 (en) 2015-06-30 2016-09-01 Novozymes A/S Laundry detergent composition, method for washing and use of composition
WO2017046260A1 (en) 2015-09-17 2017-03-23 Novozymes A/S Polypeptides having xanthan degrading activity and polynucleotides encoding same
WO2017046232A1 (en) 2015-09-17 2017-03-23 Henkel Ag & Co. Kgaa Detergent compositions comprising polypeptides having xanthan degrading activity
EP3957711A2 (en) 2015-10-28 2022-02-23 Novozymes A/S Detergent composition comprising amylase and protease variants
WO2017079756A1 (en) 2015-11-05 2017-05-11 Danisco Us Inc Paenibacillus and bacillus spp. mannanases
EP4141113A1 (en) 2015-11-05 2023-03-01 Danisco US Inc Paenibacillus sp. mannanases
WO2017079751A1 (en) 2015-11-05 2017-05-11 Danisco Us Inc Paenibacillus sp. mannanases
US11920170B2 (en) 2015-12-09 2024-03-05 Danisco Us Inc. Alpha-amylase combinatorial variants
EP3901257A1 (en) * 2015-12-09 2021-10-27 Danisco US Inc. Alpha-amylase combinatorial variants
EP3387124B1 (en) * 2015-12-09 2021-05-19 Danisco US Inc. Alpha-amylase combinatorial variants
WO2017100720A1 (en) * 2015-12-09 2017-06-15 Danisco Us Inc. Alpha-amylase combinatorial variants
WO2017106676A1 (en) 2015-12-18 2017-06-22 Danisco Us Inc Polypeptides with endoglucanase activity and uses thereof
WO2017129754A1 (en) 2016-01-29 2017-08-03 Novozymes A/S Beta-glucanase variants and polynucleotides encoding same
WO2017144008A1 (en) * 2016-02-26 2017-08-31 南京百斯杰生物工程有限公司 Αlpha amylase variant and use thereof
CN108699544A (en) * 2016-02-26 2018-10-23 南京百斯杰生物工程有限公司 Alpha-amylase variants and its application
US11104909B2 (en) 2016-02-26 2021-08-31 Nanjing Bestzyme Bio-Engineering Co., Ltd. α-amylase variant and use thereof
CN108699544B (en) * 2016-02-26 2021-10-26 南京百斯杰生物工程有限公司 Alpha-amylase variants and uses thereof
WO2017174769A2 (en) 2016-04-08 2017-10-12 Novozymes A/S Detergent compositions and uses of the same
WO2017192692A1 (en) 2016-05-03 2017-11-09 Danisco Us Inc Protease variants and uses thereof
EP3845642A1 (en) 2016-05-05 2021-07-07 Danisco US Inc. Protease variants and uses thereof
WO2017192300A1 (en) 2016-05-05 2017-11-09 Danisco Us Inc Protease variants and uses thereof
WO2017210295A1 (en) 2016-05-31 2017-12-07 Danisco Us Inc. Protease variants and uses thereof
WO2017207762A1 (en) 2016-06-03 2017-12-07 Novozymes A/S Subtilase variants and polynucleotides encoding same
WO2017219011A1 (en) 2016-06-17 2017-12-21 Danisco Us Inc Protease variants and uses thereof
EP4151726A1 (en) 2016-06-17 2023-03-22 Danisco US Inc Protease variants and uses thereof
WO2017220422A1 (en) 2016-06-23 2017-12-28 Novozymes A/S Use of enzymes, composition and method for removing soil
WO2018001959A1 (en) 2016-06-30 2018-01-04 Novozymes A/S Lipase variants and compositions comprising surfactant and lipase variant
EP3284805A1 (en) 2016-08-17 2018-02-21 The Procter & Gamble Company Cleaning composition comprising enzymes
WO2018034842A1 (en) 2016-08-17 2018-02-22 The Procter & Gamble Company Cleaning composition comprising enzymes
WO2018060216A1 (en) 2016-09-29 2018-04-05 Novozymes A/S Use of enzyme for washing, method for washing and warewashing composition
WO2018085524A2 (en) 2016-11-07 2018-05-11 Danisco Us Inc Laundry detergent composition
WO2018099762A1 (en) 2016-12-01 2018-06-07 Basf Se Stabilization of enzymes in compositions
WO2018108865A1 (en) 2016-12-12 2018-06-21 Novozymes A/S Use of polypeptides
WO2018112123A1 (en) 2016-12-15 2018-06-21 Danisco Us Inc. Polypeptides with endoglucanase activity and uses thereof
WO2018118917A1 (en) 2016-12-21 2018-06-28 Danisco Us Inc. Protease variants and uses thereof
EP4212622A2 (en) 2016-12-21 2023-07-19 Danisco US Inc. Bacillus gibsonii-clade serine proteases
EP4424805A2 (en) 2016-12-21 2024-09-04 Danisco Us Inc Bacillus gibsonii-clade serine proteases
WO2018118950A1 (en) 2016-12-21 2018-06-28 Danisco Us Inc. Bacillus gibsonii-clade serine proteases
WO2018169750A1 (en) 2017-03-15 2018-09-20 Danisco Us Inc Trypsin-like serine proteases and uses thereof
WO2018184004A1 (en) 2017-03-31 2018-10-04 Danisco Us Inc Alpha-amylase combinatorial variants
WO2018178061A1 (en) 2017-03-31 2018-10-04 Novozymes A/S Polypeptides having rnase activity
WO2018177936A1 (en) 2017-03-31 2018-10-04 Novozymes A/S Polypeptides having dnase activity
WO2018183662A1 (en) 2017-03-31 2018-10-04 Danisco Us Inc Delayed release enzyme formulations for bleach-containing detergents
WO2018185048A1 (en) 2017-04-03 2018-10-11 Novozymes A/S Recovery process
WO2018185152A1 (en) 2017-04-04 2018-10-11 Novozymes A/S Polypeptide compositions and uses thereof
WO2018185181A1 (en) 2017-04-04 2018-10-11 Novozymes A/S Glycosyl hydrolases
WO2018185280A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Cleaning compositions and uses thereof
WO2018185267A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Cleaning compositions and uses thereof
EP3967756A1 (en) 2017-04-06 2022-03-16 Novozymes A/S Detergent compositions and uses thereof
WO2018184873A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Detergent compositions and uses thereof
WO2018185269A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Cleaning compositions and uses thereof
WO2018184816A1 (en) 2017-04-06 2018-10-11 Novozymes A/S Cleaning compositions and uses thereof
WO2018206535A1 (en) 2017-05-08 2018-11-15 Novozymes A/S Carbohydrate-binding domain and polynucleotides encoding the same
WO2018206178A1 (en) 2017-05-08 2018-11-15 Henkel Ag & Co. Kgaa Detergent composition comprising polypeptide comprising carbohydrate-binding domain
EP3401385A1 (en) 2017-05-08 2018-11-14 Henkel AG & Co. KGaA Detergent composition comprising polypeptide comprising carbohydrate-binding domain
WO2019006077A1 (en) 2017-06-30 2019-01-03 Danisco Us Inc Low-agglomeration, enzyme-containing particles
WO2019036721A2 (en) 2017-08-18 2019-02-21 Danisco Us Inc Alpha-amylase variants
WO2019057758A1 (en) 2017-09-20 2019-03-28 Novozymes A/S Use of enzymes for improving water absorption and/or whiteness
WO2019086528A1 (en) 2017-11-01 2019-05-09 Novozymes A/S Polypeptides and compositions comprising such polypeptides
EP4379029A1 (en) 2017-11-01 2024-06-05 Novozymes A/S Polypeptides and compositions comprising such polypeptides
WO2019086532A1 (en) 2017-11-01 2019-05-09 Novozymes A/S Methods for cleaning medical devices
WO2019086530A1 (en) 2017-11-01 2019-05-09 Novozymes A/S Polypeptides and compositions comprising such polypeptides
WO2019105781A1 (en) 2017-11-29 2019-06-06 Basf Se Storage-stable enzyme preparations, their production and use
WO2019108599A1 (en) 2017-11-29 2019-06-06 Danisco Us Inc Subtilisin variants having improved stability
WO2019125683A1 (en) 2017-12-21 2019-06-27 Danisco Us Inc Enzyme-containing, hot-melt granules comprising a thermotolerant desiccant
WO2019156670A1 (en) 2018-02-08 2019-08-15 Danisco Us Inc. Thermally-resistant wax matrix particles for enzyme encapsulation
EP3783102A4 (en) * 2018-03-21 2022-02-23 Feed Research Institute, Chinese Academy of Agricultural Sciences Amylase mutant having high specific activity and thermal stability, gene of mutant, and applications thereof
US11377647B2 (en) * 2018-03-21 2022-07-05 Institute Of Animal Science Of Chinese Academy Amylase mutant having high specific activity and thermal stability, gene of mutant, and applications thereof
WO2019180111A1 (en) 2018-03-23 2019-09-26 Novozymes A/S Subtilase variants and compositions comprising same
WO2019201793A1 (en) 2018-04-17 2019-10-24 Novozymes A/S Polypeptides comprising carbohydrate binding activity in detergent compositions and their use in reducing wrinkles in textile or fabric.
WO2019206994A1 (en) 2018-04-26 2019-10-31 Basf Se Lipase enzymes
WO2019211143A1 (en) 2018-05-03 2019-11-07 Basf Se Amylase enzymes
WO2019238761A1 (en) 2018-06-15 2019-12-19 Basf Se Water soluble multilayer films containing wash active chemicals and enzymes
WO2019245704A1 (en) 2018-06-19 2019-12-26 Danisco Us Inc Subtilisin variants
WO2019245705A1 (en) 2018-06-19 2019-12-26 Danisco Us Inc Subtilisin variants
WO2020002604A1 (en) 2018-06-28 2020-01-02 Novozymes A/S Detergent compositions and uses thereof
WO2020002608A1 (en) 2018-06-29 2020-01-02 Novozymes A/S Detergent compositions and uses thereof
WO2020002255A1 (en) 2018-06-29 2020-01-02 Novozymes A/S Subtilase variants and compositions comprising same
WO2020007863A1 (en) 2018-07-02 2020-01-09 Novozymes A/S Cleaning compositions and uses thereof
WO2020007875A1 (en) 2018-07-03 2020-01-09 Novozymes A/S Cleaning compositions and uses thereof
WO2020008024A1 (en) 2018-07-06 2020-01-09 Novozymes A/S Cleaning compositions and uses thereof
WO2020028443A1 (en) 2018-07-31 2020-02-06 Danisco Us Inc Variant alpha-amylases having amino acid substitutions that lower the pka of the general acid
WO2020047215A1 (en) 2018-08-30 2020-03-05 Danisco Us Inc Enzyme-containing granules
WO2020068486A1 (en) 2018-09-27 2020-04-02 Danisco Us Inc Compositions for medical instrument cleaning
WO2020070063A2 (en) 2018-10-01 2020-04-09 Novozymes A/S Detergent compositions and uses thereof
WO2020070209A1 (en) 2018-10-02 2020-04-09 Novozymes A/S Cleaning composition
WO2020070009A1 (en) 2018-10-02 2020-04-09 Novozymes A/S Endonuclease 1 ribonucleases for cleaning
WO2020070014A1 (en) 2018-10-02 2020-04-09 Novozymes A/S Cleaning composition comprising anionic surfactant and a polypeptide having rnase activity
WO2020070011A1 (en) 2018-10-02 2020-04-09 Novozymes A/S Cleaning composition
WO2020070249A1 (en) 2018-10-03 2020-04-09 Novozymes A/S Cleaning compositions
WO2020070199A1 (en) 2018-10-03 2020-04-09 Novozymes A/S Polypeptides having alpha-mannan degrading activity and polynucleotides encoding same
WO2020069915A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing hydrolases in liquids
WO2020069914A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing amylases in liquids
WO2020069913A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing hydrolases in liquids
WO2020074545A1 (en) 2018-10-11 2020-04-16 Novozymes A/S Cleaning compositions and uses thereof
WO2020077331A2 (en) 2018-10-12 2020-04-16 Danisco Us Inc Alpha-amylases with mutations that improve stability in the presence of chelants
EP3647398A1 (en) 2018-10-31 2020-05-06 Henkel AG & Co. KGaA Cleaning compositions containing dispersins v
WO2020088957A1 (en) 2018-10-31 2020-05-07 Henkel Ag & Co. Kgaa Cleaning compositions containing dispersins iv
WO2020088958A1 (en) 2018-10-31 2020-05-07 Henkel Ag & Co. Kgaa Cleaning compositions containing dispersins v
EP3647397A1 (en) 2018-10-31 2020-05-06 Henkel AG & Co. KGaA Cleaning compositions containing dispersins iv
WO2020112599A1 (en) 2018-11-28 2020-06-04 Danisco Us Inc Subtilisin variants having improved stability
WO2020114965A1 (en) 2018-12-03 2020-06-11 Novozymes A/S LOW pH POWDER DETERGENT COMPOSITION
WO2020114968A1 (en) 2018-12-03 2020-06-11 Novozymes A/S Powder detergent compositions
WO2020127796A2 (en) 2018-12-21 2020-06-25 Novozymes A/S Polypeptides having peptidoglycan degrading activity and polynucleotides encoding same
WO2020127775A1 (en) 2018-12-21 2020-06-25 Novozymes A/S Detergent pouch comprising metalloproteases
EP3677676A1 (en) 2019-01-03 2020-07-08 Basf Se Compounds stabilizing amylases in liquids
WO2020169563A1 (en) 2019-02-20 2020-08-27 Basf Se Industrial fermentation process for bacillus using defined medium and magnesium feed
WO2020169564A1 (en) 2019-02-20 2020-08-27 Basf Se Industrial fermentation process for bacillus using defined medium and trace element feed
WO2020178102A1 (en) 2019-03-01 2020-09-10 Novozymes A/S Detergent compositions comprising two proteases
EP3702452A1 (en) 2019-03-01 2020-09-02 Novozymes A/S Detergent compositions comprising two proteases
WO2020188095A1 (en) 2019-03-21 2020-09-24 Novozymes A/S Alpha-amylase variants and polynucleotides encoding same
WO2020193534A2 (en) 2019-03-25 2020-10-01 Basf Se Amylase enzymes
WO2020193532A1 (en) 2019-03-25 2020-10-01 Basf Se Cleaning composition having amylase enzymes
WO2020193535A2 (en) 2019-03-25 2020-10-01 Basf Se Amylase enzymes
WO2020229480A1 (en) 2019-05-14 2020-11-19 Basf Se Compounds stabilizing hydrolases in liquids
WO2020242858A1 (en) 2019-05-24 2020-12-03 Danisco Us Inc Subtilisin variants and methods of use
WO2020247582A1 (en) 2019-06-06 2020-12-10 Danisco Us Inc Methods and compositions for cleaning
WO2020249546A1 (en) 2019-06-13 2020-12-17 Basf Se Method of recovering a protein from fermentation broth using a divalent cation
WO2021004830A1 (en) 2019-07-05 2021-01-14 Basf Se Industrial fermentation process for microbial cells using a fed-batch pre-culture
WO2021009067A1 (en) 2019-07-12 2021-01-21 Novozymes A/S Enzymatic emulsions for detergents
WO2021032881A1 (en) 2019-08-22 2021-02-25 Basf Se Amylase variants
WO2021053127A1 (en) 2019-09-19 2021-03-25 Novozymes A/S Detergent composition
WO2021064068A1 (en) 2019-10-03 2021-04-08 Novozymes A/S Polypeptides comprising at least two carbohydrate binding domains
WO2021074430A1 (en) 2019-10-18 2021-04-22 Basf Se Storage-stable hydrolase containing liquids
WO2021080948A2 (en) 2019-10-24 2021-04-29 Danisco Us Inc Variant maltopentaose/maltohexaose-forming alpha-amylases
WO2021105336A1 (en) 2019-11-29 2021-06-03 Basf Se Compositions comprising polymer and enzyme
WO2021115912A1 (en) 2019-12-09 2021-06-17 Basf Se Formulations comprising a hydrophobically modified polyethyleneimine and one or more enzymes
WO2021123307A2 (en) 2019-12-20 2021-06-24 Novozymes A/S Polypeptides having proteolytic activity and use thereof
WO2021122118A1 (en) 2019-12-20 2021-06-24 Henkel Ag & Co. Kgaa Cleaning compositions comprising dispersins vi
WO2021122120A2 (en) 2019-12-20 2021-06-24 Henkel Ag & Co. Kgaa Cleaning compositions comprising dispersins viii
WO2021122117A1 (en) 2019-12-20 2021-06-24 Henkel Ag & Co. Kgaa Cleaning composition coprising a dispersin and a carbohydrase
WO2021121394A1 (en) 2019-12-20 2021-06-24 Novozymes A/S Stabilized liquid boron-free enzyme compositions
WO2021214059A1 (en) 2020-04-21 2021-10-28 Novozymes A/S Cleaning compositions comprising polypeptides having fructan degrading activity
WO2021239818A1 (en) 2020-05-26 2021-12-02 Novozymes A/S Subtilase variants and compositions comprising same
WO2021259099A1 (en) 2020-06-24 2021-12-30 Novozymes A/S Use of cellulases for removing dust mite from textile
EP3936593A1 (en) 2020-07-08 2022-01-12 Henkel AG & Co. KGaA Cleaning compositions and uses thereof
WO2022008387A1 (en) 2020-07-08 2022-01-13 Henkel Ag & Co. Kgaa Cleaning compositions and uses thereof
WO2022008732A1 (en) 2020-07-10 2022-01-13 Basf Se Enhancing the activity of antimicrobial preservatives
WO2022047149A1 (en) 2020-08-27 2022-03-03 Danisco Us Inc Enzymes and enzyme compositions for cleaning
WO2022043547A1 (en) 2020-08-28 2022-03-03 Novozymes A/S Protease variants with improved solubility
WO2022043563A1 (en) 2020-08-28 2022-03-03 Novozymes A/S Polyester degrading protease variants
JP7510309B2 (en) 2020-08-31 2024-07-03 花王株式会社 α-Amylase Variants
WO2022044629A1 (en) * 2020-08-31 2022-03-03 花王株式会社 α-AMYLASE VARIANT
WO2022063699A1 (en) 2020-09-22 2022-03-31 Basf Se Improved combination of protease and protease inhibitor with secondary enzyme
WO2022063698A1 (en) 2020-09-22 2022-03-31 Basf Se Liquid composition comprising peptide aldehyde
WO2022074037A2 (en) 2020-10-07 2022-04-14 Novozymes A/S Alpha-amylase variants
WO2022084303A2 (en) 2020-10-20 2022-04-28 Novozymes A/S Use of polypeptides having dnase activity
EP4015629A1 (en) 2020-12-18 2022-06-22 Basf Se Polymer mixtures for increasing stability and performance of hydrolase-containing detergents
EP4032966A1 (en) 2021-01-22 2022-07-27 Novozymes A/S Liquid enzyme composition with sulfite scavenger
WO2022157311A1 (en) 2021-01-22 2022-07-28 Novozymes A/S Liquid enzyme composition with sulfite scavenger
WO2022165107A1 (en) 2021-01-29 2022-08-04 Danisco Us Inc Compositions for cleaning and methods related thereto
WO2022171872A1 (en) 2021-02-12 2022-08-18 Novozymes A/S Stabilized biological detergents
WO2022171780A2 (en) 2021-02-12 2022-08-18 Novozymes A/S Alpha-amylase variants
WO2022175435A1 (en) 2021-02-22 2022-08-25 Basf Se Amylase variants
EP4047088A1 (en) 2021-02-22 2022-08-24 Basf Se Amylase variants
WO2022189521A1 (en) 2021-03-12 2022-09-15 Novozymes A/S Polypeptide variants
WO2022268885A1 (en) 2021-06-23 2022-12-29 Novozymes A/S Alpha-amylase polypeptides
WO2023278297A1 (en) 2021-06-30 2023-01-05 Danisco Us Inc Variant lipases and uses thereof
WO2023034486A2 (en) 2021-09-03 2023-03-09 Danisco Us Inc. Laundry compositions for cleaning
WO2023039270A2 (en) 2021-09-13 2023-03-16 Danisco Us Inc. Bioactive-containing granules
WO2023114936A2 (en) 2021-12-16 2023-06-22 Danisco Us Inc. Subtilisin variants and methods of use
WO2023114988A2 (en) 2021-12-16 2023-06-22 Danisco Us Inc. Variant maltopentaose/maltohexaose-forming alpha-amylases
WO2023114939A2 (en) 2021-12-16 2023-06-22 Danisco Us Inc. Subtilisin variants and methods of use
WO2023114932A2 (en) 2021-12-16 2023-06-22 Danisco Us Inc. Subtilisin variants and methods of use
WO2023118015A1 (en) 2021-12-21 2023-06-29 Basf Se Environmental attributes for care composition ingredients
EP4206309A1 (en) 2021-12-30 2023-07-05 Novozymes A/S Protein particles with improved whiteness
WO2023126254A1 (en) 2021-12-30 2023-07-06 Novozymes A/S Protein particles with improved whiteness
WO2023168234A1 (en) 2022-03-01 2023-09-07 Danisco Us Inc. Enzymes and enzyme compositions for cleaning
WO2023165507A1 (en) 2022-03-02 2023-09-07 Novozymes A/S Use of xyloglucanase for improvement of sustainability of detergents
WO2023225459A2 (en) 2022-05-14 2023-11-23 Novozymes A/S Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections
WO2023250301A1 (en) 2022-06-21 2023-12-28 Danisco Us Inc. Methods and compositions for cleaning comprising a polypeptide having thermolysin activity
WO2024012894A1 (en) 2022-07-15 2024-01-18 Basf Se Alkanolamine formates for enzyme stabilization in liquid formulations
WO2024033135A2 (en) 2022-08-11 2024-02-15 Basf Se Amylase variants
WO2024033136A1 (en) 2022-08-11 2024-02-15 Basf Se Amylase variants
WO2024050339A1 (en) 2022-09-02 2024-03-07 Danisco Us Inc. Mannanase variants and methods of use
WO2024050343A1 (en) 2022-09-02 2024-03-07 Danisco Us Inc. Subtilisin variants and methods related thereto
WO2024050346A1 (en) 2022-09-02 2024-03-07 Danisco Us Inc. Detergent compositions and methods related thereto
WO2024094735A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024094732A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024094733A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024102698A1 (en) 2022-11-09 2024-05-16 Danisco Us Inc. Subtilisin variants and methods of use
WO2024121070A1 (en) 2022-12-05 2024-06-13 Novozymes A/S Protease variants and polynucleotides encoding same
WO2024137246A1 (en) 2022-12-19 2024-06-27 Novozymes A/S Carbohydrate esterase family 1 (ce1) polypeptides having ferulic acid esterase and/or acetyl xylan esterase activity and polynucleotides encoding same
WO2024137250A1 (en) 2022-12-19 2024-06-27 Novozymes A/S Carbohydrate esterase family 3 (ce3) polypeptides having acetyl xylan esterase activity and polynucleotides encoding same
WO2024137252A1 (en) 2022-12-19 2024-06-27 Novozymes A/S Process for reducing syrup viscosity in the backend of a process for producing a fermentation product
WO2024137248A1 (en) 2022-12-19 2024-06-27 Novozymes A/S Compositions comprising arabinofuranosidases and a xylanase, and use thereof for increasing hemicellulosic fiber solubilization
WO2024132625A1 (en) 2022-12-20 2024-06-27 Basf Se Cutinases
EP4389864A1 (en) 2022-12-20 2024-06-26 Basf Se Cutinases
WO2024131880A2 (en) 2022-12-23 2024-06-27 Novozymes A/S Detergent composition comprising catalase and amylase
WO2024156628A1 (en) 2023-01-23 2024-08-02 Novozymes A/S Cleaning compositions and uses thereof
WO2024163584A1 (en) 2023-02-01 2024-08-08 Danisco Us Inc. Subtilisin variants and methods of use
EP4410938A1 (en) 2023-02-02 2024-08-07 AMSilk GmbH Automatic dishwashing composition comprising a structural polypeptide
WO2024186819A1 (en) 2023-03-06 2024-09-12 Danisco Us Inc. Subtilisin variants and methods of use
WO2024191711A1 (en) 2023-03-16 2024-09-19 Nutrition & Biosciences USA 4, Inc. Brevibacillus fermentate extracts for cleaning and malodor control and use thereof

Also Published As

Publication number Publication date
ES2905323T3 (en) 2022-04-07
EP4026902A1 (en) 2022-07-13
EP2859097B9 (en) 2023-03-08
EP4389885A3 (en) 2024-07-17
DK3967757T3 (en) 2024-04-22
CA2874061A1 (en) 2014-01-09
EP2825643B1 (en) 2021-11-03
EP2859097A1 (en) 2015-04-15
DK3967757T5 (en) 2024-08-05
EP3967757B1 (en) 2024-01-31
ES2978034T3 (en) 2024-09-04
WO2014007921A1 (en) 2014-01-09
CN104379738A (en) 2015-02-25
BR112014030449A2 (en) 2017-09-12
DK2859097T1 (en) 2021-10-04
HUE058058T2 (en) 2022-07-28
DK2859097T3 (en) 2021-11-08
DK2825643T3 (en) 2021-11-08
HUE057894T2 (en) 2022-06-28
DK2825643T1 (en) 2021-10-04
US20170037387A1 (en) 2017-02-09
EP2825643A1 (en) 2015-01-21
CN104379737B (en) 2018-10-23
EP3967757A1 (en) 2022-03-16
DK202000115Y3 (en) 2021-04-09
EP4389885A2 (en) 2024-06-26
EP2859097B1 (en) 2021-11-03
CA2874198A1 (en) 2013-12-12
ES2909509T3 (en) 2022-05-06
HUE067114T2 (en) 2024-09-28
DK202000115U1 (en) 2020-12-02
US20150141316A1 (en) 2015-05-21
CN104379737A (en) 2015-02-25
US20150152401A1 (en) 2015-06-04

Similar Documents

Publication Publication Date Title
US11898177B2 (en) Variant maltohexaose-forming alpha-amylase variants
EP3967757B1 (en) Alpha-amylase variants derived from the alpha amylase of cytophaga sp. amylase (cspamy2).
EP3071691B1 (en) Variant alpha-amylases having reduced susceptibility to protease cleavage, and methods of use, thereof
EP2970931A1 (en) Alpha-amylase combinatorial variants
EP2935575A1 (en) Alpha-amylase variants
EP3060659B1 (en) Alpha-amylases from exiguobacterium, and methods of use, thereof
EP3052622B1 (en) Alpha-amylases from a subset of exiguobacterium, and methods of use, thereof
WO2014200656A1 (en) Alpha-amylase from streptomyces umbrinus
EP2922951B1 (en) Amylase with maltogenic properties
US20160130571A1 (en) Alpha-Amylase from Bacillaceae Family Member
WO2014200658A1 (en) Alpha-amylase from promicromonospora vindobonensis
WO2014200657A1 (en) Alpha-amylase from streptomyces xiamenensis

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13729864

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2013729864

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2874198

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 14406494

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014030449

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014030449

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20141204