WO2012175741A2 - Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains - Google Patents
Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains Download PDFInfo
- Publication number
- WO2012175741A2 WO2012175741A2 PCT/EP2012/062251 EP2012062251W WO2012175741A2 WO 2012175741 A2 WO2012175741 A2 WO 2012175741A2 EP 2012062251 W EP2012062251 W EP 2012062251W WO 2012175741 A2 WO2012175741 A2 WO 2012175741A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- isv
- nanobody
- protein
- polypeptide
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2875—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins
- C07K16/4283—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an allotypic or isotypic determinant on Ig
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/5306—Improving reaction conditions, e.g. reduction of non-specific binding, promotion of specific binding
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54393—Improving reaction conditions or stability, e.g. by coating or irradiation of surface, by reduction of non-specific binding, by promotion of specific binding
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
- G01N33/6857—Antibody fragments
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the present invention relates to the field of immunoglobulin single variable domains.
- immunoglobulin single variable domain or "IS V” is generally defined herein as an amino acid sequence that:
- an immunoglobulin fold i.e., by folding
- an immunoglobulin variable domain such as, for example, a VH, VL or
- an immunoglobulin variable domain that comprises a functional antigen binding site (in the sense that it does not require an interaction with another immunoglobulin variable domain (such as a VH-
- VHH's and/or (other) Nanobodies, dAb's and (single) domain antibodies are examples of immunoglobulin single variable domains that are currently known in the art.
- VHH's and/or (other) Nanobodies, dAb's and (single) domain antibodies are examples of immunoglobulin single variable domains that are currently known in the art.
- various Nanobodies are in phase I and phase II clinical trials. This makes it important to have available reliable assays for analyzing biological samples from people that are treated with ISV's (such as clinical trial subjects and, after such ISV's reach the market, patients that are treated with such ISV's).
- ADA assay formats such as "ELISA-bridging format”, “ELISA-Direct Format”, “Indirect Format”, Radio Immuno-precipitation Assay (RIP), “Surface Plasmon Resonance” and “Electrochemiluminescence-Bridging Format”.
- ELISA-bridging format such as "ELISA-bridging format”
- ELISA-Direct Format such as "ELISA-Direct Format”
- Indirect Format such as "Exdirect Format”
- RIP Radio Immuno-precipitation Assay
- ADA assay formats are also schematically shown in Figures 1 A to 1C.
- the ISV is used as the "analytical agent” (i.e., as the compound used to detect whether any ADA's are present in the sample that is tested), and the ADA's are the "antigen” (i.e., the compound to be detected in the sample that is tested).
- the ISV will usually/often be bound to the carrier (such as the ELISA plate), whereas the ADA's (if any) will be present in the sample that is subjected to the assay.
- the ISV will usually be used as the "antigen” (i.e., as the compound to be detected), and an antibody (which is as further described herein) is used as the "analytical agent” (i.e., as a means to detect whether a given ISV binds or not, respectively; and thus has a high or increased risk of giving rise to protein interference or not, respectively).
- the antibody used as analytical agent (which is also referred to herein as the "analytical antibody”) will usually be bound to the carrier (i.e., to the ELISA plate) and the ISV will be (present in) the sample to be tested.
- the invention is not limited to assays in which the "analytical antibody” is bound to the carrier.
- the analytical antibody is instead used as a bridging agent and thus will be in solution rather than bound to the plate (although it is indirectly bound to the plate via the IS V that is coated on the plate).
- the analytical antibody is still used as the analytical agent (i.e., to determine whether the ISV of interest binds or not, respectively; and thus has a high or increased risk of giving rise to protein interference or not, respectively). It is also envisaged that, based on the further disclosure herein, the skilled person will be able to design other assay formats in which the analytical antibody can be used as an analytical agent in order to determine whether a given ISV can bind or not, respectively; and thus has a high or increased risk of giving rise to protein interference or not).
- immunoglobulin variable domain forms a hydrophobic patch that in an antibody is buried in the interface between the variable domain and the constant domain but that becomes solvent- exposed when the variable domain is not associated with a constant domain (Nieba et al., Protein Engineering, 10, 435-444 (1997)). It has also been described that the exposed C- terminus may form B-cell epitopes which can give rise to and/or interact with (emerging and/or pre-existing) anti-drug antibodies (WO 11/07586), the presence of which can then be determined using the ADA assays referred to above.
- variable domain may have a tendency or risk to undergo such protein interference in an ADA assay, to easily test (proposed) modifications to a variable domain in order to predict whether any such (proposed) modifications will reduce or essentially completely avoid such protein
- the present invention also describes a number of modifications that can be made to variable domains in order to reduce or essentially avoid such protein interference.
- this modification involves adding a limited number (as further described herein) of amino acid residues (as further described herein) to the C-terminal end of the variable domain.
- variable domain including, without limitation, a V H H domain
- VH domain in order to "camelize" a VH domain
- variable domains that is not linked to or otherwise associated with a constant domain (or with another group or peptide moiety that functions to "shield", cover or “bury” the C- terminal region of the variable domain) and more generally to any variable domain that has a C-terminal regions that is solvent-exposed.
- the methods, assays and modifications may in particular be applied to heavy chain variable domains (VH domains), and according to one specific aspect of the invention to VH H domains.
- the methods, assays and modifications described herein can be suitably applied to protein constructs that contain one or more variable domains, and in particular to such constructs in which a variable domain forms the C-terminal part of the construct or, in the case of the methods and assays described herein, in which the C-terminal region of a variable domain is otherwise solvent-exposed.
- the methods, assays and modifications are applied to constructs in which a VH domain (and in particular a V H H domain) forms the C-terminal part of the construct or, in case of the methods and assays of the invention, is otherwise solvent- exposed.
- Such constructs are multivalent, multispecific (such as bispecific) or multiparatopic (such as biparatopic) constructs that contain two or more ISV's linked directly or via one or more suitable linkers (with again, according to one specific aspect, a V H or V H H domain) forming the C-terminal part of such a construct.
- a V H or V H H domain may be entirely comprised of VH domains, and in particular of Nanobodies (i.e. VHH domains, humanized VHH domains or camelized VH domains), again linked directly or via one or more suitable linkers.
- the invention can be applied to other constructs which have a solvent-exposed variable domain and in particular have a variable domain at their C-terminus, such as for example single chain Fv's, and in particular ScFv's that have their heavy chain variable domain at the C-terminus.
- an ISV as described herein may in particular either be a Nanobody or an(other) ISV (i.e. other than a Nanobody) that is a VH domain or that comprises a VH domain; and is preferably a Nanobody.
- any protein or polypeptide that comprises an ISV preferably has said (or at least one) such ISV at its C-terminal end.
- said ISV may in particular either be a Nanobody or an(other) ISV (i.e. other than a Nanobody) that is a VH domain or that comprises a VH domain; and is preferably a Nanobody.
- VH domains including human VH domains
- Nanobodies such as VHH domains (including humanized and sequence optimized VHH domains) or camelized VH domains.
- VHH domains including humanized and sequence optimized VHH domains
- camelized VH domains may be synthetic (for example, obtained starting from a synthetic library and/or based on a fixed framework regions), semi-synthetic (for example, humanized, camelized or sequence-optimized, or obtained by affinity maturation or CDR grafting, starting from a natural VH or VHH domain) or fully naturally occurring VH or VHH domains.
- the invention will therefore be further described herein with reference to ISV's that are, are based on and/or have been derived from VH or VHH domains.
- protein interference may occur, and that such protein interference may give rise to an aspecific signal in some of these assays and/or in some of these samples.
- Such protein interference may occur not only in samples that were obtained from subjects that have been treated with ISV's (and in particular with Nanobodies; or with proteins, polypeptides or other biological drugs that comprise at least one such ISV or Nanobody) and/or to whom the same have been administered (such as patients or clinical trial subjects), but also in samples from subjects that have never received an ISV (indicating that such interference is likely due to an aspecific protein-protein interaction with pre-existing proteins rather than any emerging ADA' S).
- the invention provides, and in certain specific but non-limiting aspects relates to: - assays that can be used to predict whether a given ISV will be subject to such protein interference and/or give rise to such an (aspecific) signal in such an assay (such as for example in an ADA immunoassay).
- Such predictive assays could for example be used to test whether a given ISV could have a tendency to give rise to such protein interference and/or such a signal; to select ISV's that are not or less prone to such protein interference or to giving such a signal; as an assay or test that can be used to test whether certain modification(s) to an ISV will (fully or partially) reduce its tendency to give rise to such interference or such a signal; and/or as an assay or test that can be used to guide modification or improvement of an ISV so as to reduce its tendency to give rise to such protein interference or signal;
- ISV's that have been specifically selected (for example, using the assay(s) described herein) to have no or low(er)/reduced tendency to give rise to such protein interference or such a signal;
- modified and/or improved ISV's that have no or a low(er)/reduced tendency to give rise to such protein interference or such a signal.
- the invention relates to a method that can be used to predict whether a given ISV or Nanobody (or ISV-based or Nanobody-based drug) will give rise to (or has an high or increased risk of giving rise to) protein interference in an immunoassay (i.e., after it has been administered to a subject, a sample of a biological fluid has been obtained from said subject, and said sample is subjected to an immunoassay as further described herein), said method comprising performing an immunoassay that at least comprises the steps of:
- said ISV, Nanobody, ISV-based drug or Nanobody-based drug may be modified or improved so as to reduce or remove its tendency to give rise to such protein interference (which may again be determined using the assay above), and some strategies that can be used to modify said ISV, Nanobody, ISV-based drug or Nanobody-based drag will be described herein (and for example include attaching a small number of amino acid residues to the C-terminal end and/or introducing one or more specific amino acid substitutions).
- the invention makes available to the skilled person assays and methods/techniques that can be used to predict the tendency of an ISV, Nanobody, ISV-based drag or Nanobody-based drug to give rise to protein interference and/or as a tool to improve ISVs so as to reduce or avoid their tendency to give rise to protein interference.
- the invention also provides the skilled person with means to select ISVs, Nanobodies, ISV- based drugs or Nanobody-based drugs based on their low or reduced ability (or the absence of any ability) to give rise to protein interference.
- the invention provides the skilled person with an important assay and tool that can be used in the optimization and development of ISVs, Nanobodies, ISV-based drags or Nanobody-based drags.
- the invention teaches the skilled person a number of ways in which an ISV, Nanobody, ISV-based drug or Nanobody-based drug can be modified or improved so as to reduce or avoid their tendency to give rise to protein interference.
- the invention also generally makes available modified and/or improved ISVs, Nanobodies, ISV-based drugs or Nanobody-based drugs with a reduced, low or without any tendency to give rise to protein interference.
- the invention can in particular be used to predict whether a given ISV or Nanobody (or ISV-based or Nanobody-based drug) will give rise to protein interference (as further described herein) in an immunoassay, and more in particular in an ADA assay.
- Said ADA assay may for example be an ADA assay for detecting or measuring ADA's against ISV's generally, and may in particular be an ADA assay for detecting or measuring ADA's against the ISV used in steps (i) and (ii) above.
- an ISV as described herein may in particular either be a Nanobody or an(other) ISV (i.e. other than a Nanobody) that is a VH domain or that comprises a VH domain; and is preferably a Nanobody.
- any protein or polypeptide that comprises an ISV preferably has said (or at least one) such ISV at its C-tenninal end.
- said ISV may in particular either be a Nanobody or an(other) ISV (i.e. other than a Nanobody) that is a VH domain or that comprises a VH domain; and is preferably a Nanobody.
- test sample or "assay sample”.
- biological sample that is used herein as a starting material for obtaining the (polyclonal or monoclonal) "analytical antibody” used in the invention.
- the invention can be used to predict whether a given ISV or Nanobody (or ISV-based or Nanobody-based drug) will give rise to protein interference (as further described herein) in an immunoassay (and in particular, in an ADA assay) that involves the use of such an ISV.
- said ADA assay may for example be an ADA assay for detecting or measuring ADA's against ISV's generally, and may in particular be an ADA assay for detecting or measuring ADA's against the ISV used in steps (i) and (ii) above.
- the invention can be used to predict whether a given ISV or Nanobody (or ISV-based or Nanobody-based drug) will give rise to protein interference (as further described herein) in an immunoassay (and in particular, in an ADA assay) that is intended to determine or measure whether the sample contains any ADA's against the ISV.
- such an immunoassay may be one of the known types of ADA assay (for which reference is for example made to the prior art on ADA assays cited herein) that is performed to determine or measure whether any ADA's against said ISV are present in the "test sample", wherein said test sample is a sample of biological fluid (as described herein) that is obtained from a subject to which said ISV has been administered (as further described herein).
- the invention can also be used to select ISV's that are not or less prone to such protein interference in such immunoassays or ADA assays; as an assay or test that can be used to test whether certain modification(s) to an ISV will (fully or partially) reduce its tendency to give rise to such interference in such immunoassays or ADA assays; and/or as an assay or test that can be used to guide modification or improvement of an ISV so as to reduce its tendency to give rise to such protein interference in such immunoassays or ADA assays.
- Nanobody is generally as defined in or WO 08/020079 or WO 09/138519, and thus in a specific aspect generally denotes a VHH, a humanized VHH or a camelized VH (such as a camelized human VH) or generally a sequence optimized VHH (such as e.g. optimized for chemical stability and/or solubility, maximum overlap with known human framework regions and maximum expression).
- the terms Nanobody or Nanobodies are registered trademarks of Ablynx N.V. and thus may also be referred to as Nanobody® and/or Nanobodies®);
- ISV in its broadest sense also includes “ISV-based biologicals” and, when the ISV is a Nanobody, “Nanobody-based biologicals".
- An "ISV-based biological” is defined herein as a protein, polypeptide or other biological drug that comprises or essentially consist of at least one (such as one, two or three) ISV's.
- a “Nanobody-based biological” is defined as a protein, polypeptide or other biological drug that comprises or essentially consist of at least one (such as one, two or three) Nanobodies.
- ISV whenever the term "ISV-based biological” is used, it should be understood that such an ISV-based biological is preferably a Nanobody-based biological.
- an "ISV-based biological” and a “Nanobody-based biological” may for example be a monovalent, bivalent (or multivalent), bispecific (or multispecific), and biparatopic (or “multiparatopic) ISV construct or Nanobody construct, respectively.
- any ISV-based or Nanobody-based biological may for example, in addition to the one or more (such as one, two or three) ISV's or Nanobodies, optionally further comprise one or more (such as one or two) other further therapeutic moieties and/or one or more (such as one or two) other moieties that influence the pharmacokinetic or pharmacodynamic properties of the ISV-based or Nanobody-based biological (such as its half-life).
- An ISV- based biological or Nanobody-based biological is preferably a therapeutic or intended for use as a therapeutic (which includes prophylaxis and diagnosis) and for this purpose preferably contains at least one ISV against a therapeutically relevant target (such as for example RANK-L, vWF, IgE, RSV, CXCR4, IL-23 or other interleuldns, etc.).
- a therapeutically relevant target such as for example RANK-L, vWF, IgE, RSV, CXCR4, IL-23 or other interleuldns, etc.
- half-life as used herein relation to an ISV, Nanobody, ISV-based biological, Nanobody-based biological or any other amino acid sequence, compound or polypeptide can generally be defined as described in paragraph o) on page 57 of WO
- 08/020079 refers to the time taken for the serum concentration of the amino acid sequence, compound or polypeptide to be reduced by 50%, in vivo, for example due to degradation of the sequence or compound and/or clearance or sequestration of the sequence or compound by natural mechanisms.
- the in vivo half-life of an amino acid sequence, compound or polypeptide of the invention can be determined in any manner known per se, such as by pharmacokinetic analysis. Suitable techniques will be clear to the person skilled in the art, and may for example generally be as described in paragraph o) on page 57 of WO 08/020079.
- the half- life can be expressed using parameters such as the tl/2-alpha, tl/2-beta and the area under the curve (AUC).
- AUC area under the curve
- amino acid residues of a Nanobody are numbered according to the general numbering for VH domains given by Kabat et al. ("Sequence of proteins of immunological interest", US Public Health Services, NIH Bethesda, MD, Publication No. 91), as applied to VHH domains from Camelids in the article of Riechmann and
- FRl of a Nanobody comprises the amino acid residues at positions 1-30
- CDR1 of a Nanobody comprises the amino acid residues at positions 31-35
- FR2 of a Nanobody comprises the amino acids at positions 36-49
- CDR2 of a Nanobody comprises the amino acid residues at positions 50-65
- FR3 of a Nanobody comprises the amino acid residues at positions 66-94
- CDR3 of a Nanobody comprises the amino acid residues at positions 95-102
- FR4 of a Nanobody comprises the amino acid residues at positions 103-1 13.
- the total number of amino acid residues in each of the CDR's may vary and may not correspond to the total number of amino acid residues indicated by the Kabat numbering (that is, one or more positions according to the Kabat numbering may not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than the number allowed for by the Kabat numbering).
- the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence.
- position 1 according to the Kabat numbering corresponds to the start of FRl and vice versa
- position 36 according to the Kabat numbering corresponds to the start of FR2 and vice versa
- position 66 according to the Kabat numbering corresponds to the start of FR3 and vice versa
- position 103 according to the Kabat numbering corresponds to the start of FR4 and vice versa.
- the present invention is not specifically limited to any causation, explanation, hypothesis or mechanism of/for the protein interference (and/or signals arising in immunoassays) that is observed in, and that may be reduced according to, the present invention.
- the blood or serum (or other biological fluids, such as those mentioned herein) of certain individuals or groups of individuals may contain certain (pre-existing) proteins that under certain circumstances may (aspecifically) bind to ISV's leading to a interfering signal in certain assays that are used to analyze blood or serum samples obtained from such individuals.
- the aspecific protein interference that is addressed by the present invention not only occurs when assaying samples that have been obtained from subjects to which an ISV has previously been administered, but also when assaying sample that have been obtained from subjects that have not previously received an ISV.
- the present invention can in particular be used to reduce or avoid protein interference and/or signals due to aspecific binding in immunoassays that are performed on biological samples (such as blood or serum samples) obtained from a subject to whom a (biological) drug has been administered (again, such samples are also referred to herein as the "test sample” or "assay sample”).
- biological samples such as blood or serum samples
- test sample or “assay sample”
- immunoassay sample Some examples of this are immunoassays that are used for characterization of drug disposition and of the formation of antibodies upon administration of a biological drug to a subject, such as those referred to in the ' "Guideline on the Clinical Investigation of the Pharmacokinetics of Therapeutic Proteins" (document
- CHMP/EWP/89249/2004 dated January 27, 2007 issued by the Committee for Medicinal Products for Human Use (CHMP) of the European Medicines Agency (EMEA).
- CHMP Committee for Medicinal Products for Human Use
- EMEA European Medicines Agency
- the invention can in particular be used in order to predict, reduce or avoid this type of interference in immunoassays that are used in analyzing test samples/assay samples of biological fluids taken from subjects to whom ISV's (and in particular Nanobodies; or an ISV-based biological or Nanobody-based biological, as further defined herein) have been administered.
- the invention can in particular be used in order to predict, reduce or avoid this type (aspecific) protein interference in immunoassays that are used for characterization of drug disposition and/or for determining the formation of any ADA's (anti-drug) antibodies.
- this does not only include predicting, reduce or avoiding such protein interference per se, but also generally predicting, reduce or avoiding the occurrence of aspecific signals in immunoassays (such as those in which (aspecific) signals associated with protein interference may occur, for example in ADA assays), and in particular predicting, reduce or avoiding, in such immunoassays, the occurrence of aspecific signals that, when they are observed in such an assay, are usually attributed to, associated with and/or taken as a sign of (aspecific) protein interference.
- the present invention is not specifically limited to any causation
- the invention can be used to predict, avoid or reduce such protein interference in "anti-drug antibody” or "ADA” assays that are performed on samples (i.e., “test samples”) of biological fluids taken from subjects to whom ISV's (and in particular Nanobodies; or an ISV-based biological or Nanobody-based biological, as further defined herein) have been administered.
- samples i.e., “test samples”
- ISV's and in particular Nanobodies; or an ISV-based biological or Nanobody-based biological, as further defined herein
- the invention can be used to predict, avoid or reduce such protein interference (and/or aspecific signals usually associated with the same) in "anti-drug antibody” or "ADA” assays that are used to detect, measure and/or characterize the presence of (any) anti-drug antibodies against one or more ISV's (and in particular against Nanobodies; or an ISV-based biological or Nanobody-based biological, as further defined herein).
- the invention can be used to predict, avoid or reduce such protein interference in such "anti-drug antibody” or "ADA” assays that are performed on samples (i.e., "test samples") of biological fluids, and more in particular on samples of biological fluids of that have been obtained from a subject to whom one or more such ISV's or Nanobodies (or an ISV-based biological or Nanobody-based biological, as further defined herein) have been administered.
- the invention can be used to predict, avoid or reduce such protein interference in such "anti-drug antibody” or "ADA” assays that are used to detect, measure and/or characterize the presence of (any) anti-drug antibodies against the ISV or Nanobody (or an ISV-based biological or Nanobody-based biological, as further defined herein) that has been administered to the subject from which the sample has been obtained (either in the context of a clinical trial and/or in the context of therapy).
- anti-drug antibody or “ADA” assays that are used to detect, measure and/or characterize the presence of (any) anti-drug antibodies against the ISV or Nanobody (or an ISV-based biological or Nanobody-based biological, as further defined herein) that has been administered to the subject from which the sample has been obtained (either in the context of a clinical trial and/or in the context of therapy).
- the invention can be used to predict, avoid or reduce such protein interference (and/or aspecific signals usually associated with the same) in biological samples (i.e., "test samples") obtained from a subject to whom one or more such ISV's or Nanobodies (or an ISV-based biological or Nanobody-based biological, as further defined herein) have been administered, wherein said samples as suitable for and/or intended for use in an immunological assay, such as an ADA assay.
- biological samples i.e., "test samples”
- test samples obtained from a subject to whom one or more such ISV's or Nanobodies (or an ISV-based biological or Nanobody-based biological, as further defined herein) have been administered, wherein said samples as suitable for and/or intended for use in an immunological assay, such as an ADA assay.
- such a biological sample may be blood (including whole blood, serum or plasma), ocular fluid, bronchoalveolar fluid/BALF, cerebrospinal fluid or any other suitable biological fluid or sample that is suitable for use in an immunoassay, and in particular an ADA assay.
- such a test sample may have been obtained from a subject that has been subjected to multiple administrations (for example at least 1 to 3 separate administrations over a period of at least 10 days, such as at least one month or longer) and/or to chronic treatment (i.e. treatment during at least 10 days such as at least one month) with an ISV, Nanobody, an ISV-based biological (as further defined herein) or Nanobody-based biological (as further defined herein).
- Such an ISV, Nanobody, ISV-based biological or Nanobody-based biological may for example have been administered to said subject in the context of therapy or in the context of a clinical trial.
- such a test sample may have been obtained from a subject to which a ISV, Nanobody, ISV-based biological or Nanobody-based biological has been administered that has (and/or has been provided with) an increased half- life (as defined herein, and compared to a monovalent ISV), for example a half-life of at least 1 day, preferably at least 3 days, more preferably at least 7 days, such as at least 10 days in the subject to which the same is/has been administered.
- an increased half- life as defined herein, and compared to a monovalent ISV
- such an ISV, Nanobody, ISV-based biological or Nanobody-based biological may have been provided with an increased half-life by functionalization and/or by including in the construct a moiety or binding unit that increases the half-life of the construct.
- functionalization, moieties or binding units will be clear to the skilled person and may for example be as described herein, and for example may include pegylation, fusion to serum albumin, or fusion to a peptide or binding unit that can bind to a serum protein such as serum albumin.
- Such a serum-albumin binding peptide or binding domain may be any suitable serum-albumin binding peptide or binding domain capable of increasing the half-life of the constmct (compared to the same construct without the serum-albumin binding peptide or binding domain), and may in particular be serum albumin binding peptides as described in WO 2008/068280 by applicant (and in particular WO 2009/127691 and the non-prepublished US application 61/301 ,819, both by applicant), or a serum-albumin binding ISV (such as a serum-albumin binding Nanobody; for example Alb-1 or a humanized version of Alb-1 such as Alb-8, for which reference is for example made to WO 06/122787).
- such a biological sample may have been obtained from a subject to which an ISV, Nanobody, ISV-based biological or Nanobody- based biological has been administered that comprises a (human) serum albumin-binding binding peptide or binding domain.
- the invention generally relates to a method that can be used to predict whether a given ISV or Nanobody (or ISV- based or Nanobody-based drug) will give rise to (or has high or increased tendency to give rise to) protein interference (as further described herein) in an immunoassay (i.e. after said ISV has been administered to a subject, a sample of a biological fluid has been obtained from said subject, and said biological fluid is subjected to an immunoassay as further described herein), said method comprising performing an immunoassay that at least comprises the steps of:
- an ISV as described herein may in particular either be a Nanobody or an(other) ISV (i.e. other than a Nanobody) that is a VH domain or that comprises a VH domain; and is preferably a Nanobody.
- any protein or polypeptide that comprises an ISV preferably has said (or at least one) such ISV at its C-terminal end.
- said ISV may in particular either be a Nanobody or an(other) ISV (i.e. other than a Nanobody) that is a VH domain or that comprises a VH domain; and is preferably a Nanobody.
- the monoclonal antibody referred to herein as "21-4-3" (or “21-4" for short, see SEQ ID NO's 35 and 36 for the VH and VL sequences) may be used.
- 21-4 was generated using hybridoma technology starting from a mouse immunized with the Nanobody construct of SEQ ID NO:98 in WO 2006/122825, as further described in Example 7, and a hybridoma cell line (called "ABH0015”) expressing 21-4 has been deposited on June 4, 2012 with the BCCM, Ghent, Belgium, under accession number LMBP-9680-CB.
- Monoclonal 21-4 has been shown to recognize the C-terminus the Nanobody construct of SEQ ID NO:98 in WO 2006/122825, which C-terminal end consists of a Nanobody (humanized VHH) raised against Von Willebrand Factor (vWF).
- vWF Von Willebrand Factor
- 21-4 was originally raised as analytical reagent for use in detecting the protein Nanobodies (n particular, the Nanobody construct of SEQ ID NO:98 in WO 2006/122825) in (serum) samples; surprisingly, it has now been found that 21-4 can also be used in order to predict whether an ISV has a tendency to undergo aspecific protein interference (more so than some other, comparable (mouse) monoclonals raised against the Nanobody construct of SEQ ID NO:98 in WO 2006/122825 or against other Nanobodies).
- MW may be calculated as the sum of all the MW's of all the amino acid residues present in the ISV.
- any ISV, protein or polypeptide described herein preferably has such an RU value for binding by 21-4 of less than 500 (determined according to the protocol set out in Example 9, and after adjusting the measured RU value for the molecular weight of the ISV or protein used according to the formula set out above).
- this aspect of the invention generally relates to a method that can be used to predict whether a given ISV or Nanobody (or ISV-based or Nanobody-based drug) will give rise to (or has high or increased tendency to give rise to) protein interference (as further described herein) in an immunoassay (i.e. after said ISV has been administered to a subject, a sample of a biological fluid has been obtained from said subject, and said biological fluid is subjected to an immunoassay as further described herein), said method comprising performing an immunoassay that at least comprises the steps of:
- Said method may in particular be performed using BiaCore or a similar technique, and more in particular using the protocol set out in Example 9.
- the binding of the ISV or ISV-based drug in this protocol shows an RU value of less than 500 (after adjusting the measured RU value for the molecular weight to the protein, according to the formula [RU measured]/[MW of the protein] x 10 6 )
- said ISV or ISV-based protein will likely not be bound by any interference factor(s) present in the blood or serum of a human being and/or will likely not have a tendency to undergo aspecific protein interference in an ADA assay (i.e. within the degrees of confidence set out in the experimental part below).
- an ISV as described herein may in particular either be a Nanobody or an(other) ISV (i.e. other than a Nanobody) that is a VH domain or that comprises a VH domain; and is preferably a Nanobody.
- any protein or polypeptide that comprises an ISV preferably has said (or at least one) such ISV at its C-terminal end.
- said ISV may in particular either be a Nanobody or an(other) ISV (i.e. other than a Nanobody) that is a VH domain or that comprises a VH domain; and is preferably a Nanobody.
- the above method using 21-4 can also be used to determine whether an ISV or protein or polypeptide that comprises a ISV is bound by (or has a tendency to be bound by) interference factor(s) that are present in the blood or serum of a human being.
- said method using 21-4 can also be used to predict whether any protein or polypeptide (such as an antibody fragment or ScFv) that has a VH domain at its C-terminal end will bound by (or has a tendency to be bound by) interference factor(s) that are present in the blood or serum of a human being and/or has a tendency to undergo protein interference in an ADA assay.
- an antibody or antibody fragment such as a suitable Fab fragment that contains the heavy chain and light chain variable domains of 21-4 (see SEQ ID NO's: 35 and 36, respectively) or even only the CDR sequences of 21-4
- VH and VK frameworks may also be used in the methods described herein.
- the invention can in particular be used to predict whether a given ISV or Nanobody (or ISV-based or Nanobody-based drug) will give rise to protein interference (as further described herein) in an immunoassay that is an ADA assay.
- Said ADA assay may for example be an ADA assay for detecting or measuring ADA's against ISV's generally, and may in particular be an ADA assay for detecting or measuring ADA's against the ISV used in steps (i) and (ii) above.
- the invention can be used to predict whether a given ISV or Nanobody (or ISV-based or Nanobody-based drug) will give rise to protein interference (as further described herein) in an immunoassay (and in particular, in an ADA assay) that involves the use of such an ISV.
- said ADA assay may for example be an ADA assay for detecting or measuring ADA's against ISV's generally, and may in particular be an ADA assay for detecting or measuring ADA's against the ISV used in steps (i) and (ii) above.
- the invention can be used to predict whether a given ISV or Nanobody (or ISV-based or Nanobody-based drug) will give rise to protein interference (as further described herein) in an immunoassay (and in particular, in an ADA assay) that involves the use of such an ISV.
- an immunoassay may be an ADA assay (i.e. involving the ISV) that is performed to determine or measure whether any ADA's against said ISV are present in the sample that is tested, wherein said sample is a sample of biological fluid (as described herein) that is obtained from a subject to which said ISV has been administered (as further described herein).
- said sample i.e., the "test sample” may be a sample of (including whole blood, serum or plasma), ocular fluid, bronchoalveolar fluid/BALF, cerebrospinal fluid or any other suitable biological fluid, and may in particular be a biological sample that is suitable for and/or intended for use in an immunological assay, such as an ADA assay.
- the invention can also be used to select ISV's that are not or less prone to such protein interference in such immunoassays or ADA assays; as an assay or test that can be used to test whether certain modification(s) to an ISV will (fully or partially) reduce its tendency to give rise to such interference in such immunoassays or ADA assays; and/or as an assay or test that can be used to guide modification or improvement of an ISV so as to reduce its tendency to give rise to such protein interference in such immunoassays or ADA assays.
- step (i) of the method of the invention comprises contacting said ISV or Nanobody (or ISV-based or Nanobody-based drug) with an antibody that has been obtained from a human subject and that has been selected/isolated based on its ability to recognize and/or bind to the C-terminal end of an ISV or Nanobody (as further described herein).
- said ISV or Nanobody (or ISV-based or Nanobody-based drug) is used as the antigen in the immunoassay (i.e. as the substance to be detected).
- the "antibody that has been obtained from a human subject and that has been selected/isolated based on its ability to recognize and/or bind to the C-terminal end of an ISV or Nanobody” is used as the analytical reagent (i.e. in the same way as other antibodies are used in immunoassays to detect the presence of an antigen to which they are directed).
- the ISV will usually be used as the "antigen” ⁇ i.e., as the compound to be detected), and the “analytical antibody” will be used as the analytical agent (i.e., as a means to detect whether a given ISV binds or not, respectively; and thus has a high or increased risk of giving rise to protein interference or not, respectively).
- the "antibody/analytical agent” will usually be bound to the earner (i.e., to the ELISA plate) and the ISV will be (present in) the sample to be tested.
- the ISV is used as the "analytical agent” (i.e., as the compound used to detect whether any ADA's are present), and the ADA's are the "antigen” (i.e., the compound to be detected).
- the ISV will usually/often be bound to the carrier (such as the ELISA plate), whereas the ADA's (if any) will be present in the sample that is subjected to the assay.
- the invention is not limited to assays in which the "analytical antibody" is bound to the carrier.
- the analytical antibody is instead used as a bridging agent and thus will be in solution rather than bound to the plate (although it is indirectly bound to the plate via the ISV that is coated on the plate).
- the analytical antibody is still used as the analytical agent (i.e., to determine whether the ISV of interest binds or not, respectively; and thus has a high or increased risk of giving rise to protein interference or not, respectively).
- the "analytical antibody” used in step (i) may be a polyclonal or monoclonal antibody.
- the analytical antibody is a polyclonal antibody
- it may for example be a polyclonal antibody (preparation) that has been obtained/purified/isolated from a biological sample obtained of a human subject (such as blood, plasma, B-cells or another suitable biological sample or fluid from which polyclonal antibodies can be suitably isolated).
- a biological sample obtained of a human subject such as blood, plasma, B-cells or another suitable biological sample or fluid from which polyclonal antibodies can be suitably isolated.
- This may for example be a suitable biological sample that has been obtained of a human subject to which at least one ISV (such as the ISV used in step (i), but this is not required or essential) has been administered, but may also be (and preferably is) a suitable biological sample from a human subject which has never received or been treated with an ISV.
- the polyclonal antibody has been obtained from said biological sample by a method that involves at least one affinity step using an affinity matrix or column that carries an ISV as the affinity moiety (and one or more further steps for obtaining/purifying/isolating polyclonal antibodies known per se).
- the polyclonal antibody may have been obtained from such a biological sample by means of affinity chromatography using an affinity column that carries an ISV, as for example described in Example 2. This may for example be performed using well known techniques for immunoaffinity chromatography for isolating antibodies from a biological sample, using an affinity matrix that carries an ISV as the antigen. Such techniques are generally known in the art and suitable examples thereof will be clear to the skilled person based on the disclosure herein.
- Such a polyclonal antibody may in particular be an IgG (or IgG fraction).
- it may be a polyclonal antibody that has been obtained means of a method that involves (immuno) affinity chromatography, performed on a sample of biological fluid obtained from a human subject, using as the antigen bound to the affinity matrix an ISV (and in particular a Nanobody, such as a VHH, humanized and/or sequence-optimized VHH or a camelized VH, such as a camelized human VH) that does not contain a C-terminal tag ⁇ i.e., of which the C-terminus ends with the amino acid sequence VTVSS (SEQ ID NO:33)).
- the ISV used as the antigen bound to the affinity matrix may be a humanized or sequence-optimized VHH (or alternatively a corresponding camelized human VH) of which the C-terminus ends with the amino acid sequence VTVSS (SEQ ID NO:33).
- the ISV used as the antigen bound to the affinity matrix may be a humanized or sequence-optimized VHH that, as a result of such humanization or sequence- optimization, comprises a proline (P) residue at position 14 where the corresponding "na ' ive" VHH comprises an alanine (A) at position 14 (in other words, the ISV used as the antigen is a humanized version of a VHH that naturally comprises an alanine at position 14, which alanine residue, as a result of the humanization and/or sequence optimization, has been replaced with a proline (P) residue).
- the ISV used as the antigen may also comprise one or more other amino acid substitutions as a result of such humanization or sequence
- IS Vs that can be used as the antigen to generate/isolate the "analytical antibody” used in the invention are given in SEQ ID NO's: 1 and 2.
- the method used to obtain the polyclonal antibody may, in addition to the (immune)affinity steps, also comprise one or more further steps for isolating/purifying a polyclonal antibody from the biological sample (performed either before or after the affinity steps). Again, such steps and techniques for performing them will be clear to the skilled person.
- the invention comprises a method as further described herein that comprises steps (i) and (ii) described herein, in which the "analytical antibody” (i.e., the antibody that has been obtained from a human subject and that has been selected/isolated based on its ability to recognize and/or bind to the C-terminal end of an ISV or Nanobody) has been obtained from a biological sample obtained from a human subject (wherein said biological sample is a sample that is suitable for use in a method for generating/isolating an antibody from said sample) using a method that comprises at least one affinity step (such as a step of affinity chromatography, such as immunoaffmity chromatography) in which an ISV (and preferably a Nanobody) is used as an antigen, and preferably an ISV is used as an antigen that comprises the amino acid sequence VTVSS (SEQ ID NO:33) as the C-terminal sequence, and more preferably a humanized and/or sequence optimized Nanobody is used as the antigen that comprises
- Nanobody is used as the antigen that comprises the amino acid sequence VTVSS (SEQ ID NO:33) as the C-terminal sequence and that comprises a proline residue at position 14, such as a Nanobody that comprises the amino acid sequence VTVSS (SEQ ID NO:33) as the C- terminal sequence and that comprises a proline residue at position 14 that has been introduced into the Nanobody as a result of said humanization and/or sequence-optimization (for example, to replace an alanine residue that naturally occurs at said position in the VHH that has been humanized and/or sequence optimized).
- ISV's can also be used in methods to isolate monoclonal antibodies (again starting from a suitable biological sample obtained from a human being) that are suitable for use in the invention as the "analytical antibody”.
- such a monoclonal antibody may be obtained starting from blood, B- cells or another suitable sample or material for isolating antibodies, may be selected based on its ability to recognize and/or bind to (the C-terminal end of) an ISV or Nanobody (in which, again, the ISV(s) used as the antigen during screening and/or selection is preferably as described in the preceding paragraphs, including the preferences stated for such ISV/antigen).
- Such screening and selection may be performed in any suitable manner, for example by using B-cell selection and/or expansion techniques essentially the same or suitably similar to the B- cell selection techniques described in EP 0 488 470, WO 92/02551, EP 1 633 787, WO 01/55216, WO 02/26829, WO 04/051268, WO 04/102198 or WO 04/106377 or techniques similar to the Nanoclone technique described in WO 06/079372 (but using human B-cells rather than camelid B-cells).
- said antibody may be isolated, expressed and/or produced in any suitable manner.
- said B-cell(s) may be immortalized as hybridomas producing the desired antibody/antibodies (using techniques well known per se for generating hybridomas starting from selected B-cells), and said antibody/antibodies may then be isolated from (the culture supernatant of) said hybridoma(s), again using suitable techniques well established in the art and described in various handbooks and manuals, and also described and/or referred to in the patent publications mentioned in the preceding paragraph.
- said B-cell(s) may be expanded using B-cell expansion techniques known per se, and the antibody/antibodies may be isolated from (the culture supernatant of) said expanded B-cell(s). Again, this may be performed using suitable techniques well established in the art and described in various handbooks and manuals, and also described and/or referred to in the patent publications mentioned in the preceding paragraphs.
- DNA encoding the antibody/antibodies of interest may be obtained (e.g., by amplification) from said B-cell(s) or other suitable cells, either directly (for example using suitable single-cell PCR cloning techniques) or after suitable expansion of the desired B-cell(s). Said DNA may then be suitably expressed in a suitable host cell or host organism to provide the desired antibody/antibodies. Again, this may be performed using suitable techniques well established in the art and described in various handbooks and manuals, and also described and/or referred to in the patent publications mentioned in the preceding paragraphs.
- the biological sample that is used as a starting point for obtaining the (polyclonal or monoclonal) analytical antibody may be any suitable sample (i.e. suitable as a starting material for obtaining a polyclonal or monoclonal antibody, respectively) obtained from any suitable human subject.
- a sample may for example have been obtained from a woman, and in particular a post-menopausal woman.
- the analytical antibody used in steps (i) and (ii) above has been obtained starting from a biological sample that has been obtained/ derived from a post-menopausal woman (or has been derived from an antibody that has been obtained/derived from a post-menopausal woman).
- polyclonal or monoclonal analytical antibody may be obtained from a subject to whom an ISV has previously been administered (for example, as part of a clinical trial or
- the invention is not particularly limited to the source of the analytical antibody/antibodies used, and it has proven possible in some cases, using the techniques described herein, to obtain (generate, isolate) other suitable analytical antibodies from other sources, including commercially available human blood or plasma (and even blood, plasma or B-cells from other species of mammals or primates, such as from baboon or cynomolgus monkey).
- the (polyclonal or monoclonal) analytical antibody used in steps (i) and (ii) should be such that it is capable of recognizing or binding to the C-terminal end of an ISV or Nanobody, and is most preferably selected and/or isolated based on this ability to bind to the C-terminal end of an ISV or Nanobody.
- the C-terminal end of an ISV comprises the amino acid sequence VTVSS (SEQ ID NO:33), and accordingly the analytical antibody should be capable of recognizing any ISV that has the amino acid sequence VTVSS (SEQ ID NO:33) at its C-terminal end.
- (at least some of the amino acid residues in) the sequence VTVSS is part of a putative epitope on the ISV that also includes, among other residues, the amino acid residue at position 14 (and the amino acid residues next/close to the same in the amino acid sequence, such as positions 11, 13 and 15) and may also comprise the amino acid residue at position 83 (and the amino acid residues next/ close to the same in the amino acid sequence, such as positions 82, 82a, 82b and 84) and/or the amino acid residue at position 108 (and the amino acid residues next/close to the same in the amino acid sequence, such as positions 107.
- Position 109 is the first V of the C-terminal VTVSS (SEQ ID NO:33) sequence and it has been shown that for example position 1 10 may have an influence on protein interference as well).
- This is also collectively referred to herein as the "C-terminal region", it being understood that this C-terminal region at least comprises the C- terminal sequence VTVSS (SEQ ID NO:33) and the amino acid residue at position 14, and may also comprise the amino acid residues at positions 83 and 108, and possibly also the amino acid residues at positions 13, 15, 82b, 83, 84 and 107.
- this C-terminal epitope is available for (aspecific) interaction with other proteins, and again without being limited to any hypothesis or explanation, it is assumed that this C-terminal region may now be accessible to undergo an (aspecific) protein interaction with one or more proteins that are pre-existing in the "test sample" (for example, one or more IgG's) to be tested and that this may cause protein interference and/or aspecific signals in the immunoassays (and in particular in ADA assays).
- test sample for example, one or more IgG's
- the methods described herein can be used to predict, reduce or avoid such protein interaction, and can also be used as a tool to guide modification to the ISV, Nanobody, ISV-based drug or Nanobody-based drug so as to provide the same with a (partially or preferably essentially fully) reduced tendency to give rise to such protein interference.
- the present invention also teaches certain modifications that can be introduced for this purpose in the C-terminal region of an ISV, Nanobody, ISV-based drug or Nanobody-based drug (of which the (potential) effectiveness can be tested using the methods described herein). Also, based on the teaching herein, it is envisaged that the skilled person will be able to choose, design or propose other (candidate) modifications to the C-terminal region that could be introduced for this purpose (and of which the (potential) effectiveness can again be tested using the methods described herein).
- this is preferably a
- the "analytical antibody” may be a polyclonal or monoclonal that recognizes (and/or is capable of binding to, and in particular of specific binding to) the C-terminal region of an ISV or Nanobody of which the C-terminal end of the sequence ends with VTVSS (SEQ ID NO:33), but does not recognize (and/or is not capable of specific binding to) the C-terminal region of an ISV or Nanobody (which may be a different ISV but is preferably the same ISV) when there are one or more further amino acid residues (such as 1 to 5 amino acid residues, or alternatively a small peptide sequence or even another polypeptide or protein) linked to the C-terminal VTVSS (SEQ ID NO:33).
- the "analytical antibody” may be a polyclonal or monoclonal that recognizes (and/or is capable of binding to, and in particular of specific binding to) the C-terminal region of an ISV or Nanobody of which the C-terminal end of the sequence ends with VTVSS (SEQ ID NO:33) and in which position 14 is an amino acid that does not naturally occur at position 14 and/or has been modified compared to the amino acid that naturally occurs at position 14 (for example as a result of humanization, camelization and/or sequence optimization), but that does not recognize (and/or is not capable of specific binding to) the C-terminal region of an ISV or Nanobody (which may be a different ISV but is preferably the same ISV) in which there are one or more further amino acid residues (such as 1 to 5 amino acid residues, or alternatively a small peptide sequence or even another polypeptide or protein) linked to the C-terminal VTVSS (SEQ ID NO:33); and
- the "analytical antibody” may also be a polyclonal or monoclonal that recognizes (and/or is capable of binding to, and in particular of specific binding to) the C- terminal region of an ISV or Nanobody of which the C-terminal end of the sequence ends with VTVSS (SEQ ID NO:33) and in which position 14 is proline (and in particular when position 14 has been modified to proline, for example as a result of humanization, camelization and/or sequence optimization), but does not recognize the C-terminal region of an ISV or Nanobody (which may be a different ISV but is preferably the same ISV) in which there are one or more further amino acid residues (such as 1 to 5 amino acid residues, or alternatively a small peptide sequence or even another polypeptide or protein) linked to the C-terminal VTVSS (SEQ ID NO:33); and/or in which position 14 is alanine.
- an ISV or Nanobody which may be a different ISV but is preferably the same ISV
- the “analytical antibody” may also be a polyclonal or monoclonal that recognizes (and/or is capable of binding to, and in particular of specific binding to) the C-terminal region of an ISV or Nanobody of which the C-terminal end of the sequence ends with VTVSS (SEQ ID NO:33) and in which position 14 is proline (in particular where a proline residue naturally occurs at said position in said ISV), but does not recognize the C-terminal region of an ISV or Nanobody (which may be a different ISV but is preferably the same ISV) in which there are one or more further amino acid residues (such as 1 to 5 amino acid residues, or alternatively a small peptide sequence or even another polypeptide or protein) linked to the C-terminal
- VTVSS (SEQ ID NO:33) in which position 14 is still a (naturally occurring or unmodified) proline.
- the “analytical antibody” may also for example be a polyclonal or monoclonal that recognizes (the C-terminal region of) the sequence of the ISV called "Nb 3.4" herein (SEQ ID NO: 5) but does not recognize (the C-terminal region of) the sequence of the ISV called “Nb 3.1” herein (SEQ ID NO: 3) and/or (and preferably and) does not recognize the sequence of the ISV called "Nb 3.2" herein (SEQ ID NO: 4).
- an “analytical antibody” does (or does not) recognize an ISV or Nanobody (and/or is or is not capable of (specifically) binding to an ISV or Nanobody) can be determined using any suitable binding assay (such as Biacore), but may also be determined using either the BIACORE assay described in example 3 or an ADA assay such as the ADA bridging/competition assay described in Example 5 (See also Figure 1A to 1C and in particular Figure IB).
- a colorimetric assay such as ELISA with analytical antibody coated directly or indirectly to the plate and detection of bound ISV with monoclonal or polyclonal anti-ISV antibody.
- Other useful alternative technologies for this setup include but are not limited to electrochemiluminescence (the MSD platform), Fluorescence (DELFIA, GYROS), and other methods that rely on secondary detection of the bound ISV.
- a Surface Plasmon Resonance such as BIACORE or other real-time biosensor method (i.e. other than using SPR) with directly or indirectly immobilized analytical antibody and monitoring the binding of subsequently injected/administered ISV. These methods do not need further detection of the bound ISV.
- a representative method for performing this type is assay is described in Example 3.
- ADA assay a bridging assay
- the analytical antibody instead of ADA containing biological fluid.
- ADA assay a bridging assay
- the bridging assay one can make use of different technologies such as ELISA, the MSD platform.
- said analytical antibody can be used to determine whether a given ISV or Nanobody (or ISV- based or Nanobody-based drug) will give rise to (or has high or increased tendency to give rise to) protein interference (as defined herein), i.e. by performing steps (i) and (ii) described above.
- this generally involves contacting said ISV, Nanobody, ISV-based drug or Nanobody-based drug with the analytical antibody and determining whether said ISV, Nanobody, ISV-based drug or Nanobody-based drug is recognized by (and/or is bound by, and in particular specifically bound by) said analytical antibody (and in particular whether the C-terminal region of said ISV or Nanobody or of any ISV or
- Nanobody that forms the C-terminal end of said ISV-based drug or Nanobody-based drug is recognized by said analytical antibody).
- suitable ELISA techniques including for example sandwich ELISA' s); in which, depending on the ELISA format used (as will be clear to the skilled person), either the analytical antibody or the ISV may be coated on the plate and either the analytical antibody or the ISV may be detectably labeled.
- Other techniques may for example involve the use of a BIAcore instrument (in which again either the analytical antibody or the ISV may be coated on the chip, see for example Example 3).
- Another alternative may be a competitive bridging assay (as for example exemplified in Example 5), in which the ability is tested of the ISV to compete with another ISV, Nanobody, ISV-based drug or Nanobody-based drug that is known to be bound by the analytical antibody (or visa versa).
- a competitive bridging assay as for example exemplified in Example 5
- the ability is tested of the ISV to compete with another ISV, Nanobody, ISV-based drug or Nanobody-based drug that is known to be bound by the analytical antibody (or visa versa).
- the present invention can be used to determine whether or not a given ISV, Nanobody, ISV-based drug or Nanobody-based drug contains an interaction site (such as an interaction site present at or within the C-terminal region, and/or of which the C-terminal region forms part) that is capable of undergoing an (aspecific) protein interaction with one or more proteins or other components that may be present in a biological sample (i.e., a "test sample") obtained from a subject that is to be subjected to an immunoassay such as an ADA assay (in particular, an ADA assay for determining the presence of any ADA's against the ISV, Nanobody, ISV-based drug or Nanobody-based drug).
- an interaction site such as an interaction site present at or within the C-terminal region, and/or of which the C-terminal region forms part
- an immunoassay such as an ADA assay (in particular, an ADA assay for determining the presence of any ADA's against the ISV, Nanobody, ISV-based drug
- an ISV, Nanobody, ISV-based drug or Nanobody-based drug is recognized by the analytical antibody used in the invention, it is very likely that said ISV, Nanobody, ISV-based drug or Nanobody-based drug contains such an (accessible or exposed) interaction site, and thus will have a tendency to give rise to such protein interference (as defined herein) when it is used in such an immunoassay or ADA assay for testing the test sample.
- such a modification may for example comprise making one or more modifications (such as amino acid insertions, additions, deletions or substitutions) to the interaction site on the ISV, Nanobody, ISV-based drug or Nanobody-based drug, such that its ability to undergo an (aspecific) protein interaction with one or more proteins or other components that may be present in a test sample will be reduced or removed.
- modifications such as amino acid insertions, additions, deletions or substitutions
- this can be performed by limited trial and error by introducing one or more modifications and then testing whether this ability has been reduced or not, again using the method and analytical antibody disclosed herein.
- one or more such modifications may be introduced, and then the ability of the modified ISV to bind to the analytical antibody may be compared to that of the
- this interaction site is likely located at/near the C-terminal region (as defined herein) or that said interaction site forms part of the C-terminal region (or that the C-terminal region forms part of this interaction site).
- VTVSS (SEQ ID NO:33)
- SEQ ID NO:33 may be any suitable amino acid(s) or combination of amino acids, which may each be independently chosen from any naturally occurring amino acids such as those listed in Table A-2 on page 64 of WO 09/138519, for example and without limitation from alanine, glycine, valine, leucine or isoleucine
- the invention relates to a VHH, a Nanobody (as defined herein, and in particular a humanized VHH or a camelized VH, such as a camelized human VH) or another ISV (or ISV-based drug or Nanobody-based drug with a VHH, Nanobody or other ISV at its C-terminal end) that has been modified (for example, by introducing one or more amino acid substitutions, additions or deletions), and in particular modified in the C-terminal regions (such as by one or more amino acid substitutions or additions in the C-terminal region), such that (i) it has a substantially reduced tendency (such as at least a statistically relevant reduced tendency) to give rise to protein interference (as defined herein); and/or such that (ii) it has, in the method of the invention described herein (such as in the specific assay described in Example 3 or 5), substantially reduced ability to be bound by an analytical antibody as described herein (such as the polyclonal antibody described in Example 2 and used in Examples 3
- the invention relates to a VHH, a Nanobody (as defined herein, and in particular a humanized VHH or a camelized VH, such as a camelized human VH) or another ISV (or ISV-based drug or Nanobody-based drug with a VHH, Nanobody or other ISV at its C-terminal end) that is a VHH or VH domain (i.e.
- VHH, Nanobody or ISV comprises the amino acid sequence VTVSS(X) repeat (SEQ ID NO:34) at its C-terminal end, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1), and in which each X is an (preferably naturally occurring) amino acid residue that is independently chosen (and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I); however, as can be seen from the data presented below, other (preferably naturally occurring) amino acid residues or combinations of the aforementioned preferred amino acid residues with other amino acid residues (such as serine, proline, threonine and/or lysine) may also be used).
- said VHH, Nanobody or ISV with the amino acid sequence VTVSS(X) n (SEQ ID NO:34) at its C-terminal end is such that (i) it has a substantially reduced tendency (such as at least a statistically relevant reduced tendency) to give rise to protein interference (as defined herein); and/or such that (ii) it has, in the method of the invention described herein (such as in the specific assay described in Example 3 or 5), substantially reduced ability to be bound by an analytical antibody as described herein (such as the polyclonal antibody described in Example 2), in both cases preferably compared to the same VHH, Nanobody or ISV but with the amino acid sequence VTVSS (SEQ ID NO:33) at its C-terminal end.
- an analytical antibody as described herein such as the polyclonal antibody described in Example 2
- VHH's, Nanobodies or (other) ISVs are preferably such that they have an RU value for binding by 21-4 of less than 500 (determined according to the protocol set out in Example 9, and after adjusting the measured RU value for the molecu It should also be noted that, any time that reference is made in the description herein or in the claims to any C-terminal sequence VTVSS(X) n (including any of the aspects (a) to (p) above, that according to one specific aspect of the invention, none of the amino acids X is a cysteine residue.
- the C-terminal end of the ISV or ISV- containing construct (when this C-terminal end is a VH-derived ISV, VHH or Nanobody) may be:
- VTVSS(X) n in which n— 2 and at least one X— Gly (with the remaining amino acid residue(s) X being independently chosen from any naturally occurring amino acid but preferably being independently chosen from Val, Leu and/or He);
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- ISV immunoglobulin single variable domain
- the invention relates to an immunoglobulin single variable domain (ISV), which is either a Nanobody or an(other) ISV that comprises a VH sequence or is derived from a VH sequence (with Nanobodies being preferred) which has a C-terminal end of the sequence VTVSS(X) n , in which:
- the invention relates to an immunoglobulin single variable domain (ISV), which is either a Nanobody or an(other) ISV that comprises a VH sequence or is derived from a VH sequence (with Nanobodies being preferred) which has a C-terminal end of the sequence VTVSS(X) n , in which:
- ISV that comprises a VH sequence or is derived from a VH sequence is meant any ISV that comprises a VH sequence or that is derived from a VH sequence and that is not a Nanobody (i.e. not a VHH, humanized VHH or camelized VH).
- such (other) ISV may for example be a VH -based (single) domain antibody, VH-based dAbTM, or VH-based microbody (see WO 00/29004).
- any time that one of the ISV's referred to herein has a C-terminal sequence VTVSS(X) n (including without limitation in ISV's referred to in the preceding aspects) that according to one specific aspect of the invention, none of the amino acids X in the sequence VTVSS(X) n is a cysteine residue.
- any such protein or polypeptide may for example be a construct that contains two or more ISV's (such as two or more Nanobodies), optionally linked via one or more suitable linkers.
- a construct may be a bivalent, trivalent, tetravalent or pentavalent construct (such as a bivalent, trivalent, tetravalent or pentavalent Nanobody construct), and may for example be a bivalent, trivalent, tetravalent or pentavalent construct (such as a bivalent, trivalent, tetravalent or pentavalent Nanobody construct) that is bispecific, trispecific or biparatopic construct (including for example monospecific, bispecific or biparatopic constructs that also can bind to serum albumin (preferred) or another serum protein for half-life extension).
- Nanobodies, ISVs and proteins/polypeptides according to each of the aspects described above are preferably such that they have an RU value for binding by 21 -4 of less than 500 (determined according to the protocol set out in Example 9, and after adjusting the measured RU value for the molecular weight of the ISV or protein used according to the formula set out above).
- the invention may also be applied to other proteins or polypeptides (and in particular antibody fragments such as Fab fragments or other proteins or polypeptides based on antibody fragments, such as ScFv's) that have a VH- domain at their C-terminal end.
- antibody fragments such as Fab fragments or other proteins or polypeptides based on antibody fragments, such as ScFv's
- the invention relates to such a protein or polypeptide (such as an ScFv) that has a VH domain at its C-terminal end with the amino acid sequence VTVSS(X) n (SEQ ID NO:34) at its C-terminal end, in which n is 1 to 10, preferably 1 to 5, such as 1 , 2, 3, 4 or 5, and in which each X is an (preferably naturally occurring) amino acid residue that is independently chosen (and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I).
- A alanine
- G glycine
- V valine
- L leucine
- I isoleucine
- said C-terminal end may be according to any of (a) to (p) above, and preferably according to one of (a), (b), (c), (g), (h), (i), (m) or (n), with n being 1 , 2 or 3 and preferably 1 or 2.
- such proteins or polypeptides are preferably such that they have an RU value for binding by 21-4 of less than 500 (determined according to the protocol set out in Example 9, and after adjusting the measured RU value for the molecular weight of the ISV or protein used according to the formula set out above). Also, again, according to one specific aspect of this aspect of the invention, none of the amino acids X in the C-terminal sequence
- VTVSS(X) n is a cysteine residue.
- the invention further relates to a pharmaceutical composition that comprises an ISV (and preferably a therapeutic ISV) or a protein or polypeptide comprising at least one ISV (and preferably at least one therapeutic ISV), wherein said ISV, protein or polypeptide is as further described herein (i.e. an ISV, protein or polypeptide according to one or more of the aspects described herein, and in particular according to one or more of the aspects described on the preceding pages; and more in particular an ISV, protein or polypeptide that has a C- terminal end/sequence that is according to one or more of the aspects described herein), and at least one suitable carrier, diluent or excipient (i.e. suitable for pharmaceutical use), and optionally one or more further active substances.
- Such compositions, carriers, diluents or excipients can for example be as described in WO 08/020079 for pharmaceutical
- compositions that comprise a Nanobody or a protein or polypeptide that comprises at least one Nanobody (and as already mentioned, according to the present invention, the ISV is also preferably a Nanobody).
- the invention further relates to an ISV or a protein or polypeptide comprising at least one ISV for use in therapy of a disease in a human being (e.g. a patient in need of such therapy), wherein said ISV, protein or polypeptide is as further described herein (i.e. an ISV, protein or polypeptide according to one or more of the aspects described herein, and in particular according to one or more of the aspects described on the preceding pages; and more in particular an ISV, protein or polypeptide that has a C-terminal end/sequence that is according to one or more of the aspects described herein).
- the invention further relates to the use of an ISV or a protein or polypeptide comprising at least one ISV in the preparation of a pharmaceutical composition, wherein said ISV, protein or polypeptide is as further described herein (i.e. an ISV, protein or polypeptide according to one or more of the aspects described herein, and in particular according to one or more of the aspects described on the preceding pages; and more in particular an ISV, protein or polypeptide that has a C-terminal end/sequence that is according to one or more of the aspects described herein).
- the invention further relates to a method of treatment which comprises administering to a human subject (e.g to a patient in need of such treatment) an ISV or a protein or polypeptide comprising at least one ISV in the preparation of a pharmaceutical composition, wherein said ISV, protein or polypeptide is as further described herein (i.e. an ISV, protein or polypeptide according to one or more of the aspects described herein, and in particular according to one or more of the aspects described on the preceding pages; and more in particular an ISV, protein or polypeptide that has a C-terminal end/sequence that is according to one or more of the aspects described herein); or a pharmaceutical composition (as described above) that comprises at least one such ISV, protein or polypeptide.
- a human subject e.g to a patient in need of such treatment
- an ISV, protein or polypeptide comprising at least one ISV in the preparation of a pharmaceutical composition
- said ISV, protein or polypeptide is as further described herein (i.
- the therapeutic use of the ISV's, proteins and polypeptides described herein are a very important aspect of the invention, as such therapeutic use (or the clinical development of such ISV's, proteins and polypeptides for such therapeutic use) may involve the use of ADA assays to determine whether said ISV, protein or polypeptide is immunogenic (i.e. can give rise to ADA's when administered to a human subject).
- ADA assays to determine whether said ISV, protein or polypeptide is immunogenic (i.e. can give rise to ADA's when administered to a human subject).
- immunogenicity will in particular have to be addressed when a therapeutic is either used for longer periods of time (for during weeks, months or years), and/or has a half-life (preferably expressed as tl/2-beta) in a human subject of at least 3 days, such as at least one week, and up to 10 days or more.
- a therapeutic is either used for longer periods of time (for during weeks, months or years), and/or has a half-life (preferably expressed as tl/2-beta) in a human subject of at least 3 days, such as at least one week, and up to 10 days or more.
- a ISV, protein, polypeptide or pharmaceutical composition as described herein is intended for treatment of a chronic disease in a human being, and/or such ISV, protein, polypeptide as described herein is intended to be present in the circulation of the subject (i.e. at pharmacologically active levels) to which it is administered (i.e.
- ISV, protein, polypeptide as described herein is such that it has a half-life (preferably expressed as 11/2 -beta) in a human subject of at least 3 days, such as at least one week, and up to 10 days or more; and/or such an ISV, protein, polypeptide or pharmaceutical composition as described herein is intended to be administered to a human being as two or more doses that are administered over a period of at least 3 days, such as at least one week, for example at least two weeks or at least one month, or even longer (i.e. at least 3 months, at least 6 months or at least one year), or even chronically administered.
- the invention further relates to a method for (substantially) reducing or essentially removing the tendency of an ISV, a Nanobody or an ISV-based drug or a Nanobody-based drug to give rise to protein interference, said method comprising at least the steps of: optionally determining the tendency of the ISV, Nanobody, ISV-based drug or
- Nanobody-based drug to give rise to protein interference using a method that at least comprises steps (i) and (ii) as referred to herein;
- Nanobody or in the C-terminal ISV or Nanobody (if any) of the ISV-based drag or Nanobody-based drug; and in particular by introducing one or more amino acid substitutions or additions in the C-terminal region of said ISV or Nanobody, or in the C- terminal region of the C-terminal ISV or Nanobody (if any) of the ISV-based drug or Nanobody-based drag, for example by adding to the C-terminal end of the sequence 1 to
- amino acid residues each independently chosen from any naturally occurring amino acids (such as those listed in Table A-2 on page 64 of WO 09/138519, for example and without limitation from alanine, glycine, valine, leucine or isoleucine);
- Nanobody-based drag to give rise to protein interference using a method that at least comprises steps (i) and (ii) as referred to herein; optionally in a manner that allows the tendency of the so modified ISV, Nanobody, ISV-based drug or Nanobody-based drug to give rise to protein interference to be compared to the tendency of the original ISV, Nanobody, ISV-based drug or Nanobody-based drug to give rise to protein interference
- Figure 1 A to 1C schematically shows some non-limiting examples of ADA assay formats. Some representative but non-limiting protocols for performing these assays are mentioned in Example 4.
- Figure 2 schematically shows a representative 3D structure of an ISV, such as a
- Nanobody. - Figure 3 is a binding curve (obtained using the BIACORE assay described in Example 3) showing the binding of NB's 3.4 to 3.9 (SEQ ID NO's. 5 to 10) to the immobilized polyclonal antibody obtained in Example 2.
- FIG. 4 is a binding curve (obtained using the BIACORE assay described in Example 3) showing the binding of NB's 3.4, 3.1 1, 3.12 and 3.13 (SEQ ID NO's: 5, 12, 13 and 14) to the immobilized polyclonal antibody obtained in Example 2.
- FIG. 5 is a binding curve (obtained using the BIACORE assay described in Example 3) showing the binding of NB's 3.4, 3.14 and 3.15 (SEQ ID NO's: 5, 15 and 16) to the immobilized polyclonal antibody obtained in Example 2.
- FIG. 6 is a binding curve (obtained using the BIACORE assay described in Example 3) showing the binding of NB's 3.1, 3.2 and 3.4 (SEQ ID NO's: 3, 4 and 5) to the immobilized polyclonal antibody obtained in Example 2.
- FIG. 7 is a binding curve (obtained using the BIACORE assay described in Example 3) showing the binding of NB's 4.1 and 4.2 (SEQ ID NO's: 17 and 18) to the immobilized polyclonal antibody obtained in Example 2.
- FIG. 8 is a binding curve (obtained using the BIACORE assay described in Example 3) showing the binding of NB's 6.1, 6.2, 6.4 and 6.5 (SEQ ID NO's 19 to 22) to the immobilized polyclonal antibody obtained in Example 2.
- Example 1C 23 HHHHHHEVQLVESGGGLVQAGGSLRLSCAASGRTFNNYAMG wildtype WFRRAPG EREFVAAITRSGVRSGVSAIYGDSV DRFTISRDNA
- Example 1 C 24 HHHHHHEVQLVESGGGLVQPGGSLRLSCAASGRTFNNYAMG (A14P) WFRRAPGKEREFVAAITRSGVRSGVSAIYGDSVKDRFTISRDNA
- Example 1C 25 HHHHHHEVQLVESGGGLVQAGGSLRLSCAASGRTFNNYA G (K83R) WFRRAPGKEREFVAAITRSGVRSGVSAIYGDSVKDRFTISRDNA
- Example 1C 26 HHHHHHE VQL VES GGGLVQ AGG S LRLS C A AS GRTFNN Y AMG (Q108L) WFRRAPG EREFVAAITRSGVRSGVSAIYGDSVKDRFTISRDNA
- Example 1C 27 HHHHHHEVQLVESGGGLVQPGGSLRLSCAASGRTFNNYAMG
- Example lc 28 HHHHHHE VQLVE SGGGLVQPGGS LRLS C A A S GRTFNNY AMG (A14P,R39Q, WFRQAPGKEREFVAAITRSGVRSGVSAIYGDSVKDRFTISRDNA K83R,T91Y,Q KNTLYLQMNSLRPEDTAVYYCAASAIGSGALRRFEYDYSGQGT 108L) LVTVSS TABLE A (continued)
- Example 1C 29 HHHHHHEVQLVESGGGLVQPGGSLRLSCAASGRTFNNYAMG (A14P,R39Q, WFRQ AP GKEREF V A AITRS G VRS G VS AI YGD S VKDRFTISRDN A K83R,T91Y,Q KNTLYLQMNSLRPEDTAVYYCAASAIGSGALRRFEYDYSGQGT 108L)-1A LVTVSSA
- Example 1C 30 HHHHHHE VQL VE S GGGLVQP GG S LRLS C A AS GRTFNN Y AMG (A14P,R39Q, WFRQAPGKEREFVAAITRSGVRSGVSAIYGDSVKDRFTISRDNA K83R,T91Y,Q KNTLYLQMNSLRPEDTAVYYCAASAIGSGALRRFEYDYSGQGT 108L)-3A LVTVSSAAA
- Example 1 Generation of a polyclonal analytical antibody.
- a polyclonal antibody (IgG fraction) that can be used as the "analytical antibody” was generated as follows:
- the ISV that was initially used in this Example was SEQ ID NO: 1. Subsequently, to confirm that the interaction is not specific for this particular ISV, but is an aspecific protein- protein interaction that may occur with a number of ISV's, the assays below were repeated with other ISV's (see paragraph C) below).
- SEQ ID NO: l for example SEQ ID NO:2 may also be used.
- the assay used was an ECL (Electrochemiluminescence) based bridging assay that used biotmylated ISV (a biotinylated variant of SEQ ID NO: l) to capture and sulfo-tagged ISV to detect anti-drug antibodies.
- ECL Electrohemiluminescence
- biotmylated ISV a biotinylated variant of SEQ ID NO: l
- a similar format is also used for performing ADA assays.
- Biotinylation and sulfo-tagging of the ISV was done using standard coupling chemistry on primary amines using Sulfo-NHS-LC-Biotin (Pierce) and Sulfo-tag NHS-Ester (MSD), respectively according to the manufacturer's instructions.
- the plasma samples were diluted 1/5 in PBS/0.1% casein and were incubated for 30 minutes at 37°C, 600 RPM in 96 well polypropylene plates.
- the samples (50 ⁇ ,) were then diluted 1/3 in 1 : 1 mixture (100 ⁇ ) of 2 ⁇ g/ml biotinylated and 2 ⁇ g/ml sulfo-tagged ISV (SEQ ID NO:l) and incubated for 1 hour at RT, 600 RPM.
- Sample/ 1 : 1 mix biotinylated and sulfo-tagged ISV (SEQ ID NO: l) (50.0 ⁇ ) was transferred from the polypropylene plate to the MSD plate and incubated for 1 hour at RT, 600 rpm. Plates were washed three times prior to addition of 2 x Read Buffer (MSD) (150 ⁇ ) and reading the ECL units (ECLU) on an MSD instrument (Sector Imager 2400 reader). Samples were screened as positive or negative using the screening cut-point determined during method validation.
- MSD Read Buffer
- ECLU ECL units
- the screening cut-point was calculated based on the background values of 118 individual plasma samples from healthy individuals that were never treated with an ISV, using appropriate statistical analysis as recommended by the guidelines for ADA assay development (Shankar, 2008). A non-parametric assessment was used and the cut-off value was calculated based on the 95 th percentile, after exclusion of outliers.
- samples were further analyzed in a drug displacement set-up (confirmatory assay) to confirm the specificity of the positive screening outcome (Table II). Therefore, the samples were diluted 1/5 in PBS/0. l%casein containing 12.5 g/mL ISV (SEQ ID NO:l) and were incubated for 30 minutes at 37°C, 600 RPM in 96 well polypropylene plates. The samples (50 ⁇ ,) are then diluted 1/3 in 1 : 1 mixture (100 ⁇ ,) of 2 ⁇ g/ml biotinylated and 2 ⁇ sulfo-tagged ISV (SEQ ID NO: l) and incubated for 1 hour at RT, 600 RPM.
- sample/ 1 : 1 mix biotinylated and sulfo-tagged ISV
- sample/ 1 : 1 mix was transferred from the polypropylene plate to the blocked MSD MA ® 96-well Standard Streptavidin plate as described above for the screening assay and incubated for 1 hour at RT, 600 rpm. Plates were washed three times prior to addition of 2 x Read Buffer (MSD) (150 ⁇ , ⁇ ) and measuring ECL units (ECLU) on an MSD instrument (Sector Imager 2400 reader).
- MSD Read Buffer
- ECLU ECL units
- Samples were confirmed as true positives using the confirmatory cut-point determined during method validation and was calculated on the ECL response of 118 individual plasma samples from healthy individuals that were never treated with ISV, that were spiked with 50 ⁇ ISV (SEQ ID NO.l) using appropriate statistical analysis as recommended by the guidelines for ADA assay development (Shankar, 2008). A minimal signal reduction of 50% was calculated based on the 99% confidence interval.
- a further three serum samples from individuals that not have been treated with an ISV were also evaluated using the ECL based bridging assay described above and confirmed using the drug displacement set-up assay.
- a polyclonal IgG was purified from the samples IHUS#B09032311A3 and
- the purified IgG antibody was analyzed in the ECL based bridging assay described above and confirmed using the drag displacement set-up assay used under A) above.
- purified IgG antibody was confirmed to be involved in the aspecific binding leading to a positive signal in the assays (Table III). This confirmed that the purified polyclonal IgG could be used as an "analytical antibody", and it was used as such in (the assays of) Examples 3 and 5.
- the ECL based bridging assay and the drug displacement set-up assay were repeated using the plasma samples IHUS#B09032311A3, IHUS#B09032311 A20 and IHUS#B09032311 Al .
- these plasma samples contain the polyclonal "analytical" antibody isolated under B) above, this also provides information on the specificity, selectivity and epitope recognition of the polyclonal analytical antibody.
- ISV's were tested (SEQ ID NO's 23 to 30, respectively - see Table A above), of which one was a wildtype VHH (SEQ ID NO: 23) and the other 7 ISV's were humanized versions of the wildtype sequence with different humanizing substitutions.
- Two ISV's (SEQ ID NO's: 29 and 30) also contained additional amino acid residues at the C-terminus (1 and 3 additional alanine residues, respectively).
- introducing a proline residue at position 14 of the wildtype sequence can apparently also strongly influence the extent to which the plasma samples used can give rise to protein interference (for example, only 20 % reduction in the ECLU assay with sample IHUS#B0903231 1A3 for the wildtype sequence of SEQ ID NO's: 23, compared to 91% reduction for SEQ ID NO: 24, the wildtype sequence with an A14P substitution).
- K83R and Q108L which are also substitutions close to the C-terminal region, also lead to some increase in the tendency to give rise to protein interference, but not as much as the A14P substitution, and the total combined effect of the A14P+K83R+Q108L substitutions can be negated by adding one or more amino acid residues to the C-terminus (compare again the data for SEQ ID NO's: 29 and 30 with the data for the other humanized variants).
- Nanobody Variant (right hand ECLU % ECLU % ECLU % column mentions the humanizing confirmat reduct confirmat reduct confirmat reducti substitutions and C-terminal ory assay ion ory assay ion ory assay on additions made compared to the
- Nanobody Variant (right hand ECLU % ECLU % ECLU % column mentions the humanizing confirmat reduct confirmat reduct confirmat reducti substitutions and C-terminal ory assay ion ory assay ion ory assay on additions made compared to the
- This Example describes two methods that can be used to isolate from a biological fluid from a human subject an analytical antibody that is able to recognize and/or bind the C- terminal end of an ISV.
- the antibody is isolated from 4 different serum samples that were characterized in that these induced a positive signal in an ADA assay according to the test as described in Example 1.
- each of these protocols provide a purified preparation of interference factor(s) that can be used as the analytical antibody in the methods described herein.
- These methods can also more generally be used to purify the interference factor(s) for other purposes (for example, the interference factor(s) purified using the protocols below were also used experimentally in Example 8 in order to show that binding to an ISV or IS V- construct by monoclonal 21-4 is predictive for binding of the same ISV or ISV-construct by interference factors, and thus by the tendency of said ISV or ISV-construct to undergo aspecific protein interference in an ADA assay).
- Example 2A purification using protein A and affinity chromatography
- the IgG antibody fraction was enriched from the serum samples using protein A affinity chromatography. Typical columns that were used for this enrichment included HiTrap MabselectSure and MabSelectXtra (GE Healthcare); PorosMabCapture A (Applied Biosystems). Purification of the IgG antibodies from the serum samples was performed in an automated and similar manner over all experiments. Chromatographic runs were performed on the AKTA purifier systems (GE Healthcare) and logged in real-time using UNICORN protein purification software (GE Healthcare).
- the serum sample was diluted 1 :1 with D-PBS (Dulbecco's Phosphate-Buffered Saline) and 0.22 ⁇ filtered before uploading on the column at a fixed flow rate of 0.5 mI7 min.
- the column was washed to remove non-specific binding components over 5 column volumes using D-PBS at a flow rate of 0.5 mL/min.
- the IgG fraction was eluted by acidic elution, using 100 mM Glycine pH 2.6 buffer, and a flow rate of 0.5 mL/min. After elution, the fractions were neutralized using 1.5 M Tris buffer pH 8.8. SDS-PAGE was run to confirm the isolation of IgG antibodies in the elution.
- the interfering IgGs were further enriched by applying the protein A purified IgG fraction from the 4 different sera onto ISV coupled affinity columns. More specifically, the interfering IgG were further enriched by binding to a column containing an ISV with sequence of SEQ ID NO: 1. To this, the ISV was covalently linked to Sepharose 4 fast flow (GE Healthcare) using the CNBr (Cyanogen bromide) -coupling method according to the manufacturer's procedure. The affinity purification was performed in an automated and similar manner over all experiments. Chromatographic runs were performed on the AKTA purifier systems and logged in UNICORN.
- the IgG enriched sample (up to l OmL loading volume) was uploaded on the column at a fixed flow rate of 0.5 mL/ min.
- the column was washed to remove non-specific binding-components over 5 column volumes using D-PBS at a flow rate of 0.5 mL/min.
- the ISV-binding components were eluted by acidic elution, using 100 mM Glycine pH 2.6 buffer, and a flow rate of 0.5 mL/min. After elution, the fractions were neutralized using 1.5 M Tris buffer pH 8.8. The fractions were analyzed using SDS-PAGE which confirmed the isolation of IgG antibodies in the elution (data not shown).
- Example 2B purification suing CaptureSelectTM chromatography.
- interference factor(s) were recovered from plasma and purified using the commercially available IgA binding affinity resin CaptureSelect hlgATM (BAC BV), which is based on camelid-derived heavy-chain only variable domains (VHH).
- BAC BV IgA binding affinity resin CaptureSelect hlgATM
- VHH camelid-derived heavy-chain only variable domains
- the collected 'IgA fraction' containing IgA together with interfering IgG was subsequently loaded onto a protein A column to remove the IgA fraction.
- the interference factor was recovered from the Prot A elution in >95% yield.
- CaptureSelect affinity resin CaptureSelect Alpha- 1 Antitrypsin resin, a VHH based commercially available affinity resin, not targeting any antibody related proteins
- This resin provided a high interference factor binding efficacy and allowed for a selective 2 step elution: antitrypsin via neutral pH elution using 2.0 M MgC12, followed by the interference factor elution via an acidic step (0.1 M Glycine pH3.0, similar to protein A/G elution conditions; neutralisation using 1.5M Tris).
- This one step purification yielded up to 15 ⁇ g interfering IgGl per mL high interference plasma, which is approximately 0.3% of the total IgG present.
- the neutralised interference fraction can be desalted and further purified via a Size Exclusion Column equilibrated in D-PBS.
- the present invention makes available certain assays and techniques which make it possible to make an assessment of whether or not a given ISV has a tendency to give rise to protein interference.
- these include the ECL based bridging assay and the drug displacement set-up assay used in Example 1, as well as the BIACORE assay described in this Example 3 and the bridging/competition ADA assay described in the further Examples below.
- these assays can also be used to determine whether specific changes (such as amino acid deletions, substitutions or additions) can influence (and preferably reduce) the tendency of a given ISV to give rise to protein interference.
- Example 3 both the effect of other substitutions as well as the effect of adding additional amino acids to the C-terminus was investigated by comparing related ISV's with different substitutions, using the analytical polyclonal antibody generated in Example 2.
- the analysis was done by measuring the kinetics of interaction between each of the ISV's investigated and the analytical polyclonal by means of surface Plasmon resonance (SPR) using the BiacoreTM T100 biosensor from GE Healthcare.
- SPR surface Plasmon resonance
- the ISV tested in this Example 3 were those of SEQ ID NO's 3 to 22 (see Table A above and Table V below).
- a polyclonal antibody solution was prepared at 10 ⁇ g/ml in 10 rnM NaOAc pH5.0.
- EDC N-ethyl-N'-[3-diethylamino-propyl]- carbodiimide
- NHS N-hydroxysuccinimide
- the signal obtained by injecting the ISV onto a blank flow cell was subtracted from the signal obtained by injecting the ISV onto the polyclonal antibody bound flow cell.
- Figure 3 shows the binding of NB's 3.4 to 3.9 to the immobilized polyclonal antibody.
- Table V summarizes the results obtained.
- position 113 is the last "S" of the C-terminal VTVSS motif, and positions 114, 115 and 116 are the positions immediately following (downstream) of said position 113.
- the ISVs containing said substitutions that were tested were NB's 3.1 , 3.2 and 3.4
- FIG. 5 shows the binding of NB's 3.4, 3.14 and 3.15 to the immobilized polyclonal antibody
- Figure 6 shows the binding of NB's 3.1, 3.2 and 3.4 to the immobilized polyclonal antibody
- FIG. 7 shows the binding of NB's 4.1 and 4.2 to the immobilized polyclonal antibody
- - Figure 8 shows the binding of NB's 6.1, 6.2, 6.4 and 6.5 to the immobilized polyclonal antibody.
- Example 4 representative protocols for performing the ADA assays of Figure 1.
- ADA assay of Figure IB in solution Samples 20% matrix, 30', 37°C, Preincubation sample: ISV- -Sulfo 1 :1 : 1, lh, RT, On plate 1 h, RT, Wash 3x, Readbuffer 2x
- Example 5 Predicting sensitivity of the ISV to aspecific protein interference using the analytical antibody.
- This example describes a bridging/competition ADA assay using the analytical antibody that can be used to predict sensitivity of an ISV to aspecific protein interference.
- the ISV to be tested is diluted at a concentration of 10 ⁇ g/ml and incubated with the analytical antibody at 400 ng/ml, purified according to Example 2, and incubated at 37°C at 600 rpm in 96 well polypropylene plates.
- the sample (50 ,uL) is then diluted 1/3 in 1 : 1 mixture (100 ⁇ ) of 2 ⁇ g/ml biotinylated and 2 ⁇ g/ml sulfo-tagged ISV and incubated for 1 hour at RT, 600 RPM.
- Sample/ 1 : 1 mix biotinylated and sulfo-tagged ISV (50.0 ⁇ ) is transferred from the polypropylene plate to the MSD plate and incubated for 1 hour at RT, 600 rpm.
- MSD Read Buffer
- ECLU ECL units
- Example can be used to predict the tendency of an ISV to give rise to protein interference, but the data generated also confirm the findings from the earlier Examples on the effect of substitutions in the C-terminal region.
- Mutating position 14 on the wild type ISV variant from Alanine to Proline clearly increased its capacity as competitor in the assay, ( making the ISV variant more prone to aspecific protein interference), whereas mutating position 83 and 108 did not clearly influenced the sensitivity of the ISV to aspecific protein interference.
- Example 6 Influence of the addition of amino acids to the C-terminus of anti-OX40L anohodies on their OX40L blocking potency.
- a first assay the T-cell activation assay was performed as follows. PBMCs were isolated from buffy coats (Red Cross, Ghent, Belgium) from healthy donors using Ficoll Paque Plus reagent (GE Healthcare) and washed using RPMI 1640 complete medium
- the PBMCs (lxlO 5 cells/well) were stimulated with phytohaemagglutinin (PHA-L; final concentration 0 ⁇ g/ml) before the addition to lxl 0 4 hOX40L expressing CHO cells (irradiated with gamma scintillator at 3000 RAD; UZ Gent, Belgium) and dilution series of anti-OX40L Nanobodies RPMI 1640 complete medium and incubated for 22 hours at 37°C in C0 2 incubator. Production of IL2 by the PBMCs was measured in ELISA.
- PHA-L phytohaemagglutinin
- a dilution series (from 1.5 ⁇ to 0.083 pM) of the Nanobodies were pre-incubated overnight at room temperature with l OOng/ml human OX40/Fc (R&D Systems) and l Ong/ml biotinylated human OX40L (R&D Systems; in-house biotinylated as described in Example 1 ) in PBS +0.1 % BSA +0.01 % Tween-20.
- the samples were incubated on Maxisorp plates coated with l Oug/ml anti-human Fc Nanobody (in-house generated) and blocked with PBS + 1 % BSA +0.1 % Tween-20.
- the spleens were aseptically removed and a single cell suspension of pooled spleens was prepared.
- Spleen cells and myeloma cells were washed several times with DMEM and fused in the presence of 1 ml 50% (w/v) PEG 3350 (ratio spleen cells to SP2/0 3 : 1).
- PEG 3350 ratio spleen cells to SP2/0 3 : 1
- the myeloma cell line SP2/0-Agl4 from German Collection of Microorganisms and Cell Cultures (DSMZ GmbH, Braunschweig). This cell line is a hybrid between BALB/c spleen cells and the myeloma cell line P3x63Ag8.
- hybridomas were resuspended in CGM containing 20% FCS and aminopterin (HAT medium) and plated out (140 ⁇ /well) into eight 96-well tissue culture flat-bottom plates (Corning-Costar) containing 140 ⁇ /well CGM (20% FCS) with peritoneal excudate cells as feeder cells.
- the plates were incubated for 10 days in a complete growth medium (CGM) containing DMEM with supplements 2-mercaptoethanol, L-Glutamin, Stable Glutamin, HT and non essential amino acids (in concentrations recommended by the supplier) and FCS at different concentrations (10%, 15% or 20%). During this period cells were fed two times with HAT medium.
- the cell culture supernatants from hybridoma cells usually contained 1 to 20 ⁇ / ⁇ 1 antibody, which were tested in a binding ELISA to confirm binding to the Nanobody construct of SEQ ID NO:98 in WO 2006/122825.
- Example 8 binding of 21-4 to an ISV is predictive of the tendency of an ISV to undergo aspecifie protein interference
- Example 9 demonstrates that binding of the monoclonal 21-4 to an ISV can be used to predict (within the degrees of certainty indicated in this Example) of whether a given ISV will have a tendency to undergo aspecifie protein interference (e.g. in an ADA assay).
- This Example 8 shows that 21-4 can be used to predict whether certain proposed modifications to a given ISV (such as adding one or more amino acid residues to the C-terminus of an ISV and/or substituting one or more amino acid substitutions within the C-terminal region of an ISV) will lead to a reduction of the tendency of said ISV to undergo aspecifie protein interference.
- certain proposed modifications to a given ISV such as adding one or more amino acid residues to the C-terminus of an ISV and/or substituting one or more amino acid substitutions within the C-terminal region of an ISV
- Nanobodies and Nanobody constructs were also tested for binding by purified preparations of interference factor(s) obtained from three different human donors (referred to herein as "Donor 8", “Donor 19” and “Donor 30"), to see if there was any correlation between binding by 21-4 and by the purified interference factors.
- the reference was chosen such that compared to the reference, the tested Nanobodies or Nanobody constructs either had one or more additional amino acid residues at the C-terminal end (which were added in order to test the effect of such addition on protein interference, and in particular in order to reduce said interference) and/or one or more mutations within the C-terminal region (for example, as a result of humanization compared to the reference).
- binding of the purified interference factor(s) from each of the three donors to each of the 53 Nanobodies or Nanobody constructs was measured using the same Biacore instrument and compared to binding of the purified interference factor(s) to the same reference Nanobody or construct. The results were similarly expressed as a percentage reduction in binding of the interference factor to the given Nanobody or Nanobody construct vs the reference.
- such a reduction in binding of the interference factor(s) by more than 50% means that such interference factor(s) essentially no longer interfere(s) with an ADA assay for the ISV in question: experimental confirmation using an ADA assay showed that when the binding by the interference factor(s) is reduced by more than 45%, that no significant influence of the presence of the interference factor(s) on the ADA assay could be observed.
- the data presented herein on the correlation between (reduction in) binding by 21-4 and (reduction in) binding by interference factor also allowed the present inventors to set an absolute value for the binding by 21-4 below which it can be expected (within the confidence provided by the data set out in this Example 8) that an ISV or ISV-based construct will not be susceptible to binding by interference factor(s) in a way that could interfere with an ADA assay.
- this value is 500 RU (determined and calculated as set out in Example 9).
- Monoclonal 21-4 was purified from the culture medium of the hybridoma obtained in Example 7 above, as follows: Hybridoma cells secreting the monoclonal antibody 21-4-3 were cultured in spinner flasks in serum free medium (CD Hybridoma, Gibco, supplemented with 8mM L-glutamine (Invitrogen) and l xcholesterol (250x cholersterol lipid concentrate, Gibco)) at a volume of lOOmL or 500mL. The cleared supernatant was filtered, and the murine IgGl captured on a ProteinA column (HiTrap MabSelect SuRe, 5mL, GE Healthcare) at a reduced flow rate of 2mL/min.
- CD Hybridoma Gibco
- 8mM L-glutamine Invitrogen
- l xcholesterol 250x cholersterol lipid concentrate, Gibco
- the cleared supernatant was filtered, and the murine IgGl captured on a ProteinA
- Bound antibody was eluted in 0.1 M citrate buffer pH3.0, and elution fractions (of 5mL) directly neutralized with lmL of 1M TRIS pH9. Purity of the antibody was verified by reducing and non-reducing SDS-PAGE.
- the purified preparations of interference factor(s) from Donors 8 and 19 were obtained from serum samples from said donors by means of affinity purification, essentially as described in Example 2A.
- the interference factor(s) from Donor 30 were obtained from a serum sample of Donor 30, essentially as described in Example 2B.
- Nanobodies or Nanobody constructs was determined using a Biacore T100 essentially as described in Example 3, using the interference factor from each of the donors 8, 19 and 30, directly immobilized on a CM5 sensor chip.
- Example 9 protocol for predicting whether an ISV will have a tendency to undergo aspecifie protein interference (using monoclonal 21-4 Binding measurements were performed using a Biacore T100 using a CM5 T120416 sensor chip, with running buffer HBS-EP+, 25°C. 21 -4 was captured via immobilized rabbit anti -mouse IgG, as it was found that directly immobilized mAb 21 -4-3 surface could not efficiently be regenerated.
- the anti-mouse IgG used was a polyclonal rabbit anti-mouse IgG antibodies reacting with all IgG subclasses, IgA and IgM (GE Healthcare; Cat#BR- 1008-38; Lot#l 0056316).
- Immobilisation of the anti-mouse IgG was performed using manual amine coupling using a 7 minute injection of EDC/NHS for activation and a 7 minute injection of 1M ethanolamine HC1 pH 8.5 for deactivation (Biacore, amine coupling kit). Binding conditions are listed in Table XI. Based on the immobilization level and MW of the proteins, the theoretical R max for mAb21-4-3 binding to the immobilized anti-mouse IgG was
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Food Science & Technology (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Apparatus Associated With Microorganisms And Enzymes (AREA)
Abstract
Description
Claims
Priority Applications (64)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PL12729968.3T PL2723769T5 (en) | 2011-06-23 | 2012-06-25 | Techniques for the prediction, detection and reduction of non-specific protein interference in assays involving single immunoglobulin variable domains |
| KR1020227026895A KR102880093B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| EP23214392.5A EP4350345A3 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| KR1020197008750A KR102240318B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| KR1020187020494A KR102025035B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| PH1/2022/550312A PH12022550312A1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| BR122018012485-7A BR122018012485B1 (en) | 2011-06-23 | 2012-06-25 | TECHNIQUES TO PREDICT, DETECT AND REDUCE NON-SPECIFIED PROTEIN INTERFERENCE IN ASSAYS INVOLVING SINGLE VARIABLE DOMAINS OF IMMUNOGLOBULIN |
| US14/128,681 US20180009888A9 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| KR1020197026729A KR102246924B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| EP15179669.5A EP2974737B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing a specific protein interference in assays involving immunoglobulin single variable domains |
| RS20170334A RS55775B2 (en) | 2011-06-23 | 2012-06-25 | TECHNIQUES TO PREDICT, DETECT, AND REDUCE NON-SPECIFIC PROTEIN INTERFERENCE IN ASSAYS INVOLVING INDIVIDUAL IMMUNOGLOBULIN VARIABLE DOMAINS |
| IN373CHN2014 IN2014CN00373A (en) | 2011-06-23 | 2012-06-25 | |
| KR1020217011601A KR102430693B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| BR122017005075-3A BR122017005075B1 (en) | 2011-06-23 | 2012-06-25 | TECHNIQUES TO PREDICT, DETECT AND REDUCE NON-SPECIFIED PROTEIN INTERFERENCE IN ASSAYS INVOLVING SINGLE VARIABLE DOMAINS OF IMMUNOGLOBULIN |
| CN201280030902.9A CN104203975B (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing nonspecific protein interference in assays involving immunoglobulin single variable domains |
| PH1/2013/502669A PH12013502669B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| IL229503A IL229503B (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting ,detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| AU2012273929A AU2012273929B2 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| KR1020137035011A KR101965462B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| ES12729968T ES2622006T5 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting, and reducing nonspecific protein interference in assays involving single immunoglobulin variable domains |
| IL324872A IL324872A (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| EP18162772.0A EP3363812A1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| PH1/2022/550309A PH12022550309A1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| SI201230908T SI2723769T2 (en) | 2011-06-23 | 2012-06-25 | Techniques for Predicting, Detecting, and Reducing Nonspecific Protein Interference in Assays Involving Single-Variable Immunoglobulin Domains |
| IL250396A IL250396B (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| EP12729968.3A EP2723769B2 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| PH1/2022/550313A PH12022550313A1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| SG2013084678A SG194982A1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| JP2014516387A JP6258199B2 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing non-specific protein interference in assays involving immunoglobulin single variable domains |
| KR1020247007180A KR102929408B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| HRP20170535TT HRP20170535T4 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| CA2837998A CA2837998C (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| DK12729968.3T DK2723769T4 (en) | 2011-06-23 | 2012-06-25 | TECHNIQUES TO PREDICT, DETECT, AND REDUCE UNSPECIFIC PROTEIN INTERFERENCE IN ASSAYS INVOLVING VARIABLE IMMUNE GLOBULIN SINGLE DOMAINS |
| IL293155A IL293155B1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| CN201810379995.5A CN108653728B (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting, and reducing non-specific protein interference in assays involving immunoglobulin single variable domains |
| EP18162775.3A EP3363813A1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| IL293163A IL293163A (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| PH1/2022/550310A PH12022550310A1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| MX2013014614A MX350074B (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains. |
| PH1/2022/550311A PH12022550311A1 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| NZ617995A NZ617995B2 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| RU2014102007A RU2700630C2 (en) | 2011-06-23 | 2012-06-25 | Methods for prediction, detection and reduction of non-specific interference of proteins in methods of analysis using single variable domains of immunoglobulins |
| LTEP12729968.3T LT2723769T (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| BR112013032145-8A BR112013032145B1 (en) | 2011-06-23 | 2012-06-25 | TECHNIQUES TO PREDICT, DETECT AND REDUCE NON-SPECIFIED PROTEIN INTERFERENCE IN ASSAYS INVOLVING SINGLE VARIABLE DOMAINS OF IMMUNOGLOBULIN |
| ZA2013/09295A ZA201309295B (en) | 2011-06-23 | 2013-12-10 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US14/138,863 US11644471B2 (en) | 2010-09-30 | 2013-12-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US14/698,917 US20150344568A1 (en) | 2011-06-23 | 2015-04-29 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US15/615,281 US11192938B2 (en) | 2011-06-23 | 2017-06-06 | Serum albumin binding proteins containing immunoglobulin single variable domains |
| US15/615,197 US11192937B2 (en) | 2011-06-23 | 2017-06-06 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| PH12017501178A PH12017501178A1 (en) | 2011-06-23 | 2017-06-22 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| AU2017204339A AU2017204339B2 (en) | 2011-06-23 | 2017-06-27 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| AU2018202782A AU2018202782B2 (en) | 2011-06-23 | 2018-04-20 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US15/975,834 US20180355031A1 (en) | 2011-06-23 | 2018-05-10 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| AU2019201606A AU2019201606B2 (en) | 2011-06-23 | 2019-03-08 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US16/822,186 US10858418B2 (en) | 2011-06-23 | 2020-03-18 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US16/823,412 US12006352B2 (en) | 2011-06-23 | 2020-03-19 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| AU2020230299A AU2020230299B2 (en) | 2011-06-23 | 2020-09-10 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| AU2021201506A AU2021201506B2 (en) | 2011-06-23 | 2021-03-10 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US17/408,893 US20220298227A9 (en) | 2011-06-23 | 2021-08-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US17/408,987 US12516105B2 (en) | 2011-06-23 | 2021-08-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US17/409,019 US20210403536A1 (en) | 2011-06-23 | 2021-08-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US17/408,937 US20210388062A1 (en) | 2011-06-23 | 2021-08-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US18/299,871 US20230242620A1 (en) | 2011-06-23 | 2023-04-13 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| AU2024200309A AU2024200309A1 (en) | 2011-06-23 | 2024-01-17 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
Applications Claiming Priority (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161500464P | 2011-06-23 | 2011-06-23 | |
| US201161500360P | 2011-06-23 | 2011-06-23 | |
| US61/500,360 | 2011-06-23 | ||
| US61/500,464 | 2011-06-23 | ||
| US201161541368P | 2011-09-30 | 2011-09-30 | |
| EPPCT/EP2011/067132 | 2011-09-30 | ||
| US61/541,368 | 2011-09-30 | ||
| PCT/EP2011/067132 WO2012042026A1 (en) | 2010-09-30 | 2011-09-30 | Biological materials related to c-met |
| US13/435,567 US8703135B2 (en) | 2010-09-30 | 2012-03-30 | Biological materials related to c-Met |
| US13/435,567 | 2012-03-30 | ||
| PCT/EP2012/061304 WO2012175400A1 (en) | 2011-06-23 | 2012-06-14 | Serum albumin binding proteins |
| EPPCT/EP2012/061304 | 2012-06-14 |
Related Parent Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2011/067132 Continuation-In-Part WO2012042026A1 (en) | 2010-09-30 | 2011-09-30 | Biological materials related to c-met |
| US13/435,567 Continuation-In-Part US8703135B2 (en) | 2010-09-30 | 2012-03-30 | Biological materials related to c-Met |
| PCT/EP2012/061304 Continuation-In-Part WO2012175400A1 (en) | 2010-09-30 | 2012-06-14 | Serum albumin binding proteins |
Related Child Applications (12)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/128,681 A-371-Of-International US20180009888A9 (en) | 2011-06-23 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US14/138,863 Continuation-In-Part US11644471B2 (en) | 2010-09-30 | 2013-12-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US14/698,917 Division US20150344568A1 (en) | 2011-06-23 | 2015-04-29 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US15/615,197 Continuation US11192937B2 (en) | 2011-06-23 | 2017-06-06 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US15/615,281 Continuation US11192938B2 (en) | 2011-06-23 | 2017-06-06 | Serum albumin binding proteins containing immunoglobulin single variable domains |
| US16/822,186 Continuation US10858418B2 (en) | 2011-06-23 | 2020-03-18 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US16/823,412 Continuation US12006352B2 (en) | 2011-06-23 | 2020-03-19 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US17/408,987 Continuation US12516105B2 (en) | 2011-06-23 | 2021-08-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US17/409,019 Continuation US20210403536A1 (en) | 2011-06-23 | 2021-08-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US17/408,937 Continuation US20210388062A1 (en) | 2011-06-23 | 2021-08-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US17/408,893 Division US20220298227A9 (en) | 2011-06-23 | 2021-08-23 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US18/299,871 Continuation US20230242620A1 (en) | 2011-06-23 | 2023-04-13 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012175741A2 true WO2012175741A2 (en) | 2012-12-27 |
| WO2012175741A3 WO2012175741A3 (en) | 2013-02-14 |
Family
ID=47423024
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2012/062251 Ceased WO2012175741A2 (en) | 2010-09-30 | 2012-06-25 | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
Country Status (26)
| Country | Link |
|---|---|
| US (11) | US20180009888A9 (en) |
| EP (1) | EP2723769B2 (en) |
| JP (6) | JP6258199B2 (en) |
| KR (7) | KR102246924B1 (en) |
| CN (5) | CN108659120A (en) |
| AU (7) | AU2012273929B2 (en) |
| BR (3) | BR112013032145B1 (en) |
| CA (3) | CA3142288A1 (en) |
| DK (1) | DK2723769T4 (en) |
| ES (1) | ES2622006T5 (en) |
| FI (1) | FI2974737T3 (en) |
| HR (1) | HRP20260089T1 (en) |
| HU (1) | HUE031828T2 (en) |
| IL (5) | IL293163A (en) |
| IN (1) | IN2014CN00373A (en) |
| LT (2) | LT2974737T (en) |
| MX (2) | MX350074B (en) |
| NZ (1) | NZ780183A (en) |
| PH (7) | PH12022550313A1 (en) |
| PL (2) | PL2974737T3 (en) |
| PT (2) | PT2974737T (en) |
| RS (1) | RS67664B1 (en) |
| RU (1) | RU2700630C2 (en) |
| SG (4) | SG10201805064SA (en) |
| WO (1) | WO2012175741A2 (en) |
| ZA (1) | ZA201309295B (en) |
Cited By (125)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013073968A3 (en) * | 2011-09-12 | 2013-06-20 | Industrial Research Limited | Agents for modulation of cell signalling |
| WO2014043509A3 (en) * | 2012-09-13 | 2014-05-30 | Novartis Ag | Single domain antibody with c-terminal modification |
| US9139825B2 (en) | 2009-10-30 | 2015-09-22 | Novartis Ag | Universal fibronectin type III bottom-side binding domain libraries |
| US9173960B2 (en) | 2011-11-04 | 2015-11-03 | Novartis Ag | Methods of treating cancer with low density lipoprotein-related protein 6 (LRP6)—half life extender constructs |
| WO2015173342A1 (en) | 2014-05-16 | 2015-11-19 | Ablynx Nv | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| WO2015193452A1 (en) | 2014-06-18 | 2015-12-23 | Ablynx Nv | Kv1.3 binding immunoglobulins |
| WO2015173325A3 (en) * | 2014-05-16 | 2016-02-18 | Ablynx Nv | Improved immunoglobulin variable domains |
| US9328174B2 (en) | 2012-05-09 | 2016-05-03 | Novartis Ag | Chemokine receptor binding polypeptides |
| EP3020728A1 (en) | 2011-06-23 | 2016-05-18 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| WO2016118733A1 (en) | 2015-01-21 | 2016-07-28 | Inhibrx Biopharma LLC | Non-immunogenic single domain antibodies |
| US9428583B2 (en) | 2010-05-06 | 2016-08-30 | Novartis Ag | Compositions and methods of use for therapeutic low density lipoprotein-related protein 6 (LRP6) multivalent antibodies |
| WO2016156570A1 (en) | 2015-04-02 | 2016-10-06 | Ablynx N.V. | Bispecific cxcr4-cd-4 polypeptides with potent anti-hiv activity |
| WO2016180982A1 (en) | 2015-05-13 | 2016-11-17 | Ablynx N.V. | T cell recruiting polypeptides based on cd3 reactivity |
| WO2016180969A1 (en) | 2015-05-13 | 2016-11-17 | Ablynx N.V. | T cell recruiting polypeptides based on tcr alpha/beta reactivity |
| WO2017081320A1 (en) * | 2015-11-12 | 2017-05-18 | Ablynx Nv | Improved tnf binders |
| WO2017081265A1 (en) * | 2015-11-12 | 2017-05-18 | Ablynx Nv | Improved p2x7 receptor binders and polypeptides comprising the same |
| WO2017080850A1 (en) | 2015-11-13 | 2017-05-18 | Ablynx Nv | Improved serum albumin-binding immunoglobulin variable domains |
| WO2017087589A2 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Pd1 and/or lag3 binders |
| WO2017085172A2 (en) | 2015-11-18 | 2017-05-26 | Ablynx Nv | Improved serum albumin binders |
| WO2017087587A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | PD1/CTLA4 Binders |
| WO2017087588A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Ctla4 binders |
| WO2017220645A1 (en) | 2016-06-23 | 2017-12-28 | Ablynx N.V. | Improved pharmacokinetic assays for immunoglobulin single variable domains |
| WO2018050833A1 (en) | 2016-09-15 | 2018-03-22 | Ablynx Nv | Immunoglobulin single variable domains directed against macrophage migration inhibitory factor |
| WO2018091606A1 (en) | 2016-11-16 | 2018-05-24 | Ablynx Nv | T cell recruiting polypeptides capable of binding cd123 and tcr alpha/beta |
| WO2018104444A1 (en) | 2016-12-07 | 2018-06-14 | Ablynx Nv | Improved serum albumin binding immunoglobulin single variable domains |
| IL258742A (en) * | 2015-11-02 | 2018-06-28 | Singh Biotechnology Llc | Monoclonal antibodies against intracellular antigens |
| WO2018134234A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| WO2018134235A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| WO2018178307A1 (en) | 2017-03-31 | 2018-10-04 | Ablynx N.V. | Improved immunogenicity assays |
| WO2018220225A1 (en) | 2017-06-02 | 2018-12-06 | Ablynx Nv | Aggrecan binding immunoglobulins |
| WO2018220235A1 (en) | 2017-06-02 | 2018-12-06 | Merck Patent Gmbh | Mmp13 binding immunoglobulins |
| WO2018220236A1 (en) | 2017-06-02 | 2018-12-06 | Merck Patent Gmbh | Polypeptides binding adamts5, mmp13 and aggrecan |
| WO2018220080A1 (en) | 2017-05-31 | 2018-12-06 | Boehringer Ingelheim International Gmbh | Polypeptides antagonizing wnt signaling in tumor cells |
| WO2018220234A1 (en) | 2017-06-02 | 2018-12-06 | Merck Patent Gmbh | Adamts binding immunoglobulins |
| WO2019016237A1 (en) | 2017-07-19 | 2019-01-24 | Vib Vzw | Serum albumin binding agents |
| AU2016277685B2 (en) * | 2011-08-17 | 2019-03-28 | Glaxo Group Limited | Modified proteins and peptides |
| WO2019086548A1 (en) | 2017-10-31 | 2019-05-09 | Vib Vzw | Novel antigen-binding chimeric proteins and methods and uses thereof |
| GB201914468D0 (en) | 2019-10-07 | 2019-11-20 | Crescendo Biologics Ltd | Binding Molecules |
| EP3569618A1 (en) | 2018-05-19 | 2019-11-20 | Boehringer Ingelheim International GmbH | Antagonizing cd73 antibody |
| WO2019234220A1 (en) | 2018-06-09 | 2019-12-12 | Boehringer Ingelheim International Gmbh | Dll3-cd3 bispecific antibodies |
| US10633438B2 (en) | 2015-03-31 | 2020-04-28 | Vhsquared Limited | Polypeptides |
| FR3088640A1 (en) | 2018-10-14 | 2020-05-22 | Smart Diagnostix Pharma | NOVEL POLYPEPTIDE SPECIFICALLY BINDING TO PROTEIN P16 |
| WO2020221888A1 (en) | 2019-04-30 | 2020-11-05 | Vib Vzw | Cystic fibrosis transmembrane conductance regulator stabilizing agents |
| US10858418B2 (en) | 2011-06-23 | 2020-12-08 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| EP3797790A1 (en) | 2015-12-04 | 2021-03-31 | Boehringer Ingelheim International GmbH | Biparatopic polypeptides antagonizing wnt signaling in tumor cells |
| WO2021064137A2 (en) | 2019-10-02 | 2021-04-08 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| WO2021105438A1 (en) | 2019-11-27 | 2021-06-03 | Vib Vzw | Positive allosteric modulators of the calcium-sensing receptor |
| WO2021110817A1 (en) | 2019-12-06 | 2021-06-10 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting tnfa and ox40l |
| WO2021110816A1 (en) | 2019-12-06 | 2021-06-10 | Ablynx Nv | POLYPEPTIDES COMPRISING IMMUNOGLOBULIN SINGLE VARIABLE DOMAINS TARGETING TNFα AND IL-23 |
| WO2021116182A1 (en) | 2019-12-09 | 2021-06-17 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting il-13 and tslp |
| WO2021123360A1 (en) | 2019-12-20 | 2021-06-24 | Vib Vzw | Nanobody exchange chromatography |
| WO2021156490A2 (en) | 2020-02-06 | 2021-08-12 | Vib Vzw | Corona virus binders |
| WO2021170540A1 (en) | 2020-02-25 | 2021-09-02 | Vib Vzw | Leucine-rich repeat kinase 2 allosteric modulators |
| US11208476B2 (en) | 2019-12-09 | 2021-12-28 | Ablynx N.V. | Polypeptides comprising immunoglobulin single variable domains targeting IL-13 and TSLP |
| EP3932945A1 (en) | 2015-11-27 | 2022-01-05 | Ablynx NV | Polypeptides inhibiting cd40l |
| WO2022003156A1 (en) | 2020-07-02 | 2022-01-06 | Oncurious Nv | Ccr8 non-blocking binders |
| WO2022063984A1 (en) | 2020-09-25 | 2022-03-31 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting il-13 and ox40l |
| WO2022117572A2 (en) | 2020-12-02 | 2022-06-09 | Oncurious Nv | An ltbr agonist in combination therapy against cancer |
| WO2022117569A1 (en) | 2020-12-02 | 2022-06-09 | Oncurious Nv | A ccr8 antagonist antibody in combination with a lymphotoxin beta receptor agonist antibody in therapy against cancer |
| WO2022120388A2 (en) | 2020-12-04 | 2022-06-09 | Tidal Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles, and methods of synthesis and use thereof |
| RU2774823C2 (en) * | 2015-11-12 | 2022-06-23 | Аблинкс Нв | Improved tnf-binding agents |
| WO2022129637A1 (en) | 2020-12-18 | 2022-06-23 | Ablynx Nv | T cell recruiting polypeptides based on tcr alpha/beta reactivity |
| WO2022129560A1 (en) | 2020-12-18 | 2022-06-23 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting glypican-3 and t cell receptor |
| WO2022129572A1 (en) | 2020-12-18 | 2022-06-23 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting il-6 and tnf-alpha |
| WO2022136685A1 (en) | 2020-12-23 | 2022-06-30 | Vib Vzw | Antibody compositions for treatment of corona virus infection |
| WO2022167666A1 (en) | 2021-02-05 | 2022-08-11 | Vib Vzw | Sarbecovirus binders |
| WO2022175532A1 (en) | 2021-02-19 | 2022-08-25 | Vib Vzw | Cation-independent mannose-6-phosphate receptor binders |
| WO2022238550A1 (en) | 2021-05-12 | 2022-11-17 | Vib Vzw | Pan-specific corona virus binders |
| WO2023016828A2 (en) | 2021-07-30 | 2023-02-16 | Vib Vzw | Cation-independent mannose-6-phosphate receptor binders for targeted protein degradation |
| US11623952B2 (en) | 2019-06-21 | 2023-04-11 | Sorriso Pharmaceuticals, Inc. | IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides |
| US11644471B2 (en) | 2010-09-30 | 2023-05-09 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| WO2023093899A1 (en) | 2021-11-29 | 2023-06-01 | 江苏恒瑞医药股份有限公司 | Modified protein or polypeptide |
| US11667719B2 (en) | 2019-06-21 | 2023-06-06 | Sorriso Pharmaceuticals, Inc. | VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases |
| WO2023111266A1 (en) | 2021-12-17 | 2023-06-22 | Ablynx Nv | POLYPEPTIDES COMPRISING IMMUNOGLOBULIN SINGLE VARIABLE DOMAINS TARGETING TCRαβ, CD33 AND CD123 |
| WO2023110190A1 (en) | 2021-12-13 | 2023-06-22 | Heraeus Medical Gmbh | Tests and methods for detecting bacterial infection |
| US11684677B2 (en) | 2016-09-30 | 2023-06-27 | Sorriso Pharmaceuticals, Inc. | Compositions |
| WO2023135198A1 (en) | 2022-01-12 | 2023-07-20 | Vib Vzw | Human ntcp binders for therapeutic use and liver-specific targeted delivery |
| WO2023198848A1 (en) | 2022-04-13 | 2023-10-19 | Vib Vzw | An ltbr agonist in combination therapy against cancer |
| WO2023222825A1 (en) | 2022-05-18 | 2023-11-23 | Vib Vzw | Sarbecovirus spike s2 subunit binders |
| WO2023240156A1 (en) | 2022-06-08 | 2023-12-14 | Tidal Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles, and methods of synthesis and use thereof |
| WO2023242247A1 (en) | 2022-06-14 | 2023-12-21 | Ablynx Nv | Immunoglobulin single variable domains targeting t cell receptor |
| WO2024023271A1 (en) | 2022-07-27 | 2024-02-01 | Ablynx Nv | Polypeptides binding to a specific epitope of the neonatal fc receptor |
| WO2024068744A1 (en) | 2022-09-27 | 2024-04-04 | Vib Vzw | Antivirals against human parainfluenza virus |
| EP4357778A1 (en) | 2022-10-20 | 2024-04-24 | Heraeus Medical GmbH | Treatment of microbial infections diagnosed using the biomarker d-lactate |
| WO2024083843A1 (en) | 2022-10-18 | 2024-04-25 | Confo Therapeutics N.V. | Amino acid sequences directed against the melanocortin 4 receptor and polypeptides comprising the same for the treatment of mc4r-related diseases and disorders |
| WO2024133935A1 (en) | 2022-12-23 | 2024-06-27 | Ablynx Nv | Protein-based conjugation carriers |
| WO2024137731A2 (en) | 2022-12-21 | 2024-06-27 | Genzyme Corporation | Anti‑pd‑1×4‑1bb binding proteins |
| WO2024151515A2 (en) | 2023-01-09 | 2024-07-18 | Odyssey Therapeutics, Inc. | Anti-tnfr2 antigen-binding proteins and uses thereof |
| WO2024168279A2 (en) | 2023-02-10 | 2024-08-15 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) and methods for making and using the same |
| WO2024170756A1 (en) | 2023-02-17 | 2024-08-22 | Ablynx N.V. | Polypeptides binding to the neonatal fc receptor |
| WO2024175787A1 (en) | 2023-02-24 | 2024-08-29 | Vrije Universiteit Brussel | Anti-inflammatory pannexin 1 channel inhibitors |
| WO2024192065A1 (en) | 2023-03-14 | 2024-09-19 | Odyssey Therapeutics, Inc. | Anti-cd25 antigen-binding proteins and uses thereof |
| WO2024208816A1 (en) | 2023-04-03 | 2024-10-10 | Vib Vzw | Blood-brain barrier crossing antibodies |
| WO2024231447A1 (en) | 2023-05-08 | 2024-11-14 | Sanofi | Glycosylation of immunoglobulin single variable domains |
| WO2024238790A1 (en) | 2023-05-17 | 2024-11-21 | Odyssey Therapeutics, Inc. | Modified single-domain antibodies |
| US12173054B2 (en) | 2015-03-31 | 2024-12-24 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
| WO2024261235A1 (en) | 2023-06-22 | 2024-12-26 | Ablynx Nv | Chimeric proteins for modulating cytokine receptor activity |
| WO2025006846A2 (en) | 2023-06-29 | 2025-01-02 | Odyssey Therapeutics, Inc. | Anti-trailr2 antigen-binding proteins and uses thereof |
| WO2025008537A1 (en) | 2023-07-05 | 2025-01-09 | Ablynx Nv | Improved fcrn antagonists for treatment of igg-related diseases and disorders |
| US12234279B2 (en) | 2015-03-31 | 2025-02-25 | Sorriso Pharmaceuticals, Inc. | Peptide construct having a protease-cleavable linker |
| WO2025051767A1 (en) | 2023-09-04 | 2025-03-13 | Sanofi | Polypeptides for use in the treatment of glypican-3-expressing tumours |
| WO2025061919A1 (en) | 2023-09-22 | 2025-03-27 | Ablynx Nv | Bi- and multivalent albumin binders |
| WO2025080751A2 (en) | 2023-10-13 | 2025-04-17 | Odyssey Therapeutics, Inc. | Anti-cdh17 antigen-binding proteins and uses thereof |
| WO2025099632A1 (en) | 2023-11-08 | 2025-05-15 | Sanofi | Cd25 based lysosomal degrader and uses thereof |
| WO2025109176A1 (en) | 2023-11-22 | 2025-05-30 | Exevir Bio Bv | Optimized sarbecovirus spike s2 subunit binders and compositions comprising the same |
| WO2025114529A1 (en) | 2023-12-01 | 2025-06-05 | Ablynx Nv | Multispecific antibodies recognising human serum albumin, tcr and a tumor antigen recognising moiety |
| WO2025125577A1 (en) | 2023-12-14 | 2025-06-19 | Vib Vzw | Antibodies against influenza b virus |
| WO2025133253A2 (en) | 2023-12-22 | 2025-06-26 | Ablynx Nv | Protein-based conjugation carriers for intranuclear delivery |
| WO2025133166A1 (en) | 2023-12-22 | 2025-06-26 | Ablynx Nv | Protein-based carriers for site-specific amine conjugation |
| WO2025174825A2 (en) | 2024-02-12 | 2025-08-21 | Aera Therapeutics, Inc. | Delivery compositions |
| WO2025181155A1 (en) | 2024-02-26 | 2025-09-04 | Vib Vzw | Human beta-glucocerebrosidase binders and uses thereof |
| WO2025217240A1 (en) | 2024-04-10 | 2025-10-16 | Odyssey Therapeutics, Inc. | Anti-tnfr2 antigen-binding proteins and uses thereof |
| WO2025219231A1 (en) | 2024-04-15 | 2025-10-23 | Vib Vzw | Computer-implemented means and methods for the de novo design of antibodies targeting a specific epitope |
| USRE50682E1 (en) | 2014-05-16 | 2025-12-02 | Ablynx Nv | Immunoglobulin variable domains |
| WO2025255435A2 (en) | 2024-06-07 | 2025-12-11 | Odyssey Therapeutics, Inc. | Antigen-binding proteins against serum albumin and uses thereof |
| WO2025255558A2 (en) | 2024-06-07 | 2025-12-11 | Odyssey Therapeutics, Inc. | Anti-thymic stromal lymphopoietin (tslp) antigen-binding proteins and uses thereof |
| WO2025265116A1 (en) | 2024-06-21 | 2025-12-26 | Georgia State University Research Foundation, Inc. | Nanobodies to henipavirus and uses thereof |
| WO2025262150A2 (en) | 2024-06-18 | 2025-12-26 | Ablynx Nv | Antibody-recruiting molecules |
| WO2026006708A2 (en) | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Anti-cd25 antigen-binding proteins and uses thereof |
| WO2026006809A1 (en) | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Multispecific molecules binding tnfr2 and cd25 and uses thereof |
| WO2026008665A1 (en) | 2024-07-01 | 2026-01-08 | Vib Vzw | Binders of the pd-1•pd-l1 complex and their use |
| WO2026024863A2 (en) | 2024-07-24 | 2026-01-29 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) in combination with androgen receptor antagonists |
| WO2026030375A2 (en) | 2024-07-30 | 2026-02-05 | Genzyme Corporation | Lipid nanoparticles and methods of manufacture and use thereof |
| US12570736B2 (en) | 2019-06-21 | 2026-03-10 | Sorriso Pharmaceuticals, Inc. | Compositions |
| WO2026052756A1 (en) | 2024-09-05 | 2026-03-12 | Ablynx Nv | Her2 binding immunoglobulin single variable domains, constructs comprising the same and uses thereof |
Families Citing this family (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2012042026A1 (en) | 2010-09-30 | 2012-04-05 | Ablynx Nv | Biological materials related to c-met |
| EP3466972B1 (en) | 2011-06-23 | 2026-03-04 | Ablynx NV | Serum albumin binding proteins |
| US9346884B2 (en) | 2011-09-30 | 2016-05-24 | Ablynx N.V. | Biological materials related to c-Met |
| US10967298B2 (en) | 2012-03-15 | 2021-04-06 | Flodesign Sonics, Inc. | Driver and control for variable impedence load |
| US9458450B2 (en) | 2012-03-15 | 2016-10-04 | Flodesign Sonics, Inc. | Acoustophoretic separation technology using multi-dimensional standing waves |
| US9950282B2 (en) | 2012-03-15 | 2018-04-24 | Flodesign Sonics, Inc. | Electronic configuration and control for acoustic standing wave generation |
| US10704021B2 (en) | 2012-03-15 | 2020-07-07 | Flodesign Sonics, Inc. | Acoustic perfusion devices |
| US9725710B2 (en) | 2014-01-08 | 2017-08-08 | Flodesign Sonics, Inc. | Acoustophoresis device with dual acoustophoretic chamber |
| US11021699B2 (en) | 2015-04-29 | 2021-06-01 | FioDesign Sonics, Inc. | Separation using angled acoustic waves |
| US11708572B2 (en) | 2015-04-29 | 2023-07-25 | Flodesign Sonics, Inc. | Acoustic cell separation techniques and processes |
| US11377651B2 (en) | 2016-10-19 | 2022-07-05 | Flodesign Sonics, Inc. | Cell therapy processes utilizing acoustophoresis |
| US11474085B2 (en) | 2015-07-28 | 2022-10-18 | Flodesign Sonics, Inc. | Expanded bed affinity selection |
| US11459540B2 (en) | 2015-07-28 | 2022-10-04 | Flodesign Sonics, Inc. | Expanded bed affinity selection |
| RU2018119732A (en) * | 2015-10-30 | 2019-12-03 | Аблинкс Нв | POLYPEPTIDES AGAINST IL-23 |
| US11085035B2 (en) | 2016-05-03 | 2021-08-10 | Flodesign Sonics, Inc. | Therapeutic cell washing, concentration, and separation utilizing acoustophoresis |
| US11214789B2 (en) | 2016-05-03 | 2022-01-04 | Flodesign Sonics, Inc. | Concentration and washing of particles with acoustics |
| KR20190127655A (en) | 2016-10-19 | 2019-11-13 | 프로디자인 소닉스, 인크. | Affinity cell extraction by acoustics |
| WO2019038986A1 (en) | 2017-08-23 | 2019-02-28 | 本田技研工業株式会社 | Air bag device for saddle-type vehicles |
| JP2021507561A (en) | 2017-12-14 | 2021-02-22 | フロデザイン ソニックス, インク.Flodesign Sonics, Inc. | Acoustic Transducer Driver and Controller |
| IL277888B2 (en) * | 2018-07-10 | 2025-04-01 | Regeneron Pharma | Methods for mitigating drug target interference in an anti-drug antibody (ada) immunoassay |
| JP2023552865A (en) | 2020-12-14 | 2023-12-19 | 武田薬品工業株式会社 | conditional bispecific binding protein |
| CN113173978B (en) * | 2021-04-22 | 2024-03-01 | 温州医科大学 | A polypeptide with binding affinity to HPV16E6 protein and its application |
| AR128593A1 (en) | 2022-02-23 | 2024-05-22 | Takeda Pharmaceuticals Co | CONDITIONALLY BISPECIFIC BINDING PROTEINS |
Citations (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0368684A1 (en) | 1988-11-11 | 1990-05-16 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| WO1990014430A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | A new method for tapping the immunological repertoire |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| EP0488470A1 (en) | 1990-11-26 | 1992-06-03 | Akzo Nobel N.V. | Method for the production of antibodies |
| EP0589877A1 (en) | 1990-07-10 | 1994-04-06 | Cambridge Antibody Tech | Methods for producing members of specific binding pairs. |
| WO2000029004A1 (en) | 1998-11-18 | 2000-05-25 | Peptor Ltd. | Small functional units of antibody heavy chain variable regions |
| WO2001055216A1 (en) | 2000-01-26 | 2001-08-02 | Raven Biotechnologies, Inc. | Methods and compositions for generating human monoclonal antibodies |
| WO2002026829A1 (en) | 2000-09-25 | 2002-04-04 | Rega Stichting Vzw | Method for the production of human antibodies, antibodies thus obtained and their use in therapy and diagnosis |
| WO2004051268A1 (en) | 2002-12-03 | 2004-06-17 | Celltech R & D Limited | Assay for identifying antibody producing cells |
| WO2004062551A2 (en) | 2003-01-10 | 2004-07-29 | Ablynx N.V. | RECOMBINANT VHH SINGLE DOMAIN ANTIBODY FROM CAMELIDAE AGAINST VON WILLEBRAND FACTOR (vWF) OR AGAINST COLLAGEN |
| WO2004102198A2 (en) | 2003-05-15 | 2004-11-25 | Cytos Biotechnology Ag | Selection of b cells with specificity of interest: method of preparation and use |
| WO2004106377A1 (en) | 2003-05-30 | 2004-12-09 | Celltech R & D Limited | Methods for producing antibodies |
| WO2006038027A2 (en) | 2004-10-08 | 2006-04-13 | Domantis Limited | SINGLE DOMAIN ANTIBODIES AGAINST TNFRl AND METHODS OF USE THEREFOR |
| WO2006059108A2 (en) | 2004-12-02 | 2006-06-08 | Domantis Limited | ANTI-IL-IRl SINGLE DOMAIN ANTIBODIES AND THERAPEUTIC USES |
| WO2006079372A1 (en) | 2005-01-31 | 2006-08-03 | Ablynx N.V. | Method for generating variable domain sequences of heavy chain antibodies |
| WO2006122787A1 (en) | 2005-05-18 | 2006-11-23 | Ablynx Nv | Serum albumin binding proteins |
| WO2006122825A2 (en) | 2005-05-20 | 2006-11-23 | Ablynx Nv | Single domain vhh antibodies against von willebrand factor |
| WO2007063308A2 (en) | 2005-12-01 | 2007-06-07 | Domantis Limited | Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1 |
| WO2007063311A2 (en) | 2005-12-01 | 2007-06-07 | Domantis Limited | Competitive domain antibody formats that bind interleukin 1 receptor type 1 |
| WO2007066016A1 (en) | 2005-12-08 | 2007-06-14 | Centre National D'etudes Spatiales | Information transmission system |
| WO2007085814A1 (en) | 2006-01-24 | 2007-08-02 | Domantis Limited | Fusion proteins that contain natural junctions |
| WO2008020079A1 (en) | 2006-08-18 | 2008-02-21 | Ablynx N.V. | Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling |
| WO2008068280A1 (en) | 2006-12-05 | 2008-06-12 | Ablynx N.V. | Peptides capable of binding to serum proteins |
| WO2009068627A2 (en) | 2007-11-27 | 2009-06-04 | Ablynx N.V. | Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same |
| WO2009127691A1 (en) | 2008-04-17 | 2009-10-22 | Ablynx N.V. | Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same |
| WO2009138519A1 (en) | 2008-05-16 | 2009-11-19 | Ablynx Nv | AMINO ACID SEQUENCES DIRECTED AGAINST CXCR4 AND OTHER GPCRs AND COMPOUNDS COMPRISING THE SAME |
| WO2009138159A1 (en) | 2008-05-15 | 2009-11-19 | Mettler-Toledo (Albstadt) Gmbh | Functional unit having a function that can be invoked, and method for invoking the same |
| WO2010130832A2 (en) | 2009-05-15 | 2010-11-18 | Ablynx N.V. | Amino acid sequences directed against dickkopf-1 and polypeptides comprising the same for the treatment of diseases and disorders associated with bone loss and/or osteolytic lesions |
| WO2011007586A1 (en) | 2009-07-13 | 2011-01-20 | Sharp Kabushiki Kaisha | Methods and systems for reducing compression artifacts |
Family Cites Families (91)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE1545106C3 (en) | 1963-07-16 | 1979-05-31 | Union Carbide Corp., New York, N.Y. (V.St.A.) | Process for the production of linear polyarylene polyethers |
| US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| GB9016299D0 (en) * | 1990-07-25 | 1990-09-12 | Brien Caroline J O | Binding substances |
| US5608039A (en) * | 1990-10-12 | 1997-03-04 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Single chain B3 antibody fusion proteins and their uses |
| WO1994008943A1 (en) | 1992-10-21 | 1994-04-28 | Yoshitomi Pharmaceutical Industries, Ltd. | 2-amino-1,3-propanediol compound and immunosuppressant |
| JPH1180026A (en) | 1997-09-02 | 1999-03-23 | Yoshitomi Pharmaceut Ind Ltd | Novel immunosuppressants, methods of use and methods of identification thereof |
| ES2358576T3 (en) | 1999-07-05 | 2011-05-11 | K.U. LEUVEN RESEARCH & DEVELOPMENT | DETECTION OF THE ACTIVITY OF THE VON-WILLEBRAND FACTOR (VWF). |
| US20020155574A1 (en) | 2000-08-01 | 2002-10-24 | Novozymes A/S | Alpha-amylase mutants with altered properties |
| US20040053340A1 (en) | 2000-12-13 | 2004-03-18 | De Haard Johannes Joseph | Protein arrays |
| US9321832B2 (en) * | 2002-06-28 | 2016-04-26 | Domantis Limited | Ligand |
| FR2846667B1 (en) | 2002-11-06 | 2004-12-31 | Pasteur Institut | VARIABLE FRAGMENTS OF SINGLE-CHAIN CAMELIDE ANTIBODIES DIRECTED AGAINST BETA-AMYLOID PEPTIDE 1-42 AND THEIR APPLICATIONS FOR DIAGNOSIS AND TREATMENT OF NEUROAGREGATIVE DISEASES |
| WO2004041862A2 (en) | 2002-11-08 | 2004-05-21 | Ablynx N.V. | Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor |
| EP1578801A2 (en) * | 2002-12-27 | 2005-09-28 | Domantis Limited | Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand |
| US20050079574A1 (en) * | 2003-01-16 | 2005-04-14 | Genentech, Inc. | Synthetic antibody phage libraries |
| EP1688035A1 (en) | 2003-11-04 | 2006-08-09 | Japan Science and Technology Agency | Hyperlipemia/ hyperalbuminemia model animal |
| AU2005267720B2 (en) | 2004-08-05 | 2012-02-23 | Genentech, Inc. | Humanized anti-cmet antagonists |
| DE102005023617A1 (en) | 2005-05-21 | 2006-11-23 | Aspre Ag | Method for mixing colors in a display |
| US7989219B2 (en) * | 2005-05-31 | 2011-08-02 | Canon Kabushiki Kaisha | Bispecific capturing molecule |
| US7875465B2 (en) | 2005-05-31 | 2011-01-25 | Canon Kabushiki Kaisha | Target substance capturing molecule |
| JP2007008925A (en) * | 2005-05-31 | 2007-01-18 | Canon Inc | Target substance capture molecule |
| CN101415730B (en) | 2006-03-30 | 2013-04-10 | 诺瓦提斯公司 | Compositions and methods of use of c-Met antibodies |
| US7741273B2 (en) | 2006-04-13 | 2010-06-22 | Warsaw Orthopedic, Inc. | Drug depot implant designs |
| EP2064244B1 (en) * | 2006-08-03 | 2019-06-05 | MedImmune Limited | ANTIBODIES DIRECTED TO alphaVbeta6 AND USES THEREOF |
| EP2069402A2 (en) * | 2006-09-08 | 2009-06-17 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
| AU2007306340A1 (en) | 2006-10-11 | 2008-04-17 | Ablynx N.V. | Amino acid sequences that bind to serum proteins in a manner that is essentially independent of the pH, compounds comprising the same, and use thereof |
| CN101855241B (en) | 2006-12-08 | 2013-11-06 | 莱克康制药公司 | Monoclonal antibodies against ANGPTL3 |
| US8907065B2 (en) * | 2006-12-15 | 2014-12-09 | Ablynx N.V. | Polypeptides that modulate the interaction between cells of the immune system |
| EP2097451A2 (en) | 2006-12-22 | 2009-09-09 | Ablynx N.V. | Anti-chemokine (ccl2, ccl3, ccl5, cxcl11, cxcl12) single-domain antibodies |
| CA2678218A1 (en) | 2007-02-21 | 2008-08-28 | Ablynx N.V. | Amino acid sequences directed against vascular endothelial growth factor and polypeptides comprising the same for the treatment of conditions and diseases characterized by excessive and/or pathological angiogenesis or neovascularization |
| GB0706793D0 (en) | 2007-04-05 | 2007-05-16 | Evotec Ag | Compounds |
| AU2008252853B2 (en) | 2007-05-24 | 2011-12-01 | Ablynx N.V. | Amino acid sequences directed against RANK-L and polypeptides comprising the same for the treatment of bone diseases and disorders |
| EP2014681A1 (en) | 2007-07-12 | 2009-01-14 | Pierre Fabre Medicament | Novel antibodies inhibiting c-met dimerization, and uses thereof |
| AR062123A1 (en) | 2007-07-27 | 2008-10-15 | Inst Nac De Tecnologia Agropec | VHH MONOMERIC DOMAIN DERIVED FROM ANTI-VP6 CAMELID ANTIBODIES, DIMERIC DOMAIN, ROTAVIRUS IMMUNODETECTION METHOD, COMPOSITIONS, ROTAVIRUS INFECTION PREVENTION AND TREATMENT METHODS |
| WO2009032949A2 (en) * | 2007-09-04 | 2009-03-12 | The Regents Of The University Of California | High affinity anti-prostate stem cell antigen (psca) antibodies for cancer targeting and detection |
| WO2009042589A1 (en) * | 2007-09-24 | 2009-04-02 | Vanderbilt University | Monoclonal antibodies to respiratory syncytial virus and uses thereof |
| KR20100085964A (en) | 2007-11-05 | 2010-07-29 | 다니스코 유에스 인크. | Alpha-amylase variants with altered properties |
| EP2235063B1 (en) * | 2007-12-28 | 2015-09-02 | Genentech, Inc. | Anti-hedgehog antibodies |
| EP2250201B1 (en) * | 2008-01-29 | 2014-04-30 | Ludwig Institute for Cancer Research Ltd. | Membrane transporter napi2b (slc34a2) epitope for antibody therapy, antibodies directed thereto, and target for cancer therapy |
| US7858729B2 (en) | 2008-05-29 | 2010-12-28 | Novomer, Inc. | Methods of controlling molecular weight distribution of polymers and compositions thereof |
| ES2713864T3 (en) | 2008-06-05 | 2019-05-24 | Ablynx Nv | Amino acid sequences directed against envelope proteins of a virus and polypeptides comprising the same for the treatment of viral diseases |
| EP2143735A1 (en) * | 2008-07-10 | 2010-01-13 | Institut Pasteur | Variable domains of camelid heavy-chain antibodies directed against glial fibrillary acidic proteins |
| US20110200525A1 (en) * | 2008-10-09 | 2011-08-18 | Patz Jr Edward F | Vhh antibody fragments for use in the detection and treatment of cancer |
| US8372808B2 (en) | 2008-10-31 | 2013-02-12 | Wisconsin Alumni Research Foundation | Suppression of glial fibrillary acidic protein |
| WO2010100135A1 (en) † | 2009-03-05 | 2010-09-10 | Ablynx N.V. | Novel antigen binding dimer-complexes, methods of making/avoiding and uses thereof |
| TW201100104A (en) | 2009-03-27 | 2011-01-01 | Glaxo Group Ltd | Drug fusions and conjugates |
| AU2010233658B2 (en) | 2009-04-10 | 2013-11-28 | Ablynx Nv | Improved amino acid sequences directed against IL-6R and polypeptides comprising the same for the treatment of IL-6R related diseases and disorders |
| US8450888B2 (en) | 2009-04-20 | 2013-05-28 | General Electric Company | Integrated brushless starter/generator system |
| DK2451839T3 (en) | 2009-07-10 | 2020-07-13 | Ablynx Nv | METHOD FOR PRODUCING VARIABLE DOMAINS |
| WO2011064382A1 (en) * | 2009-11-30 | 2011-06-03 | Ablynx N.V. | Improved amino acid sequences directed against human respiratory syncytial virus (hrsv) and polypeptides comprising the same for the prevention and/or treatment of respiratory tract infections |
| RS67588B1 (en) | 2009-12-14 | 2026-01-30 | Ablynx Nv | Immunoglobulin single variable domain antibodies against ox40l, constructs and their therapeutic use |
| MX347613B (en) † | 2009-12-18 | 2017-05-04 | Sanofi Sa | Novel antagonist antibodies and their fab fragments against gpvi and uses thereof. |
| KR101758703B1 (en) | 2009-12-23 | 2017-07-18 | 에스바테크 - 어 노바티스 컴파니 엘엘씨 | Method for decreasing immunogenicity |
| AP2012006359A0 (en) | 2010-03-03 | 2012-08-31 | Boehringer Ingelheim Int | Biparatopic abeta binding polypeptides |
| ES2993335T3 (en) | 2010-03-10 | 2024-12-27 | Genmab As | Monoclonal antibodies against c-met |
| US8937164B2 (en) | 2010-03-26 | 2015-01-20 | Ablynx N.V. | Biological materials related to CXCR7 |
| AU2011247612A1 (en) | 2010-04-30 | 2012-12-06 | Ablynx Nv | Amino acid sequences of nanobodies directed against p19 subunit of the heterodimeric cytokine IL-23 |
| AU2011254557B2 (en) | 2010-05-20 | 2015-09-03 | Ablynx Nv | Biological materials related to HER3 |
| US11644471B2 (en) | 2010-09-30 | 2023-05-09 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| WO2012042026A1 (en) | 2010-09-30 | 2012-04-05 | Ablynx Nv | Biological materials related to c-met |
| CN103443126B (en) * | 2011-01-06 | 2016-11-23 | 葛兰素集团有限公司 | Ligands that bind TGF-beta receptor II |
| CN106039306A (en) | 2011-03-30 | 2016-10-26 | 埃博灵克斯股份有限公司 | Methods of treating immune disorders with single domain antibodies against TNF-alpha |
| WO2012130314A1 (en) † | 2011-03-31 | 2012-10-04 | Elara Pharmaceuticals Gmbh | Composition comprising docetaxel |
| PH12022550313A1 (en) | 2011-06-23 | 2023-01-23 | Ablynx Nv | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| EP3466972B1 (en) | 2011-06-23 | 2026-03-04 | Ablynx NV | Serum albumin binding proteins |
| US20150344568A1 (en) | 2011-06-23 | 2015-12-03 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| CN103842380A (en) | 2011-07-27 | 2014-06-04 | 葛兰素集团有限公司 | Anti-VEGF single variable domains fused to Fc domains |
| PH12014500380A1 (en) | 2011-08-17 | 2022-05-02 | Glaxo Group Ltd | Modified proteins and peptides |
| US9346884B2 (en) | 2011-09-30 | 2016-05-24 | Ablynx N.V. | Biological materials related to c-Met |
| US8614548B2 (en) | 2012-01-19 | 2013-12-24 | Sonoco Development Incorporated | Electroluminescent display and method for production |
| US9328174B2 (en) | 2012-05-09 | 2016-05-03 | Novartis Ag | Chemokine receptor binding polypeptides |
| WO2013177271A2 (en) | 2012-05-22 | 2013-11-28 | Owens Corning Intellectual Capital, Llc | Laminated foam product and methods for making laminated foam products |
| WO2014111550A1 (en) † | 2013-01-17 | 2014-07-24 | Glaxosmithkline Intellectual Property Development Limited | Modified anti-serum albumin binding proteins |
| DK3143403T3 (en) | 2014-05-16 | 2022-01-17 | Ablynx Nv | PROCEDURES FOR THE DETECTION AND / OR MEASUREMENT OF ANTI-DRUG ANTIBODIES, IN PARTICULAR, TREATMENT-INDUCTED ANTI-DRUG ANTIBODIES |
| HUE050007T2 (en) | 2014-05-16 | 2020-11-30 | Ablynx Nv | Immunoglobulin variable domains |
| CA2963712A1 (en) | 2014-10-21 | 2016-04-28 | Ablynx Nv | Treatment of il-6r related diseases |
| NO2768984T3 (en) | 2015-11-12 | 2018-06-09 | ||
| LT3374392T (en) | 2015-11-13 | 2022-01-25 | Ablynx Nv | IMPROVED SERUM ALBUMIN BINDING IMMUNOGLOBULIN VARIABLES |
| WO2017085172A2 (en) | 2015-11-18 | 2017-05-26 | Ablynx Nv | Improved serum albumin binders |
| KR20180083418A (en) | 2015-11-18 | 2018-07-20 | 머크 샤프 앤드 돔 코포레이션 | PD1 / CTLA4 binding agent |
| CR20180279A (en) | 2015-11-18 | 2018-08-24 | Merck Sharp & Dohme | CTLA4 BINDERS |
| SG11201804178YA (en) | 2015-11-18 | 2018-06-28 | Merck Sharp & Dohme | Pd1 and/or lag3 binders |
| US10626186B2 (en) | 2016-01-26 | 2020-04-21 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Anti-VWF D'D3 single-domain antibodies and methods of use |
| IL310340A (en) * | 2016-12-07 | 2024-03-01 | Ablynx Nv | Immunoglobulin sites with a single variable enhance serum albumin binding |
| KR102662499B1 (en) * | 2017-01-17 | 2024-05-02 | 아블린쓰 엔.브이. | Improved serum albumin binder |
| WO2018220235A1 (en) | 2017-06-02 | 2018-12-06 | Merck Patent Gmbh | Mmp13 binding immunoglobulins |
| US11813307B2 (en) | 2017-06-02 | 2023-11-14 | Merck Patent Gmbh | Polypeptides binding ADAMTS5, MMP13 and aggrecan |
| WO2018220225A1 (en) | 2017-06-02 | 2018-12-06 | Ablynx Nv | Aggrecan binding immunoglobulins |
| BR112019024333A2 (en) * | 2017-06-02 | 2020-07-28 | Merck Patent Gmbh | adamts binding immunoglobulins |
| MY204220A (en) | 2018-02-06 | 2024-08-16 | Ablynx Nv | Methods of treating initial episode of ttp with immunoglobulin single variable domains |
| AR120698A1 (en) | 2019-12-09 | 2022-03-09 | Ablynx Nv | POLYPEPTIDES COMPRISING SINGLE VARIABLE DOMAINS OF IMMUNOGLOBULIN TARGETING IL-13 AND TSLP |
| EP4262985A1 (en) | 2020-12-18 | 2023-10-25 | Ablynx N.V. | Polypeptides comprising immunoglobulin single variable domains targeting glypican-3 and t cell receptor |
-
2012
- 2012-06-25 PH PH1/2022/550313A patent/PH12022550313A1/en unknown
- 2012-06-25 RS RS20260072A patent/RS67664B1/en unknown
- 2012-06-25 PT PT151796695T patent/PT2974737T/en unknown
- 2012-06-25 PL PL15179669.5T patent/PL2974737T3/en unknown
- 2012-06-25 WO PCT/EP2012/062251 patent/WO2012175741A2/en not_active Ceased
- 2012-06-25 IL IL293163A patent/IL293163A/en unknown
- 2012-06-25 PL PL12729968.3T patent/PL2723769T5/en unknown
- 2012-06-25 PH PH1/2022/550311A patent/PH12022550311A1/en unknown
- 2012-06-25 PH PH1/2022/550309A patent/PH12022550309A1/en unknown
- 2012-06-25 IL IL293155A patent/IL293155B1/en unknown
- 2012-06-25 CA CA3142288A patent/CA3142288A1/en not_active Withdrawn
- 2012-06-25 CA CA2837998A patent/CA2837998C/en active Active
- 2012-06-25 KR KR1020197026729A patent/KR102246924B1/en active Active
- 2012-06-25 EP EP12729968.3A patent/EP2723769B2/en active Active
- 2012-06-25 BR BR112013032145-8A patent/BR112013032145B1/en active IP Right Grant
- 2012-06-25 KR KR1020137035011A patent/KR101965462B1/en active Active
- 2012-06-25 NZ NZ780183A patent/NZ780183A/en unknown
- 2012-06-25 CA CA3141978A patent/CA3141978A1/en active Pending
- 2012-06-25 AU AU2012273929A patent/AU2012273929B2/en active Active
- 2012-06-25 SG SG10201805064SA patent/SG10201805064SA/en unknown
- 2012-06-25 DK DK12729968.3T patent/DK2723769T4/en active
- 2012-06-25 PH PH1/2022/550310A patent/PH12022550310A1/en unknown
- 2012-06-25 IN IN373CHN2014 patent/IN2014CN00373A/en unknown
- 2012-06-25 BR BR122017005075-3A patent/BR122017005075B1/en active IP Right Grant
- 2012-06-25 ES ES12729968T patent/ES2622006T5/en active Active
- 2012-06-25 MX MX2013014614A patent/MX350074B/en active IP Right Grant
- 2012-06-25 US US14/128,681 patent/US20180009888A9/en active Pending
- 2012-06-25 FI FIEP15179669.5T patent/FI2974737T3/en active
- 2012-06-25 CN CN201810379010.9A patent/CN108659120A/en active Pending
- 2012-06-25 KR KR1020247007180A patent/KR102929408B1/en active Active
- 2012-06-25 KR KR1020227026895A patent/KR102880093B1/en active Active
- 2012-06-25 IL IL324872A patent/IL324872A/en unknown
- 2012-06-25 RU RU2014102007A patent/RU2700630C2/en active
- 2012-06-25 KR KR1020197008750A patent/KR102240318B1/en active Active
- 2012-06-25 CN CN201810379995.5A patent/CN108653728B/en active Active
- 2012-06-25 CN CN201810382807.4A patent/CN108663504B/en active Active
- 2012-06-25 SG SG10201605048XA patent/SG10201605048XA/en unknown
- 2012-06-25 PH PH1/2022/550312A patent/PH12022550312A1/en unknown
- 2012-06-25 IL IL229503A patent/IL229503B/en unknown
- 2012-06-25 CN CN201280030902.9A patent/CN104203975B/en active Active
- 2012-06-25 JP JP2014516387A patent/JP6258199B2/en active Active
- 2012-06-25 BR BR122018012485-7A patent/BR122018012485B1/en active IP Right Grant
- 2012-06-25 KR KR1020217011601A patent/KR102430693B1/en active Active
- 2012-06-25 LT LTEP15179669.5T patent/LT2974737T/en unknown
- 2012-06-25 CN CN201810379994.0A patent/CN108659121A/en active Pending
- 2012-06-25 HR HRP20260089TT patent/HRP20260089T1/en unknown
- 2012-06-25 LT LTEP12729968.3T patent/LT2723769T/en unknown
- 2012-06-25 PH PH1/2013/502669A patent/PH12013502669B1/en unknown
- 2012-06-25 KR KR1020187020494A patent/KR102025035B1/en active Active
- 2012-06-25 IL IL250396A patent/IL250396B/en unknown
- 2012-06-25 SG SG10201707604SA patent/SG10201707604SA/en unknown
- 2012-06-25 SG SG2013084678A patent/SG194982A1/en unknown
- 2012-06-25 PT PT127299683T patent/PT2723769T/en unknown
- 2012-06-25 HU HUE12729968A patent/HUE031828T2/en unknown
-
2013
- 2013-12-10 ZA ZA2013/09295A patent/ZA201309295B/en unknown
- 2013-12-11 MX MX2018007826A patent/MX2018007826A/en unknown
-
2017
- 2017-04-20 JP JP2017083475A patent/JP6982400B2/en active Active
- 2017-06-06 US US15/615,197 patent/US11192937B2/en active Active
- 2017-06-06 US US15/615,281 patent/US11192938B2/en active Active
- 2017-06-22 PH PH12017501178A patent/PH12017501178A1/en unknown
- 2017-06-27 AU AU2017204339A patent/AU2017204339B2/en active Active
-
2018
- 2018-04-20 AU AU2018202782A patent/AU2018202782B2/en active Active
- 2018-05-10 US US15/975,834 patent/US20180355031A1/en not_active Abandoned
- 2018-07-02 JP JP2018126032A patent/JP6869923B2/en active Active
-
2019
- 2019-03-08 AU AU2019201606A patent/AU2019201606B2/en active Active
-
2020
- 2020-03-18 US US16/822,186 patent/US10858418B2/en active Active
- 2020-03-19 US US16/823,412 patent/US12006352B2/en active Active
- 2020-09-10 AU AU2020230299A patent/AU2020230299B2/en active Active
-
2021
- 2021-03-10 AU AU2021201506A patent/AU2021201506B2/en active Active
- 2021-04-14 JP JP2021068327A patent/JP2021107426A/en active Pending
- 2021-08-23 US US17/408,987 patent/US12516105B2/en active Active
- 2021-08-23 US US17/408,893 patent/US20220298227A9/en active Pending
- 2021-08-23 US US17/408,937 patent/US20210388062A1/en active Pending
- 2021-08-23 US US17/409,019 patent/US20210403536A1/en active Pending
- 2021-11-25 JP JP2021191076A patent/JP2022031790A/en active Pending
-
2023
- 2023-04-13 US US18/299,871 patent/US20230242620A1/en active Pending
-
2024
- 2024-01-17 AU AU2024200309A patent/AU2024200309A1/en active Pending
- 2024-02-02 JP JP2024014906A patent/JP2024050769A/en active Pending
Patent Citations (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0368684A1 (en) | 1988-11-11 | 1990-05-16 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| WO1990014430A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | A new method for tapping the immunological repertoire |
| EP0589877A1 (en) | 1990-07-10 | 1994-04-06 | Cambridge Antibody Tech | Methods for producing members of specific binding pairs. |
| EP0774511A1 (en) | 1990-07-10 | 1997-05-21 | Cambridge Antibody Technology Limited | Methods of producing members of specific binding pairs |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| EP0488470A1 (en) | 1990-11-26 | 1992-06-03 | Akzo Nobel N.V. | Method for the production of antibodies |
| WO2000029004A1 (en) | 1998-11-18 | 2000-05-25 | Peptor Ltd. | Small functional units of antibody heavy chain variable regions |
| WO2001055216A1 (en) | 2000-01-26 | 2001-08-02 | Raven Biotechnologies, Inc. | Methods and compositions for generating human monoclonal antibodies |
| WO2002026829A1 (en) | 2000-09-25 | 2002-04-04 | Rega Stichting Vzw | Method for the production of human antibodies, antibodies thus obtained and their use in therapy and diagnosis |
| WO2004051268A1 (en) | 2002-12-03 | 2004-06-17 | Celltech R & D Limited | Assay for identifying antibody producing cells |
| WO2004062551A2 (en) | 2003-01-10 | 2004-07-29 | Ablynx N.V. | RECOMBINANT VHH SINGLE DOMAIN ANTIBODY FROM CAMELIDAE AGAINST VON WILLEBRAND FACTOR (vWF) OR AGAINST COLLAGEN |
| WO2004102198A2 (en) | 2003-05-15 | 2004-11-25 | Cytos Biotechnology Ag | Selection of b cells with specificity of interest: method of preparation and use |
| WO2004106377A1 (en) | 2003-05-30 | 2004-12-09 | Celltech R & D Limited | Methods for producing antibodies |
| EP1633787A1 (en) | 2003-05-30 | 2006-03-15 | Celltech R & D Limited | Methods for producing antibodies |
| WO2006038027A2 (en) | 2004-10-08 | 2006-04-13 | Domantis Limited | SINGLE DOMAIN ANTIBODIES AGAINST TNFRl AND METHODS OF USE THEREFOR |
| WO2006059108A2 (en) | 2004-12-02 | 2006-06-08 | Domantis Limited | ANTI-IL-IRl SINGLE DOMAIN ANTIBODIES AND THERAPEUTIC USES |
| WO2006079372A1 (en) | 2005-01-31 | 2006-08-03 | Ablynx N.V. | Method for generating variable domain sequences of heavy chain antibodies |
| WO2006122787A1 (en) | 2005-05-18 | 2006-11-23 | Ablynx Nv | Serum albumin binding proteins |
| WO2006122825A2 (en) | 2005-05-20 | 2006-11-23 | Ablynx Nv | Single domain vhh antibodies against von willebrand factor |
| WO2007063308A2 (en) | 2005-12-01 | 2007-06-07 | Domantis Limited | Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1 |
| WO2007063311A2 (en) | 2005-12-01 | 2007-06-07 | Domantis Limited | Competitive domain antibody formats that bind interleukin 1 receptor type 1 |
| WO2007066016A1 (en) | 2005-12-08 | 2007-06-14 | Centre National D'etudes Spatiales | Information transmission system |
| WO2007085814A1 (en) | 2006-01-24 | 2007-08-02 | Domantis Limited | Fusion proteins that contain natural junctions |
| WO2008020079A1 (en) | 2006-08-18 | 2008-02-21 | Ablynx N.V. | Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling |
| WO2008068280A1 (en) | 2006-12-05 | 2008-06-12 | Ablynx N.V. | Peptides capable of binding to serum proteins |
| WO2009068627A2 (en) | 2007-11-27 | 2009-06-04 | Ablynx N.V. | Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same |
| WO2009127691A1 (en) | 2008-04-17 | 2009-10-22 | Ablynx N.V. | Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same |
| WO2009138159A1 (en) | 2008-05-15 | 2009-11-19 | Mettler-Toledo (Albstadt) Gmbh | Functional unit having a function that can be invoked, and method for invoking the same |
| WO2009138519A1 (en) | 2008-05-16 | 2009-11-19 | Ablynx Nv | AMINO ACID SEQUENCES DIRECTED AGAINST CXCR4 AND OTHER GPCRs AND COMPOUNDS COMPRISING THE SAME |
| WO2010130832A2 (en) | 2009-05-15 | 2010-11-18 | Ablynx N.V. | Amino acid sequences directed against dickkopf-1 and polypeptides comprising the same for the treatment of diseases and disorders associated with bone loss and/or osteolytic lesions |
| WO2011007586A1 (en) | 2009-07-13 | 2011-01-20 | Sharp Kabushiki Kaisha | Methods and systems for reducing compression artifacts |
Non-Patent Citations (21)
| Title |
|---|
| "Guideline on the Clinical Investigation of the Pharmacokinetics of Therapeutic Proteins", 27 January 2007, pages: 4,5 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883 |
| CONRATH ET AL., JBC 276, vol. 10, no. 9, 2001, pages 7346 |
| F. AUSUBEL ET AL,: "Current protocols in molecular biology", 1987, GREEN PUBLISHING AND WILEY INTERSCIENCE |
| JANEWAY ET AL.: "Immunobiology(6th Ed.),", 2005, GARLAND SCIENCE PUBLISHING/CHURCHILL LIVINGSTONE |
| KABAT ET AL.: "Sequence of proteins of immunological interest", US PUBLIC HEALTH SERVICES |
| KENNETH, A ET AL.: "Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists" |
| LEWIN: "Genes II", 1985, JOHN WILEY & SONS |
| LOYET ET AL., J. IMMUNOL. METH., vol. 345, 2009, pages 17 - 28 |
| M GIBALDI; D PERRON: "Pharmacokinetics", 1982, MARCEL DEKKER |
| MIRE-SLUIS ET AL., J. IMMUNOL. METH., vol. 289, 2004, pages 1 - 16 |
| MUYLDERMANS, REVIEWS IN MOL. BIOTECHNOL., vol. 74, 2001, pages 27 |
| NIEBA ET AL., PROTEIN ENGINEERING, vol. 10, 1997, pages 435 - 444 |
| OLD ET AL.: "Principles of Gene Manipulation: An Introduction to Genetic Engineering, 2nd edition,", 1981, UNIVERSITY OF CALIFORNIA PRESS |
| PENG ET AL., JOURNAL OF PHARMACEUTICAL AND BIOMEDICAL ANALYSIS, vol. 54, 2011, pages 629 - 635 |
| PETERS ET AL.: "Pharmacokinete analysis: A Practical Approach", 1996 |
| RIECHMANN; MUYLDERMANS, J. IMMUNOL. METHODS, vol. 240, no. 1-2, 23 June 2000 (2000-06-23), pages 185 - 195 |
| ROITT ET AL.: "Immunology(6th. Ed.),", 2001, MOSBY/ELSEVIER |
| ROITT ET AL.: "Roitt's Essential Immunology, 10th Ed.", 2001, BLACKWELL PUBLISHING |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual(2nd.Ed.)", vol. 1-3, 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SHANKAR ET AL., JOURNAL OF PHARMACEUTICAL AND BIOMEDICAL ANALYSIS, vol. 48, 2008, pages 1267 - 1281 |
Cited By (238)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10253313B2 (en) | 2009-10-30 | 2019-04-09 | Novartis Ag | Universal fibronectin type III bottom-side binding domain libraries |
| US9139825B2 (en) | 2009-10-30 | 2015-09-22 | Novartis Ag | Universal fibronectin type III bottom-side binding domain libraries |
| US9428583B2 (en) | 2010-05-06 | 2016-08-30 | Novartis Ag | Compositions and methods of use for therapeutic low density lipoprotein-related protein 6 (LRP6) multivalent antibodies |
| US11644471B2 (en) | 2010-09-30 | 2023-05-09 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US10858418B2 (en) | 2011-06-23 | 2020-12-08 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US11192937B2 (en) | 2011-06-23 | 2021-12-07 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US12516105B2 (en) | 2011-06-23 | 2026-01-06 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US12006352B2 (en) | 2011-06-23 | 2024-06-11 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| US11192938B2 (en) | 2011-06-23 | 2021-12-07 | Ablynx N.V. | Serum albumin binding proteins containing immunoglobulin single variable domains |
| EP3020728A1 (en) | 2011-06-23 | 2016-05-18 | Ablynx N.V. | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains |
| JP2020054374A (en) * | 2011-08-17 | 2020-04-09 | グラクソ グループ リミテッドGlaxo Group Limited | Modified proteins and peptides |
| AU2016277685B2 (en) * | 2011-08-17 | 2019-03-28 | Glaxo Group Limited | Modified proteins and peptides |
| US10808040B2 (en) | 2011-08-17 | 2020-10-20 | Glaxo Group Limited | Modified proteins and peptides |
| WO2013073968A3 (en) * | 2011-09-12 | 2013-06-20 | Industrial Research Limited | Agents for modulation of cell signalling |
| USRE47860E1 (en) | 2011-11-04 | 2020-02-18 | Novartis Ag | Methods of treating cancer with low density lipoprotein-related protein 6 (LRP6)—half life extender constructs |
| US9173960B2 (en) | 2011-11-04 | 2015-11-03 | Novartis Ag | Methods of treating cancer with low density lipoprotein-related protein 6 (LRP6)—half life extender constructs |
| US9328174B2 (en) | 2012-05-09 | 2016-05-03 | Novartis Ag | Chemokine receptor binding polypeptides |
| US11466089B2 (en) | 2012-05-09 | 2022-10-11 | Ablynx N.V. | Chemokine receptor binding polypeptides |
| US9688763B2 (en) | 2012-05-09 | 2017-06-27 | Novartis Ag | Chemokine receptor binding polypeptides |
| US20140161796A1 (en) * | 2012-09-13 | 2014-06-12 | Andreas Loew | Single chain proteins with c-terminal modifications |
| WO2014043509A3 (en) * | 2012-09-13 | 2014-05-30 | Novartis Ag | Single domain antibody with c-terminal modification |
| US11485777B2 (en) | 2014-05-16 | 2022-11-01 | Ablynx N.V. | Immunoglobulin variable domains |
| JP7454525B2 (en) | 2014-05-16 | 2024-03-22 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domains |
| RU2809788C2 (en) * | 2014-05-16 | 2023-12-18 | Аблинкс Нв | Improved immunoglobulin variable domains |
| AU2022279374B2 (en) * | 2014-05-16 | 2026-01-15 | Ablynx Nv | Improved immunoglobulin variable domains |
| IL248636B (en) * | 2014-05-16 | 2022-12-01 | Ablynx Nv | Improved immunoglobulin variable domains |
| JP2017518072A (en) * | 2014-05-16 | 2017-07-06 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domains |
| US12553901B2 (en) * | 2014-05-16 | 2026-02-17 | Ablynx N.V. | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| EP3248986A2 (en) | 2014-05-16 | 2017-11-29 | Ablynx NV | Immunoglobulin variable domains |
| JP2021006563A (en) * | 2014-05-16 | 2021-01-21 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domains |
| EP3248986A3 (en) * | 2014-05-16 | 2017-12-20 | Ablynx NV | Immunoglobulin variable domains |
| JP7098439B2 (en) | 2014-05-16 | 2022-07-11 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domain |
| AU2020202855B2 (en) * | 2014-05-16 | 2022-12-08 | Ablynx Nv | Improved immunoglobulin variable domains |
| AU2020202570B2 (en) * | 2014-05-16 | 2022-12-08 | Ablynx Nv | Improved immunoglobulin variable domains |
| IL248636B2 (en) * | 2014-05-16 | 2023-04-01 | Ablynx Nv | Improved immunoglobulin variable domains |
| EP4707303A2 (en) | 2014-05-16 | 2026-03-11 | Ablynx NV | Improved immunoglobulin variable domains |
| USRE50682E1 (en) | 2014-05-16 | 2025-12-02 | Ablynx Nv | Immunoglobulin variable domains |
| IL295534B2 (en) * | 2014-05-16 | 2025-03-01 | Ablynx Nv | Improved immunoglobulin variable domains |
| JP2021130681A (en) * | 2014-05-16 | 2021-09-09 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domain |
| US11708404B2 (en) | 2014-05-16 | 2023-07-25 | Ablynx N.V. | Immunoglobulin variable domains |
| US11319364B2 (en) | 2014-05-16 | 2022-05-03 | Ablynx N.V. | Immunoglobulin variable domains |
| US11312764B2 (en) * | 2014-05-16 | 2022-04-26 | Ablynx N.V. | Immunoglobulin variable domains |
| AU2015261467B2 (en) * | 2014-05-16 | 2020-12-17 | Ablynx Nv | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| US11312765B2 (en) | 2014-05-16 | 2022-04-26 | Ablynx N.V. | Immunoglobulin variable domains |
| JP2018162297A (en) * | 2014-05-16 | 2018-10-18 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domains |
| EP3982124A1 (en) | 2014-05-16 | 2022-04-13 | Ablynx NV | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| EP3248986B1 (en) | 2014-05-16 | 2022-01-26 | Ablynx NV | Immunoglobulin variable domains |
| US11220539B2 (en) | 2014-05-16 | 2022-01-11 | Ablynx N.V. | Immunoglobulin variable domains |
| RU2845084C2 (en) * | 2014-05-16 | 2025-08-13 | Аблинкс Нв | Improved immunoglobulin variable domains |
| IL295534B1 (en) * | 2014-05-16 | 2024-11-01 | Ablynx Nv | Enhanced immunoglobulin variable sites |
| CN109053885A (en) * | 2014-05-16 | 2018-12-21 | 埃博灵克斯股份有限公司 | Improved immunoglobulin variable domain domain |
| JP7325928B2 (en) | 2014-05-16 | 2023-08-15 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domains |
| CN106661100A (en) * | 2014-05-16 | 2017-05-10 | 埃博灵克斯股份有限公司 | Improved immunoglobulin variable domains |
| US20170082637A1 (en) * | 2014-05-16 | 2017-03-23 | Ablynx N.V. | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| US11485778B2 (en) * | 2014-05-16 | 2022-11-01 | Ablynx N.V. | Immunoglobulin variable domains |
| JP2024041939A (en) * | 2014-05-16 | 2024-03-27 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domains |
| US11009511B2 (en) | 2014-05-16 | 2021-05-18 | Ablynx N.V. | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| JP2024069377A (en) * | 2014-05-16 | 2024-05-21 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domains |
| WO2015173342A1 (en) | 2014-05-16 | 2015-11-19 | Ablynx Nv | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| US20210341490A1 (en) * | 2014-05-16 | 2021-11-04 | Ablynx N.V. | Methods for detecting and/or measuring anti-drug antibodies, in particular treatment-emergent anti-drug antibodies |
| US12180268B2 (en) | 2014-05-16 | 2024-12-31 | Ablynx N.V. | Immunoglobulin variable domains |
| CN113717280A (en) * | 2014-05-16 | 2021-11-30 | 埃博灵克斯股份有限公司 | Improved immunoglobulin variable domains |
| EP3702369A1 (en) | 2014-05-16 | 2020-09-02 | Ablynx NV | Immunoglobulin variable domains |
| RU2746738C2 (en) * | 2014-05-16 | 2021-04-20 | Аблинкс Нв | Improved variable domains of immunoglobulins |
| WO2015173325A3 (en) * | 2014-05-16 | 2016-02-18 | Ablynx Nv | Improved immunoglobulin variable domains |
| EP3693386A1 (en) | 2014-05-16 | 2020-08-12 | Ablynx NV | Immunoglobulin variable domains |
| AU2015261536B2 (en) * | 2014-05-16 | 2020-05-07 | Ablynx Nv | Improved immunoglobulin variable domains |
| JP7471987B2 (en) | 2014-05-16 | 2024-04-22 | アブリンクス エン.ヴェー. | Improved immunoglobulin variable domains |
| EP3143042B1 (en) | 2014-05-16 | 2020-06-10 | Ablynx N.V. | Immunoglobulin variable domains |
| WO2015193452A1 (en) | 2014-06-18 | 2015-12-23 | Ablynx Nv | Kv1.3 binding immunoglobulins |
| WO2016118733A1 (en) | 2015-01-21 | 2016-07-28 | Inhibrx Biopharma LLC | Non-immunogenic single domain antibodies |
| EP3247407A4 (en) * | 2015-01-21 | 2018-08-22 | Inhibrx LP | Non-immunogenic single domain antibodies |
| EP3247407A1 (en) | 2015-01-21 | 2017-11-29 | Inhibrx LP | Non-immunogenic single domain antibodies |
| US10633438B2 (en) | 2015-03-31 | 2020-04-28 | Vhsquared Limited | Polypeptides |
| US12173054B2 (en) | 2015-03-31 | 2024-12-24 | Sorriso Pharmaceuticals, Inc. | Polypeptides |
| US12234279B2 (en) | 2015-03-31 | 2025-02-25 | Sorriso Pharmaceuticals, Inc. | Peptide construct having a protease-cleavable linker |
| WO2016156570A1 (en) | 2015-04-02 | 2016-10-06 | Ablynx N.V. | Bispecific cxcr4-cd-4 polypeptides with potent anti-hiv activity |
| WO2016180969A1 (en) | 2015-05-13 | 2016-11-17 | Ablynx N.V. | T cell recruiting polypeptides based on tcr alpha/beta reactivity |
| EP4345112A2 (en) | 2015-05-13 | 2024-04-03 | Ablynx N.V. | T cell recruiting polypeptides based on cd3 reactivity |
| EP3611192A2 (en) | 2015-05-13 | 2020-02-19 | Ablynx N.V. | T cell recruiting polypeptides based on tcr alpha/beta reactivity |
| WO2016180982A1 (en) | 2015-05-13 | 2016-11-17 | Ablynx N.V. | T cell recruiting polypeptides based on cd3 reactivity |
| EP4524163A2 (en) | 2015-05-13 | 2025-03-19 | Ablynx N.V. | T cell recruiting polypeptides based on tcr alpha/beta reactivity |
| RU2741110C2 (en) * | 2015-11-02 | 2021-01-22 | Сингх Биотекнолоджи, Ллк | Single-domain antibodies directed against intracellular antigens |
| EP3371215A4 (en) * | 2015-11-02 | 2019-10-02 | Singh Biotechnology, LLC | SINGLE DOMAIN ANTIBODIES DIRECTED AGAINST INTRACELLULAR ANTIGENS |
| US11214626B2 (en) | 2015-11-02 | 2022-01-04 | Singh Biotechnology, Llc | Single domain antibodies directed against arachidonate 12-lipoxygenase |
| AU2016349876B2 (en) * | 2015-11-02 | 2023-07-06 | Singh Biotechnology, Llc | Single domain antibodies directed against intracellular antigens |
| IL258742A (en) * | 2015-11-02 | 2018-06-28 | Singh Biotechnology Llc | Monoclonal antibodies against intracellular antigens |
| EP3266798A3 (en) * | 2015-11-12 | 2018-03-28 | Ablynx NV | Improved tnf binders |
| AU2016352695B2 (en) * | 2015-11-12 | 2023-07-27 | Ablynx Nv | Improved P2X7 receptor binders and polypeptides comprising the same |
| US10875918B2 (en) | 2015-11-12 | 2020-12-29 | Ablynx N.V. | P2X7 receptor binders and polypeptides comprising the same |
| WO2017081320A1 (en) * | 2015-11-12 | 2017-05-18 | Ablynx Nv | Improved tnf binders |
| WO2017081265A1 (en) * | 2015-11-12 | 2017-05-18 | Ablynx Nv | Improved p2x7 receptor binders and polypeptides comprising the same |
| US9745372B2 (en) | 2015-11-12 | 2017-08-29 | Ablynx N.V. | TNF binders |
| US10544211B2 (en) | 2015-11-12 | 2020-01-28 | Ablynx N.V. | TNF binders |
| CN108431039B (en) * | 2015-11-12 | 2022-06-28 | 埃博灵克斯股份有限公司 | Improved P2X7 receptor binding agents and polypeptides comprising the same |
| EP3266798A2 (en) | 2015-11-12 | 2018-01-10 | Ablynx NV | Improved tnf binders |
| RU2774823C2 (en) * | 2015-11-12 | 2022-06-23 | Аблинкс Нв | Improved tnf-binding agents |
| CN108431039A (en) * | 2015-11-12 | 2018-08-21 | 埃博灵克斯股份有限公司 | Improved P2X7 receptor-binding agents and the polypeptide comprising it |
| AU2016351710B2 (en) * | 2015-11-13 | 2023-08-03 | Ablynx Nv | Improved serum albumin-binding immunoglobulin variable domains |
| CN108290943A (en) * | 2015-11-13 | 2018-07-17 | 埃博灵克斯股份有限公司 | Improved serum albumin-binding immunoglobulin variable domains |
| CN115925919A (en) * | 2015-11-13 | 2023-04-07 | 埃博灵克斯股份有限公司 | Improved serum albumin-binding immunoglobulin variable domains |
| US11142569B2 (en) | 2015-11-13 | 2021-10-12 | Ablynx N.V. | Serum albumin-binding immunoglobulin variable domains |
| EP3974449A1 (en) | 2015-11-13 | 2022-03-30 | Ablynx NV | Improved serum albumin-binding immunoglobulin variable domains |
| WO2017080850A1 (en) | 2015-11-13 | 2017-05-18 | Ablynx Nv | Improved serum albumin-binding immunoglobulin variable domains |
| EP3374392B1 (en) * | 2015-11-13 | 2021-11-24 | Ablynx NV | Improved serum albumin-binding immunoglobulin variable domains |
| WO2017087588A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Ctla4 binders |
| US11649290B2 (en) | 2015-11-18 | 2023-05-16 | Merck Sharp & Dohme Llc | CTLA4 binders |
| AU2016357460B2 (en) * | 2015-11-18 | 2023-07-27 | Ablynx Nv | Improved serum albumin binders |
| US11332519B2 (en) | 2015-11-18 | 2022-05-17 | Ablynx N.V. | Serum albumin binders |
| WO2017087589A2 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | Pd1 and/or lag3 binders |
| WO2017085172A2 (en) | 2015-11-18 | 2017-05-26 | Ablynx Nv | Improved serum albumin binders |
| WO2017087587A1 (en) | 2015-11-18 | 2017-05-26 | Merck Sharp & Dohme Corp. | PD1/CTLA4 Binders |
| WO2017085172A3 (en) * | 2015-11-18 | 2017-06-29 | Ablynx Nv | Improved serum albumin binders |
| EP3932945A1 (en) | 2015-11-27 | 2022-01-05 | Ablynx NV | Polypeptides inhibiting cd40l |
| US11952418B2 (en) | 2015-12-04 | 2024-04-09 | Boehringer Ingelheim International Gmbh | Biparatopic polypeptides antagonizing Wnt signaling in tumor cells |
| EP3797790A1 (en) | 2015-12-04 | 2021-03-31 | Boehringer Ingelheim International GmbH | Biparatopic polypeptides antagonizing wnt signaling in tumor cells |
| IL263704B1 (en) * | 2016-06-23 | 2024-05-01 | Ablynx Nv | Improved pharmacokinetic testing for single immunoglobulin variable sites |
| IL263704B2 (en) * | 2016-06-23 | 2024-09-01 | Ablynx Nv | Improved pharmacokinetic testing for single immunoglobulin variable sites |
| AU2017281421B2 (en) * | 2016-06-23 | 2024-07-25 | Ablynx N.V. | Improved pharmacokinetic assays for immunoglobulin single variable domains |
| EP4119944A1 (en) | 2016-06-23 | 2023-01-18 | Ablynx N.V. | Improved pharmacokinetic assays for immunoglobulin single variable domains |
| WO2017220645A1 (en) | 2016-06-23 | 2017-12-28 | Ablynx N.V. | Improved pharmacokinetic assays for immunoglobulin single variable domains |
| US20190195866A1 (en) * | 2016-06-23 | 2019-06-27 | Ablynx N.V. | Improved pharmacokinetic assays for immunoglobulin single variable domains |
| WO2018050833A1 (en) | 2016-09-15 | 2018-03-22 | Ablynx Nv | Immunoglobulin single variable domains directed against macrophage migration inhibitory factor |
| US11684677B2 (en) | 2016-09-30 | 2023-06-27 | Sorriso Pharmaceuticals, Inc. | Compositions |
| WO2018091606A1 (en) | 2016-11-16 | 2018-05-24 | Ablynx Nv | T cell recruiting polypeptides capable of binding cd123 and tcr alpha/beta |
| WO2018104444A1 (en) | 2016-12-07 | 2018-06-14 | Ablynx Nv | Improved serum albumin binding immunoglobulin single variable domains |
| EP4471058A2 (en) | 2017-01-17 | 2024-12-04 | Ablynx NV | Improved serum albumin binders |
| EP4442708A2 (en) | 2017-01-17 | 2024-10-09 | Ablynx NV | Improved serum albumin binders |
| WO2018134234A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| WO2018134235A1 (en) | 2017-01-17 | 2018-07-26 | Ablynx Nv | Improved serum albumin binders |
| EP4442709A2 (en) | 2017-01-17 | 2024-10-09 | Ablynx NV | Improved serum albumin binders |
| EP4442707A2 (en) | 2017-01-17 | 2024-10-09 | Ablynx NV | Improved serum albumin binders |
| WO2018178307A1 (en) | 2017-03-31 | 2018-10-04 | Ablynx N.V. | Improved immunogenicity assays |
| WO2018220080A1 (en) | 2017-05-31 | 2018-12-06 | Boehringer Ingelheim International Gmbh | Polypeptides antagonizing wnt signaling in tumor cells |
| EP4678235A2 (en) | 2017-06-02 | 2026-01-14 | Merck Patent GmbH | Mmp13 binding immunoglobulins |
| WO2018220225A1 (en) | 2017-06-02 | 2018-12-06 | Ablynx Nv | Aggrecan binding immunoglobulins |
| WO2018220235A1 (en) | 2017-06-02 | 2018-12-06 | Merck Patent Gmbh | Mmp13 binding immunoglobulins |
| WO2018220236A1 (en) | 2017-06-02 | 2018-12-06 | Merck Patent Gmbh | Polypeptides binding adamts5, mmp13 and aggrecan |
| WO2018220234A1 (en) | 2017-06-02 | 2018-12-06 | Merck Patent Gmbh | Adamts binding immunoglobulins |
| EP4272822A2 (en) | 2017-06-02 | 2023-11-08 | Merck Patent GmbH | Adamts binding immunoglobulins |
| US12209136B2 (en) | 2017-06-02 | 2025-01-28 | Merck Patent Gmbh | ADAMTS binding immunoglobulins |
| WO2019016237A1 (en) | 2017-07-19 | 2019-01-24 | Vib Vzw | Serum albumin binding agents |
| EP4635987A2 (en) | 2017-10-31 | 2025-10-22 | Vib Vzw | Novel antigen-binding chimeric proteins and methods and uses thereof |
| WO2019086548A1 (en) | 2017-10-31 | 2019-05-09 | Vib Vzw | Novel antigen-binding chimeric proteins and methods and uses thereof |
| WO2019224025A2 (en) | 2018-05-19 | 2019-11-28 | Boehringer Ingelheim International Gmbh | Antagonizing cd73 antibody |
| EP3569618A1 (en) | 2018-05-19 | 2019-11-20 | Boehringer Ingelheim International GmbH | Antagonizing cd73 antibody |
| US11312785B2 (en) | 2018-05-19 | 2022-04-26 | Boehringer Ingelheim International Gmbh | Antagonizing CD73 antibody |
| WO2019234220A1 (en) | 2018-06-09 | 2019-12-12 | Boehringer Ingelheim International Gmbh | Dll3-cd3 bispecific antibodies |
| EP4566621A2 (en) | 2018-06-09 | 2025-06-11 | Boehringer Ingelheim International GmbH | Dll3/cd3 binding proteins for the treatment of cancer |
| US11332541B2 (en) | 2018-06-09 | 2022-05-17 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| US12173083B2 (en) | 2018-06-09 | 2024-12-24 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| US12528879B2 (en) | 2018-06-09 | 2026-01-20 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| FR3088640A1 (en) | 2018-10-14 | 2020-05-22 | Smart Diagnostix Pharma | NOVEL POLYPEPTIDE SPECIFICALLY BINDING TO PROTEIN P16 |
| WO2020221888A1 (en) | 2019-04-30 | 2020-11-05 | Vib Vzw | Cystic fibrosis transmembrane conductance regulator stabilizing agents |
| US11667719B2 (en) | 2019-06-21 | 2023-06-06 | Sorriso Pharmaceuticals, Inc. | VHH immunoglobulin chain variable domain that binds to IL-7R and methods of use thereof for treating autoimmune and/or inflammatory diseases |
| US11623952B2 (en) | 2019-06-21 | 2023-04-11 | Sorriso Pharmaceuticals, Inc. | IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides |
| US12570736B2 (en) | 2019-06-21 | 2026-03-10 | Sorriso Pharmaceuticals, Inc. | Compositions |
| US12247079B2 (en) | 2019-06-21 | 2025-03-11 | Sorriso Pharmaceuticals, Inc. | Polynucleotides encoding, and method of making, a polypeptide comprising a VHH which binds interleukin-receptor (IL-7R) |
| US12559552B2 (en) | 2019-06-21 | 2026-02-24 | Sorriso Pharmaceuticals, Inc. | IL-23 and TNF-alpha binding bi-specific heavy chain polypeptides |
| WO2021064137A2 (en) | 2019-10-02 | 2021-04-08 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| US11732045B2 (en) | 2019-10-02 | 2023-08-22 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
| GB201914468D0 (en) | 2019-10-07 | 2019-11-20 | Crescendo Biologics Ltd | Binding Molecules |
| WO2021105438A1 (en) | 2019-11-27 | 2021-06-03 | Vib Vzw | Positive allosteric modulators of the calcium-sensing receptor |
| WO2021110817A1 (en) | 2019-12-06 | 2021-06-10 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting tnfa and ox40l |
| WO2021110816A1 (en) | 2019-12-06 | 2021-06-10 | Ablynx Nv | POLYPEPTIDES COMPRISING IMMUNOGLOBULIN SINGLE VARIABLE DOMAINS TARGETING TNFα AND IL-23 |
| US11840566B2 (en) | 2019-12-09 | 2023-12-12 | Ablynx N.V. | Methods of treating asthma with polypeptides targeting IL-13 and TSLP |
| WO2021116182A1 (en) | 2019-12-09 | 2021-06-17 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting il-13 and tslp |
| US11208476B2 (en) | 2019-12-09 | 2021-12-28 | Ablynx N.V. | Polypeptides comprising immunoglobulin single variable domains targeting IL-13 and TSLP |
| US12492248B2 (en) | 2019-12-09 | 2025-12-09 | Ablynx N.V. | Methods of treatment utilizing polypeptides comprising immunoglobulin single variable domains targeting IL-13 and TSLP |
| US12384840B2 (en) | 2019-12-09 | 2025-08-12 | Ablynx N.V. | Nucleic acids encoding polypeptides comprising immunoglobulin single variable domains targeting IL-13 and TSLP |
| WO2021123360A1 (en) | 2019-12-20 | 2021-06-24 | Vib Vzw | Nanobody exchange chromatography |
| WO2021156490A2 (en) | 2020-02-06 | 2021-08-12 | Vib Vzw | Corona virus binders |
| WO2021170540A1 (en) | 2020-02-25 | 2021-09-02 | Vib Vzw | Leucine-rich repeat kinase 2 allosteric modulators |
| WO2022003156A1 (en) | 2020-07-02 | 2022-01-06 | Oncurious Nv | Ccr8 non-blocking binders |
| WO2022063984A1 (en) | 2020-09-25 | 2022-03-31 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting il-13 and ox40l |
| WO2022117569A1 (en) | 2020-12-02 | 2022-06-09 | Oncurious Nv | A ccr8 antagonist antibody in combination with a lymphotoxin beta receptor agonist antibody in therapy against cancer |
| WO2022117572A2 (en) | 2020-12-02 | 2022-06-09 | Oncurious Nv | An ltbr agonist in combination therapy against cancer |
| WO2022120388A2 (en) | 2020-12-04 | 2022-06-09 | Tidal Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles, and methods of synthesis and use thereof |
| WO2022129572A1 (en) | 2020-12-18 | 2022-06-23 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting il-6 and tnf-alpha |
| WO2022129560A1 (en) | 2020-12-18 | 2022-06-23 | Ablynx Nv | Polypeptides comprising immunoglobulin single variable domains targeting glypican-3 and t cell receptor |
| US11897951B2 (en) | 2020-12-18 | 2024-02-13 | Ablynx N.V. | Polypeptides comprising immunoglobulin single variable domains targeting IL-6 and TNF-α |
| US11932702B2 (en) | 2020-12-18 | 2024-03-19 | Ablynx N.V. | Polypeptides comprising immunoglobulin single variable domains targeting glypican-3 and T cell receptor |
| WO2022129637A1 (en) | 2020-12-18 | 2022-06-23 | Ablynx Nv | T cell recruiting polypeptides based on tcr alpha/beta reactivity |
| WO2022136685A1 (en) | 2020-12-23 | 2022-06-30 | Vib Vzw | Antibody compositions for treatment of corona virus infection |
| WO2022167666A1 (en) | 2021-02-05 | 2022-08-11 | Vib Vzw | Sarbecovirus binders |
| WO2022175532A1 (en) | 2021-02-19 | 2022-08-25 | Vib Vzw | Cation-independent mannose-6-phosphate receptor binders |
| WO2022238550A1 (en) | 2021-05-12 | 2022-11-17 | Vib Vzw | Pan-specific corona virus binders |
| WO2023016828A2 (en) | 2021-07-30 | 2023-02-16 | Vib Vzw | Cation-independent mannose-6-phosphate receptor binders for targeted protein degradation |
| WO2023093899A1 (en) | 2021-11-29 | 2023-06-01 | 江苏恒瑞医药股份有限公司 | Modified protein or polypeptide |
| WO2023110190A1 (en) | 2021-12-13 | 2023-06-22 | Heraeus Medical Gmbh | Tests and methods for detecting bacterial infection |
| WO2023111266A1 (en) | 2021-12-17 | 2023-06-22 | Ablynx Nv | POLYPEPTIDES COMPRISING IMMUNOGLOBULIN SINGLE VARIABLE DOMAINS TARGETING TCRαβ, CD33 AND CD123 |
| WO2023135198A1 (en) | 2022-01-12 | 2023-07-20 | Vib Vzw | Human ntcp binders for therapeutic use and liver-specific targeted delivery |
| WO2023198848A1 (en) | 2022-04-13 | 2023-10-19 | Vib Vzw | An ltbr agonist in combination therapy against cancer |
| WO2023222825A1 (en) | 2022-05-18 | 2023-11-23 | Vib Vzw | Sarbecovirus spike s2 subunit binders |
| WO2023240156A1 (en) | 2022-06-08 | 2023-12-14 | Tidal Therapeutics, Inc. | Ionizable cationic lipids and lipid nanoparticles, and methods of synthesis and use thereof |
| WO2023242247A1 (en) | 2022-06-14 | 2023-12-21 | Ablynx Nv | Immunoglobulin single variable domains targeting t cell receptor |
| WO2024023271A1 (en) | 2022-07-27 | 2024-02-01 | Ablynx Nv | Polypeptides binding to a specific epitope of the neonatal fc receptor |
| WO2024068744A1 (en) | 2022-09-27 | 2024-04-04 | Vib Vzw | Antivirals against human parainfluenza virus |
| WO2024083843A1 (en) | 2022-10-18 | 2024-04-25 | Confo Therapeutics N.V. | Amino acid sequences directed against the melanocortin 4 receptor and polypeptides comprising the same for the treatment of mc4r-related diseases and disorders |
| WO2024083429A1 (en) | 2022-10-20 | 2024-04-25 | Heraeus Medical Gmbh | Treatment of microbial infections diagnosed using the biomarker d-lactate |
| EP4357778A1 (en) | 2022-10-20 | 2024-04-24 | Heraeus Medical GmbH | Treatment of microbial infections diagnosed using the biomarker d-lactate |
| WO2024137731A2 (en) | 2022-12-21 | 2024-06-27 | Genzyme Corporation | Anti‑pd‑1×4‑1bb binding proteins |
| WO2024133935A1 (en) | 2022-12-23 | 2024-06-27 | Ablynx Nv | Protein-based conjugation carriers |
| WO2024151515A2 (en) | 2023-01-09 | 2024-07-18 | Odyssey Therapeutics, Inc. | Anti-tnfr2 antigen-binding proteins and uses thereof |
| WO2024168279A2 (en) | 2023-02-10 | 2024-08-15 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) and methods for making and using the same |
| WO2024170756A1 (en) | 2023-02-17 | 2024-08-22 | Ablynx N.V. | Polypeptides binding to the neonatal fc receptor |
| WO2024175787A1 (en) | 2023-02-24 | 2024-08-29 | Vrije Universiteit Brussel | Anti-inflammatory pannexin 1 channel inhibitors |
| WO2024192065A1 (en) | 2023-03-14 | 2024-09-19 | Odyssey Therapeutics, Inc. | Anti-cd25 antigen-binding proteins and uses thereof |
| WO2024208816A1 (en) | 2023-04-03 | 2024-10-10 | Vib Vzw | Blood-brain barrier crossing antibodies |
| WO2024231447A1 (en) | 2023-05-08 | 2024-11-14 | Sanofi | Glycosylation of immunoglobulin single variable domains |
| WO2024238790A1 (en) | 2023-05-17 | 2024-11-21 | Odyssey Therapeutics, Inc. | Modified single-domain antibodies |
| WO2024261235A1 (en) | 2023-06-22 | 2024-12-26 | Ablynx Nv | Chimeric proteins for modulating cytokine receptor activity |
| WO2025006846A2 (en) | 2023-06-29 | 2025-01-02 | Odyssey Therapeutics, Inc. | Anti-trailr2 antigen-binding proteins and uses thereof |
| WO2025008537A1 (en) | 2023-07-05 | 2025-01-09 | Ablynx Nv | Improved fcrn antagonists for treatment of igg-related diseases and disorders |
| WO2025051767A1 (en) | 2023-09-04 | 2025-03-13 | Sanofi | Polypeptides for use in the treatment of glypican-3-expressing tumours |
| WO2025061919A1 (en) | 2023-09-22 | 2025-03-27 | Ablynx Nv | Bi- and multivalent albumin binders |
| WO2025080751A2 (en) | 2023-10-13 | 2025-04-17 | Odyssey Therapeutics, Inc. | Anti-cdh17 antigen-binding proteins and uses thereof |
| WO2025099632A1 (en) | 2023-11-08 | 2025-05-15 | Sanofi | Cd25 based lysosomal degrader and uses thereof |
| WO2025109176A1 (en) | 2023-11-22 | 2025-05-30 | Exevir Bio Bv | Optimized sarbecovirus spike s2 subunit binders and compositions comprising the same |
| WO2025114529A1 (en) | 2023-12-01 | 2025-06-05 | Ablynx Nv | Multispecific antibodies recognising human serum albumin, tcr and a tumor antigen recognising moiety |
| WO2025125577A1 (en) | 2023-12-14 | 2025-06-19 | Vib Vzw | Antibodies against influenza b virus |
| WO2025133253A2 (en) | 2023-12-22 | 2025-06-26 | Ablynx Nv | Protein-based conjugation carriers for intranuclear delivery |
| WO2025133166A1 (en) | 2023-12-22 | 2025-06-26 | Ablynx Nv | Protein-based carriers for site-specific amine conjugation |
| WO2025174825A2 (en) | 2024-02-12 | 2025-08-21 | Aera Therapeutics, Inc. | Delivery compositions |
| WO2025181155A1 (en) | 2024-02-26 | 2025-09-04 | Vib Vzw | Human beta-glucocerebrosidase binders and uses thereof |
| WO2025217240A1 (en) | 2024-04-10 | 2025-10-16 | Odyssey Therapeutics, Inc. | Anti-tnfr2 antigen-binding proteins and uses thereof |
| WO2025219231A1 (en) | 2024-04-15 | 2025-10-23 | Vib Vzw | Computer-implemented means and methods for the de novo design of antibodies targeting a specific epitope |
| WO2025255435A2 (en) | 2024-06-07 | 2025-12-11 | Odyssey Therapeutics, Inc. | Antigen-binding proteins against serum albumin and uses thereof |
| WO2025255558A2 (en) | 2024-06-07 | 2025-12-11 | Odyssey Therapeutics, Inc. | Anti-thymic stromal lymphopoietin (tslp) antigen-binding proteins and uses thereof |
| WO2025262150A2 (en) | 2024-06-18 | 2025-12-26 | Ablynx Nv | Antibody-recruiting molecules |
| WO2025265116A1 (en) | 2024-06-21 | 2025-12-26 | Georgia State University Research Foundation, Inc. | Nanobodies to henipavirus and uses thereof |
| WO2026006809A1 (en) | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Multispecific molecules binding tnfr2 and cd25 and uses thereof |
| WO2026006708A2 (en) | 2024-06-27 | 2026-01-02 | Odyssey Therapeutics, Inc. | Anti-cd25 antigen-binding proteins and uses thereof |
| WO2026008664A1 (en) | 2024-07-01 | 2026-01-08 | Vib Vzw | Allosteric modulators of inhibitory immune receptor complexes |
| WO2026008665A1 (en) | 2024-07-01 | 2026-01-08 | Vib Vzw | Binders of the pd-1•pd-l1 complex and their use |
| WO2026024863A2 (en) | 2024-07-24 | 2026-01-29 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) in combination with androgen receptor antagonists |
| WO2026030375A2 (en) | 2024-07-30 | 2026-02-05 | Genzyme Corporation | Lipid nanoparticles and methods of manufacture and use thereof |
| WO2026052756A1 (en) | 2024-09-05 | 2026-03-12 | Ablynx Nv | Her2 binding immunoglobulin single variable domains, constructs comprising the same and uses thereof |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12516105B2 (en) | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains | |
| AU2012273929A1 (en) | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains | |
| EP2974737B1 (en) | Techniques for predicting, detecting and reducing a specific protein interference in assays involving immunoglobulin single variable domains | |
| US20150050266A9 (en) | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains | |
| US20150344568A1 (en) | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains | |
| EP4350345A2 (en) | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains | |
| HK1260347A1 (en) | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobin single variable domains | |
| NZ716279B2 (en) | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains | |
| NZ617995B2 (en) | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12729968 Country of ref document: EP Kind code of ref document: A2 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 2837998 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2012273929 Country of ref document: AU Date of ref document: 20120625 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2013/014614 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2014516387 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20137035011 Country of ref document: KR Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2012729968 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012729968 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2014102007 Country of ref document: RU Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14128681 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013032145 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 250396 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: P-2017/0334 Country of ref document: RS |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12017501178 Country of ref document: PH |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112013032145 Country of ref document: BR Ref country code: BR Ref legal event code: B01E Ref document number: 112013032145 Country of ref document: BR Free format text: COM BASE NA RESOLUCAO 228/09, SOLICITA-SE QUE SEJAM APRESENTADOS NOVOS CONTEUDOS DE LISTAGEM DE SEQUENCIA NOS MOLDES DA RESOLUCAO NO 187 DE 27/04/2017, POIS O TITULO DA LISTAGEM DE SEQUENCIA NAO ESTA EM LINGUA VERNACULA. |
|
| ENP | Entry into the national phase |
Ref document number: 112013032145 Country of ref document: BR Kind code of ref document: A2 Effective date: 20131213 |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 823787 Country of ref document: NZ |
|
| WWG | Wipo information: grant in national office |
Ref document number: 1020227026895 Country of ref document: KR |









