FR3088640A1 - NOVEL POLYPEPTIDE SPECIFICALLY BINDING TO PROTEIN P16 - Google Patents
NOVEL POLYPEPTIDE SPECIFICALLY BINDING TO PROTEIN P16 Download PDFInfo
- Publication number
- FR3088640A1 FR3088640A1 FR1907860A FR1907860A FR3088640A1 FR 3088640 A1 FR3088640 A1 FR 3088640A1 FR 1907860 A FR1907860 A FR 1907860A FR 1907860 A FR1907860 A FR 1907860A FR 3088640 A1 FR3088640 A1 FR 3088640A1
- Authority
- FR
- France
- Prior art keywords
- protein
- polypeptide
- vhh
- seq
- overexpression
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57442—Specifically defined cancers of the uterus and endometrial
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
- G01N2333/4701—Details
- G01N2333/4703—Regulators; Modulating activity
- G01N2333/4704—Inhibitors; Supressors
Abstract
La présente invention concerne un nouveau polypeptide comprenant au moins un domaine variable (VHH) d’un anticorps à domaine unique se liant spécifiquement à la protéine P16 ou d’un dérivé de celui-ci, caractérisé en ce que le domaine variable comprend des séquences spécifiques pour les CDR1, CDR2 et CDR3 ; et les utilisations de ce polypeptide, notamment dans un procédé de diagnostic in vitro du cancer du col de l’utérus.The present invention relates to a new polypeptide comprising at least one variable domain (VHH) of a single domain antibody specifically binding to the P16 protein or a derivative thereof, characterized in that the variable domain comprises sequences specific for CDR1, CDR2 and CDR3; and the uses of this polypeptide, in particular in a method for the in vitro diagnosis of cervical cancer.
Description
DescriptionDescription
Titre de l’invention : NOUVEAU POLYPEPTIDE SE LIANT SPECIFIQUEMENT A LA PROTEINE P16Title of the invention: NEW POLYPEPTIDE SPECIFICALLY BINDING TO PROTEIN P16
Domaine technique [0001] La présente invention concerne le domaine du diagnostic et, plus spécifiquement, le domaine du diagnostic du cancer du col de l’utérus.Technical Field [0001] The present invention relates to the field of diagnosis and, more specifically, the field of diagnosis of cervical cancer.
[0002] Art antérieur à l’invention :Art prior to the invention:
[0003] Le cancer du col de l’utérus constitue aujourd’hui une préoccupation majeure puisqu’il correspond à la deuxième forme la plus fréquente de cancer chez les femmes à l’échelle mondiale après le cancer du sein. Dans près de 99% des cas, il est la résultante d’une infection par le papillomavirus humain.Cervical cancer is a major concern today as it is the second most common form of cancer in women worldwide after breast cancer. In almost 99% of cases, it is the result of infection with the human papillomavirus.
[0004] Le dépistage des lésions précancéreuses est possible grâce à la pratique du frottis de dépistage, dans laquelle on recherche la présence de lésions visibles à l’œil nu. Maintenant, de nouveaux biomarqueurs, tels que les protéines E6-E7 des virus HPV ou la protéine P16 ont été utilisées lors d’études initiales et ont montré des résultats prometteurs lors d’études cliniques.[0004] Screening for precancerous lesions is possible thanks to the practice of screening smears, in which the presence of lesions visible to the naked eye is sought. Now, new biomarkers, such as E6-E7 proteins from HPV viruses or P16 protein have been used in initial studies and have shown promising results in clinical studies.
[0005] Pour ce qui est de la protéine P16, elle est codée par un cadre ouvert de lecture d’environ 150 acides aminés, au sein du gène cdkn2A, codant pour une protéine de 16 kDa de poids moléculaire qui comprend quatre répétitions ankyrine. Cette protéine P16, également dénommée P16INK4a, présente une activité suppresseur de tumeur qui est liée à son rôle dans la régulation du cycle cellulaire où elle agit en ralentissant la progression de la cellule de la phase G1 à la phase S. Elle est ainsi impliquée dans la prévention des cancers, notamment le mélanome, le cancer du col de l’utérus ou encore le cancer de l’œsophage et est utilisée comme biomarqueur en lien avec de nombreux cancers. La détection de la surexpression de P16INK4a dans des échantillons biologiques est ainsi un marqueur utile de lésions anogénitales comme le carcinome du col de l’utérus (cf. Demande internationale WO 00/01845).As for the P16 protein, it is coded by an open reading frame of about 150 amino acids, within the cdkn2A gene, coding for a protein of 16 kDa of molecular weight which includes four ankyrin repeats. This protein P16, also called P16INK4a, has a tumor suppressor activity which is linked to its role in regulating the cell cycle where it acts by slowing the progression of the cell from phase G1 to phase S. It is thus involved in the prevention of cancers, in particular melanoma, cancer of the cervix or even cancer of the esophagus and is used as a biomarker in connection with many cancers. The detection of overexpression of P16INK4a in biological samples is thus a useful marker of anogenital lesions such as carcinoma of the cervix (cf. International Application WO 00/01845).
[0006] Maintenant, les tests ciblant ces biomarqueurs, et notamment P16, utilisent des anticorps monoclonaux conventionnels qui sont coûteux à produire et sont peu stables. En conséquence, le prix final de ces tests est loin d’être négligeable ce qui complique d’autant leur utilisation à grande échelle et la mise en place d’une vraie prévention du cancer du col de l’utérus.[0006] Now, the tests targeting these biomarkers, and in particular P16, use conventional monoclonal antibodies which are expensive to produce and are not very stable. As a result, the final price of these tests is far from being negligible, which complicates their large-scale use and the implementation of true prevention of cervical cancer.
[0007] Description détaillé de l’invention :Detailed description of the invention:
[0008] Les inventeurs ont maintenant identifié un anticorps à domaine unique présentant une très forte spécificité pour la protéine P16 et permettant d’envisager sa détection, notamment sous la forme d’un kit pour la détection de la surexpression de P16INK4a dans des échantillons biologiques, notamment pour la détection de lésions anogénitales en vue du diagnostique du cancer du col de l’utérus.The inventors have now identified a single domain antibody having a very high specificity for the P16 protein and making it possible to envisage its detection, in particular in the form of a kit for the detection of the overexpression of P16INK4a in biological samples. , in particular for the detection of anogenital lesions for the diagnosis of cervical cancer.
[0009] En conséquence, un premier objet de l’invention porte sur un polypeptide comprenant au moins un domaine variable (VHH) d’un anticorps à domaine unique se liant spécifiquement à la protéine P16 ou d’un dérivé de celui-ci, lequel domaine variable comprend les séquences CDR suivantes :[0009] Consequently, a first subject of the invention relates to a polypeptide comprising at least one variable domain (VHH) of a single domain antibody specifically binding to the P16 protein or a derivative thereof, which variable domain includes the following CDR sequences:
[0010] RYGIG (SEQ id n°l) pour la région CDR1 ;RYGIG (SEQ id No. 1) for the CDR1 region;
[0011] GTNLSGGSTYYVDTVKG (SEQ id n°2) pour la région CDR2 ; et [0012] SAYGYVSPELYKY (SEQ id n°3) pour la région CDR3.GTNLSGGSTYYVDTVKG (SEQ id No. 2) for the CDR2 region; and SAYGYVSPELYKY (SEQ id No. 3) for the CDR3 region.
[0013] Par protéine P16, on entend la protéine humaine présentant le numéro d’accession P42771.By protein P16 is meant the human protein having the accession number P42771.
[0014] Par « capable de se lier spécifiquement à la protéine P16 », on entend un polypeptide présentant une constante de dissociation (KD) avec la protéine P16, laquelle correspond à l’inverse de la constante d’association (KA), comprise entre 10-6 à 10-14 moles/litre (M), de préférence entre 10-7 à 10-14 moles/litre (M) et, de manière particulièrement préférée, entre 10-8 à 10-14 moles/litre (M). Une telle valeur peut être déterminée simplement par l’homme du métier à l’aide de méthodes connues, par exemple à l’aide d’un BIACORE qui utilise la SPR (Surface Plasmon Resonance).By “capable of specifically binding to the P16 protein”, is meant a polypeptide having a dissociation constant (KD) with the P16 protein, which corresponds to the inverse of the association constant (KA), understood between 10-6 to 10-14 moles / liter (M), preferably between 10-7 to 10-14 moles / liter (M) and, particularly preferably, between 10-8 to 10-14 moles / liter ( M). Such a value can be determined simply by a person skilled in the art using known methods, for example using a BIACORE which uses SPR (Surface Plasmon Resonance).
[0015] Les anticorps à domaine unique sont des anticorps identifiés chez les camélidés qui ont la particularité de ne posséder que des chaînes lourdes. Il en résulte que l’activité de liaison de ces anticorps ne dépend d’aucune chaîne légère. Au final, ces anticorps ne comprennent qu’un seul domaine variable (VHH) et deux domaines constants (CH2 et CH3).Single domain antibodies are antibodies identified in camelids which have the distinction of having only heavy chains. As a result, the binding activity of these antibodies does not depend on any light chain. Ultimately, these antibodies include only one variable domain (VHH) and two constant domains (CH2 and CH3).
[0016] Dans le cas présent, le polypeptide selon l’invention peut comprendre ou non les deux domaines constants CH2 et CH3. Maintenant et préférentiellement, le polypeptide selon l’invention ne comprendra pas ces deux domaines constants.In the present case, the polypeptide according to the invention may or may not include the two constant domains CH2 and CH3. Now and preferably, the polypeptide according to the invention will not include these two constant domains.
[0017] Pour ce qui est du domaine variable, dénommé domaine VHH, domaine VHH, fragment d'anticorps VHH, anticorps VHH, NANOBODY® ou domaine NANOBODY®, il présente une structure de type FRI -CDR 1-FR2-CDR2-FR3-CDR3-FR4.Regarding the variable domain, called VHH domain, VHH domain, VHH antibody fragment, VHH antibody, NANOBODY® or NANOBODY® domain, it has a structure of FRI type -CDR 1-FR2-CDR2-FR3 -CDR3-FR4.
[0018] Dans cette structure de type FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4, les régions CDR (Complementary-Determining Region) déterminent la complémentarité avec l’antigène et présentent une grande variabilité. D’ailleurs, ce domaine VHH suffit à reconnaître l'antigène avec des propriétés de liaison à l'antigène qui sont similaires à celles des anticorps conventionnels. Maintenant, et avec sa petite taille (15 kDa), ce domaine VHH qui est particulièrement stable et soluble, présente notamment l'avantage de pouvoir être produit de façon recombinante, en masse, chez la bactérie ou d'autres espèces tant procaryotes qu'eucaryotes, le cas échéant en fusion avec une ou plusieurs protéine(s) fonctionnelle(s) d'intérêt, et de pouvoir ainsi être utilisé comme un anticorps monoclonal pour la détection d'un antigène.In this FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 type structure, the CDR (Complementary-Determining Region) regions determine the complementarity with the antigen and exhibit great variability. Moreover, this VHH domain suffices to recognize the antigen with antigen-binding properties which are similar to those of conventional antibodies. Now, and with its small size (15 kDa), this VHH domain which is particularly stable and soluble, has in particular the advantage of being able to be produced in a recombinant manner, in mass, in bacteria or other species both prokaryotic and eukaryotes, where appropriate in fusion with one or more functional protein (s) of interest, and can thus be used as a monoclonal antibody for the detection of an antigen.
[0019] Par séquence dérivé, on entend une séquence polypeptidique présentant un pourcentage d’identité d’au moins 80 %, de préférence d’au moins 90% et de manière particulièrement préférée d’au moins 95% avec la séquence SEQ id n°l, SEQ id n°2 et/ou SEQ id n°3.By derivative sequence is meant a polypeptide sequence having a percentage identity of at least 80%, preferably at least 90% and particularly preferably at least 95% with the sequence SEQ id n ° l, SEQ id n ° 2 and / or SEQ id n ° 3.
[0020] Par pourcentage d’identité entre deux séquences polypeptidiques, on entend le pourcentage d’acides aminés identiques, entre deux séquences devant être comparées, obtenu avec le meilleur alignement possible desdites séquences. Ce pourcentage est purement statistique et les différences entre les deux séquences sont réparties aléatoirement sur toute la longueur des séquences d’acides aminés. Par meilleur alignement possible ou alignement optimal, on entend l’alignement permettant d’obtenir le pourcentage d’identité le plus élevé. Les comparaisons de séquences entre deux séquences d’acides aminés sont habituellement réalisées en comparant lesdites séquences après que celles-ci aient été alignées selon le meilleur alignement possible ; la comparaison est alors réalisée sur des segments de comparaison de façon à identifier et comparer des régions de similarité. Le meilleur alignement possible pour effectuer une comparaison peut être réalisé en utilisant l’algorithme d’homologie globale développé par SMITH et WATERMAN (Ad. App. Math., vol.2, p:482, 1981), en utilisant l’algorithme d’homologie locale développé par NEDDLEMAN et WUNSCH (J. Mol. Biol., vol.48, p:443, 1970), en utilisant la méthode de similarité développé par PEARSON et LIPMAN (Proc. Natl. Acd. Sci. USA, vol.85, p:2444, 1988), en utilisant des programmes d’ordinateur basés sur de tels algorithmes (GAP, BESTPIT, BLAST P, BLAST N, PASTA, TPASTA, Genetics Computer Group, 575 Science Dr., Madison, WI USA), en utilisant les algorithmes d’alignement multiples MUSCLE (Edgar, Robert C., Nucleic Acids Research, vol. 32, p:1792, 2004 ). Pour obtenir le meilleur alignement possible, on utilisera de préférence le programme BLAST avec la matrice BLOSUM 62 ou la matrice PAM 30. Le pourcentage d’identité est déterminé en comparant les deux séquences alignées de façon optimale, lesdites séquences pourront comprendre des additions ou des délétions au regard de la séquence de référence de sorte d’obtenir le meilleur alignement possible entre ces deux séquences. Le pourcentage d’identité est calculé en déterminant le nombre de position identique entre les deux séquences, en divisant le nombre obtenu par le nombre total de positions comparées et en multipliant le résultat obtenu par 100 pour obtenir le pourcentage d’identité entre ces deux séquences.By percentage of identity between two polypeptide sequences is meant the percentage of identical amino acids, between two sequences to be compared, obtained with the best possible alignment of said sequences. This percentage is purely statistical and the differences between the two sequences are distributed randomly over the entire length of the amino acid sequences. By best possible alignment or optimal alignment, we mean the alignment allowing to obtain the highest percentage of identity. Sequence comparisons between two amino acid sequences are usually performed by comparing said sequences after they have been aligned in the best possible alignment; the comparison is then carried out on comparison segments so as to identify and compare regions of similarity. The best possible alignment for making a comparison can be achieved using the global homology algorithm developed by SMITH and WATERMAN (Ad. App. Math., Vol.2, p: 482, 1981), using the d algorithm. local homology developed by NEDDLEMAN and WUNSCH (J. Mol. Biol., vol.48, p: 443, 1970), using the similarity method developed by PEARSON and LIPMAN (Proc. Natl. Acd. Sci. USA, vol .85, p: 2444, 1988), using computer programs based on such algorithms (GAP, BESTPIT, BLAST P, BLAST N, PASTA, TPASTA, Genetics Computer Group, 575 Science Dr., Madison, WI USA ), using the MUSCLE multiple alignment algorithms (Edgar, Robert C., Nucleic Acids Research, vol. 32, p: 1792, 2004). To obtain the best possible alignment, the BLAST program will preferably be used with the BLOSUM 62 matrix or the PAM 30 matrix. The identity percentage is determined by comparing the two optimally aligned sequences, said sequences may include additions or deletions with regard to the reference sequence so as to obtain the best possible alignment between these two sequences. The percentage of identity is calculated by determining the number of identical positions between the two sequences, by dividing the number obtained by the total number of positions compared and by multiplying the result obtained by 100 to obtain the percentage of identity between these two sequences .
[0021] Dans cette structure de type PR1-CDR1-PR2-CDR2-PR3-CDR3-PR4 toujours, les régions PR (Pramework Region) sont très conservées et participent à la structure 3D.In this PR1-CDR1-PR2-CDR2-PR3-CDR3-PR4 type structure always, the PR (Pramework Region) regions are very conserved and participate in the 3D structure.
[0022] Aussi, et en plus des séquences CDR décrites précédemment, le domaine variable de l’anticorps à domaine unique comprend en outre des séquences FR. Ces séquences peuvent être immunogéniques ou non (chez l’homme) selon que l’on envisage ou pas une utilisation thérapeutique du polypeptide selon l’invention. A noter que de telles séquences FR peuvent être simplement identifiées par l’homme du métier.Also, and in addition to the CDR sequences described above, the variable domain of the single domain antibody further comprises FR sequences. These sequences can be immunogenic or not (in humans) depending on whether or not a therapeutic use of the polypeptide according to the invention is envisaged. Note that such FR sequences can be simply identified by a person skilled in the art.
[0023] De préférence toujours, le VHH est un VHH de camélidé et, de manière particulièrement préférée, il présente la séquence DVQLVESGGGLVQTGGSLRLSCAASGRTFSRYGIGWFRQAPGKEREFVGGTNLSGGSTYYVDTVKGRFTISRDNAKNT VYLQMSSLKPEDTAVYYCAASAYGYVSPELYKYWGQGTQVTVSS (SEQ id n°4).[0023] Still preferably, the VHH is a camelid VHH and, particularly preferably, it shows the sequence DVQLVESGGGLVQTGGSLRLSCAASGRTFSRYGIGWFRQAPGKEREFVGGTNLSGGSTYYVDTVKGRFTISRDNAKNT VYLQMSSLKPEDTAVYYCAASAYGYVSPELYKYWGQGTQVTVSS (SEQ ID NO: 4).
[0024] A titre d’exemple, le polypeptide selon l’invention comprend la séquence MKYLLPTAAAGLLLLAAQPAMADVQLVESGGGLVQTGGSLRLSCAASGRTFSRYGIGW FRQAPGKEREFVGGTNLSGGSTYYVDTVKGRFTISRDNAKNTVYLQMSSLKPE DTAVYYCAASAYGYVSPELYKYWGQGTQVTVSSAAAEQKLISEEDLNGAA (SEQ id n°5).[0024] For example, the polypeptide according to the invention comprises the sequence MKYLLPTAAAGLLLLAAQPAMADVQLVESGGGLVQTGGSLRLSCAASGRTFSRYGIGW FRQAPGKEREFVGGTNLSGGSTYYVDTVKGRFTISRDNAKNTVYLQMSSLKPE DTAVYYCAASAYGYVSPELYKYWGQGTQVTVSSAAAEQKLISEEDLNGAA (SEQ ID NO: 5).
[0025] Le polypeptide selon l’invention peut également comprendre un ou plusieurs autres domaines variables (VHH) d’un ou plusieurs autres anticorps à domaine unique se liant spécifiquement soit à la même protéine P16, soit à un autre antigène.The polypeptide according to the invention can also comprise one or more other variable domains (VHH) of one or more other single domain antibodies which specifically bind either to the same P16 protein or to another antigen.
[0026] De préférence, le polypeptide selon l’invention comprend en outre au moins un domaine variable (VHH) d’un anticorps à domaine unique dirigé contre une protéine sérique.Preferably, the polypeptide according to the invention further comprises at least one variable domain (VHH) of a single domain antibody directed against a serum protein.
[0027] Une telle protéine sérique peut-être choisie dans le groupe comprenant la sérumalbumine, les immunoglobulines sériques, la transférrine, le fibrinogène et la globuline liant la thyroxine.Such a serum protein can be chosen from the group comprising serum albumin, serum immunoglobulins, transferrin, fibrinogen and globulin binding thyroxine.
[0028] Idéalement, la protéine sérique ciblée est la transférrine.Ideally, the targeted serum protein is transferrin.
[0029] De préférence encore, le polypeptide selon l’invention peut comprendre au moins deux domaines variables (VHH) d’un anticorps à domaine unique se liant spécifiquement à la protéine P16, ou d’un dérivé de celui-ci, lequel domaine variable est tel que défini préalablement.More preferably, the polypeptide according to the invention may comprise at least two variable domains (VHH) of a single-domain antibody specifically binding to the P16 protein, or a derivative thereof, which domain variable is as previously defined.
[0030] Les différents domaines variables présents dans le polypeptide selon l’invention peuvent être liés les uns aux autres soit directement, soit par le biais d’un adaptateur. Un tel adaptateur est de préférence un peptide adaptateur sélectionné de manière à ne pas altérer la liaison entre le domaine variable de d’un anticorps à domaine unique avec son épitope. Typiquement, de tels adaptateurs peptidiques présentent une taille d’au moins 3 acides aminés (ex. Ala-Ala-Ala) et, plus généralement, entre 10 et 40 acides aminés.The different variable domains present in the polypeptide according to the invention can be linked to each other either directly or by means of an adapter. Such an adapter is preferably an adapter peptide selected so as not to alter the binding between the variable domain of a single domain antibody with its epitope. Typically, such peptide adapters have a size of at least 3 amino acids (eg Ala-Ala-Ala) and, more generally, between 10 and 40 amino acids.
[0031] Le polypeptide selon l’invention peut également comprendre d’autres séquences protéiques et, notamment, des séquences permettant de faciliter sa purification (Tag Histidine, étiquette GST (Glutathion-S-transférase) ou CBD (domaine de liaison à la chitine) ou sa détection (GFP (Green Fluorescent Protein).The polypeptide according to the invention may also comprise other protein sequences and, in particular, sequences making it possible to facilitate its purification (Tag Histidine, GST label (Glutathion-S-transferase) or CBD (chitin-binding domain ) or its detection (GFP (Green Fluorescent Protein).
[0032] Le polypeptide selon l’invention peut comprendre en outre des modifications additionnelles comme des résidus glycosyl ou des acides amines présentant des chaînes latérales modifiées, notamment par PEGylation pour augmenter la demi-vie du polypeptide.The polypeptide according to the invention may also comprise additional modifications such as glycosyl residues or amino acids having modified side chains, in particular by PEGylation to increase the half-life of the polypeptide.
[0033] Le polypeptide selon l'invention peut également présenter une séquence N-terminale modifiée, par exemple avec une délétion, d'un ou plusieurs des acides aminés Nterminaux, ou par substitution de sorte d’optimiser son expression en fonction du système d’expression utilisée ou pour être exprimé en tant que corps d'inclusion ou sous forme soluble, ou pour être sécrétés dans le milieu ou dans l'espace périplasmique, pour être contenus dans la cellule ou pour obtenir un produit plus homogène. Les polypeptides de l'invention peuvent avoir une séquence C-terminale modifiée, telle qu'une alanine supplémentaire et / ou d'autres échanges d'acides aminés dans la partie C-terminale ou à d'autres positions définies dans l'une quelconque des régions de la structure, comme expliqué par exemple, dans les demandes internationales WO2012/175741, WO2011/075861 ou WO2013/024059, afin, par exemple, de améliorer encore la stabilité ou réduire l’immunogénicité de ces polypeptides.The polypeptide according to the invention may also have a modified N-terminal sequence, for example with a deletion, of one or more of the Nterminal amino acids, or by substitution so as to optimize its expression as a function of the system d expression used either to be expressed as an inclusion body or in soluble form, or to be secreted in the medium or in the periplasmic space, to be contained in the cell or to obtain a more homogeneous product. The polypeptides of the invention may have a modified C-terminal sequence, such as an additional alanine and / or other amino acid exchanges in the C-terminal part or at other positions defined in any one regions of the structure, as explained for example, in international applications WO2012 / 175741, WO2011 / 075861 or WO2013 / 024059, in order, for example, to further improve the stability or reduce the immunogenicity of these polypeptides.
[0034] Avantageusement, ledit polypeptide présentant en outre un peptide signal à son extrémité N-terminale, lequel peptide signal permet alors la sécrétion du polypeptide selon l’invention.Advantageously, said polypeptide further having a signal peptide at its N-terminal end, which signal peptide then allows the secretion of the polypeptide according to the invention.
[0035] Enfin, le polypeptide peut être couplé à une ou plusieurs autres molécules. A titre d’exemple, on pourra envisager un polypeptide couplé à au moins un fluorophore. A noter que les méthodes permettant de réaliser un tel couplage sont bien connues de l’homme du métier.Finally, the polypeptide can be coupled to one or more other molecules. By way of example, it is possible to envisage a polypeptide coupled to at least one fluorophore. Note that the methods for achieving such coupling are well known to those skilled in the art.
[0036] Un deuxième objet de l’invention concerne une composition comprenant un polypeptide tel que décrit précédemment, éventuellement associé à un support acceptable.A second object of the invention relates to a composition comprising a polypeptide as described above, optionally combined with an acceptable support.
[0037] A titre d’exemple de support acceptable, la composition peut comprendre des diluants, des excipients, des stabilisateurs et des conservateurs. De tels additifs sont bien connus de l’homme du métier et sont décrits notamment dans « Ullmann’s Encyclopedia of Industrial Chemistry, 6th Ed. » (différents éditeurs, 1989-1998, Marcel Dekker); et dans “Pharmaceutical Dosage Forms and Drug Delivery Systerri’s (ANSEL et al., 1994, WILLIAMS & WILKINS).As an example of an acceptable support, the composition may include diluents, excipients, stabilizers and preservatives. Such additives are well known to those skilled in the art and are described in particular in "Ullmann's Encyclopedia of Industrial Chemistry, 6th Ed." (Various publishers, 1989-1998, Marcel Dekker); and in "Pharmaceutical Dosage Forms and Drug Delivery Systerri’s (ANSEL et al., 1994, WILLIAMS & WILKINS).
[0038] A titre d’exemple, le polypeptide selon l’invention peut être solubilisé dans un tampon, comme le tampon phosphate salin (PBS), le sérum artificiel (150 mM NaCl dans de l’eau) ou les tampons Tris.For example, the polypeptide according to the invention can be dissolved in a buffer, such as phosphate buffered saline (PBS), artificial serum (150 mM NaCl in water) or Tris buffers.
[0039] A noter qu’il existe de nombreuses causes d’instabilité ou de dégradation des polypeptides telles que l’hydrolyse et la dénaturation. Aussi, et avantageusement, la composition peut comprendre au moins un stabilisateur. A titre d’exemple de stabilisateurs, on peut citer les monosaccharrides, les disaccharrides, les polysaccharides, les détergents ioniques et non-ioniques, les sels de métaux alcalins, les phospholipides, les acides gras, les polyols et les peptides stabilisants comme la sérum albumine bovine.Note that there are many causes of instability or degradation of polypeptides such as hydrolysis and denaturation. Also, and advantageously, the composition can comprise at least one stabilizer. By way of example of stabilizers, mention may be made of monosaccharides, disaccharides, polysaccharides, ionic and non-ionic detergents, alkali metal salts, phospholipids, fatty acids, polyols and stabilizing peptides such as serum bovine albumin.
[0040] Un troisième objet de l’invention est un polynucléotide codant pour un polypeptide tel que défini précédemment.A third object of the invention is a polynucleotide coding for a polypeptide as defined above.
[0041] Ledit polynucléotide correspond à une séquence d’ADN, de préférence ledit polynucléotide est une séquence d’ADN.Said polynucleotide corresponds to a DNA sequence, preferably said polynucleotide is a DNA sequence.
[0042] Avantageusement encore, le polynucléotide selon l’invention est lié de façon opérationnelle à une séquence d’expression génique dirigeant l’expression dudit polynucléotide dans une cellule eucaryote ou procaryote, de préférence dans une cellule procaryote. Ladite séquence d’expression génique correspond à toute séquence de régulation, telle qu’une séquence promotrice ou une combinaison entre une séquence promotrice et une séquence activatrice facilitant la transcription et la traduction efficace du polypeptide tel que décrit précédemment.Advantageously also, the polynucleotide according to the invention is operably linked to a gene expression sequence directing the expression of said polynucleotide in a eukaryotic or prokaryotic cell, preferably in a prokaryotic cell. Said gene expression sequence corresponds to any regulatory sequence, such as a promoter sequence or a combination between a promoter sequence and an activator sequence facilitating the efficient transcription and translation of the polypeptide as described above.
[0043] Un quatrième objet de l’invention concerne un vecteur d’expression comprenant le polynucléotide tel que décrit précédemment.A fourth object of the invention relates to an expression vector comprising the polynucleotide as described above.
[0044] A titre d’exemple de tels vecteurs, on peut citer les plasmides, les cosmides, les virus, les bactériophages dès lors qu’ils présentent les éléments nécessaires à la transcription et à la traduction de la séquence codant pour le polypeptide selon l’invention dans une cellule donnée.By way of example of such vectors, mention may be made of plasmids, cosmids, viruses, bacteriophages when they have the elements necessary for the transcription and translation of the sequence coding for the polypeptide according to the invention in a given cell.
[0045] Un cinquième objet de l’invention concerne une cellule transformée par un vecteur d’expression tel que décrit précédemment.A fifth object of the invention relates to a cell transformed by an expression vector as described above.
[0046] Une telle cellule transformée peut être une cellule procaryote ou une cellule eucaryote. Si on vise préférentiellement les cellules procaryotes (ex. Escherichia coli), l’utilisation de cellules eucaryotes inférieures (ex. levure comme Saccharomyces cerevisae) peut présenter d’importants avantages.Such a transformed cell can be a prokaryotic cell or a eukaryotic cell. If we preferentially target prokaryotic cells (eg Escherichia coli), the use of lower eukaryotic cells (eg yeast like Saccharomyces cerevisae) can have important advantages.
[0047] La transformation de cellules peut être réalisée selon des techniques bien connues de l’homme du métier (ex. électroporation).The transformation of cells can be carried out according to techniques well known to those skilled in the art (eg electroporation).
[0048] Un sixième objet de l’invention porte sur un procédé de production d’un polypeptide tel que décrit précédemment, lequel comprend les étapes de :A sixth object of the invention relates to a process for the production of a polypeptide as described above, which comprises the steps of:
[0049] La culture de cellules transformées comprenant un vecteur d’expression codant pour un polypeptide selon l’invention dans des conditions permettant l’expression de ce polypeptide ; et [0050] La récupération du polypeptide exprimé par ces cellules transformées ; et [0051] Eventuellement, la purification et/ou la modification et/ou la formulation du polypeptide.The culture of transformed cells comprising an expression vector coding for a polypeptide according to the invention under conditions allowing the expression of this polypeptide; and the recovery of the polypeptide expressed by these transformed cells; and optionally, the purification and / or modification and / or formulation of the polypeptide.
[0052] Il est à noter que la production du polypeptide selon l’invention dans des organismes hôtes tels qu’E. coli ou les levures est particulièrement avantageuse en terme de coûts, en comparaison de ceux nécessaires à la production d’anticorps dans des cellules de mammifères. En outre, les niveaux de production sont particulièrement élevés et compris entre 1 et 10 gZL (E. coli) ou supérieurs à 10 g/1 (levure).It should be noted that the production of the polypeptide according to the invention in host organisms such as E. coli or yeast is particularly advantageous in terms of costs, compared to those necessary for the production of antibodies in mammalian cells. In addition, production levels are particularly high and between 1 and 10 gZL (E. coli) or greater than 10 g / 1 (yeast).
[0053] Un septième objet de l’invention porte sur un procédé in vitro de diagnostic d’un trouble caractérisé par une surexpression de la protéine P16 chez un sujet comprenant les étapes de :A seventh subject of the invention relates to an in vitro method for diagnosing a disorder characterized by an overexpression of the P16 protein in a subject comprising the steps of:
[0054] Mise en contact d’un échantillon biologique provenant dudit sujet avec un polypeptide ou d’une composition tels que décrits précédemment ;Contacting a biological sample from said subject with a polypeptide or a composition as described above;
[0055] Détecter la liaison dudit polypeptide au dit échantillon ;Detecting the binding of said polypeptide to said sample;
[0056] Comparer la liaison détectée à l’étape b) avec une référence, où une différence dans la liaison par rapport audit échantillon est un diagnostic d’un trouble caractérisé par une surexpression de la protéine P16.Compare the binding detected in step b) with a reference, where a difference in binding compared to said sample is a diagnosis of a disorder characterized by overexpression of the P16 protein.
[0057] Tel qu’utilisé ici, le terme « sujet » se réfère à un mammifère, de préférence à un humain et, de manière particulièrement préférée, à une femme.As used herein, the term "subject" refers to a mammal, preferably a human and, most preferably, a woman.
[0058] Par « trouble caractérisé par une surexpression de la protéine P16 », on entend un cancer dans lequel on peut observer une surexpression de la protéine P16 comme par exemple, le mélanome, le cancer du col de l’utérus, le cancer œsophagien, le carcinome squameux oropharyngé.By "disorder characterized by an overexpression of the P16 protein" is meant a cancer in which one can observe an overexpression of the P16 protein such as, for example, melanoma, cervical cancer, esophageal cancer , oropharyngeal squamous cell carcinoma.
[0059] Selon un mode de réalisation préféré, le trouble caractérisé par une surexpression de la protéine P16 est le cancer du col de l’utérus.According to a preferred embodiment, the disorder characterized by an overexpression of the P16 protein is cancer of the cervix.
[0060] Tel qu’utilisé ici, le terme « échantillon biologique » se réfère à tout échantillon solide ou liquide issu d’un sujet, dès lors qu’il contient des cellules. A titre d’exemple d’échantillons solides, on peut citer un échantillon de peau ou un frottis cervico-utérin et, à titre d’exemple d’échantillons liquides, on peut citer un échantillon de sang. De préférence, l’échantillon biologique est un frottis cervico-utérin.As used here, the term "biological sample" refers to any solid or liquid sample from a subject, as long as it contains cells. By way of example of solid samples, mention may be made of a skin sample or a cervical smear and, as example of liquid samples, mention may be made of a blood sample. Preferably, the biological sample is a cervical smear.
[0061] Par « surexpression de la protéine P16 », on entend un niveau d’expression au moins cinq (5) fois supérieur au niveau d’expression de référence et, de préférence, au moins dix (10) fois par rapport à ce niveau de référence.By "overexpression of the P16 protein" is meant an expression level at least five (5) times greater than the reference expression level and, preferably, at least ten (10) times relative to this. reference level.
[0062] La détermination du niveau d’expression de la protéine P16 à l’aide du polypeptide de l’invention est fait par des techniques bien connues de l’homme du métier comme Γimmunohistochimie, l’ELISA, l’immunoochromatographie sur membrane et la cytométrie de flux (FACS).The determination of the level of expression of the P16 protein using the polypeptide of the invention is done by techniques well known to those skilled in the art such as immunohistochemistry, ELISA, membrane immunoochromatography and flow cytometry (FACS).
[0063] Par « référence » ou « niveau de référence », on entend le niveau d’expression de la protéine PI6 dans des cellules saines, lequel niveau d’expression peut correspondre à la moyenne d’expression de la protéine P16 dans des cellules saines.By "reference" or "reference level" means the level of expression of the PI6 protein in healthy cells, which level of expression may correspond to the average expression of the P16 protein in cells healthy.
[0064] Selon un mode de réalisation préféré, le procédé selon l’invention vise plus particulièrement le suivi d’un traitement thérapeutique d’un trouble caractérisé par une surexpression de la protéine P16 chez un patient caractérisé en ce qu’il comprend la déter mination du niveau d’expression de la protéine P16 dans des échantillons biologiques dudit patient à différents temps de traitement et en ce qu’une augmentation de l’expression de la protéine P16 avec le traitement est indicatif d’une efficacité dudit traitement sur ce patient.According to a preferred embodiment, the method according to the invention relates more particularly to the monitoring of a therapeutic treatment of a disorder characterized by an overexpression of the P16 protein in a patient characterized in that it comprises determining it. mination of the level of expression of the P16 protein in biological samples of the said patient at different treatment times and in that an increase in the expression of the P16 protein with the treatment is indicative of an effectiveness of the said treatment on this patient .
[0065] Dans le cas d’une absence de modification de l’expression ou d’une diminution de l’expression de la protéine P16, ce résultat est indicatif, pour le praticien suivant le sujet, de la nécessité de changer de protocole de traitement.In the case of an absence of modification of the expression or of a reduction in the expression of the P16 protein, this result is indicative, for the practitioner depending on the subject, of the need to change the protocol of treatment.
[0066] Dans ce cas, on entend pus spécifiquement par « trouble caractérisé par une surexpression de la protéine P16 », une pathologie choisie dans le groupe comprenant les ostéosarcomes, le cancer du col de l’utérus et le cancer du sein.In this case, pus specifically means “disorder characterized by an overexpression of the P16 protein”, a pathology chosen from the group comprising osteosarcomas, cervical cancer and breast cancer.
[0067] Un huitième objet de l’invention porte sur un kit pour le diagnostic d’un trouble caractérisé par une surexpression de la protéine P16 comprenant un polypeptide tel que décrit précédemment.An eighth subject of the invention relates to a kit for the diagnosis of a disorder characterized by an overexpression of the P16 protein comprising a polypeptide as described above.
[0068] Les exemples qui suivent sont fournis à titre d’illustration et ne sauraient limiter la portée de la présente invention.The following examples are provided by way of illustration and cannot limit the scope of the present invention.
[0069] Identification d’un VHH dirigé contre P16 [0070] En vue d’identifier des VHH dirigés contre la protéine P16, les inventeurs ont utilisés une banque de phages exprimant à leur surface des séquences de domaines VHH.Identification of a VHH directed against P16 [0070] In order to identify VHH directed against the P16 protein, the inventors used a phage library expressing on their surface sequences of VHH domains.
[0071] En vue d’identifier, parmi ces phages, les séquences VHH se liant à la protéine P16 avec une forte affinité, les inventeurs ont exprimé dans E. coli la protéine P16 humaine fusionnée avec une étiquette histidine et une protéine P16 fusionnée à la protéine MBP (Maltose Binding Protein).In order to identify, among these phages, the VHH sequences binding to the P16 protein with a high affinity, the inventors expressed in E. coli the human P16 protein fused with a histidine tag and a P16 protein fused to the protein MBP (Maltose Binding Protein).
[0072] Ces deux protéines, après purification, ont chacune été adsorbées sur des boîtes de culture. Pour ce faire, ΙΟΟμΙ de solution de protéine cible à une concentration de 20pg/ml ont été déposés par puits de plaque MAXISORP (NUNC) et incubés à 4°C et 650 rpm sur la nuit. Le puits a été par la suite incubé avec 200μ1 d'une solution de PBS- 4%BSA pendant 2h afin de bloquer les sites non occupés par la protéine cible. Suite à cette étape de blocage, ΙΟΟμΙ de solution des phages de la banque ont été déposé dans le puits pour une durée de 2h, à température ambiante, à 650rpm. Ainsi les phages qui exposent à leur surface les VHH spécifiques se fixent à la cible. Les phages présentant des VHH non spécifiques ont été éliminés par 20 lavages avec 250μ1 de PBS-0,l%TWEEN. Les phages présentant des VHH spécifiques de la cible ont ensuite été élués par incubation avec ΙΟΟμΙ de glycine (pH=2,5), pendant 10min sous agitation. Le pH de la solution de phages, élués et prélevés, a été neutralisé par ajout de 60μ1 de Tris (pH=8).These two proteins, after purification, were each adsorbed on culture dishes. To do this, ΙΟΟμΙ of target protein solution at a concentration of 20pg / ml were deposited per well of MAXISORP plate (NUNC) and incubated at 4 ° C and 650 rpm overnight. The well was subsequently incubated with 200 μl of a PBS-4% BSA solution for 2 h in order to block the sites not occupied by the target protein. Following this blocking step, ΙΟΟμΙ of phage solution from the bank were deposited in the well for a period of 2 hours, at room temperature, at 650 rpm. Thus the phages which expose on their surface the specific VHH bind to the target. The phages having non-specific VHH were eliminated by 20 washes with 250 μl of PBS-0.1 l% TWEEN. The phages having target-specific VHHs were then eluted by incubation with ΙΟΟμΙ glycine (pH = 2.5), for 10 min with stirring. The pH of the phage solution, eluted and sampled, was neutralized by adding 60 μl of Tris (pH = 8).
[0073] La caractérisation des tours de sélection se fait d’une part avec le comptage des phages récupérés à la sortie de chaque tour de sélection, et d’autre part, par l’identification de variants isolés qui, exposés sur phages, reconnaissent la cible par un test phage ELISA clonal. Les clones issus des différents tours de sélections sont alors repiqués et les phages correspondants sont produits individuellement pour une meilleure caractérisation.The characterization of the selection rounds is done on the one hand with the counting of the phages recovered at the end of each selection round, and on the other hand, by the identification of isolated variants which, exposed on phages, recognize the target by a phage ELISA clonal test. The clones from the various selection rounds are then subcultured and the corresponding phages are produced individually for better characterization.
[0074] Grâce aux sélections faites sur la protéine P16, ce sont finalement 7 séquences de VHH différentes reconnaissant la protéine P16 qui ont été obtenues. A cette étape, les séquences codant pour ces VHH sont dans le phagemide pHEN qui a servi à la construction de la banque. Afin de produire ces VHH à grande échelle dans des bactéries E. coli de la souche BL21, les séquences des 7 VHH retenues ont été clonées dans le vecteur d’expression pET23-NN-GPP ([fig.l]) dans lequel les séquences VHH sont sous la dépendance d’un promoteur inductible par l’IPTG et sont fusionnées avec une séquence GPP et avec une étiquette histidine (6 résidus histidine). A noter que ce polypeptide intègre une séquence de clivage (TEV) permettant de libérer la GPP et l’étiquette histidine et que les sites de restrictions utilisés pour le clonage sont les sites de Ncol et Noth [0075] La production a ensuite été réalisée dans des bactéries E. coli de souche BL21 transformées par choc thermique avec 2μ1 de vecteur et, après une étape d’expression, les cellules ont été récupérées par centrifugation puis le culot a été repris dans un tampon de lyse (50mM TRIS, 25mM HCl, 250mM NaCl, 25mM Imidazole, DNase, Lysosyme), puis soniqué. Les cellules ainsi lysées ont ensuite été centrifugées à 14000g pendant 5 minutes, et le surnageant a été récolté pour procéder à la purification des VHH.Thanks to the selections made on the P16 protein, 7 different VHH sequences recognizing the P16 protein were finally obtained. At this stage, the sequences coding for these VHHs are in the phagemid pHEN which was used for the construction of the library. In order to produce these VHH on a large scale in E. coli bacteria of the BL21 strain, the sequences of the 7 VHH retained were cloned into the expression vector pET23-NN-GPP ([fig.l]) in which the sequences VHH are dependent on an IPTG-inducible promoter and are fused with a GPP sequence and with a histidine tag (6 histidine residues). Note that this polypeptide integrates a cleavage sequence (TEV) making it possible to release the GPP and the histidine tag and that the restriction sites used for cloning are the Ncol and Noth sites. The production was then carried out in BL21 strain E. coli bacteria transformed by heat shock with 2 μl of vector and, after an expression step, the cells were recovered by centrifugation then the pellet was taken up in a lysis buffer (50 mM TRIS, 25 mM HCl, 250mM NaCl, 25mM Imidazole, DNase, Lysosyme), then sonicated. The cells thus lysed were then centrifuged at 14000 g for 5 minutes, and the supernatant was collected to proceed with the purification of the VHH.
[0076] La purification des VHH a ensuite été effectuée avec une première étape de purification du polypeptide par affinité sur colonne de nickel (HisTrap EE Crude 5ml, GE Healthcare) grâce à la présence de l’étiquette histidine, suivie d’une deuxième étape de purification par passage de l’éluat sur une colonne de gel filtration (HILOAD 26/60 SUPERDEX 75 PG 250ML, HILOAD 26/60 SUPERDEX 200 PG 250ML, GE HEALTHCARE). Les résultats ont montré que sur les 7 séquences VHH, seuls 4 ont pu finalement être produites et purifiées de façon satisfaisante. La figure 2 ([fig.2]) montre un gel SDS-PAGE des 4 VHH obtenus avec une bande à la taille attendue (la protéine de fusion VHH-GEP fait environ 45 kDa) et des bandes contaminantes dont une correspond à la GEP (28kDa).The purification of the VHH was then carried out with a first step of purification of the polypeptide by affinity on a nickel column (HisTrap EE Crude 5ml, GE Healthcare) thanks to the presence of the histidine tag, followed by a second step purification by passing the eluate over a gel filtration column (HILOAD 26/60 SUPERDEX 75 PG 250ML, HILOAD 26/60 SUPERDEX 200 PG 250ML, GE HEALTHCARE). The results showed that of the 7 VHH sequences, only 4 could finally be produced and purified satisfactorily. Figure 2 ([fig.2]) shows an SDS-PAGE gel of the 4 VHH obtained with a band of the expected size (the VHH-GEP fusion protein is approximately 45 kDa) and contaminating bands, one of which corresponds to GEP (28kDa).
[0077] L’affinité des 4 VHH obtenu avec la protéine P16 a ensuite été testée. Pour ce faire, les vitesses d’association et de dissociation des 4 VHH ont été mesurées par la méthode de Biolayer Interferometry avec une concentration de VHH de 500 nM.The affinity of the 4 VHH obtained with the P16 protein was then tested. To do this, the association and dissociation rates of the 4 VHH were measured by the Biolayer Interferometry method with a VHH concentration of 500 nM.
[0078] Linalement, il ressort de ce travail de criblage qu’un seul et unique VHH (SEQ id n°4) présente une bonne affinité pour P16 (il a pu être déterminé un KD de lOnM (10-9 M) entre ce VHH et P16), les autres VHH ne présentant pas d’affinité pour la protéine P16.Linearly, it emerges from this screening work that a single VHH (SEQ id No. 4) has a good affinity for P16 (it has been possible to determine a KD of lOnM (10-9 M) between this VHH and P16), the other VHH showing no affinity for the P16 protein.
[0079] Détermination de l’affinité du VHH identifié pour la protéine P16 par FACS [0080] En vue de déterminer l’affinité du VHH2 identifié pour sa fixation à la protéine P16 exprimée dans des cellules de mammifères, des cellules des lignées HELA (P16++), HEK (P16+) et CHO (PI6-) incubées avec ce VHH ont été analysées par FACS. A titre de contrôle négatif, un VHH ne se liant pas à P16 a été utilisé (VHH4). Les deux VHH ont été utilisées à une concentration de 100 nM pour cette incubation.Determination of the Affinity of the VHH Identified for the P16 Protein by FACS In order to determine the Affinity of the VHH2 Identified for Its Attachment to the P16 Protein Expressed in Mammalian Cells, Cells of the HELA Lines ( P16 ++), HEK (P16 +) and CHO (PI6-) incubated with this VHH were analyzed by FACS. As a negative control, a VHH not binding to P16 was used (VHH4). The two VHH were used at a concentration of 100 nM for this incubation.
[0081] Les résultats sont montrés dans la figure 3 ([fig.3]) dans laquelle sont présenté les médianes d’intensité de fluorescence (MFI) pour les cellules HELA, HEK et CHO incubées en présence de VHH2 (P 16) ou de VHH4 (contrôle négatif).The results are shown in FIG. 3 ([fig.3]) in which the medians of fluorescence intensity (MFI) are presented for the HELA, HEK and CHO cells incubated in the presence of VHH2 (P 16) or of VHH4 (negative control).
[0082] Les résultats montrent que l’on observe bien une fixation spécifique du VHH anti P16 (VHH2) aux cellules exprimant cette protéine (HELA et HEK) et pas aux cellules ne l’exprimant pas (CHO) [0083] La détermination de la constante de dissociation du VHH pour la protéine P16 dans ces deux conditions a révélé un KD de 12,7 nM pour les cellules HELA et de 8,3 nM pour les cellules HEK, soit un KD très proche de celui déterminé préalablement par BLI.The results show that a specific binding of the anti-P16 VHH (VHH2) is clearly observed to the cells expressing this protein (HELA and HEK) and not to the cells not expressing it (CHO). the dissociation constant of the VHH for the P16 protein under these two conditions revealed a KD of 12.7 nM for the HELA cells and of 8.3 nM for the HEK cells, ie a KD very close to that determined beforehand by BLI.
[0084] Aussi, le VHH identifié présente un très bonne spécificité pour la protéine P16, laquelle est maintenue sur cellules, et est donc utilisable dans un test de diagnostic.Also, the identified VHH has very good specificity for the P16 protein, which is maintained on cells, and is therefore usable in a diagnostic test.
[0085] Procédé de diagnostique utilisant le VHH identifié [0086] Par FCAS [0087] Les cellules d’un frottis cervico-utérin sont fixées, perméabilisées avant d’être incubées en présence du VHH dirigé contre la protéine P16, lequel VHH est couplé à un fluorophore. Les cellules sont ensuite sont analysées par FACS (cytométrie de flux).Diagnostic method using the identified VHH By FCAS [0087] The cells of a cervical smear are fixed, permeabilized before being incubated in the presence of VHH directed against the P16 protein, which VHH is coupled to a fluorophore. The cells are then analyzed by FACS (flow cytometry).
[0088] Les cellules surexprimant la protéine P16 dans l’échantillon sont alors identifiées simplement.The cells overexpressing the P16 protein in the sample are then simply identified.
[0089] Par immunohistochime [0090] Les cellules d’un frottis cervico-utérin sont fixées, perméabilisées avant d’être incubées en présence du VHH dirigé contre la protéine P16, lequel VHH est fusionné à un fragment Fc d’un anticorps humain ou de souris.By immunohistochemistry The cells of a cervical smear are fixed, permeabilized before being incubated in the presence of VHH directed against the P16 protein, which VHH is fused to an Fc fragment of a human antibody or of mice.
[0091] Après lavage, les cellules sont incubées avec un anticorps secondaire dirigé contre le fragment Fc auquel est fusionné le domaine VHH, lequel anticorps secondaire est couplé à une enzyme permettant la détection de cet anticorps (péroxydase, phosphatase alcaline, etc.).After washing, the cells are incubated with a secondary antibody directed against the Fc fragment to which the VHH domain is fused, which secondary antibody is coupled to an enzyme allowing the detection of this antibody (peroxidase, alkaline phosphatase, etc.).
[0092] Après incubation et lavage, la présence de cet anticorps secondaire est mise en évidence à l’aide de l’activité enzymatique de l’enzyme qui lui est couplée.After incubation and washing, the presence of this secondary antibody is demonstrated using the enzymatic activity of the enzyme which is coupled to it.
[0093] Les cellules surexprimant la protéine P16 dans l’échantillon sont alors identifiées simplement.The cells overexpressing the P16 protein in the sample are then simply identified.
Claims (1)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DZ180497 | 2018-10-14 | ||
| DZ180497 | 2018-10-14 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| FR3088640A1 true FR3088640A1 (en) | 2020-05-22 |
Family
ID=70729125
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| FR1907860A Pending FR3088640A1 (en) | 2018-10-14 | 2019-07-12 | NOVEL POLYPEPTIDE SPECIFICALLY BINDING TO PROTEIN P16 |
Country Status (1)
| Country | Link |
|---|---|
| FR (1) | FR3088640A1 (en) |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000001845A2 (en) | 1998-07-01 | 2000-01-13 | Deutsches Krebsforschungszentrum, Stiftung Des Öffentlichen Rechts | Method for early diagnosis of carcinomas |
| WO2011075861A1 (en) | 2009-12-23 | 2011-06-30 | Esbatech, An Alcon Biomedical Research Unit Llc | Method for decreasing immunogenicity |
| WO2012175741A2 (en) | 2011-06-23 | 2012-12-27 | Ablynx Nv | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| WO2013024059A2 (en) | 2011-08-17 | 2013-02-21 | Glaxo Group Limited | Modified proteins and peptides |
| CN108558996A (en) * | 2018-01-11 | 2018-09-21 | 广州江元医疗科技有限公司 | A kind of monoclonal antibody combined with p16 protein-specifics and its application in kit |
-
2019
- 2019-07-12 FR FR1907860A patent/FR3088640A1/en active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000001845A2 (en) | 1998-07-01 | 2000-01-13 | Deutsches Krebsforschungszentrum, Stiftung Des Öffentlichen Rechts | Method for early diagnosis of carcinomas |
| WO2011075861A1 (en) | 2009-12-23 | 2011-06-30 | Esbatech, An Alcon Biomedical Research Unit Llc | Method for decreasing immunogenicity |
| WO2012175741A2 (en) | 2011-06-23 | 2012-12-27 | Ablynx Nv | Techniques for predicting, detecting and reducing aspecific protein interference in assays involving immunoglobulin single variable domains |
| WO2013024059A2 (en) | 2011-08-17 | 2013-02-21 | Glaxo Group Limited | Modified proteins and peptides |
| CN108558996A (en) * | 2018-01-11 | 2018-09-21 | 广州江元医疗科技有限公司 | A kind of monoclonal antibody combined with p16 protein-specifics and its application in kit |
Non-Patent Citations (8)
| Title |
|---|
| "Ullmann's Ency-clopedia of Industrial Chemistry", 1989, MARCEL DEKKER |
| ANSEL ET AL.: "Pharmaceutical Dosage Forms and Drug Delivery System", 1994, WILLIAMS & WILKINS |
| EDGARROBERT C., NUCLEIC ACIDS RESEARCH, vol. 32, 2004, pages 1792 |
| NEDDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| O'NEILL CIARAN J ET AL: "p16 Expression in the Female Genital Tract and Its Value in Diagnosis", ADVANCES IN ANATOMIC PATHOLOGY, vol. 13, no. 1, 1 January 2006 (2006-01-01), US, pages 8 - 15, XP055855664, ISSN: 1072-4109, Retrieved from the Internet <URL:http://dx.doi.org/10.1097/01.pap.0000201828.92719.f3> DOI: 10.1097/01.pap.0000201828.92719.f3 * |
| PEARSONLIPMAN, PROC. NATL. ACD. SCI. USA, vol. 85, 1988, pages 2444 |
| SARWATH HINA ET AL: "Introduction of p16INK4a as a surrogate biomarker for HPV in women with invasive cervical cancer in Sudan", INFECTIOUS AGENTS AND CANCER, vol. 12, no. 1, 30 September 2017 (2017-09-30), pages 1 - 8, XP055855669, Retrieved from the Internet <URL:https://infectagentscancer.biomedcentral.com/track/pdf/10.1186/s13027-017-0159-0.pdf> DOI: 10.1186/s13027-017-0159-0 * |
| SMITHWATERMAN, AD. APP. MATH., vol. 2, 1981, pages 482 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230382997A1 (en) | Antigen-binding proteins targeting shared antigens | |
| KR102365977B1 (en) | single chain variable fragment CD3 binding protein | |
| JP2021164459A (en) | Cross-species-specific psma×cd3 bispecific single-chain antibody | |
| Wuethrich et al. | Site-specific chemoenzymatic labeling of aerolysin enables the identification of new aerolysin receptors | |
| AU2016202380A1 (en) | Notum protein modulators and methods of use | |
| EP3574019A1 (en) | Tissue-specific wnt signal enhancing molecules and uses thereof | |
| US20220162320A1 (en) | Multispecific binding proteins | |
| JP2018520675A (en) | Novel binding protein based on diubiquitin mutant protein and production method thereof | |
| CA2827983A1 (en) | Novel superactive il-33 fragments, and uses thereof | |
| EP2212353A1 (en) | Antibody fragments inhibiting hiv nef protein | |
| EP2486059B1 (en) | Monovalent ligands of the human cd28 receptor | |
| Nisbet et al. | Central amyloid-β-specific single chain variable fragment ameliorates Aβ aggregation and neurotoxicity | |
| TW200846366A (en) | Agent for suppressing rejection in organ transplantation comprising anti-hmgb-1 antibody | |
| JP2012505650A (en) | TMPRSS4-specific human antibody | |
| FR3088640A1 (en) | NOVEL POLYPEPTIDE SPECIFICALLY BINDING TO PROTEIN P16 | |
| CA2051651A1 (en) | Monoclonal antibodies recognizing a peptide associated with a major histocompatibility antigen | |
| EP4305063A1 (en) | Protease cleavable prodrugs | |
| CN107108723B (en) | Antibodies to argininosuccinate synthetase and related methods | |
| JP2018508206A (en) | Antibodies against L-type voltage-gated channels and related methods | |
| WO2023058762A1 (en) | Fluorescent vhh antibody | |
| Johnston | Studying the chaperone function of small heat-shock proteins using single-molecule fluorescence microscopy | |
| US20240110153A1 (en) | Surface Modified Red Blood Cells And Methods Of Generating The Same | |
| FR3128713A1 (en) | Binding agent with enhanced affinity for the prevention and treatment of sarbecovirus-related diseases | |
| WO2022155503A1 (en) | Multi-specific antibodies and methods of use | |
| CA2980642A1 (en) | Anti-cd89 cytotoxic complex |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PLFP | Fee payment |
Year of fee payment: 2 |
|
| PLFP | Fee payment |
Year of fee payment: 3 |
|
| PLSC | Publication of the preliminary search report |
Effective date: 20211210 |
|
| RX | Complete rejection |
Effective date: 20230619 |