WO2012118353A2 - 엔도사이토시스 모티프 및 단백질 도입 도메인을 포함하는 암 예방 또는 치료용 약학적 조성물 - Google Patents

엔도사이토시스 모티프 및 단백질 도입 도메인을 포함하는 암 예방 또는 치료용 약학적 조성물 Download PDF

Info

Publication number
WO2012118353A2
WO2012118353A2 PCT/KR2012/001593 KR2012001593W WO2012118353A2 WO 2012118353 A2 WO2012118353 A2 WO 2012118353A2 KR 2012001593 W KR2012001593 W KR 2012001593W WO 2012118353 A2 WO2012118353 A2 WO 2012118353A2
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
met
endocytosis
motif
polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2012/001593
Other languages
English (en)
French (fr)
Other versions
WO2012118353A3 (ko
Inventor
박영우
조기원
조규원
박지현
현순실
박윤정
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Korea Research Institute of Bioscience and Biotechnology KRIBB
Original Assignee
Korea Research Institute of Bioscience and Biotechnology KRIBB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Korea Research Institute of Bioscience and Biotechnology KRIBB filed Critical Korea Research Institute of Bioscience and Biotechnology KRIBB
Priority to US14/002,600 priority Critical patent/US9617304B2/en
Publication of WO2012118353A2 publication Critical patent/WO2012118353A2/ko
Publication of WO2012118353A3 publication Critical patent/WO2012118353A3/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/10—Peptides having 12 to 20 amino acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/18—Growth factors; Growth regulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475—Growth factors; Growth regulators
    • C07K14/4753—Hepatocyte growth factor; Scatter factor; Tumor cytotoxic factor II
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22

Definitions

  • the present invention relates to a novel endocytic motif, specifically the fusion polypeptide comprising the motif and protein introduction domain represented by the amino acid sequence of SEQ ID NO: 1, pharmaceutical for preventing or treating cancer comprising the same A method of treating cancer comprising administering the composition and the composition.
  • Hepatocyte growth factor is a mesenchymal-derived pleiotropic factor with mitogenic, motogenic and morphogenic activity against many different cell types. HGF effect is mediated by c-Met, a specific tyrosine kinase. In addition, abnormal HGF and c-Met expression is frequently observed in various cancers, and it is known that regulation of the HGF / c-Met signaling pathway is associated with tumor growth and metastasis.
  • c-Met plays an important role in the development of cancer, it has been pointed out as an effective target of cancer treatment.
  • Overexpression of HGF / c-Met signaling is associated with metastasis and angiogenesis of various cells of the epithelial family, and in this regard, the c-Met antagonist targeting c-Met suggests potential for anticancer drug development.
  • c-Met cantilever antibodies can negatively regulate tumor growth by inhibiting HGF's c-Met dimerization activity (Jin et al, Cancer Research). 68 (11): 4360-4368, 2008; Comoglio et al., Nature Review Drug Discovery. 7: 504-516, 2008).
  • the process of endocytosis of the receptor by the ligand is very important in cytophysiology.
  • the trafficking rate of the receptor modulates the duration and signaling of the signaling process, ultimately determining cell growth, motility and cell fate (Polo et al., Cell, 124 (5). ): 897-900, 2006). Therefore, if we understand and utilize the molecular mechanism of endocytosis, we can not only regulate the biological process of cells, but also can be useful for developing effective therapeutics.
  • Protein transduction domain was discovered by studying the process of HIV's TAT instantaneously entering the cell (Green et al., Cell, 55 (6): 1179-88, 1988). Similar studies have been conducted on Drosophila homeodomain transcription factor (Drosophila homeodomain transcription factor) proteins in Drosophila, and 16 amino acid sequences 43 to 58 are known to be essential (Derossi et al., J Biol Chem, 271 (30): 18188-). 93, 1996). In addition to TAT and antennapedia, the VP22 proteins of Herpes simplex virus (HSV) have also been reported to function as PTD (Elliott et. Al., Cell, 88: 223-233, 1997).
  • HSV Herpes simplex virus
  • One object of the present invention is to provide a novel endocytic motif.
  • Another object of the present invention to provide a pharmaceutical composition for preventing or treating cancer comprising the motif as an active ingredient.
  • Another object of the present invention is a polypeptide-C terminus comprising an endocytosis motif represented by the amino acid sequence of N-terminal-protein transduction domain-SEQ ID NO: 1 or an amino acid sequence of N-terminal-SEQ ID NO: 1
  • an endocytosis motif represented by the amino acid sequence of N-terminal-protein transduction domain-SEQ ID NO: 1 or an amino acid sequence of N-terminal-SEQ ID NO: 1
  • Another object of the present invention to provide a pharmaceutical composition for preventing or treating cancer comprising the fusion polypeptide.
  • Still another object of the present invention is to provide a method for treating cancer, comprising administering the composition.
  • the present invention specifically inhibits endocytosis of c-Met to effectively inhibit HGF / c-Met signaling pathways associated with metastasis and growth of various cancer cells, thereby inhibiting metastasis, invasion, angiogenesis and growth of cancer. Has the effect. Therefore, the present invention can be usefully used as an anticancer agent for various cancers.
  • Figure 2 is a schematic diagram of the DNA constructs of Tac chimeric proteins used to explore the domain of c-Met and the endocytosis motif of c-Met.
  • Figures 3a and 3b are fluorescence micrographs showing the endocytosis of the Tac chimeric proteins shown in Figure 1 expressed in COS-7 cells.
  • 4A and 4B are graphs showing the quantification of endocytosis in FIGS. 3A and 3B.
  • FIG. 5 shows that endocytosis was inhibited by ConA (Concannavalin A), Dynasore and Go6976 when Tac / 3S chimeric protein was expressed in COS-7 cells to induce endocytosis, but K252a and Vinbla Fluorescence micrograph showing that it was not inhibited by Vinblastine.
  • ConA Concannavalin A
  • Dynasore Dynasore
  • Go6976 when Tac / 3S chimeric protein was expressed in COS-7 cells to induce endocytosis
  • K252a and Vinbla Fluorescence micrograph showing that it was not inhibited by Vinblastine.
  • FIG. 6 is a fluorescence micrograph showing the results of colocalization experiments to determine the intracellular location of Tac / 3S chimeric protein expressed in COS-7 cells.
  • Figure 7 shows the results of the combination-immunoprecipitation method showing that c-Met's leucine is essential for the interaction with ⁇ -adaptin (left) and the colocalization of c-Met and ⁇ -adaptin in HeLa cells. Fluorescence micrograph (right).
  • FIG. 8 shows the structure and amino acid sequence of the Ant-3S-FITC fusion polypeptide (top) and FACS data (bottom) showing that the Ant-3S-FITC fusion polypeptide is rapidly introduced into HeLa cells.
  • FIG. 9 is FACS data (FIG. 9A) and fluorescence micrographs (FIG. 9B) showing that the Ant-3S-FITC fusion polypeptide can inhibit endocytosis of c-Met.
  • FIG. 10 is a fluorescence micrograph showing that Ant-3S-FITC fusion polypeptides can inhibit HGF-dependent endocytosis of phosphorylated c-Met in HeLa (FIG. 10A) and Hep3B (FIG. 10B) cells.
  • FIG. 11 is a Western blot photograph showing that Ant-3S-FITC fusion polypeptides can inhibit self-phosphorylation of c-Met and FAK by HGF.
  • FIG. 12 is a Western blot photograph showing that when the Ant-3S-FITC fusion polypeptide was preincubated for 90 minutes, autophosphorylation of Erk1 / 2 by HGF can be inhibited.
  • FIG. 13 is a Western blot photograph showing that Ant-3S-FITC fusion polypeptides can inhibit self-phosphorylation of Erk1 / 2 and AKT by HGF compared to other inhibitors.
  • FIG. 14 is a graph showing MTT assay results showing that Ant-3S-FITC fusion polypeptides can inhibit proliferation of Hep3B cell lines.
  • FIG. 16 is a photograph (FIG. 16A) and a graph (FIG. 16B) showing the results of a transwell migration assay showing that Ant-3S-FITC fusion polypeptides can inhibit migration of human umbilical vein endothelial cells (HUVECs) and Hep3B cells. .
  • FIG. 17 is a fluorescence micrograph showing that Ant-3S-FITC fusion polypeptide does not affect endocytosis of other receptors except c-Met.
  • the present invention provides a novel endocytotic motif, preferably an endocytosis motif represented by the amino acid sequence of SEQ ID NO: 1.
  • the endocytosis motif (hereinafter, may be used interchangeably with “3S polypeptide” or “3S” in this specification) is C of c-Met which causes (derives) endocytosis of c-Met.
  • a motif consisting of 16 highly conserved amino acids (SEQ ID NO: 1, KCVAPYPSLLSSEDNA) present at the terminal, first identified by the inventors.
  • the inventors have found that dileucine in the motif is essential for the endocytosis of c-Met.
  • the endocytosis motif of the present invention includes, without limitation, a sequence showing endocytosis activity of c-Met, but includes an endocytosis motif consisting of the amino acid sequence of SEQ ID NO: 1 in minimum units, but exhibits endocytosis activity. All sequences consisting of substitutions, additions, deletions, etc. of amino acids of the motif may also be included in the scope of the present invention.
  • the motif may be at least 75%, preferably at least 85%, more preferably at least 90%, even more preferably at least 95%, most preferably at least 98% identical to the endocytosis motif of SEQ ID NO: 1 May comprise an amino acid sequence.
  • amino acids mentioned herein are abbreviated as follows according to the IUPAC-IUB nomenclature.
  • the present inventors have used a fusion protein (Tac / 3S) of Tac and 3S polypeptides to determine whether the motif is introduced into cells by Clathrin mediated endocytosis as in c-Met.
  • ConA Concannavalin A
  • Dynasore Dynasore
  • Go6976 Go6976
  • K252a Vinblastine
  • Vinblastine Vinblastine
  • the motif may have an activity of inhibiting endocytosis of at least one c-Met selected from the group consisting of c-Met, phosphorylated c-Met and c-Met bound to HGF.
  • the motif of the present invention may have an activity of inhibiting self-phosphorylation of c-Met by HGF.
  • the motif of the present invention can block c-Met signaling associated with cancer metastasis and growth by inhibiting the endocytosis of c-Met.
  • the invention provides a polypeptide-C terminus comprising an endocytosis motif represented by the amino acid sequence of N-Protein transduction domain-SEQ ID NO.
  • protein introduction domain is a small peptide consisting of a basic amino acid called CPP (cell permeable protein), MTS (membrane translocating sequences), substances that bind themselves or themselves without the help of a special receptor It refers to the domain of the protein that can move through the cell membrane and into the cell.
  • CPP cell permeable protein
  • MTS membrane translocating sequences
  • the protein transduction domain is a means for rapidly introducing the motif of the present invention into cells, but is not limited thereto, including Tat (SEQ ID NO: 2, YGRKKRRQRRR) of human immunodeficiency virus (HIV); VP22 (SEQ ID NO: 3, DAATATRGRSAASRPTERPRAPARSASAPRRPVE) of Herpes simplex virus (HSV); Drosophila Antp (SEQ ID NO: 4, RQIKIWFQNRRMKWKK); Mph-1 (SEQ ID NO: 5, YARVRRRGPRR); Sim-2 (SEQ ID NO: 6, AKAARQAAR); R7 (SEQ ID NO: 7, RRRRRRR); Pep-1 (SEQ ID NO: 8, LETWWETWWTEWSQPKKKRKV); And Pep-2 (SEQ ID NO: 9, KETWFETWFTEWSQPKKKRKV).
  • Tat SEQ ID NO: 2, YGRKKRRQRRR
  • HMV Herpes simplex virus
  • the protein transduction domain may be Antp (SEQ ID NO: 4) of the Drosophila
  • the fusion polypeptide may be a polypeptide represented by the amino acid sequence of SEQ ID NO: 10 (RQIKIWFQNRRMKWKKKCVAPYPSLLSSEDNA).
  • the fusion polypeptides of the present invention may be any tags for the detection of fusion polypeptides at the N- and / or C-terminals of the polypeptide, intracellular location, etc., such as biotin signaling peptides, histidine peptides (his), hemaggluti EGFP (Green Fluorescent Protein), EGFP (Enhanced Blue Fluorescent Protein), EBFP2, which is a type of nin (HA), flag, gold binding peptide and fluorescent protein Azurite, mKalama1], light blue fluorescent protein [ECFP (Enhanced Cyan Fluorescent Protein), Cerulean, CyPet], yellow fluorescent protein derivatives [YFP (Yellow Fluorescent Protein), Citrine, Venus, YPet], BFP derivative (Blue Fluorescent Protein derivatives) It may further include a tag such as FITC (Fluorescein isothiocyanate).
  • FITC Fluorescein isothiocyanate
  • the fusion polypeptides of the present invention may further comprise a protein of interest.
  • target protein includes any protein to be introduced into the cell by endocytosis by the fusion polypeptide of the present invention, but may be a therapeutic protein.
  • the fusion polypeptides of the present invention may further comprise a compound.
  • the compound may be a drug including an anticancer agent.
  • the fusion polypeptide of the present invention may be used as a carrier capable of introducing a drug or foreign protein into a cell.
  • Adding the target protein or compound to the fusion polypeptide may use various methods such as known chemical binding, enzymatic binding, genetic recombination technology, but is not limited thereto.
  • fusion polypeptide (Ant-3S-FITC fusion polypeptide) expressed as "N-Drosophila Antp-3S polypeptide-FITC-C terminus"
  • FACS Fluorescence Activated Cell Sorting
  • the fusion polypeptide can be rapidly introduced into cells by clathrin mediated endocytosis, thereby consisting of c-Met, phosphorylated c-Met and c-Met bound to HGF present on the cell surface. It can inhibit the endocytosis of one or more c-Met selected from the group.
  • c-Met is inhibited by Ant-3S-FITC fusion polypeptide through FACS and fluorescence microscopy (Figs. 9a and 9b)
  • c- phosphorylated by HGF Fluorescence microscopy confirmed that endocytosis of Met could also be inhibited (FIGS. 10A and 10B).
  • the self-phosphorylation of c-Met is inhibited by the fusion polypeptide through Western blot (FIG. 11).
  • the present invention provides a pharmaceutical composition for preventing or treating cancer, comprising an endocytosis motif represented by the amino acid sequence of SEQ ID NO: 1 as an active ingredient.
  • the present invention provides a polypeptide-C terminus or an N-terminal SEQ ID NO: 1 amino acid sequence comprising an endocytosis motif represented by the amino acid sequence of the N-terminal protein introduction domain-SEQ ID NO: 1.
  • a pharmaceutical composition for preventing or treating cancer comprising a fusion polypeptide represented by a polypeptide-protein introduction domain-C terminus including an expressed endocytosis motif as an active ingredient.
  • the present invention provides a method for preventing or treating cancer, comprising administering the composition to a subject who develops or is likely to develop cancer.
  • the pharmaceutical composition may have an activity of inhibiting metastasis or growth of cancer.
  • cancer refers to a disease associated with control of cell death, and the disease caused by excessive proliferation of cells when the normal apoptotic balance is broken. These abnormally over-proliferating cells sometimes invade surrounding tissues and organs to form masses and destroy or modify the normal structure of the body, which is called cancer.
  • the cancer may be a cancer in which a signaling pathway by HGF and its receptor c-Met is activated, but is not limited thereto.
  • the cancer may include ovarian cancer, breast cancer, osteosarcoma, colon cancer, esophageal cancer, duodenal cancer, It may be one or more cancers selected from the group consisting of kidney cancer, lung cancer, pancreatic cancer, gastric cancer, cervical cancer and prostate cancer.
  • prevention means any action that inhibits metastasis, growth, etc., or delays the onset of cancer by administration of the composition
  • treatment means that symptoms caused by cancer are improved by administration of the composition
  • the term "individual” means all animals, including humans, who may or may have a cancer, and can effectively prevent or treat the cancer by administering the composition of the present invention to an individual.
  • the composition of the present invention can be administered in parallel with existing anticancer agents.
  • the route of administration of the pharmaceutical composition may be administered via any general route as long as it can reach the target tissue.
  • the composition of the present invention may be administered as desired, but is not limited to intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, oral administration, intranasal administration, pulmonary administration, rectal administration.
  • the composition may also be administered by any device in which the active agent may migrate to the target cell.
  • the composition for preventing or treating cancer of the present invention may include a pharmaceutically acceptable carrier.
  • the composition comprising a pharmaceutically acceptable carrier may be in various oral or parenteral formulations.
  • diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrating agents, and surfactants are usually used.
  • Solid form preparations for oral administration include tablet pills, powders, granules, capsules, and the like, which form at least one excipient such as starch, calcium carbonate, sucrose or lactose in one or more compounds. ) And gelatin.
  • lubricants such as magnesium stearate, talc and the like are also used.
  • Liquid preparations for oral administration include suspensions, solution solutions, emulsions, and syrups, and various excipients, such as wetting agents, sweeteners, fragrances, and preservatives, in addition to commonly used simple diluents such as water and liquid paraffin, may be included.
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilized preparations, suppositories.
  • non-aqueous solvent and the suspension solvent propylene glycol, polyethylene glycol, vegetable oil such as olive oil, injectable ester such as ethyl oleate, and the like can be used.
  • As the base of the suppository witepsol, macrogol, tween 61, cacao butter, laurin butter, glycerogelatin and the like can be used.
  • the pharmaceutical composition is any one selected from the group consisting of tablets, pills, powders, granules, capsules, suspensions, liquid solutions, emulsions, syrups, sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, lyophilized preparations and suppositories. It can have one formulation.
  • composition of the present invention is administered in a pharmaceutically effective amount.
  • pharmaceutically effective amount means an amount sufficient to treat a disease at a reasonable benefit / risk ratio applicable to medical treatment, and an effective dose level is determined by the type and severity of the subject, age, sex, activity of the drug, drug Sensitivity, time of administration, route of administration and rate of release, duration of treatment, factors including concurrent use of drugs, and other factors well known in the medical arts.
  • the compositions of the present invention may be administered as individual therapeutic agents or in combination with other therapeutic agents, may be administered sequentially or simultaneously with conventional therapeutic agents, and may be single or multiple doses. In consideration of all the above factors, it is important to administer an amount that can obtain the maximum effect in a minimum amount without side effects.
  • composition of the present invention can be used alone or in combination with methods for using surgery, hormonal therapy, drug therapy and biological response modifiers for the prevention and treatment of cancer.
  • the fusion polypeptide of the present invention can specifically inhibit the endocytosis of c-Met or phosphorylated c-Met (Fig. 9a, 9b, 10a, 10b and FIG. 17) confirmed that the fusion polypeptide could inhibit the proliferation of cancer cell lines through an MTT assay (FIG. 14).
  • the transwell migration assay and the scattering assay confirmed that the fusion polypeptide can inhibit HGF-dependent cellular migration of cancer cell lines (FIGS. 15, 16A and 16B). Therefore, the pharmaceutical composition comprising the fusion polypeptide as an active ingredient can be usefully used for the prevention and treatment of cancer.
  • HUVEC, Hep3B, HeLa, COS-7 and MDCK cell lines were treated in DMEM (Thermo, SH30243.01) containing 10% FBS (Thermo, SH30532.03) and 1% penicillin stubtomycin (thermo, SV30010). % CO 2 , incubated at 37 °C conditions. After suspension of 0.05% trypsin (Thermo, SH30236.01) for suspension of HUVEC, HeLa and Hep3B cells, the reaction was performed at 37 ° C for 5 minutes.
  • a mixture of 1.5 ⁇ g of plasmid DNA and 3 ⁇ l of lipofectamin (Invitrogen, 11668-027) in 0.2 ml serum-free DMEM was placed at room temperature, followed by 25 minutes of 50% cells in 6 wells.
  • the medium of cells crushed in confluency was changed to serum free DMEM and the mixture was treated. After 5 hours, it was replaced with DMEM containing 10% FBS, and after 48 hours, it was used for fluorescence microscopy observation.
  • Ant-3S-FITC fusion polypeptide of the present invention is rapidly introduced into the cells.
  • HeLa cells are suspended with 0.05% trypsin, washed once with PBS and then 100 nM Ant-3S-FITC fusion polypeptide (in serum-free DMEM). Cells were released. Then, incubated with time at 37 ° C. at 5% CO 2 , washed three times with PBS, and then measured with fluorescence intensity by FACS analyzer (BD CantoII Flow Cytometer).
  • Ant-3S-FITC fusion polypeptide inhibits c-Met endocytosis in HeLa cells
  • HeLa cells were suspended with 0.05% trypsin and washed once with DPBS, followed by 100 nM Ant-3S-FITC fusion polypeptide.
  • Cells were released (in serum-free DMEM). Then, incubated for 30 minutes at 5% CO 2 37 °C and then transferred to 4 °C to prevent endocytosis and left for 30 minutes, and then transferred to 37% 5% CO 2 37 for 30 minutes to advance the endocytosis was left for 30 minutes. . Thereafter, it was placed at -20 ° C for 10 minutes with cold methanol to fix.
  • Plasmid DNA encoding each Tac chimeric protein shown in FIG. 2 was expressed in a COS-7 cell line to induce endocytosis, and the following method was used to quantify the endocytosis percentage.
  • the plasmid DNA was transfected into a COS-7 cell line and released in DMEM supplemented with 10% FBS the next day, and inoculated into 8% slide glass (Thermo, 154534) at 50% cell aggregation. The next day, it was transferred to 4 ° C. for 30 minutes to prevent endocytosis.
  • Anti-Tac (BD bioscience, 347640) antibody was diluted 1:10 in DMEM containing 10% FBS and treated for 30 minutes at 4 ° C.
  • anti-mouse IgG-Alexa Fluor 568 (Invitrogen, A11061) was diluted 1: 500 in PBST containing 3% normal goat serum and treated at room temperature for 1 hour. After washing three times with PBST and fixed with Mounting Medium with DAPI (Vector, H-1200), the sample was confirmed by a fluorescent microscope (Olympus IX2-UCB) the next day.
  • HeLa cells are suspended in DMEM supplemented with 0.05% trypsin and supplemented with 10% FBS and seeded at 8% slide glass (Thermo, 154534) at 50% cell aggregation. It was. The next day, after washing once with DPBS, cells were treated with 100 nM Ant-3S-FITC fusion polypeptide (in DMEM containing 10% FBS) for 30 minutes at 5% CO 2 , 37 ° C. Thereafter, the mixture was transferred to 4 ° C. for 30 minutes to prevent endocytosis, and then transferred to 5% CO 2 , 37 ° C. for 30 minutes to advance the endocytosis.
  • Ant-3S-FITC fusion polypeptides can inhibit HGF-dependent endocytosis of phosphorylated c-Met (Phospho-c-Met) in HeLa and Hep3B cell lines.
  • HeLa and Hep3B cells were suspended with 0.05% trypsin. Then, the cells were released in DMEM supplemented with 10% FBS and inoculated into 8% slide glass (Thermo, 154534) at 50% cell aggregation. The next day, starvation was performed with serum free DMEM for 24 hours. The next day, after washing once with DPBS, Ant-3S-FITC fusion polypeptide was diluted in serum-free DMEM by concentration and treated with cells at 5% CO 2 , 37 ° C.
  • anti-p-Met antibody (Invitrogen, 44888G) was diluted in a ratio of 1: 1000 in 3% normal goat serum (in PBST) and treated at 4 ° C. for 16 hours. After washing three times with PBST, anti-rabit IgG Alexa Fluor568 (Invitrogen, A-11036) was diluted 1: 500 in order to attach a secondary antibody and treated at room temperature for 1 hour. After washing three times with PBST and fixed with Mounting Medium with DAPI (Vector, H-1200), the sample was confirmed by a fluorescent microscope (Olympus IX2-UCB) the next day.
  • Plasmid DNA was transfected into a COS-7 cell line, and the next day, it was released in DMEM supplemented with 10% FBS and inoculated into 8% slide glass (Thermo, 154534) at 50% cell aggregation. The next day, after washing once with DPBS, cells were treated with 100 nM Ant-3S-FITC fusion polypeptide (in DMEM containing 10% FBS) for 30 minutes at 5% CO 2 , 37 ° C.
  • Anti-HA (Invitrogen, 71-5500) antibody and anti-Tac (BD bioscience, 347640) antibody was diluted 1: 100 and 1:10 in DMEM containing 10% FBS, respectively, and treated for 30 minutes at 4 ° C. After washing three times with DMEM containing 10% FBS, 5% CO 2 , 37 ° C. was left for 30 minutes to advance endocytosis. In order to fix, it was placed at room temperature for 45 minutes in 4% paraformaldehyde.
  • Hep3B cell lines were inoculated into 6-well plates with a cell aggregation of 70% and the medium was changed to serum-free DMEM the next day. The next day, after washing once with serum-free DMEM, the Ant-3S-FITC fusion polypeptide was diluted in serum-free DMEM by concentration and treated with cells at 5% CO 2 , 37 ° C. for 30 minutes. Thereafter, 40 ng / ml of recombinant human HGF (R & D systems, 294-HG-005) was treated with cells at 5% CO 2 , 37 ° C. for 30 minutes in order to activate signaling by HGF.
  • R & D systems 294-HG-005
  • the plate was moved on ice, washed three times with cold PBS, and then the cells were collected using a cell scraper, where a Protease Inhibitor cocktail (Calbiochem, 11836153001) and a Phosphatase Inhibitor cocktail (Sigma) were used.
  • a Protease Inhibitor cocktail Calbiochem, 11836153001
  • a Phosphatase Inhibitor cocktail Sigma
  • the cell lysates thus obtained were electrophoresed at 100 volts for 1 hour and 30 minutes on an 8% Tris-HCl SDS gel and transferred for 1 hour at 100 volts with a nitrocellulose membrane.
  • the membrane was immersed in 5% skim milk (0.05% T-tween in PBS) in TBST and shaken at room temperature for 1 hour.
  • Primary antibodies were diluted in 5% skim milk in TBST, treated with membranes and shaken at 4 ° C. for 16 hours. After moving the membrane to room temperature and washing three times with TBST for 10 minutes, the secondary antibody was diluted in 5% skim milk in TBST, treated with the membrane, and shaken at room temperature for 1 hour.
  • Primary antibodies include anti-p-Met antibody (Invitrogen, 44888G), anti-p-FAK antibody (Cell signaling, 3283S), anti-p-AKT antibody (Millipore, 05-736), anti-p-Erk1 / 2 (Cell signaling, 9101S) and anti- ⁇ -actin antibody (Sigma, A5441) were used. Secondary antibodies were anti-rabbit IgG-HRP (Santacruz, sc-2004) and anti-mouse IgG-HRP (Santacruz). , sc-2005).
  • Hep3B cell lines were seeded in 6 well plates at 90% cell aggregation. The next day was washed once with DPBS and the medium was changed to serum-free DMEM. The next day, the surface was evenly wound by 200 ⁇ l yellow tip, washed once with serum-free DMEM, and then the Ant-3S-FITC fusion polypeptide was diluted in serum-free DMEM by concentration and 5% CO 2 , Cells were treated for 30 minutes at 37 ° C. Thereafter, 40 ng / ml of recombinant human HGF (R & D systems, 294-HG-005) was treated to activate signaling by HGF, and then wound healing was observed under a microscope after 24 hours.
  • R & D systems 294-HG-005
  • the upper chamber was washed once with PBS and then incubated for 10 minutes at RT in crystal violet. Thereafter, while rinsing the upper chamber with distilled water, the cells were weakly attached to the upper surface with a cotton swab and then observed under a microscope.
  • Hep3B cell lines were inoculated into 96 well plates by 5 ⁇ 10 3 cells and then replaced with serum-free DMEM the next day for starvation.
  • the next day Ant-3S-FITC fusion polypeptide was diluted in serum-free DMEM by concentration, treated at 37 ° C. for 30 minutes, and then a mixture of 2% FBS + Ant-3S-FITC fusion polypeptide was added.
  • 20 ⁇ l per 100 ⁇ l of MTT was added to each well, and then incubated at 37 ° C. for 1 hour. After removing all the supernatant, the absorbance at 560 nm was measured.
  • Plasmid DNA encoding Tac / 3S protein and Tac / 3S-LL / AA protein was transfected into COS-7 cells using lipofectamine, and an endocytosis assay was performed 48 hours later. Specifically, the plate was placed at 4 ° C. for 1 hour and then transferred to 37 ° C. for 10 minutes. After washing three times with PBS, the cells were collected by scraper, and the cells were lysed with 1 ml of NP-40 containing a protease inhibitor cocktail. The e-tubes containing the lysate were then stirred for 30 minutes on ice and centrifuged at 4 ° C., 13000 rpm for 20 minutes.
  • the supernatants were transferred to fresh e-tubes followed by Bradford quantification and 1 mg of lysate was diluted in 1 ml lysis buffer.
  • 20 ⁇ l of a protein G (GE Healthcare, 17-0618-01) slurry was added thereto, followed by pre-clearing by stirring at 4 ° C. for 10 minutes (at this time, the protein G was washed three times with PBS in advance).
  • the supernatant was transferred to a new e-tube by centrifugation at 13000 rpm for 10 minutes at 4 ° C., and 4 ⁇ g of anti-Tac antibody (BD, 347640) and 20 ⁇ l of Protein G slurry were added thereto, followed by 4 ° C.
  • BD anti-Tac antibody
  • the MDCK cell line was inoculated into 6 wells with a cell aggregation of 30% and the next day the medium was changed to serum free medium without FBS. The next day, Ant-3S-FITC fusion polypeptide was treated for 90 minutes at a concentration of 0.1 ⁇ M. Thereafter, recombinant human HGF was treated at a concentration of 20 ng / ml, and after 16 hours, the morphology of the cells was observed through an optical microscope.
  • Tac was labeled with anti-mouse IgG-Alexa Fluor 488 before infiltration to detect surface Tac
  • Tac was labeled with anti-mouse IgG-Alexa Fluor 568 after infiltration to detect intracellular Tac.
  • green fluorescence intensity refers to the amount of cell surface Tac
  • red fluorescence intensity refers to the amount of endocytosised Tac and some cell surface Tac. Since the two secondary antibodies used here are different polyclonal antibodies, detection of the surface Tac of anti-mouse IgG-Alexa Fluor 568, which was later labeled by the first labeled anti-mouse IgG-Alexa Fluor 488, was partially Weakens.
  • a DNA construct as shown in FIG. 2 was constructed. Specifically, a chimeric protein was constructed in which the extracellular domain (Tac ECD) of the Tac (CD25) protein was linked to the cytoplasmic domains of c-Met in order to track endocytic trafficking. Since the extracellular domain of Tac alone cannot induce endocytosis, the purpose of this study was to find out which part is essential for endocytosis by connecting amino acids sequences of various sizes derived from c-Met to Tac.
  • PSD95 has an endocytosis motif at the C-terminus, resulting in endocytosis well (Craven et al., J Biol Chem, 275 (26): 20045-51, 2000), and the cytoplasmic tail of this protein.
  • the structure linked with Tac was used as a positive control.
  • the plasmid DNA was transferred from 4 ° C. to 37 ° C. to induce endocytosis, and the distribution of chimeric protein was observed under a microscope.
  • endocytosis did not occur in the case of Tac ECD over time, but Tac / PSD95 was internalized most of the cells within 10 minutes. Endocytosis of c-Met from 1343 to 1408 to Tac also resulted in rapid endocytosis, and as a result of the shortening of the length of the amino acid, endocytosis was achieved with only 16 amino acid sequences at the C-terminus. It could be confirmed that (Fig. 3a, 3b, 4a and 4b). Three serines are present in the 16-amino acid sequence of the C-terminus of c-Met, and the polypeptides having the 16-amino acid sequence of 3S and 3S sequences are designated as 3S polypeptides.
  • c-Met is introduced into cells via Clathrin-mediated endocytosis and is known to be located in EEA1, endoplasmic reticulum (Kermorgant et al., J Cell Biol, 182 (5): 855-63 Kakazu et al., Invest Ophthalmol Vis Sci, 182 (5): 855-63, 2008). Therefore, in order to confirm whether the 3S polypeptide is an important signal regulating endocytotic sorting of c-Met, whether the Tac / 3S protein is also endocytosis in the same pattern as c-Met is described in Example 2-2. Observed with a fluorescence microscope according to the described method, it is shown in FIG.
  • ConA and Dynasore are known to perturb endocytic machinery (Kermorgant et al., EMBO J, 23 (19): 3721-34, 2004), Go6976 c -An inhibitor of PKC ⁇ involved in Met traffic (Kermorgant et al., J Cell Biol, 182 (5): 855-63, 2008).
  • Clathrin Coated Pit allows pinching-off of Dynamin to allow vesicles to form (Hinshaw et al., Nature, 374 (6518): 190 -2, 1995).
  • Inhibition of endocytosis of Tac / 3S protein by treatment of dynasor, an inhibitor of dinamin, means that Tac / 3S protein is introduced into cells through clathrin-mediated endocytosis.
  • Tac / 3S protein traffics dependent on PKC ⁇ and migrates around the nucleus via microtubule-dependent transport.
  • the adapters selectively bind to the cargo receptor by recognizing specific motifs in the cytoplasmic tail of the receptor (Kirchhausen et al. Curr Opin Cell Biol, 9 (4): 488-95, 1997).
  • adaptin ⁇ 2 recognizes cargo dileucine when GLUT8 is endocytosis (Schmidt et al., J Cell Sci, 119 (Pt 11): 2321-31, 2006). Therefore, the complex-immunoprecipitation method as described in Example 2-7 was performed in order to determine whether the leucine in the 3S polypeptide also plays a role in interacting with the ⁇ -adaptin as shown in FIG. 7.
  • an antennapedia-derived protein transduction domain consisting of 16 amino acids (PTD, SEQ ID NO: 4), an endocytosis motif (3S polypeptide) of c-Met, and Fluorescein isothiocyanate (FITC)
  • PTD 16 amino acids
  • SEQ ID NO: 4 an endocytosis motif
  • FITC Fluorescein isothiocyanate
  • the fluorescence intensity was measured through FACS after treating the polypeptide with HeLa cells at different times according to the method described in Example 2-1. 8 is shown.
  • the MFI which was only 101 at 0 minutes, reached 1166 at 30 minutes, and then stably fluorescence until 120 minutes (FIG. 8).
  • c-Met is endocytosis when HGF, a ligand of c-Met, binds to c-Met (Kamei et al., Oncogene, 18 (48): 6776-84, 1999). Therefore, to determine whether the Ant-3S-FITC fusion polypeptide inhibits the endocytosis of c-Met by HGF, Ant-3S-FITC fusion polypeptide and HGF in HeLa and Hep3B cells as described in Example 2-2 above. Treatment of the phospho-c-Met (p-Met) of the cellular distribution (cellular distribution) was observed by fluorescence microscopy, shown in Figure 10a and 10b.
  • Ant-3S-FITC fusion polypeptide when the Ant-3S-FITC fusion polypeptide was treated at low concentration in HeLa cells, some cells absorbed much Ant-3S-FITC fusion polypeptide, while others absorbed relatively little. P-Met is mainly distributed in the form of puncta around the nucleus in the cells which absorbed the Ant-3S-FITC fusion polypeptide, whereas the p-Met was relatively evenly distributed in the cells which absorbed much. .
  • the higher the concentration of the Ant-3S-FITC fusion polypeptide was confirmed that the inhibition of proliferation of Hep3B cell line (Fig. 14). Furthermore, the Ant-3S-FITC fusion polypeptide was subjected to HGF-dependent migration of Hep3B cell line and MDCK cell line through the transwell transfer assay as described in Example 2-5 and the MDCK scattering assay as described in Example 2-8. It was confirmed that it can be suppressed (Figs. 15, 16A and 16B).
  • Ant-3S-FITC fusion polypeptide can be usefully used as a therapeutic agent for inhibiting metastasis of cancer cells.
  • Ant-3S-FITC fusion polypeptide comprising the PSLL sequence can also inhibit the endocytosis of GLUT4, which also includes the PSLL sequence, or specifically inhibit the endocytosis of c-Met, furthermore without the PSLL sequence
  • GLUT4 which also includes the PSLL sequence
  • c-Met specifically inhibit the endocytosis of c-Met
  • Ant-3S-FITC fusion polypeptides effectively inhibit the endocytosis of Tac / 3S chimeric protein, but had no effect on the endocytosis of Tac / PSD95 and GLUT4-HA protein (FIG. 17). These results indicate that Ant-3S-FITC fusion polypeptides can interfere with c-Met's endocytosis specifically.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Toxicology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 신규한 엔도사이토시스 모티프(endocytic motif)에 관한 것으로서, 구체적으로는 서열번호 1의 아미노산 서열로 표시되는 상기 모티프 및 단백질 도입 도메인을 포함하는 융합 폴리펩티드, 이를 포함하는 암 예방 또는 치료용 약학적 조성물 및 상기 조성물을 투여하는 단계를 포함하는 암 치료 방법에 관한 것이다. 본 발명은 c-Met의 엔도사이토시스를 특이적으로 억제하여 다양한 암 세포의 전이 및 성장과 관련된 HGF/c-Met 신호전달 경로를 효과적으로 억제함으로써 암의 전이, 침윤, 혈관신생 및 성장을 억제할 수 있는 효과를 가지고 있다. 따라서, 본 발명은 다양한 암에 대한 항암제로서 유용하게 사용할 수 있다.

Description

엔도사이토시스 모티프 및 단백질 도입 도메인을 포함하는 암 예방 또는 치료용 약학적 조성물
본 발명은 신규한 엔도사이토시스 모티프(endocytic motif)에 관한 것으로서, 구체적으로는 서열번호 1의 아미노산 서열로 표시되는 상기 모티프 및 단백질 도입 도메인을 포함하는 융합 폴리펩티드, 이를 포함하는 암 예방 또는 치료용 약학적 조성물 및 상기 조성물을 투여하는 단계를 포함하는 암 치료 방법에 관한 것이다.
HGF(hepatocyte growth factor)는 다수의 상이한 세포 유형에 대한 분열촉진(mitogenic), 운동촉진(motogenic) 및 형태발생(morphogenic) 활성이 있는 중간엽-유래 다면발현성 인자이다. HGF 효과는 특이적 타이로신 키나제인 c-Met에 의해 매개된다. 또한, 비정상적인 HGF 및 c-Met 발현이 각종 암에서 빈번하게 관찰되고, HGF/c-Met 신호전달 경로의 조절이 종양의 성장 및 전이와 관련된다고 알려져 있다.
따라서, c-Met은 암의 발달과정에서 중요한 역할을 하기 때문에 암 치료제의 효율적인 타겟으로 지목받고 있다. HGF/c-Met 신호전달의 과발현이 상피(epithelial)계열의 다양한 세포의 전이 및 혈관신생과 관련되며, 이러한 관점에서 c-Met을 타겟으로 하는 c-Met 길항제인 항체가 항암제로서의 개발 가능성을 제시하고 있다(Comoglio et al., Nature Review Drug Discovery. 7:504-516, 2008). 예컨대, 이종이식 마우스 모델에서 c-Met 외팔 항체가 HGF의 c-Met 이량체화(dimerization)에 의한 활성을 음성적으로 조절하여 종양 성장을 억제할 수 있음이 보고된바 있다(Jin et al, Cancer Research 68(11): 4360-4368, 2008; Comoglio et al., Nature Review Drug Discovery. 7:504-516, 2008).
한편, 리간드에 의한 수용체의 엔도사이토시스(Endocytosis) 과정은 세포생리학적으로 매우 중요하다. 다시 말하면, 수용체의 트래픽 율(trafficking rate)이 신호전달 과정의 지속시간 및 신호전달을 조절하여 궁극적으로는 세포성장, 운동성 및 세포의 운명까지 결정하게 된다(Polo et al., Cell, 124(5):897-900, 2006). 따라서, 엔도사이토시스의 분자적 메커니즘을 잘 이해하고 이것을 활용한다면 세포의 생물학적 과정을 조절할 수 있을 뿐만 아니라, 효율적인 치료제 개발에 유용하게 사용할 수 있을 것이다.
이와 관련하여, c-Met의 분자적 메커니즘에 관련된 많은 보고들이 나오고 있다. 예를 들면, c-Met의 엔도사이토시스 과정에서 PKC(Kermorgant et al., EMBO J., 23(19):3721-34, 2004), Cbl(Petrelli et al., Nature, 416(6877):187-90, 2002), 디나민(Dynamin; Li et al., Traffic, 6(6):459-73, 2005), Grb2(Li et al., J Biol Chem, 282(23):16764-75, 2007) 등이 관여한다고 알려져 있다. 그러나, c-Met의 어떤 아미노산 서열이 엔도사이토시스 과정에 필수적인지는 알려진 바가 없다.
단백질 도입 도메인(Protein transduction domain, PTD)은 HIV의 TAT이 순간적으로 세포 안으로 들어가는 과정을 연구하면서 발견되었다(Green et al., Cell, 55(6):1179-88, 1988). 비슷한 연구가 초파리의 antennapedia(Drosophila homeodomain transcription factor) 단백질에서 이루어졌으며, 43번부터 58번에 이르는 16개의 아미노산 서열이 필수적임이 알려져 있다(Derossi et al., J Biol Chem, 271(30):18188-93, 1996). 또한, TAT와 antennapedia 외에 HSV(Herpes simplex virus)의 VP22 단백질들도 PTD 기능을 하는 것으로 보고되었다(Elliott et.al., Cell, 88:223-233, 1997).
본 발명자들은 암의 전이 및 성장에 중요한 역할을 하는 HGF/c-Met 신호전달 경로를 억제하기 위한 새로운 메커니즘에 관하여 연구하던 중, c-Met의 C 말단에 존재하는 16개의 아미노산으로 이루어진 엔도사이토시스 모티프를 새롭게 동정하였으며, 이를 단백질 도입 도메인을 이용하여 세포 내로 이입시키는 경우 c-Met의 엔도사이토시스가 특이적으로 억제되며, 나아가 암세포의 이동이 억제됨을 확인하고, 본 발명을 완성하였다.
본 발명의 하나의 목적은 신규한 엔도사이토시스 모티프(endocytic motif)를 제공하는 것이다.
본 발명의 다른 목적은 상기 모티프를 유효성분으로 포함하는 암 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 [N 말단-단백질 도입 도메인-서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 포함하는 폴리펩티드-C 말단] 또는 [N 말단-서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 포함하는 폴리펩티드-단백질 도입부 도메인-C 말단]으로 표현되는 융합 폴리펩티드를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 융합 폴리펩티드를 포함하는 암 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 조성물을 투여하는 단계를 포함하는 암 치료 방법을 제공하는 것이다.
본 발명은 c-Met의 엔도사이토시스를 특이적으로 억제하여 다양한 암 세포의 전이 및 성장과 관련된 HGF/c-Met 신호전달 경로를 효과적으로 억제함으로써 암의 전이, 침윤, 혈관신생 및 성장을 억제할 수 있는 효과를 가지고 있다. 따라서, 본 발명은 다양한 암에 대한 항암제로서 유용하게 사용할 수 있다.
도 1은 c-Met C 말단의 PSLL 모티프가 보존되어 있음을 보이는 도면이다.
도 2는 c-Met의 도메인 및 c-Met의 엔도사이토시스 모티프를 탐색하기 위하여 사용한 Tac 키메라 단백질들의 DNA 구조체의 모식도이다.
도 3a 및 3b는 COS-7 세포에서 발현된 도 1에 도시한 Tac 키메라 단백질들의 엔도사이토시스 여부를 보인 형광현미경 사진이다.
도 4a 및 4b는 도 3a 및 3b의 엔도사이토시스 여부를 정량화하여 나타낸 그래프이다.
도 5는 Tac/3S 키메라 단백질을 COS-7 세포에 발현시켜 엔도사이토시스를 유도했을 때, ConA(Concannavalin A), 다이나소어(Dynasore) 및 Go6976에 의해 엔도사이토시스가 억제되었으나, K252a 및 빈블라스틴(Vinblastine)에 의해서는 억제되지 않았음을 보인 형광현미경 사진이다.
도 6은 COS-7 세포에서 발현된 Tac/3S 키메라 단백질의 세포 내 위치를 알아보기 위한 colocalization 실험 결과를 보인 형광현미경 사진이다.
도 7은 c-Met의 다이류신이 β-어댑틴과의 상호작용에 필수적임을 보여주는 복합-면역침강법 결과를 보인 사진(좌) 및 HeLa 세포에서 c-Met과 β-어댑틴이 colocalization 됨을 보인 형광현미경 사진(우)이다.
도 8은 Ant-3S-FITC 융합 폴리펩티드의 구조 및 아미노산 서열(상단)과 Ant-3S-FITC 융합 폴리펩티드가 HeLa 세포 안으로 빠르게 이입됨을 보이는 FACS 데이터(하단)를 보인 도면이다.
도 9는 Ant-3S-FITC 융합 폴리펩티드가 c-Met의 엔도사이토시스를 억제할 수 있음을 보이는 FACS 데이터(도 9a) 및 형광현미경 사진(도 9b)이다.
도 10은 HeLa(도 10a) 및 Hep3B(도 10b) 세포에서 Ant-3S-FITC 융합 폴리펩티드가 인산화된 c-Met의 HGF-의존성 엔도사이토시스를 억제할 수 있음을 보인 형광현미경 사진이다.
도 11은 Ant-3S-FITC 융합 폴리펩티드가 HGF에 의한 c-Met 및 FAK의 자가-인산화를 억제할 수 있음을 보인 웨스턴 블랏 사진이다.
도 12는 Ant-3S-FITC 융합 폴리펩티드를 90분 동안 전배양(preincubation)한 경우, HGF에 의한 Erk1/2의 자가-인산화를 억제할 수 있음을 보인 웨스턴 블랏 사진이다.
도 13은 Ant-3S-FITC 융합 폴리펩티드가 HGF에 의한 Erk1/2 및 AKT의 자가-인산화를 억제할 수 있음을 다른 억제제와 비교하여 보인 웨스턴 블랏 사진이다.
도 14는 Ant-3S-FITC 융합 폴리펩티드가 Hep3B 세포주의 증식을 억제할 수 있음을 나타낸 MTT 에세이 결과를 보인 그래프이다.
도 15는 Ant-3S-FITC 융합 폴리펩티드가 MDCK 세포주의 HGF에 의한 scattering을 억제할 수 있음을 나타낸 사진이다.
도 16은 Ant-3S-FITC 융합 폴리펩티드가 HUVEC(human umbilical vein endothelial cell) 및 Hep3B 세포의 이동을 억제할 수 있음을 나타낸 트랜스웰 이동 에세이 결과를 보인 사진(도 16a)및 그래프(도 16b)이다.
도 17은 Ant-3S-FITC 융합 폴리펩티드가 c-Met을 제외한 다른 수용체의 엔도사이토시스에는 영향을 미치지 않음을 보이는 형광현미경 사진이다.
하나의 양태로서, 본 발명은 신규한 엔도사이토시스 모티프(endocytic motif)를 제공하는 것으로, 바람직하게 서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 제공한다.
본 발명에 있어서, 상기 엔도사이토시스 모티프(이하, 본 명세서에서 "3S 폴리펩티드" 또는 "3S"와 혼용하여 사용할 수 있다)는 c-Met의 엔도사이토시스를 야기(유도)하는 c-Met의 C 말단에 존재하는 매우 보존된 16개의 아미노산(서열번호 1, KCVAPYPSLLSSEDNA)으로 이루어진 모티프로서, 본 발명자들에 의해 최초로 규명되었다. 또한, 본 발명자들은 상기 모티프 중 다이류신(dileucine)이 c-Met의 엔도사이토시스에 필수적임을 규명하였다.
본 발명의 엔도사이토시스 모티프는 c-Met의 엔도사이토시스 활성을 나타내는 서열은 제한없이 포함되며, 최소 단위로 서열번호 1의 아미노산 서열로 이루어진 엔토사이토시스 모티프를 포함하나, 엔도사이토시스 활성을 나타내는 한 상기 모티프의 아미노산의 치환, 부가, 결실 등이 이루어진 서열도 모두 본 발명의 권리범위에 포함될 수 있다. 상기 모티프는 서열번호 1의 엔도사이토시스 모티프와 75% 이상, 바람직하게는 85% 이상, 보다 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 98%이상 동일할 수 있는 아미노산 서열을 포함할 수 있다.
본 명세서에서 언급된 아미노산은 IUPAC-IUB 명명법에 따라 다음과 같이 약어로 기재하였다.
알라닌A 아르기닌R
아스파라긴N 아스파르트 산D
시스테인C 글루타민 산E
글루타민Q 글리신G
히스티딘H 아이소루이신I
루이신L 리신K
메티오닌M 페닐알라닌F
프롤린P 세린S
트레오닌T 트립토판W
타이로신Y 발린V
나아가, 본 발명자들은 상기 모티프가 c-Met과 동일하게 클라트린 매개 엔도사이토시스(Clathrin mediated endocytosis)에 의해 세포 내로 이입되는지 여부를 확인하기 위하여, Tac와 3S 폴리펩티드의 융합 단백질(Tac/3S)을 COS-7 세포에 발현시켜 엔도사이토시스를 유도한 후, ConA(Concannavalin A), 다이나소어(Dynasore), Go6976, K252a 및 빈블라스틴(Vinblastine)을 처리하였다. 그 결과, 디나민(dynamin)의 억제제인 다이나소어를 처리해 주었을 때 엔도사이토시스가 억제됨을 확인함으로써, 본 발명의 모티프가 c-Met과 동일하게 클라트린 매개 엔도사이토시스에 의해 세포 내로 이입됨을 확인하였다(도 5).
본 발명에 있어서, 상기 모티프는 c-Met, 인산화된 c-Met 및 HGF와 결합한 c-Met으로 이루어진 군에서 선택된 하나 이상의 c-Met의 엔도사이토시스를 억제하는 활성을 가질 수 있다. 또한, 본 발명의 모티프는 HGF에 의한 c-Met의 자가-인산화를 억제하는 활성을 가질 수 있다. 따라서, 본 발명의 모티프는 c-Met의 엔도사이토시를 억제함으로써 암의 전이 및 성장과 관련되는 c-Met의 신호전달을 차단할 수 있다.
다른 하나의 양태로서, 본 발명은 "N 말단-단백질 도입 도메인(Protein transduction domain)-서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 포함하는 폴리펩티드-C 말단" 또는 "N 말단-서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 포함하는 폴리펩티드-단백질 도입 도메인(Protein transduction domain)-C 말단"으로 표현되는 융합 폴리펩티드를 제공한다.
본 발명에 있어서, 용어 "단백질 도입 도메인"은 CPP(cell permeable protein), MTS(membrane translocating sequences)라고 불리는 염기성 아미노산으로 구성된 작은 펩티드로서, 특별한 수용체의 도움 없이 자기 자신 혹은 자신과 결합하고 있는 물질들과 함께 세포막을 통과하여 세포 내로 이동 가능한 단백질의 도메인을 말한다.
본 발명에 있어서, 상기 단백질 도입 도메인은 본 발명의 모티프를 세포 내로 빠르게 이입시키기 위한 수단으로써 이에 제한되지는 않으나, HIV(human immunodeficiency virus)의 Tat(서열번호 2, YGRKKRRQRRR); HSV(Herpes simplex virus)의 VP22(서열번호 3, DAATATRGRSAASRPTERPRAPARSASAPRRPVE); 초파리의 Antp(서열번호 4, RQIKIWFQNRRMKWKK); Mph-1(서열번호 5, YARVRRRGPRR); Sim-2(서열번호 6, AKAARQAAR); R7(서열번호 7, RRRRRRR); Pep-1(서열번호 8, LETWWETWWTEWSQPKKKRKV); 및 Pep-2(서열번호 9, KETWFETWFTEWSQPKKKRKV)으로 이루어진 군으로부터 선택된 어느 하나의 단백질 도입 도메인일 수 있다.
바람직하게는 상기 단백질 도입 도메인은 초파리의 Antp(서열번호 4) 일 수 있으며, 상기 융합 폴리펩티드는 서열번호 10(RQIKIWFQNRRMKWKKKCVAPYPSLLSSEDNA)의 아미노산 서열로 표시되는 폴리펩티드일 수 있다.
또한, 본 발명의 융합 폴리펩티드는 폴리펩티드의 N 말단 및/또는 C 말단에 융합 폴리펩티드의 검출, 세포 내 위치 추적 등을 위한 임의의 태그, 예컨대, 바이오틴 시그날링 펩티드, 히스티딘 펩티드(his), 헤마글루티닌(HA), 플래그(Flag), 금 결합 펩티드(gold binding peptide) 및 형광단백질의 종류인 EGFP[enhanced GFP(Green Fluorescent Protein)], 파랑색 형광 단백질[EBFP(Enhanced Blue Fluorescent Protein), EBFP2, Azurite, mKalama1], 하늘색 형광 단백질[ECFP(Enhanced Cyan Fluorescent Protein), Cerulean, CyPet], 노랑색 형광 단백질 유도체들[YFP(Yellow Fluorescent Protein), Citrine, Venus, YPet], BFP 유도체(Blue Fluorescent Protein derivatives), FITC(Fluorescein isothiocyanate) 등의 태그를 더 포함할 수 있다.
또한, 본 발명의 융합 폴리펩티드는 목적 단백질을 추가로 포함할 수 있다. 본 발명에서 용어, "목적 단백질"이란 본 발명의 융합 폴리펩티드에 의해 세포 내로 엔도사이토시스에 의해 도입시키고자 하는 단백질은 제한없이 포함하나, 그 예로 치료용 단백질일 수 있다.
또한, 본 발명의 융합 폴리펩티드는 화합물을 추가로 포함할 수 있다. 바람직하게 상기 화합물은 항암제 등을 포함하는 약물일 수 있다.
이와 같이 본 발명의 융합 폴리펩티드는 약물 또는 외래 단백질을 세포 내로 도입시킬 수 있는 캐리어로서 이용될 수 있다. 상기 목적 단백질 또는 화합물을 융합 폴리펩티드에 추가하는 것은 공지의 화학적 결합, 효소적 결합, 유전자 재조합 기술 등 다양한 방법을 이용할 수 있으나, 이에 제한되지는 않는다.
본 발명의 일실시예에서는 "N 말단-초파리 Antp-3S 폴리펩티드-FITC-C 말단"으로 표현되는 융합 폴리펩티드(Ant-3S-FITC 융합 폴리펩티드)가 세포 내로 빠르게 이입되는지 여부를 확인하기 위하여, HeLa 세포에 상기 융합 폴리펩티드를 시간별로 처리한 후 FACS를 통해 형광강도를 측정하였다. 그 결과, 상기 융합 폴리펩티드가 세포 내로 빠르게 이입됨을 확인하였다(도 8). 이와 같은 결과는 본 발명의 융합 단백질이 결합된 화합물을 도입시킬 수 있음을 뒷받침하는 것이다.
본 발명에 있어서, 상기 융합 폴리펩티드는 클라트린 매개 엔도사이토시스에 의해 세포 내로 빠르게 이입될 수 있으며, 이에 의하여 세포 표면에 존재하는 c-Met, 인산화된 c-Met 및 HGF와 결합한 c-Met으로 이루어진 군에서 선택된 하나 이상의 c-Met의 엔도사이토시스를 억제할 수 있다.
본 발명의 일실시예에서는 Ant-3S-FITC 융합 폴리펩티드에 의해 c-Met의 엔도사이토시스가 억제됨을 FACS 및 형광현미경 관찰을 통해 확인하였으며(도 9a 및 도 9b), HGF에 의하여 인산화된 c-Met의 엔도사이토시스 역시 억제될 수 있음을 형광현미경 관찰을 통해 확인하였다(도 10a 및 도 10b). 또한, 웨스턴 블랏을 통하여 상기 융합 폴리펩티드에 의해 c-Met의 자가-인산화가 억제됨을 확인하였다(도 11).
또 다른 하나의 양태로서, 본 발명은 서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 유효성분으로 포함하는 암 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 또 다른 하나의 양태로서, 본 발명은 N 말단-단백질 도입 도메인-서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 포함하는 폴리펩티드-C 말단 또는 N 말단-서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 포함하는 폴리펩티드-단백질 도입 도메인-C 말단으로 표현되는 융합 폴리펩티드를 유효성분으로 포함하는 암 예방 또는 치료용 약학적 조성물을 제공한다.
또한, 또 다른 하나의 양태로서, 본 발명은 상기 조성물을 암이 발병한 또는 발병 가능성이 있는 개체에게 투여하는 단계를 포함하는 암 예방 또는 치료방법을 제공한다.
상기 약학적 조성물은 암의 전이 또는 성장을 억제하는 활성을 가질 수 있다.
본 발명에서, 용어 "암"은 세포의 사멸 조절과 관련된 질병으로서 정상적인 아포토시스 균형이 깨지는 경우 세포가 과다 증식하게 됨으로써 생기는 질병을 일컫는다. 이러한 비정상적 과다 증식 세포들은 경우에 따라 주위 조직 및 장기에 침입하여 종괴를 형성하고, 체내의 정상적인 구조를 파괴하거나 변형시키게 되는데, 이러한 상태를 암이라고 한다.
바람직하게는 상기 암은 HGF와 이의 수용체인 c-Met에 의한 신호전달 경로가 활성화된 암일 수 있으며, 이에 제한되지는 않으나, 상기 암은 난소암, 유방암, 골육종, 대장암, 식도암, 십이지장암, 신장암, 폐암, 췌장암, 위암, 경부암 및 전립선암으로 이루어진 군에서 선택된 하나 이상의 암일 수 있다.
본 발명에서, 용어 "예방"이란 조성물의 투여에 의해 암의 전이, 성장 등을 억제시키거나 발병을 지연시키는 모든 행위를 의미하고, "치료"란 조성물의 투여에 의해 암에 의한 증세가 호전되거나 이롭게 변경하는 모든 행위를 의미한다.
본 발명에서, 용어 "개체"란 암이 발병하였거나 발병할 수 있는 인간을 포함한 모든 동물을 의미하고, 본 발명의 조성물을 개체에게 투여함으로써 상기 암을 효과적으로 예방 또는 치료할 수 있다. 본 발명의 조성물은 기존의 항암제와 병행하여 투여될 수 있다.
상기 약학적 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여 투여될 수 있다. 본 발명의 조성물은 목적하는 바에 따라 복강내 투여, 정맥내 투여, 근육내 투여, 피하 투여, 피내 투여, 경구 투여, 비내 투여, 폐내 투여, 직장내 투여될 수 있으나, 이에 제한되지는 않는다. 또한, 상기조성물은 활성 물질이 표적 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수 있다.
본 발명의 암 예방 또는 치료용 조성물은 약학적으로 허용 가능한 담체를 포함할 수 있다. 약학적으로 허용 가능한 담체를 포함하는 상기 조성물은 경구 또는 비경구의 여러 가지 제형일 수 있다. 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 경구투여를 위한 고형제제에는 정제환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 하나 이상의 화합물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로오스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제된다. 또한, 단순한 부형제 이외에 스테아린산 마그네슘, 탈크 등과 같은 윤활제들도 사용된다. 경구투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁용제로는 프로필렌글리콜(propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테로 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로젤라틴 등이 사용될 수 있다.
상기 약학적 조성물은 정제, 환제, 산제, 과립제, 캡슐제, 현탁제, 내용액제, 유제, 시럽제, 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제 및 좌제로 이루어진 군으로부터 선택되는 어느 하나의 제형을 가질 수 있다.
상기 본 발명의 조성물은 약학적으로 유효한 양으로 투여한다. 용어 "약학적으로 유효한 양"은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분한 양을 의미하며, 유효 용량 수준은 개체 종류 및 중증도, 연령, 성별, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 본 발명의 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있으며, 단일 또는 다중 투여될 수 있다. 상기 요소를 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하다.
본 발명의 조성물은 암의 예방 및 치료를 위하여 단독으로, 수술, 호로몬 치료, 약물 치료 및 생물학적 반응 조절제를 사용하는 방법들과 병용하여 사용할 수 있다.
본 발명의 일실시예에서는 본 발명의 융합 폴리펩티드가 c-Met 또는 인산화된 c-Met의 엔도사이토시스를 특이적으로 억제시킬 수 있음을 확인하였으며(도 9a, 도 9b, 도 10a, 도 10b 및 도 17), MTT 에세이를 통하여 상기 융합 폴리펩티드가 암 세포주의 증식을 억제시킬 수 있음을 확인하였다(도 14). 또한, 트랜스웰 이동 에세이 및 scattering 에세이를 통하여 상기 융합 폴리펩티드가 암 세포주의 HGF-의존성 세포이동을 억제시킬 수 있음을 확인하였다(도 15, 도 16a 및 도 16b). 따라서, 상기 융합 폴리펩티드를 유효성분으로 포함하는 약학적 조성물은 암의 예방 및 치료용으로 유용하게 사용할 수 있다.
이하, 실시예를 통하여 본 발명을 상세히 설명한다. 하기 실시예는 본 발명을 예시하는 것으로, 본 발명의 내용이 실시예에 의해 한정되는 것은 아니다.
실시예 1. 세포배양 및 형질주입(transfection)
HUVEC, Hep3B, HeLa, COS-7 및 MDCK 세포주를 10% FBS(Thermo, SH30532.03) 및 1% 페니실린스텁토마이신(sterptomycin; Thermo, SV30010)를 포함하는 DMEM(Thermo, SH30243.01)에서 5% CO2, 37℃의 조건으로 배양하였다. HUVEC, HeLa 및 Hep3B 세포의 부유(suspension)를 위해 0.05% 트립신(Thermo, SH30236.01)을 처리한 후 5분간 37℃에서 반응시켰다. 형질주입을 위해서 플라스미드 DNA 1.5 ㎍과 리포펙타민(Lipofectamin, Invitrogen, 11668-027) 3 ㎕를 0.2 ㎖ 무혈청 DMEM에 섞은 혼합물(Mixture)을 상온에 두고, 25분 후 6 웰에 50 %의 세포 집합도(confluency)로 깔린 세포의 배지를 무혈청 DMEM으로 바꾸어주고, 상기 혼합물을 처리하였다. 5시간 후 10% FBS가 들어있는 DMEM으로 교체하고, 48시간 후 형광현미경 관찰을 위해 사용하였다.
실시예 2. 실험방법
2-1. 유세포 분석(Flow cytometry)
본 발명의 Ant-3S-FITC 융합 폴리펩티드가 세포 안으로 빠르게 이입되는지 알아보기 위하여 HeLa 세포를 0.05% 트립신으로 부유시키고, PBS로 1회 세척한 후 100 nM Ant-3S-FITC 융합 폴리펩티드(무혈청 DMEM 내)로 세포를 풀어주었다. 이후, 5% CO2 37℃에서 시간별로 배양한 다음, PBS로 3회 세척한 후 FACS 분석기(BD CantoII Flow Cytometer)로 형광강도를 측정하였다.
Ant-3S-FITC 융합 폴리펩티드가 HeLa 세포에서 c-Met의 엔도사이토시스를 억제하는지 알아보기 위하여 HeLa 세포를 0.05% 트립신으로 부유시키고 DPBS로 1회 세척한 후, 100 nM Ant-3S-FITC 융합 폴리펩티드(무혈청 DMEM 내)로 세포를 풀어주었다. 이후, 5% CO2 37℃에서 30분간 배양한 다음 엔도사이토시스를 막기 위해 4℃로 옮겨 30분간 놓아둔 후, 엔도사이토시스를 다시 진행시키기 위해 5% CO2 37℃로 옮겨 30분간 놓아두었다. 이후, 고정을 하기 위하여 차가운 메탄올로 10분간 -20℃에 놓아두었다. c-Met을 염색하기 위해 anti-c-Met 항체(R&D systems, AF-276)를 PBA 버퍼(1% BSA in PBS 버퍼)에 2 ㎍/㎖로 희석하여 세포를 풀어 주고 4℃에서 30분간 반응시켰다. PBS(Phosphate buffered saline)로 1회 씻은 후 2차 항체를 붙이기 위해 anti-goat IgG Alexa Fluor568(Invitrogen, A-11079)를 1:200의 비율로 희석하여 4℃에서 30분간 처리해 주고, PBS로 2회 세척한 후 FACS 분석기(BD CantoII Flow Cytometer)로 형광강도를 측정하였다.
2-2. 면역 형광 현미경 관찰(Immunofluorescence Microscopy)
<2-2-1> 엔도사이토시스 퍼센트 정량화
도 2에 도시한 각각의 Tac 키메라 단백질을 코딩하는 플라스미드 DNA를 COS-7 세포주에 발현시켜 엔도사이토시스를 유도한 후 엔도사이토시스 퍼센트를 정량화하기 위해 다음과 같은 방법을 사용하였다. 먼저, 플라스미드 DNA를 COS-7 세포주에 형질주입하고 다음날 10% FBS를 보충한 DMEM에 풀어서 8 웰 슬라이드 글라스(Thermo, 154534)에 50% 세포 집합도로 접종하였다. 다음날, 엔도사이토시스를 막기 위해 4℃로 옮겨 30분간 놓아두었다. anti-Tac(BD bioscience, 347640) 항체를 10% FBS가 들어있는 DMEM에 1:10로 희석하여 4℃에서 30분간 처리하였다. 배지로 3회 세척한 후 엔도사이토시스를 다시 진행시키기 위해 5% CO2, 37℃로 옮겨 다양한 시간별로 놓아두었다. 고정을 하기 위해 4% 파라포름알데하이드(Paraformaldehyde)를 넣고 45분간 상온에 두었다. 세포 표면에 있는 anti-Tac 항체를 검출하기 위해 anti-mouse IgG-Alexa Fluor 488(Invitrogen, A-11001)을 3% 정상 염소 혈청(normal goat serum; Vector, S-1000)이 들어간 PBS에 1:500으로 희석하여 상온에서 1시간 동안 처리하였다. 이후, PBST로 5분씩 3번 세척한 후 침투(Permeablization) 및 블록킹을 위하여 3% 정상 염소 혈청이 들어간 PBST를 넣고 1시간 동안 상온에 두었다. 다음으로 세포 내 Tac을 검출하기 위해 anti-mouse IgG-Alexa Fluor 568(Invitrogen, A11061)을 3% 정상 염소 혈청이 들어간 PBST에 1:500으로 희석하여 상온에서 1시간 동안 처리하였다. PBST로 3번 세척한 후 Mounting Medium with DAPI(Vector, H-1200)으로 고정하고, 다음날 형광현미경(Olympus IX2-UCB)으로 샘플을 확인하였다. 억제제의 처리를 위하여 엔도사이토시스 에세이 전에 100 ㎍/㎖ ConA(Sigma, C0412), 80 μM 다이나소어(Dynasore; Sigma, D7693), 1 μM Go6976(Calbiochem, 365250), 1 μM K252a(Invitrogen, PHZ1131) 및 1 μM 빈블라스틴(Vinblastine; Sigma, V1377)을 5% CO2, 37℃에서 30분간 전처리하였다.
<2-2-2> Ant-3S-FITC 융합 폴리펩티드의 세포 내 이입 분석
Ant-3S-FITC 융합 폴리펩티드가 세포 안으로 빠르게 이입되는지 알아보기 위해 HeLa 세포를 0.05% 트립신으로 부유하고 10% FBS를 보충한 DMEM에 풀어서 8 웰 슬라이드 글라스(Thermo, 154534)에 50% 세포 집합도로 접종하였다. 다음날 DPBS로 1회 세척한 후 세포에 5% CO2, 37℃에서 100 nM Ant-3S-FITC 융합 폴리펩티드(10% FBS를 함유하는 DMEM 내)를 30분간 처리하였다. 이후, 엔도사이토시스를 막기 위해 4℃로 옮겨 30분간 놓아둔 후 엔도사이토시스를 다시 진행시키기 위해 5% CO2, 37℃로 옮겨 30분간 놓아두었다. 고정을 하기 위해 4% 파라포름알데하이드에서 45분간 상온에 두었다. 세포 표면에 있는 c-Met을 염색하기 위해 anti-c-Met 항체(R&D systems, AF-276)를 PBA 버퍼(1% BSA in PBS 버퍼)에 2 ㎍/㎖로 희석하여 세포에 처리해 주고 4℃에서 30분간 반응시켰다. PBS로 1회 씻은 후 2차 항체를 붙이기 위해 anti-goat IgG Alexa Fluor568(Invitrogen, A-11079)를 1:500의 비율로 희석하여 4℃에서 30분간 처리해 주었다. PBS로 3회 세척한 후 Mounting Medium with DAPI(Vector, H-1200)으로 고정하고 다음날 형광현미경(Olympus IX2-UCB)으로 샘플을 확인하였다.
<2-2-3> Ant-3S-FITC 융합 폴리펩티드의 인산화된 c-Met의 HGF-의존성 엔도사이토시스 억제 여부 확인
Ant-3S-FITC 융합 폴리펩티드가 HeLa와 Hep3B 세포주에서 인산화된 c-Met(Phospho-c-Met)의 HGF-의존성 엔도사이토시스를 억제시킬 수 있는지 알아보기 위하여 HeLa와 Hep3B 세포를 0.05% 트립신으로 부유하고 10% FBS를 보충한 DMEM에 풀어서 8 웰 슬라이드 글라스(Thermo, 154534)에 50% 세포 집합도로 접종하였다. 다음날 무혈청 DMEM으로 24시간 동안 starvation 시켜주었다. 다음날 DPBS로 1회 세척한 후 Ant-3S-FITC 융합 폴리펩티드를 무혈청 DMEM에 농도별로 희석하여 5% CO2, 37℃에서 30분간 세포에 처리하였다. 이후, HGF에 의한 엔도사이토시스를 일으키기 위하여 40 ng/㎖의 재조합 인간 HGF(R&D systems, 294-HG-005)를 5% CO2, 37℃에서 30분간 세포에 처리하였다. 고정을 하기 위해 4% 파라포름알데하이드에서 45분간 상온에 두었다. PBST(0.2% Triton-X100 in PBS)로 3회 세척한 후 침투 및 블록킹을 위해서 3% 정상 염소 혈청이 들어간 PBST를 처리하여 1시간 상온에 두었다. 인산화-c-Met을 염색하기 위해 anti-p-Met 항체(Invitrogen, 44888G)를 3% 정상 염소 혈청(in PBST)에 1:1000의 비율로 희석하여 4℃에서 16시간 동안 샘플에 처리해 주었다. PBST로 3회 씻은 후 2차 항체를 붙이기 위해 anti-rabit IgG Alexa Fluor568(Invitrogen, A-11036)를 1:500의 비율로 희석하여 상온에서 1시간 동안 처리해 주었다. PBST로 3회 세척한 후 Mounting Medium with DAPI(Vector, H-1200)으로 고정하고, 다음날 형광현미경(Olympus IX2-UCB)으로 샘플을 확인하였다.
<2-2-4> Ant-3S-FITC 융합 폴리펩티드의 타수용체의 엔도사이토시스 억제 여부 확인
Ant-3S-FITC 융합 폴리펩티드가 c-Met을 제외한 다른 수용체의 엔도사이토시스에 영향을 미치는지 여부를 알아보기 위하여 Tac/3S, Tac/PSD-95 및 GLUT4-HA 단백질이 pcDNA3.1에 클로닝 되어있는 플라스미드 DNA를 COS-7 세포주에 형질주입하고 다음날 10% FBS를 보충한 DMEM에 풀어서 8 웰 슬라이드 글라스(Thermo, 154534)에 50% 세포 집합도로 접종하였다. 다음날 DPBS로 1회 세척한 후 세포에 5% CO2, 37℃에서 100 nM Ant-3S-FITC 융합 폴리펩티드(10% FBS를 함유하는 DMEM 내)를 30분간 처리하였다. 이후, 엔도사이토시스를 막기 위해 4℃로 옮겨 30분간 놓아두었다. anti-HA(Invitrogen, 71-5500) 항체 및 anti-Tac(BD bioscience, 347640) 항체를 10% FBS가 들어있는 DMEM에 각각 1:100, 1:10로 희석하여 4℃에서 30분간 처리하였다. 10% FBS가 들어있는 DMEM으로 3회 세척한 후 엔도사이토시스를 다시 진행시키기 위해 5% CO2, 37℃로 옮겨 30분간 놓아두었다. 고정을 하기 위해 4% 파라포름알데하이드에서 45분간 상온에 두었다. PBST(0.2% Triton-X100 in PBS)로 3회 세척한 후 침투 및 블록킹을 위해서 3% 정상 염소 혈청이 들어간 PBST를 처리하여 1시간 동안 상온에 두었다. 2차 항체를 붙이기 위해 anti-rabbit IgG Alexa Fluor568(Invitrogen, A-11036) 및 anti-mouse IgG Alexa Fluor568(Invitrogen, A-11061)을 1:500의 비율로 희석하여 상온에서 1시간 동안 처리해 주었다. PBST로 3회 세척한 후 Mounting Medium with DAPI(Vector, H-1200)으로 고정하고, 다음날 형광현미경(Olympus IX2-UCB)으로 샘플을 확인하였다.
2-3. 웨스턴 블랏
Hep3B 세포주를 70%의 세포 집합도로 6 웰 플레이트에 접종한 후 다음날 무혈청 DMEM으로 배지를 바꿔주었다. 그 다음날 무혈청 DMEM으로 1회 세척한 후 Ant-3S-FITC 융합 폴리펩티드를 무혈청 DMEM에 농도별로 희석하여 5% CO2, 37℃에서 30분간 세포에 처리하였다. 이후, HGF에 의한 신호전달을 활성화시키기 위하여 40 ng/㎖의 재조합 인간 HGF(R&D systems, 294-HG-005)를 5% CO2, 37℃에서 30분간 세포에 처리하였다.
이후, 플레이트를 얼음 위로 옮겨서 차가운 PBS로 3번 세척한 후 세포 스크래퍼(cell scraper)로 세포를 모으고, 여기에 프로테아제 억제제 칵테일(Protease Inhibitor cocktail; Calbiochem, 11836153001)과 포스파타제 억제제 칵테일(Phosphatase Inhibitor cocktail; Sigma, P5726)이 들어간 RIPA 라이시스 버퍼를 처리한 후 30분간 얼음에 놓아두었다. 이후, 원심분리기를 이용해 13000 rpm에서 20분간 원심분리하여 상층액을 새로운 e-튜브로 옮기고, 여기에 5X 샘플 버퍼를 넣어 10분간 끓는 물에서 변성시켰다. 이렇게 얻은 세포 용해물을 8% Tris-HCl SDS 겔에서 100 볼트(volt)로 1시간 30분 동안 전기영동 하고, 니트로셀룰로즈막으로 100 볼트에서 1시간 동안 트랜스퍼하였다. 막을 TBST 내 5% 탈지유(0.05% T-tween in PBS)에 담가서 1시간 동안 상온에서 쉐이킹하였다. 1차 항체를 TBST 내5% 탈지유에 희석하여 막에 처리하고 16시간 동안 4℃에서 쉐이킹해 주었다. 막을 상온으로 옮겨서 TBST로 10분씩 3번 세척한 후 2차 항체를 TBST 내 5% 탈지유에 희석하여 막에 처리하고 1시간 동안 상온에서 쉐이킹해 주었다. 다시 TBST로 10분씩 3번 세척한 후 ECL 검출 용액(Intron, 16033)으로 현상(Develop) 하였다. 1차 항체로는 anti-p-Met 항체(Invitrogen, 44888G), anti-p-FAK 항체(Cell signaling, 3283S), anti-p-AKT 항체(Millipore, 05-736), anti-p-Erk1/2(Cell signaling, 9101S) 및 anti-β-actin 항체(Sigma, A5441)를 사용하였으며, 2차 항체로는 anti-rabbit IgG-HRP(Santacruz, sc-2004) 및 anti-mouse IgG-HRP(Santacruz, sc-2005)를 사용하였다.
2-4. 상처 치료 에세이(Wound healing assay)
Hep3B 세포주를 6 웰 플레이트에 90%의 세포 집합도로 접종하였다. 다음날 DPBS로 1회 세척한 후 무혈청 DMEM으로 배지를 바꿔주었다. 그 다음날 200 ㎕ 옐로우 팁(yellow tip)으로 표면을 그어서 균등하게 상처를 낸 뒤 무혈청 DMEM으로 1회 세척한 후 Ant-3S-FITC 융합 폴리펩티드를 무혈청 DMEM에 농도별로 희석하여 5% CO2, 37℃에서 30분간 세포에 처리하였다. 이후, HGF에 의한 신호전달을 활성화시키기 위하여 40 ng/㎖의 재조합 인간 HGF(R&D systems, 294-HG-005)를 처리한 뒤, 24시간 후에 현미경으로 상처 치료 정도를 관찰하였다.
2-5. 트랜스웰 이동 에세이(Transwell migration assay)
트랜스웰(Corning, 3422)의 상위 챔버에 0.1% BSA(in PBS; 1 mg/㎖)를 100 ㎕씩 넣고, 37 ℃에서 1시간 동안 블록킹한 후 PBS로 1회 세척하였다. 상위 챔버에 Ant-3S-FITC 융합 폴리펩티드를 30분 동안 처리했던 Hep3B 세포를 0.1% BSA(in PBS)에 풀어서 웰당 1X104개씩 접종하였다(in 100 ㎕). 하위 챔버에는 40 ng/㎖의 재조합 인간 HGF (R&D systems, 294-HG-005)를 500 ㎕씩 넣어주었다. 16시간 동안 37 ℃에서 배양하고, 상위 챔버를 PBS로 1회 세척한 후, 크리스탈 바이올렛에서 10분간 RT에서 배양하였다. 이후, 상위 챔버를 증류수로 행구면서 면봉으로 상위면에 약하게 붙어있는 세포를 제거한 후 현미경으로 관찰하였다.
2-6. 세포생존 에세이(MTT assay)
Hep3B 세포주를 5 x 103 세포씩 96 웰 플레이트에 접종한 후 다음날 무혈청 DMEM으로 교체하여 starvation을 실시하였다. 그 다음날 Ant-3S-FITC 융합 폴리펩티드를 농도별로 무혈청 DMEM에 희석하여 30분간 37℃에서 처리한 후 2% FBS+Ant-3S-FITC 융합 폴리펩티드 혼합물을 넣어주었다. 3일 후 각 웰에 100 ㎕당 20 ㎕씩 MTT를 넣어준 다음, 37℃에서 1시간 동안 배양하였다. 상층액을 모두 제거한 후 560 nm에서 흡광도를 측정하였다.
2-7. 복합-면역침강법(Co-Immunoprecipitation)
Tac/3S 단백질과 Tac/3S-LL/AA 단백질을 코딩하는 플라스미드 DNA를 리포펙타민을 이용하여 COS-7 세포에 형질주입하고 48시간 후에 엔도사이토시스 에세이를 수행하였다. 구체적으로, 플레이트를 4℃에서 1시간 동안 놓아두었다가 37℃로 옮겨서 10분간 배양하였다. 이후, PBS로 3번 세척한 후 스크래퍼로 세포를 모으고, 프로테아제 억제제 칵테일을 함유하는 NP-40 1 ㎖로 세포를 용해시켰다. 이후, 용해물이 담긴 e-튜브를 얼음에서 30분 동안 교반시키고, 4℃, 13000 rpm에서 20분간 원심분리하였다. 상층액을 새로운 e-튜브에 옮긴 후 Bradford 정량하고, 1 mg의 용해물을 1 ㎖의 용해 버퍼에 희석하였다. 여기에 20 ㎕의 단백질 G(GE Healthcare, 17-0618-01) 슬러리(slurry)를 넣고 4℃에서 10분 동안 교반시킴으로써 Pre-clearing 시켰다(이때, 미리 단백질 G를 PBS로 3번 세척하여 두었다). 이 후, 4℃에서 10분 동안 13000 rpm으로 원심분리하여 상층액을 새로운 e-튜브에 옮기고 여기에 4 ㎍의 anti-Tac 항체(BD, 347640)와 20 ㎕의 단백질 G 슬러리를 넣은 후 4℃에서 16시간 동안 교반시켰다. 이후, e-튜브를 13000 rpm에서 1분간 원심분리하여 PBS로 5번 세척해주었다. 마지막 세척에서 상층액을 버린 후 샘플 버퍼를 넣어 끓는 물에서 10분간 변성시킨 후, 웨스턴 블랏을 실시하였다. 웨스턴 블랏에서 anti-Tac 항체(Santacruz, sc-665), anti-adaptinβ 항체(BD, 610381) 및 anti-β-actin 항체(Sigma, A5441)를 1차 항체로 사용하였고, anti-rabbit IgG-HRP (Santacruz, sc-2004) 및 anti-mouse IgG-HRP(Santacruz, sc-2005)를 2차 항체로 사용하였다.
2-8. MDCK scattering assay
MDCK 세포주를 6 웰에 30%의 세포 집합도로 접종한 후, 다음날 배지를 FBS가 제거된 무혈청 배지로 바꿔주었다. 그 다음날 Ant-3S-FITC 융합 폴리펩티드를 0.1 μM의 농도로 90분간 처리해주었다. 이후, 재조합 인간 HGF를 20 ng/㎖의 농도로 처리해주고, 16시간 후 세포의 형태를 광학현미경을 통해 관찰하였다.
2-9. 면역 형광 이미지의 통계분석
COS-7 세포에 발현시킨 각각의 Tac 키메라 단백질들이 시간별로 엔도사이토시스된 정도를 정량화하기 위해 다음과 같은 식을 사용하였다.
수학식 1
Figure PCTKR2012001593-appb-M000001
구체적으로, 표면 Tac을 검출하기 위해 침투시키기 전 anti-mouse IgG-Alexa Fluor 488으로 Tac을 표지하였고, 세포 내 Tac을 검출하기 위해 침투시킨 후에 anti-mouse IgG-Alexa Fluor 568으로 Tac을 표지하였다. 따라서, 녹색 형광 강도는 세포 표면 Tac의 양을 의미하고, 빨강 형광 강도는 엔도사이토시스된 Tac 및 일부 세포 표면 Tac의 양을 의미한다. 여기서 사용된 두 가지 2차 항체는 서로 다른 폴리클로날 항체이기 때문에 먼저 표지시킨 anti-mouse IgG-Alexa Fluor 488에 의해서 나중에 표지시킨 anti-mouse IgG-Alexa Fluor 568의 표면 Tac에 대한 검출이 부분적으로 약해진다. 이렇게 anti-mouse IgG-Alexa Fluor 568에 의해 부분적으로 검출된 표면 Tac을 측정하기 위하여 엔도사이토시스가 일어나지 않은 0분 상태에서 녹색과 빨강의 형광 정도를 측정하여 비교한 결과, 빨강이 녹색의 0.429배 높은 형광 강도를 나타내었고 이것을 α로 나타내었다. 이렇게 구한 엔도사이토시스 비율에 100을 곱하여 엔도사이토시스 퍼센트를 구하였다. 표시된 에러 바는 표준편차를 의미하며 도 4a 및 도 4b에서는 n=6으로, 도 5에서는 n=10으로 통계를 수행하였다.
실시예 3. 실험결과
3-1. c-Met의 엔도사이토시스 모티프 탐색
c-Met의 어떤 아미노산 서열이 엔도사이토시스를 매개하는지 알아보기 위하여 도 2에 도시한 바와 같은 DNA 구조체를 제작하였다. 구체적으로, 엔도사이토시스 이동(endocytic trafficking)을 추적하기 위하여 Tac(CD25) 단백질의 세포 외 도메인(Tac ECD)을 c-Met의 세포질 도메인들과 연결한 키메라 단백질을 제작하였다. Tac의 세포 외 도메인 자체만으로는 엔도사이토시스를 일으킬 수 없으므로 Tac에 c-Met 유래의 다양한 크기의 아미노산 서열을 연결함으로써 어떤 부분이 엔도사이토시스에 필수적임을 알아보고자 한 것이다. PSD95는 C-말단에 엔도사이토시스 모티프를 가지고 있어서 엔도사이토시스가 잘 일어나며(Craven et al., J Biol Chem, 275(26):20045-51, 2000), 이 단백질의 세포질 테일(cytoplasmic tail)을 Tac과 연결한 구조체를 양성 대조군으로 사용하였다. 제작된 플라스미드 DNA를 COS-7 세포에 일시적(transient)으로 발현시킨 후 엔도사이토시스를 유도하기 위해 4℃에서 37℃로 옮겨주고 현미경을 통해 키메라 단백질의 분포양상을 관찰하여, 도 3a, 도 3b, 도 4a 및 4b에 나타내었다.
그 결과, 도 3a, 도 3b, 도 4a 및 4b에 나타난 바와 같이, Tac ECD의 경우 시간이 지나도 엔도사이토시스가 일어나지 않았지만 Tac/PSD95는 10분 안에 대부분 세포 안으로 내부이입(internalization) 되었다. c-Met의 1343번부터 1408번에 이르는 아미노산 서열을 Tac에 연결한 경우에도 역시 빠른 속도로 엔도사이토시스 되었으며, 점점 아미노산의 길이를 줄여나간 결과, C-말단의 16개의 아미노산 서열만으로도 엔도사이토시스가 일어나는 것을 확인할 수 있었다(도 3a, 도 3b, 도 4a 및 4b). c-Met의 C-말단의 16개 아미노산 서열에는 3개의 세린이 존재하여 상기 16개 아미노산 서열을 3S, 3S 서열을 가진 폴리펩티드를 3S 폴리펩티드라고 명명하였다.
이후, 3S에 존재하는 다이류신(dileucine)이 다이알라닌(dialanine)으로 변경된 돌연변이 키메라 단백질(Tac/3S-LL/AA)은 엔도사이토시스되지 않았다(도 3a 및 도 3b). 이러한 결과는 3S 부위에 존재하는 다이류신이 c-Met의 엔도사이토시스 이동에 필수적인 역할을 담당하는 것을 시사하는 것이다.
3-2. 3S 폴리펩티드의 엔도사이토시스 유형 확인
c-Met은 클라트린-매개 엔도사이토시스(Clathrin-mediated endocytosis)를 통하여 세포 내로 이입되며, EEA1, 소포체에 위치된다고 알려져 있다(Kermorgant et al., J Cell Biol, 182(5):855-63, 2008; Kakazu et al., Invest Ophthalmol Vis Sci, 182(5):855-63, 2008). 따라서, 3S 폴리펩티드가 c-Met의 엔도사이토시스 정렬(endocytic sorting)을 조절하는 중요 시그날인지 확인하기 위하여 Tac/3S 단백질도 c-Met과 같은 패턴으로 엔도사이토시스 되는지를 상기 실시예 2-2에 설명한 방법에 따라 형광현미경으로 관찰하여, 도 5에 나타내었다.
도 5를 보면, Tac/3S 키메라 단백질을 COS-7 세포에 발현시켜 엔도사이토시스를 유도했을 때, ConA(Concannavalin A), 다이나소어(Dynasore) 및 Go6976에 의해 엔도사이토시스가 억제된 반면, K252a 및 빈블라스틴(Vinblastine)에 의해서는 억제되지 않았다. 다만, 빈블라스틴 처리시 엔도사이토시스가 잘 일어나지만, 핵 주위 지역(perinuclear region)으로의 운송은 억제되었다(도 5). ConA 및 다이나소어(Dynasore)는 엔도사이토시스 머시너리(endocytic machinery)를 동요(Perturbation) 시키는 것으로 알려져 있으며(Kermorgant et al., EMBO J, 23(19):3721-34, 2004), Go6976는 c-Met의 트래픽에 관여하는 PKCα의 억제제이다(Kermorgant et al., J Cell Biol, 182(5):855-63, 2008). 일반적으로, 클라트린피복 소공(Clathrin Coated Pit)이 형성되면 디나민(Dynamin)이 핀칭-오프(Pinching off) 해주어 소포가 형성될 수 있도록 해준다(Hinshaw et al., Nature, 374(6518):190-2, 1995). 이러한 디나민의 억제제인 다이나소어를 처리해 주었을 때, Tac/3S 단백질의 엔도사이토시스가 억제되었다는 것은 Tac/3S 단백질이 클라트린-매개 엔도사이토시스를 통해 세포 내로 이입됨을 의미한다. 또한, Tac/3S 단백질이 PKCα에 의존적으로 트래픽되며 미소관-의존성 운송(microtubule-dependent transport)을 거쳐 핵 주위 지역으로 이동하게 됨을 알 수 있었다.
다음으로, 상기 실시예 2-2에 설명한 방법에 따라 형광현미경으로 관찰함으로써 Tac/3S 단백질의 세포 내 위치(subcellular localization)를 알아보기 위한 colocalization 실험을 하여, 도 6에 나타내었다. 그 결과, 도 6에 나타난 바와 같이, Tac/3S는 ER 트랙커(ER tracker)와 부분적으로 Merge 되는 것으로 나타났다(도 6).
3-3. 3S 폴리펩티드와 β-어댑틴과의 상호작용에 대한 다이류신 모티프의 역할 규명
클라트린 피복 소공(Clathrin Coated Pit)의 형성 동안, 어댑틴(adaptin)들이 수용체의 세포질 테일에 있는 특이적 모티프를 인지함으로써 카르고(cargo) 수용체에 선택적으로 결합하는 것으로 알려져 있다(Kirchhausen et al., Curr Opin Cell Biol, 9(4):488-95, 1997). 예를 들면, GLUT8이 엔도사이토시스 될 때 어댑틴 β2는 카르고의 다이류신을 인식한다고 알려져 있다(Schmidt et al., J Cell Sci, 119(Pt 11):2321-31, 2006). 따라서, 3S 폴리펩티드의 다이류신도 이와 같이 β-어댑틴과 상호작용하는데 역할을 하는지 알아보기 위하여 상기 실시예 2-7에서 설명한 바에 따라 복합-면역침강법을 수행하여, 도 7에 나타내었다.
그 결과, Tac/3S 단백질은 β-어댑틴과 상호작용을 하는 반면, 다이알라닌으로 치환된 돌연변이체(Tac/3SLL/AA)는 상호작용에 실패하였다. 이러한 사실은 HeLa 세포에서 c-Met과 β-어댑틴이 colocalization 되는 것을 형광 현미경을 통해 확인함으로써 확증하였다(도 7). 이러한 사실은 c-Met의 세포질 테일에 존재하는 다이류신이 c-Met과 β-어댑틴과의 상호작용에 중요한 역할을 함을 나타낸다.
3-4. Ant-3S-FITC 융합 폴리펩티드의 세포 내 이입 정도 측정
도 8에 나타낸 바와 같이, 16개의 아미노산으로 이루어진 안테나페디아(Antennapedia) 유래 단백질 도입 도메인(PTD, 서열번호 4), c-Met의 엔도사이토시스 모티프(3S 폴리펩티드) 및 FITC(Fluorescein isothiocyanate)로 이루어져 있는 Ant-3S-FITC 융합 폴리펩티드가 세포 내로 쉽게 들어갈 수 있는지 알아보기 위하여 상기 실시예 2-1에 설명한 방법에 따라, HeLa 세포에 시간별로 상기 폴리펩티드를 처리한 후 FACS를 통해 형광 강도를 측정하여, 도 8에 나타내었다. 그 결과, 도 8에 나타난 바와 같이, 0분일 때에는 101에 불과하던 MFI가 30분에 1166에 이르렀고, 이후 120분까지 안정적으로 형광을 나타내었다(도 8). 이러한 결과는 Ant-3S-FITC 융합 폴리펩티드가 세포 내로 빠르게 이입될 수 있음을 나타낸다.
3-5. Ant-3S-FITC 융합 폴리펩티드의 c-Met에 대한 엔도사이토시스의 억제능 확인
일반적으로 4℃에서는 엔도사이토시스가 억제되어 세포 표면의 수용체들이 많아진다. 그러나, 37℃로 옮기게 되면 세포 표면의 수용체들이 엔도사이토시스를 통해 세포 안으로 들어오게 된다(Moore et al., Science, 236(4801):558-63, 1987). Ant-3S-FITC 융합 폴리펩티드가 c-Met의 온도변화에 의한 엔도사이토시스를 억제하는지 알아보기 위하여, 상기 실시예 2-1 및 2-2에서 설명한 바에 따라 Ant-3S-FITC 융합 폴리펩티드를 HeLa 세포에 전처리하고 온도변화를 준 후 세포 표면의 c-Met을 FACS 및 형광현미경으로 확인하여, 도 9a 및 도 9b에 나타내었다.
그 결과, 도 9a의 FACS 결과에서 나타난 바와 같이, 소포(vehicle)를 처리했을 시에는 4℃에서 37℃로 옮겨지면서 세포 표면의 c-Met이 내부이입 되었지만 Ant-3S-FITC 융합 폴리펩티드를 처리하면 37℃에서도 여전히 c-Met이 세포 표면에 남아있음을 알 수 있었다. 형광현미경으로 관찰한 경우에도 Ant-3S-FITC 융합 폴리펩티드에 의해 c-Met의 엔도사이토시스가 억제됨으로써 세포 표면에 남아있는 c-Met을 확인할 수 있었다(도 9b).
3-6. Ant-3S-FITC 융합 폴리펩티드의 phospho-c-Met의 HGF-의존성 엔도사이토시스 억제능 확인
c-Met의 리간드인 HGF가 c-Met에 결합하면 c-Met이 엔도사이토시스되는 것은 잘 알려져 있다(Kamei et al., Oncogene, 18(48):6776-84, 1999). 따라서, Ant-3S-FITC 융합 폴리펩티드가 HGF에 의한 c-Met의 내부이입을 억제하는지 알아보기 위하여, 상기 실시예 2-2에 설명한 바에 따라 HeLa 및 Hep3B 세포에 Ant-3S-FITC 융합 폴리펩티드와 HGF를 처리하여 phospho-c-Met(p-Met)의 세포 분포(cellular distribution)가 어떻게 조절되는지 형광현미경으로 관찰하여, 도 10a 및 도 10b에 나타내었다.
먼저, HeLa 세포에서 낮은 농도로 Ant-3S-FITC 융합 폴리펩티드를 처리하였을 때 Ant-3S-FITC 융합 폴리펩티드를 많이 흡수하는 세포도 있었고 상대적으로 적게 흡수하는 세포도 있었다. Ant-3S-FITC 융합 폴리펩티드를 적게 흡수한 세포에서는 p-Met이 주로 핵 주변에 puncta 형태로 분포되어 있는 반면, 상대적으로 많이 흡수한 세포에서는 p-Met이 비교적 골고루 분포되어 있는 것을 관찰할 수 있었다.
이를 좀 더 확실하게 알아보기 위하여 Hep3B 세포주에서 Ant-3S-FITC 융합 폴리펩티드를 농도별로 처리한 후 p-Met의 위치가 어떻게 조절되는지 알아보았다. 그 결과, 소포에서는 모든 p-Met이 puncta 형태로 나타나지만 높은 농도의 Ant-3S-FITC 융합 폴리펩티드 존재하에서는 그러한 puncta가 없어지고 세포 전체적으로 분산되어 있는 것을 관찰할 수 있었다. 이러한 결과는 Ant-3S-FITC 융합 폴리펩티드가 활성형인 phospho-c-Met의 엔도사이토시스를 억제할 수 있음을 나타낸다(도 10a 및 도 10b).
3-7. Ant-3S-FITC 융합 폴리펩티드의 c-Met의 자가-인산화 억제능 확인
c-Met의 리간드인 HGF가 c-Met에 결합하게 되면 c-Met이 자가-인산화되면서 다양한 단백질들이 활성화된다(Comoglio et al., EXS, 65:131-65, 1993). 따라서, Ant-3S-FITC 융합 폴리펩티드가 이러한 HGF에 의한 c-Met의 자가-인산화 및 하위 신호전달(downstream signaling)을 어떻게 조절하는지 알아보기 위하여, 상기 실시예 2-3에서 설명한 바에 따라 웨스턴 블랏을 실시하여, 도 11에 나타내었다.
그 결과, 도 11에 나타난 바와 같이, Ant-3S-FITC 융합 폴리펩티드의 처리농도가 높아질수록 c-Met의 자가-인산화가 억제되었음을 확인할 수 있었다. FAK의 인산화도 양-의존적으로 감소하였다(도 11). 또한, Ant-3S-FITC 융합 폴리펩티드에 의해 AKT 및 Erk1/2의 인산화도 억제됨을 확인할 수 있었다(도 12 및 도 13).
3-8. Ant-3S-FITC 융합 폴리펩티드의 HGF-의존성 이동(HGF-dependant migration) 억제능 확인
Ant-3S-FITC 융합 폴리펩티드에 의하여 HGF-의존성 이동이 억제되는지 알아보기 위하여, 상기 실시예 2-6에 설명한 바에 따라 MTT 에세이를 하여, 도 14에 나타내었다.
그 결과, 도 14에 나타난 바와 같이, Ant-3S-FITC 융합 폴리펩티드의 농도가 높아질수록 Hep3B 세포주의 증식이 억제됨을 확인할 수 있었다(도 14). 나아가, 상기 실시예 2-5에서 설명한 바에 따른 트랜스웰 이동 에세이 및 실시예 2-8에서 설명한 바에 따른 MDCK scattering assay를 통하여 Ant-3S-FITC 융합 폴리펩티드가 Hep3B 세포주 및 MDCK 세포주의 HGF-의존성 이동을 억제시킬 수 있음을 확인하였다(도 15, 도 16a 및 도 16b).
이러한 결과는 Ant-3S-FITC 융합 폴리펩티드를 암 세포의 전이를 억제하는 치료제로서 유용하게 사용할 수 있음을 나타낸다.
3-9. Ant-3S-FITC 융합 폴리펩티드의 c-Met 특이적 엔도사이토시스 억제능 확인
PSLL 서열을 포함하는 Ant-3S-FITC 융합 폴리펩티드가 역시 PSLL 서열을 포함하는 GLUT4의 엔도사이토시스를 억제할 수 있는지, 아니면 c-Met의 엔도사이토시스만 특이적으로 억제하는지, 나아가 PSLL 서열이 없는 다른 수용체의 엔도사이토시스에 영향을 미치는지 알아보기 위하여 Tac/3S, Tac/PSD95 키메라 단백질과 GLUT4에 HA 태깅을 한 GLUT4-HA 단백질을 COS-7 세포주에서 발현시켜 온도변화에 따라 Ant-3S-FITC 융합 폴리펩티드에 의해 엔도사이토시스의 변화 여부를 형광현미경을 통하여 확인하여 도 17에 나타내었다.
그 결과, 도 17에 나타난 바와 같이, Ant-3S-FITC 융합 폴리펩티드가 Tac/3S 키메라 단백질의 엔도사이토시스를 효과적으로 억제하지만 Tac/PSD95 및 GLUT4-HA단백질의 엔도사이토시스에는 아무런 영향을 미치지 못하였다(도 17). 이러한 결과는 Ant-3S-FITC 융합 폴리펩티드가 c-Met에 특이적으로 c-Met의 엔도사이토시스를 방해할 수 있음을 나타낸다.
이상의 설명으로부터, 본 발명이 속하는 기술분야의 당 업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시 예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로서 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.

Claims (18)

  1. 서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프(endocytic motif).
  2. 제1항에 있어서, 상기 모티프는 클라트린 매개 엔도사이토시스(Clathrin mediated endocytosis)에 의해 세포 내로 이입되는 것인 모티프.
  3. 제1항에 있어서, 상기 모티프는 c-Met, 인산화된 c-Met 및 HGF(hepatocyte growth factor)와 결합한 c-Met으로 이루어진 군에서 선택된 하나 이상의 c-Met의 엔도사이토시스를 억제하는 것인 모티프.
  4. 제1항에 있어서, 상기 모티프는 HGF(hepatocyte growth factor)에 의한 c-Met의 자가-인산화를 억제하는 것인 모티프.
  5. 제1항 내지 제4항 중 어느 한 항의 모티프를 유효성분으로 포함하는 암 예방 또는 치료용 약학적 조성물.
  6. 제5항에 있어서, 상기 암은 난소암, 유방암, 골육종, 대장암, 식도암, 십이지장암, 신장암, 폐암, 췌장암, 위암, 경부암 및 전립선암으로 이루어진 군에서 선택된 하나 이상의 암인 것인 조성물.
  7. 하기 식 1 또는 2로 표현되는 융합 폴리펩티드:
    [식 1]
    N 말단-단백질 도입 도메인(Protein transduction domain)-서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 포함하는 폴리펩티드-C 말단,
    [식 2]
    N 말단-서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프를 포함하는 폴리펩티드-단백질 도입 도메인(Protein transduction domain)-C 말단.
  8. 제7항에 있어서, 상기 단백질 도입 도메인(Protein transduction domain)은HIV(human immunodeficiency virus)의 Tat; HSV(Herpes simplex virus)의 VP22; 초파리의 Antp; Mph-1; Sim-2; R7; Pep-1; 및 Pep-2으로 이루어진 군으로부터 선택된 것인 폴리펩티드.
  9. 제7항에 있어서, 상기 융합 폴리펩티드는 하기 식으로 표현되는 것인 폴리펩티드:
    [N 말단-서열번호 4의 아미노산으로 표시되는 초파리의 Antp-서열번호 1의 아미노산 서열로 표시되는 엔도사이토시스 모티프-C 말단].
  10. 제7항에 있어서, 상기 융합 폴리펩티드는 클라트린 매개 엔도사이토시스(Clathrin mediated endocytosis)에 의해 세포 내로 이입되는 것인 폴리펩티드.
  11. 제7항에 있어서, 상기 융합 폴리펩티드는 c-Met, 인산화된 c-Met 및 HGF(hepatocyte growth factor)와 결합한 c-Met으로 이루어진 군에서 선택된 하나 이상 이상의 c-Met의 엔도사이토시스를 억제하는 것인 폴리펩티드.
  12. 제7항에 있어서, 상기 융합 폴리펩티드는 HGF(hepatocyte growth factor)에 의한 c-Met의 자가-인산화를 억제하는 것인 폴리펩티드.
  13. 제7항 내지 제12항 중 어느 한 항의 폴리펩티드를 유효성분으로 포함하는 암 예방 또는 치료용 약학적 조성물.
  14. 제13항에 있어서, 상기 암은 난소암, 유방암, 골육종, 대장암, 식도암, 십이지장암, 신장암, 폐암, 췌장암, 위암, 경부암 및 전립선암으로 이루어진 군에서 선택된 하나 이상의 암인 것인 조성물.
  15. 제13항에 있어서, 상기 조성물은 암의 전이 또는 성장을 억제하는 것인 조성물.
  16. 제5항 또는 제13항 내지 제15항 중 어느 한 항의 조성물을 암이 발병한 또는 발병 가능성이 있는 개체에게 투여하는 단계를 포함하는, 암 치료방법.
  17. 제16항에 있어서, 상기 암은 난소암, 유방암, 골육종, 대장암, 식도암, 십이지장암, 신장암, 폐암, 췌장암, 위암, 경부암 및 전립선암으로 이루어진 군에서 선택된 하나 이상의 암인 것인, 암 치료방법.
  18. 제16항에 있어서, 상기 치료는 암의 전이 또는 성장을 억제하여 수행되는 것인, 암 치료방법.
PCT/KR2012/001593 2011-03-02 2012-03-02 엔도사이토시스 모티프 및 단백질 도입 도메인을 포함하는 암 예방 또는 치료용 약학적 조성물 Ceased WO2012118353A2 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/002,600 US9617304B2 (en) 2011-03-02 2012-03-02 Pharmaceutical composition containing an endocytic motif and protein transduction domains for preventing or treating cancer

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2011-0018628 2011-03-02
KR1020110018628A KR20120100027A (ko) 2011-03-02 2011-03-02 엔도사이토시스 모티프 및 단백질 도입 도메인을 포함하는 암 예방 또는 치료용 약학적 조성물

Publications (2)

Publication Number Publication Date
WO2012118353A2 true WO2012118353A2 (ko) 2012-09-07
WO2012118353A3 WO2012118353A3 (ko) 2012-12-13

Family

ID=46758398

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2012/001593 Ceased WO2012118353A2 (ko) 2011-03-02 2012-03-02 엔도사이토시스 모티프 및 단백질 도입 도메인을 포함하는 암 예방 또는 치료용 약학적 조성물

Country Status (3)

Country Link
US (1) US9617304B2 (ko)
KR (1) KR20120100027A (ko)
WO (1) WO2012118353A2 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112979753A (zh) * 2019-12-16 2021-06-18 中国药科大学 一种靶向c-Met的多肽及其应用

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5595756A (en) * 1993-12-22 1997-01-21 Inex Pharmaceuticals Corporation Liposomal compositions for enhanced retention of bioactive agents
MX2007001064A (es) 2004-07-26 2007-04-12 Genentech Inc Metodos y composiciones para modular la activacion del factor de crecimiento de hepatocitos.
US8236761B2 (en) * 2006-07-07 2012-08-07 Washington State University Research Foundation C-Met receptor regulation by angiotensin IV (AT4) receptor ligands
WO2008131276A1 (en) * 2007-04-20 2008-10-30 Deciphera Pharmaceuticals, Llc Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases
GB0803076D0 (en) * 2008-02-20 2008-03-26 Univ Ghent Mucosal Membrane Receptor and uses thereof
AU2009246263B2 (en) * 2008-05-14 2014-08-21 Amgen Inc. Combinations VEGF(R) inhibitors and hepatocyte growth factor (c-Met) inhibitors for the treatment of cancer

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112979753A (zh) * 2019-12-16 2021-06-18 中国药科大学 一种靶向c-Met的多肽及其应用

Also Published As

Publication number Publication date
KR20120100027A (ko) 2012-09-12
US20140066375A1 (en) 2014-03-06
US9617304B2 (en) 2017-04-11
WO2012118353A3 (ko) 2012-12-13

Similar Documents

Publication Publication Date Title
Qi et al. A novel Drp1 inhibitor diminishes aberrant mitochondrial fission and neurotoxicity
Joset et al. Pincher-generated Nogo-A endosomes mediate growth cone collapse and retrograde signaling
US9067968B2 (en) Tight junction protein modulators and uses thereof
WO2014046478A1 (ko) 세포 투과성 펩티드, 그를 포함한 컨쥬게이트 및 그를 포함한 조성물
WO2014046490A1 (ko) 세포 투과성 펩티드, 그를 포함한 컨쥬게이트 및 그를 포함한 조성물
WO2015156649A1 (ko) 섬유증 억제 활성을 가지는 펩티드 및 이를 포함하는 조성물
WO2009139570A1 (en) Peptides for targeting apoptotic cells and uses thereof
Müller et al. Functional dissection of SseF, a membrane-integral effector protein of intracellular Salmonella enterica
WO2018044012A1 (ko) 항암 활성을 갖는 펩티드, 이를 유효성분으로 함유하는 암 예방 및 치료용 약학 조성물, 건강기능식품 조성물 및 기능성 화장품 조성물
Ivic et al. Intracellular trafficking of a tagged and functional mammalian olfactory receptor
WO2012118353A2 (ko) 엔도사이토시스 모티프 및 단백질 도입 도메인을 포함하는 암 예방 또는 치료용 약학적 조성물
WO2022220632A1 (ko) 세포 투과 펩티드, 항암 펩티드 및 이를 포함하는 암 예방 또는 치료용 약학적 조성물
WO2010137770A1 (ko) 신규한 ｇｐｃｒ 단백질 및 이의 용도
Dahimene et al. A CaV2. 1 N-terminal fragment relieves the dominant-negative inhibition by an Episodic ataxia 2 mutant
Fu et al. Chordate PIAS proteins act as conserved repressors of the TRAF6 self-polyubiquitination
WO2017209553A2 (ko) 환자 유래 세포를 이용한 항체 스크리닝 방법
Ogunrinde et al. Hepatocellular differentiation status is characterized by distinct subnuclear localization and form of the chanzyme TRPM7
WO2018143615A1 (ko) 페록시레독신 1 단백질의 활성 억제제를 유효성분으로 함유하는 골질환의 예방 또는 치료용 약학적 조성물
WO2018203613A1 (ko) 톨-유사 수용체(tlr) 억제를 위한 펩타이드 및 이를 포함하는 약학적 조성물
Lamsoul et al. Functional and structural insights into ASB2α, a novel regulator of integrin-dependent adhesion of hematopoietic cells
WO2018088733A1 (ko) 신규의 프로테인 트랜스덕션 도메인 및 이의 용도
WO2016159627A1 (ko) 항암 활성을 갖는 펩티드, 이를 유효성분으로 함유하는 암 예방 및 치료용 약학 조성물 및 건강기능식품 조성물
WO2010016706A2 (ko) Ｉｄｂｆ의 신규 용도
WO2019117691A1 (ko) CD44v6에 결합하는 펩타이드 및 이의 용도
WO2020080656A1 (ko) Fgf2 또는 api5 유래 펩타이드 및 그의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12752562

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 14002600

Country of ref document: US

122 Ep: pct application non-entry in european phase

Ref document number: 12752562

Country of ref document: EP

Kind code of ref document: A2