WO2012054824A2 - Biomarqueurs pronostiques chez des patientes atteintes d'un cancer ovarien - Google Patents
Biomarqueurs pronostiques chez des patientes atteintes d'un cancer ovarien Download PDFInfo
- Publication number
- WO2012054824A2 WO2012054824A2 PCT/US2011/057271 US2011057271W WO2012054824A2 WO 2012054824 A2 WO2012054824 A2 WO 2012054824A2 US 2011057271 W US2011057271 W US 2011057271W WO 2012054824 A2 WO2012054824 A2 WO 2012054824A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- biomarkers
- ovarian cancer
- subject
- sample
- prognosis
- Prior art date
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57449—Specifically defined cancers of ovaries
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N30/00—Investigating or analysing materials by separation into components using adsorption, absorption or similar phenomena or using ion-exchange, e.g. chromatography or field flow fractionation
- G01N30/02—Column chromatography
- G01N30/88—Integrated analysis systems specially adapted therefor, not covered by a single one of the groups G01N30/04 - G01N30/86
- G01N2030/8809—Integrated analysis systems specially adapted therefor, not covered by a single one of the groups G01N30/04 - G01N30/86 analysis specially adapted for the sample
- G01N2030/8813—Integrated analysis systems specially adapted therefor, not covered by a single one of the groups G01N30/04 - G01N30/86 analysis specially adapted for the sample biological materials
- G01N2030/8831—Integrated analysis systems specially adapted therefor, not covered by a single one of the groups G01N30/04 - G01N30/86 analysis specially adapted for the sample biological materials involving peptides or proteins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N27/00—Investigating or analysing materials by the use of electric, electrochemical, or magnetic means
- G01N27/26—Investigating or analysing materials by the use of electric, electrochemical, or magnetic means by investigating electrochemical variables; by using electrolysis or electrophoresis
- G01N27/416—Systems
- G01N27/447—Systems using electrophoresis
- G01N27/44756—Apparatus specially adapted therefor
- G01N27/44773—Multi-stage electrophoresis, e.g. two-dimensional electrophoresis
- G01N27/44778—Multi-stage electrophoresis, e.g. two-dimensional electrophoresis on a common gel carrier, i.e. 2D gel electrophoresis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/54—Determining the risk of relapse
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/56—Staging of a disease; Further complications associated with the disease
Definitions
- Ovarian cancer is among the most lethal gynecologic malignancies in developed countries. Annually in the United States alone, approximately 23,000 women are diagnosed with the disease and almost 14,000 women die from it. (Jamal, A., et al., CA Cancer J. Clin, 2002; 52:23-47). Despite progress in cancer therapy, ovarian cancer mortality has remained virtually unchanged over the past two decades. Given the steep survival gradient relative to the stage at which the disease is diagnosed, early detection remains the most important factor in improving long-term survival of ovarian cancer patients.
- tumor markers suitable for the early detection and diagnosis of cancer holds great promise to improve the clinical outcome of patients. It is especially important for patients presenting with vague or no symptoms or with tumors that are relatively inaccessible to physical examination. Despite considerable effort directed at early detection, women generally present with disseminated disease at diagnosis.
- the present invention provides compositions and methods for determining ovarian cancer prognosis (e.g., predicting overall survival probability or predicting progression free survival probability). Such methods are useful in selecting an appropriate therapeutic regimen for the subject.
- the invention provides compositions comprising one or more biomarkers and sensitive and rapid methods for using the kits to determine the survival status of patients with ovarian cancer by measuring the levels of particular biomarkers in a biological sample.
- the detection and measurement of these biomarkers in patient samples provides information that diagnosticians can correlate with survival status of human ovarian cancer patients or a negative diagnosis (e.g. , normal or disease-free).
- the markers are characterized by mass/charge ratio, molecular weight and/or by their known protein identities. The markers can be resolved from other proteins in a sample by using a variety of fractionation techniques, e.g.
- the method of resolution involves Surface-Enhanced Laser Desorption/Ionization ("SELDI”) mass
- the invention generally features a method of determining the prognosis of a subject having or suspected of having ovarian cancer, the method involving comparing the level of biomarkers inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein), transferrin (TFR), and beta-2 microglobin (B2M) or fragments thereof in a sample from the subject to the level present in a reference, wherein an increased level of said biomarkers relative to the reference is indicative of a poor prognosis.
- biomarkers inter-alpha (globulin) inhibitor H4 plasma Kallikrein-sensitive glycoprotein), transferrin (TFR), and beta-2 microglobin (B2M) or fragments thereof in a sample from the subject to the level present in a reference, wherein an increased level of said biomarkers relative to the reference is indicative of a poor prognosis.
- the invention generally features a method of determining the prognosis of a subject having or suspected of having ovarian cancer, the method involving comparing the level of biomarkers B2M, TrF and ITIH4 or fragments thereof, wherein an increased level of said biomarkers relative to the reference is indicative of a poor prognosis.
- the invention generally features a method of determining the prognosis of a subject having or suspected of having ovarian cancer, the method involving comparing the level of biomarkers B2M and CTAP3 or fragments thereof, wherein an increased level of said biomarkers relative to the reference is indicative of a poor prognosis.
- the invention generally features a method of determining the prognosis of a subject having or suspected of having ovarian cancer, the method involving comparing the level of biomarkers CA125, HEPC, B2M and CTAP3 or fragments thereof in a sample from the subject to the level present in a reference, wherein an increased level of said biomarkers relative to the reference is indicative of a poor prognosis.
- the invention generally features a method of determining the prognosis of a subject having or suspected of having ovarian cancer, the method involving comparing the level of biomarkers APOA1, TT, HEPC, B2M, CTAP3, TrF and CA125 or fragments thereof in a sample from the subject to the level present in a reference, wherein an increased level of said biomarkers relative to the reference is indicative of a poor prognosis.
- the invention generally features a method of qualifying ovarian cancer status in a human involving providing a subject sample of blood or a blood derivative; and fractionating proteins in the sample on an anion exchange resin and collecting fractions that contain inter-alpha (globulin) inhibitor H4 (plasma
- IIH4 Kallikrein-sensitive glycoprotein
- TFR transferrin
- B2M beta-2 microglobin
- the invention generally features a kit containing a capture reagent that binds a panel of biomarkers containing, inter-alpha (globulin) inhibitor H4 (plasma Kallikrein- sensitive glycoprotein) (ITIH4), transferrin (TFR), and ) beta-2 microglobin (B2M); and a container containingat the panel of biomarkers.
- a capture reagent that binds a panel of biomarkers containing, inter-alpha (globulin) inhibitor H4 (plasma Kallikrein- sensitive glycoprotein) (ITIH4), transferrin (TFR), and ) beta-2 microglobin (B2M); and a container containingat the panel of biomarkers.
- ITIH4 plasma Kallikrein- sensitive glycoprotein
- TFR transferrin
- B2M beta-2 microglobin
- the invention generally features a kit containing capture reagents that binds the panel of biomarkers fragments containing inter-alpha
- the invention generally features a system containing a plurality of capture reagents each of which has bound to it a different biomarker
- the invention generally features a method of determining an ovarian cancer patient's prognosis containingdetermining the concentration or expression levels or peak intensity values of inter-alpha (globulin) inhibitor H4 (plasma Kallikrein- sensitive glycoprotein) (ITIH4), transferrin (TFR), and beta-2 microglobin (B2M); and correlating the measurements with ovarian cancer patient survival status.
- inter-alpha (globulin) inhibitor H4 plasma Kallikrein- sensitive glycoprotein) (ITIH4), transferrin (TFR), and beta-2 microglobin (B2M)
- the invention generally features a method of determining an ovarian cancer patient's prognosis involving determining the concentration or expression levels or peak intensity values of a combination of two or more biomarkers in a sample from the subject, wherein the one or more biomarkers are selected from the group consisting of: inter-alpha (globulin) inhibitor H4 (plasma Kallikrein- sensitive glycoprotein) (ITIH4), transferrin (TFR), and beta-2 microglobin (B2M)and correlating the measurements with ovarian cancer patient survival status.
- ITIH4 plasma Kallikrein- sensitive glycoprotein
- TFR transferrin
- B2M beta-2 microglobin
- the invention generally features a method of determining an ovarian cancer patient's prognosis involving determining the concentration or expression levels or peak intensity values of inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein) (ITIH4), transferrin (TFR), and beta-2 microglobin (B2M); and correlating the measurements with ovarian cancer patient survival status.
- inter-alpha (globulin) inhibitor H4 plasma Kallikrein-sensitive glycoprotein) (ITIH4), transferrin (TFR), and beta-2 microglobin (B2M)
- the methods further involve comparing the level of one or more additional biomarkers to the level present in a reference, wherein the additional biomarkers are selected from the group consisting of apolipoprotein Al, transthyretin, inter-alpha trypsin inhibitor IV, transferrin, hepcidin, connective-tissue activating protein 3, and Serum Amyloid Al and beta-2 microglobin.
- the methods further involve comparing the level of CA125 in the subject sample to the level present in a reference.
- the method further comprises considering one or more of the following: radicality of primary surgery, age at diagnosis and treatment.
- the method further comprises considering one or more of FIGO stage, histological type of tumor, and CA125.
- the prognosis is predictive of overall survival or progression- free survival.
- failure to detect an increased level in one or more of said biomarkers is indicative of a good prognosis.
- a patient's prognosis is used in selecting a therapeutic regiment.
- a poor prognosis indicates that the subject requires an aggressive therapeutic regimen and a good prognosis indicates that the subject requires a less aggressive therapeutic regimen.
- an aggressive therapeutic regimen includes neoadjuvant chemotherapy.
- the overall survival or progression free survival is selected from the group consisting of one to two years survival post diagnosis; two to five years post diagnosis; and beyond five years post diagnosis.
- the capture reagent is an antibody. In other embodiments contain an MS probe to which the capture reagents are attached or is attachable. In other embodiments the capture reagents are immobilized metal chelates. In yet other embodiments the kits contain written instructions for use of the kit for detection of ovarian cancer status in a subject. In various embodiments of any of the above aspects or any other aspect of the invention delineated herein, an article of manufacture containing a panel of capture reagents that bind the panel of biomarkers or fragments of the respective biomarkers thereof.
- biomarkers are inter-alpha (globulin) inhibitor H4 (plasma Kallikrein- sensitive glycoprotein) (ITIH4), transferrin (TFR), and beta-2 microglobin (B2M).
- biomarkers are inter-alpha (globulin) inhibitor H4 (plasma Kallikrein- sensitive glycoprotein) (ITIH4), transferrin (TFR), and ) beta-2 microglobin (B2M).
- the present invention provides a method of assessing an ovarian cancer patient's survival status in a subject containing(a) measuring the panel of three biomarkers in a sample from the subject, and correlating the measurement with ovarian cancer patient survival status.
- the measuring step comprises detecting the m/z (mass-to-charge ratio) values of markers in the sample using SELDI.
- Preferred methods of the invention also include assessing ovarian cancer patient survival status comprising:
- a prognostic index may in the future be used to select patients for
- ovarian cancer patient survival status refers to the status of survival of the patient.
- types of ovarian cancer survival statuses include, but are not limited to, disease free or overall survival one year after diagnosis, 2 years after diagnosis, 3 years after diagnosis, 4 years after diagnosis, and 5 or more years after diagnosis.
- Another type of status is "treatment responsiveness” i.e. whether a patient has a high or low likelihood of responding to a given type of therapy.
- a third type of status is "remission” i.e.
- the mass accuracy of the spectral instrument is considered to be about within +/- 0.15 percent of the disclosed molecular weight value. Additionally, to such recognized accuracy variations of the instrument, the spectral mass determination can vary within resolution limits of from about 400 to 1000 m/dm, where m is mass and dm is the mass spectral peak width at 0.5 peak height.
- a Cox proportional hazards model is a regression model for studying the association between time to event data and explanatory variables, e.g. tumor stage, age and gender.
- the hazard rate (intensity of the event)on the log scale is the dependent variable which is a linear function of the explanatory
- a HR above one indicates an increased intensity or risk for the event and a value below a decreased intensity or risk.
- HR 1.62 for a patient with a stage III ovarian cancer compared to a patient with a stage I cancer. This means that the stage III patient has an increased intensity or risk of 62% for death compared to the stage I patient.
- a HR above one a poor prognosis and a HR below one a more favorable prognosis.
- a statistical test specifies a null hypothesis which is compared to the alternative hypothesis based on the probability of the observed outcome. If the probability of observing the outcome assuming the null hypothesis is below a prespecified threshold denoted the level of significance then the null hypothesis is rejected in favor of the alternative hypothesis. The probability of incorrectly rejecting the null hypothesis, i.e. the null hypothesis is true, is the chosen level of significance often denoted the Type I error. A good result is the rejection of the null hypothesis when the alternative is true, the probability of this is called the power of the test and is dependent on the difference compared to the null hypothesis and the chosen level of significance.
- Biochip arrays useful in the invention include protein and nucleic acid arrays.
- One or more markers are captured on the biochip array and subjected to laser ionization to detect the molecular weight of the markers.
- Analysis of the markers is, for example, by molecular weight of the one or more markers against a threshold intensity that is normalized against total ion current.
- logarithmic transformation is used for reducing peak intensity ranges to limit the number of markers detected.
- Another method of measuring the biomarkers includes the use of a
- the step of correlating the measurement of the biomarkers with ovarian cancer patient survival status is performed by a software classification algorithm.
- data is generated on subject samples on a biochip array, by subjecting said biochip array to laser ionization and detecting intensity of signal for mass/charge ratio; and, transforming the data into computer readable form; and executing an algorithm that classifies the data according to user input parameters, for detecting signals that represent markers present in ovarian cancer patients and are lacking in non-cancer subject controls.
- Biochip surfaces are, for example, ionic, anionic, comprised of immobilized nickel ions, comprised of a mixture of positive and negative ions, comprised of one or more antibodies, single or double stranded nucleic acids, proteins, peptides or fragments thereof, amino acid probes, or phage display libraries.
- one or more of the markers are measured using laser desorption/ionization mass spectrometry, comprising providing a probe adapted for use with a mass spectrometer comprising an adsorbent attached thereto, and contacting the subject sample with the adsorbent, and; desorbing and ionizing the marker or markers from the probe and detecting the deionized/ionized markers with the mass spectrometer.
- the laser desorption/ionization mass spectrometry comprises: providing a substrate comprising an adsorbent attached thereto; contacting the subject sample with the adsorbent; placing the substrate on a probe adapted for use with a mass spectrometer comprising an adsorbent attached thereto; and, desorbing and ionizing the marker or markers from the probe and detecting the desorbed/ionized marker or markers with the mass spectrometer.
- the adsorbent can for example be hydrophobic, hydrophilic, ionic or metal chelate adsorbent, such as, nickel or an antibody, single- or double stranded oligonucleotide, amino acid, protein, peptide or fragments thereof.
- the methods of the present invention can be performed on any type of patient sample that would be amenable to such methods, e.g., blood, serum and plasma.
- kits comprising capture reagents that bind the biomarkers and a container comprising the panel of biomarkers.
- capture reagent can be any type of reagent, preferably the reagent is a SELDI probe.
- the capture reagent comprises an immobilized metal chelate ("IMAC").
- IMAC immobilized metal chelate
- kits of the present invention further comprise a wash solution that selectively allows retention of the bound biomarker to the capture reagent as compared with other biomarkers after washing.
- the invention also provides kits comprising capture reagents that bind the three biomarkers and instructions for using the capture reagent to measure the biomarkers.
- the capture reagent comprises an antibody.
- kits further comprise an MS probe to which the capture reagent is attached or is attachable.
- the capture reagent comprises an IMAC.
- the kits may also contain a wash solution that selectively allows retention of the bound biomarker to the capture reagent as compared with other biomarkers after washing.
- the kit comprises written instructions for use of the kit for determining ovarian cancer status and the instructions provide for contacting a test sample with the capture reagents and measuring one or more biomarkers retained by the capture reagents.
- the kit also provides for capture reagents, which are antibodies, single or double stranded oligonucleotide, amino acid, protein, peptide or fragments thereof.
- Measurement of one or more protein biomarkers using the kit is by mass spectrometry or immunoassays such as an ELISA.
- Figure 3 depicts a plot showing hazard ratios for different combinations of the 3 intensities, B2M on the abscissae and for 1 and third quartiles of TRF and ⁇ 4, all HR compared to a patient with a median level of each peak.
- Adsorption refers to detectable non-covalent binding of an analyte to an adsorbent or capture reagent.
- Antibody refers to a polypeptide ligand substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, which specifically binds and recognizes an epitope (e.g. , an antigen).
- the recognized immunoglobulin genes include the kappa and lambda light chain constant region genes, the alpha, gamma, delta, epsilon and mu heavy chain constant region genes, and the myriad immunoglobulin variable region genes. Antibodies exist, e.g.
- antibody as used herein, also includes antibody fragments either produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA methodologies. It also includes polyclonal antibodies, monoclonal antibodies, chimeric antibodies, humanized antibodies, or single chain antibodies. "Fc" portion of an antibody refers to that portion of an immunoglobulin heavy chain that comprises one or more heavy chain constant region domains, CHi, CH 2 and CH 3 , but does not include the heavy chain variable region.
- Biochip refers to a solid substrate having a generally planar surface to which an adsorbent is attached. Frequently, the surface of the biochip comprises a plurality of addressable locations, each of which location has the adsorbent bound there.
- Biochips can be adapted to engage a probe interface and, therefore, function as probes.
- the "complexity" of a sample adsorbed to an adsorption surface of an affinity capture probe means the number of different protein species that are adsorbed.
- a marker refers to differences in the quantity and/or the frequency of a marker present in a sample taken from a subject having or having a propensity to develop cancer as compared to a control subject.
- the IAIH4 fragment is present at an elevated level in biological samples obtained from ovarian cancer patients as compared to samples from control subjects.
- Apo Al and transthyretin described herein are present at a decreased level in samples obtained from ovarian cancer patients compared to samples from control subjects.
- a marker can be a polypeptide, which is detected at a higher frequency or at a lower frequency in samples of human cancer patients compared to samples of control subjects.
- a marker can be differentially present in terms of level, quantity, and/or frequency.
- a polypeptide is differentially present between two samples if the
- a polypeptide in one sample is different from the amount of the polypeptide in the other sample.
- the difference is statistically significant.
- a polypeptide is differentially present between the two samples if it is present at least about 120%, at least about 130%, at least about 150%, at least about 180%, at least about 200%, at least about 300%, at least about 500%, at least about 700%, at least about 900%, or at least about 1000% greater than it is present in the other sample, or if it is detectable in one sample and not detectable in the other.
- a polypeptide is differentially present between two sets of samples if the frequency of detecting the polypeptide in the ovarian cancer patients' samples is statistically significantly higher or lower than in the control samples.
- a polypeptide is differentially present between the two sets of samples if it is detected at least about 120%, at least about 130%, at least about 150%, at least about 180%, at least about 200%, at least about 300%, at least about 500%, at least about 700%, at least about 900%, or at least about 1000% more frequently or less frequently observed in one set of samples than the other set of samples.
- Diagnostic means identifying the presence or nature of a pathologic condition, i.e., ovarian cancer. Diagnostic methods differ in their sensitivity and specificity.
- the "sensitivity” of a diagnostic assay is the percentage of diseased individuals who test positive (percent of "true positives”). Diseased individuals not detected by the assay are “false negatives.” Subjects who are not diseased and who test negative in the assay, are termed “true negatives.”
- the "specificity" of a diagnostic assay is 1 minus the false positive rate, where the "false positive” rate is defined as the proportion of those without the disease who test positive. While a particular diagnostic method may not provide a definitive diagnosis of a condition, it suffices if the method provides a positive indication that aids in diagnosis.
- a "control amount" of a marker can be any amount or a range of amount, which is to be compared against a test amount of a marker.
- a control amount of a marker can be the amount of a marker in a person without ovarian cancer.
- a control amount is an absolute amount (e.g., ⁇ g/ml).
- a control amount is the the relative level (e.g., relative intensity of signals).
- a "diagnostic amount" of a marker refers to an amount of a marker in a subject's sample that is consistent with a diagnosis of ovarian cancer.
- a diagnostic amount is the absolute amount (e.g. , g/ml) of analyte.
- a diagnostic amount is the relative level (e.g., relative intensity of signals).
- Eluant or “wash solution” refers to an agent, typically a solution, which is used to affect or modify adsorption of an analyte to an adsorbent surface and/or remove unbound materials from the surface.
- the elution characteristics of an eluant can depend, for example, on pH, ionic strength, hydrophobicity, degree of
- Gas phase ion spectrometer refers to an apparatus that detects gas phase ions.
- Gas phase ion spectrometers include an ion source that supplies gas phase ions.
- Gas phase ion spectrometers include, for example, mass spectrometers, ion mobility spectrometers, and total ion current measuring devices.
- Gas phase ion spectrometry refers to the use of a gas phase ion spectrometer to detect gas phase ions.
- Ion source refers to a sub-assembly of a gas phase ion spectrometer that provides gas phase ions.
- the ion source provides ions through a desorption/ionization process.
- Such embodiments generally comprise a probe interface that positionally engages a probe in an interrogatable relationship to a source of ionizing energy (e.g., a laser desorption/ionization source) and in concurrent communication at atmospheric or subatmospheric pressure with a detector of a gas phase ion spectrometer.
- a source of ionizing energy e.g., a laser desorption/ionization source
- Forms of ionizing energy for desorbing/ionizing an analyte from a solid phase include, for example: (1) laser energy; (2) fast atoms (used in fast atom
- ionizing energy for solid phase analytes is a laser (used in laser desorption/ionization), in particular, nitrogen lasers, Nd-Yag lasers and other pulsed laser sources.
- Fluence refers to the energy delivered per unit area of interrogated image.
- a high fluence source, such as a laser, will deliver about 1 mJ / mm2 to 50 mJ / mm2.
- a sample is placed on the surface of a probe, the probe is engaged with the probe interface and the probe surface is struck with the ionizing energy.
- the energy desorbs analyte molecules from the surface into the gas phase and ionizes them.
- ionizing energy for analytes include, for example: (1) electrons that ionize gas phase neutrals; (2) strong electric field to induce ionization from gas phase, solid phase, or liquid phase neutrals; and (3) a source that applies a combination of ionization particles or electric fields with neutral chemicals to induce chemical ionization of solid phase, gas phase, and liquid phase neutrals.
- Laser desorption mass spectrometer refers to a mass spectrometer that uses laser energy as a means to desorb, volatilize, and ionize an analyte.
- Managing subject treatment refers to the action of a clinician (e.g., physician( subsequent to a determination of ovarian cancer status in a subject. For example, if the result of the methods of the present invention is inconclusive or there is reason that confirmation of status is necessary, the physician may order more tests. Alternatively, if the result of the methods of the present invention indicates a potentially poor prognosis, alternative or more aggressive therapies may be warranted. Furthermore, if the results show a potentially good prognosis, no or less aggressive therapies may be warranted.
- a clinician e.g., physician( subsequent to a determination of ovarian cancer status in a subject. For example, if the result of the methods of the present invention is inconclusive or there is reason that confirmation of status is necessary, the physician may order more tests. Alternatively, if the result of the methods of the present invention indicates a potentially poor prognosis, alternative or more aggressive therapies may be warranted. Furthermore, if the results show a potentially good prognosis
- Examples of more aggressive therapy include: a) The physician may after surgery treat the patient with more intensive and prolonged chemotherapy, b) Offer additional chemotherapy or biological treatments, c) The patient may be monitored more closely for relapse or progressive disease, d) Patients with both an indication of a poor prognosis and extensive disease, which on imaging indicate nonradical surgery, may be offered neoadjuvant chemotherapy and subsequent interval surgery, e) The proteomic index may be part in the total clinical judgment of treatment versus palliative treatment in severe ill patients, f) Radical and correct staged patients with stage one and grade 1-2 may be offered adjuvant treatment, g) The patients may be selected for surgery by a gynecologic-oncologic surgeon experienced in performing extensive procedures.
- Examples of less aggressive therapy include, a) The index may be part of the decision making for radical surgery, b) Radical and correct staged patients with stage one and grade 1-2 may avoid a potentially harmful chemotherapy, c) The patient may be operated on by a less specialized gynecologist.
- a prognostic index may in the future be used to select patients for
- Mass analyzer refers to a sub-assembly of a mass spectrometer that comprises a means for measuring a parameter that can be translated into mass-to- charge ratios of gas phase ions.
- the mass analyzer comprises an ion optic assembly, a flight tube and an ion detector.
- Tudem mass spectrometer refers to any mass spectrometer that is capable of performing two successive stages of m/z-based discrimination or measurement of ions, including ions in an ion mixture.
- the phrase includes mass spectrometers having two mass analyzers that are capable of performing two successive stages of m/z-based discrimination or measurement of ions tandem-in-space.
- the phrase further includes mass spectrometers having a single mass analyzer that is capable of performing two successive stages of m/z-based discrimination or measurement of ions tandem-in-time.
- Solid support refers to a solid material which can be derivatized with, or otherwise attached to, a capture reagent.
- exemplary solid supports include probes, microtiter plates and chromatographic resins.
- “Surface-enhanced laser desorption/ionization” or “SELDI” refers to a method of desorption/ionization gas phase ion spectrometry (e.g., mass spectrometry) in which the analyte is captured on the surface of a SELDI probe that engages the probe interface of the gas phase ion spectrometer.
- SELDI MS the gas phase ion spectrometer is a mass spectrometer.
- SELDI technology is described in, e.g., U.S. patent 5,719,060 (Hutchens and Yip) and U.S. patent 6,225,047 (Hutchens and Yip).
- Chromatographic adsorbents include, for example, ion exchange materials, metal chelators (e.g., nitriloacetic acid or iminodiacetic acid), immobilized metal chelates, hydrophobic interaction adsorbents, hydrophilic interaction adsorbents, dyes, simple biomolecules (e.g., nucleotides, amino acids, simple sugars and fatty acids) and mixed mode adsorbents (e.g., hydrophobic attraction/electrostatic repulsion adsorbents).
- metal chelators e.g., nitriloacetic acid or iminodiacetic acid
- immobilized metal chelates e.g., immobilized metal chelates
- hydrophobic interaction adsorbents e.g., hydrophilic interaction adsorbents
- dyes e.g., simple biomolecules (e.g., nucleotides, amino acids, simple sugars and
- SEND Surface-Enhanced Neat Desorption
- SEND probe. Energy absorbing molecules
- EAM Electronic absorbing molecules
- SEPAR Surface-Enhanced Photolabile Attachment and Release
- SELDI Surface-Enhanced Photolabile Attachment and Release
- analytes can be detected by a variety of detection methods selected from, for example, a gas phase ion spectrometry method, an optical method, an electrochemical method, atomic force microscopy and a radio frequency method.
- Gas phase ion spectrometry methods are described herein. Of particular interest is the use of mass spectrometry and, in particular, SELDI.
- Optical methods include, for example, detection of fluorescence, luminescence, chemiluminescence, absorbance, reflectance, transmittance, birefringence or refractive index (e.g., surface plasmon resonance, ellipsometry, a resonant mirror method, a grating coupler waveguide method or interferometry).
- Optical methods include microscopy (both confocal and non-confocal), imaging methods and non-imaging methods.
- the present invention provides compositions and methods for determining the prognosis of subjects having or suspected of having ovarian cancer by detecting particular biomarkers.
- the detection and measurement of these biomarkers in subject samples provides information that diagnosticians can correlate with overall survival and/or progression-free survival to select an appropriate therapeutic regimen for the subject.
- the invention is based, at least in part, on the discovery that one or more of the following biomarkers are useful for detecting and/or characterizing ovarian cancer in a subject: apolipoprotein Al (APOA1), transthyretin (cysteinylated form) (TT), inter-alpha trypsin inhibitor IV (internal fragment) (ITIH4), transferrin (TrF), hepcidin (HEPC), connective-tissue activating protein 3 (CTAP3), Serum Amyloid Al (SAA), and beta-2 microglobin (B2M).
- these biomarkers are used to determine a subject's prognosis (e.g., likely overall survival and/or progression free survival).
- the biomarkers used are inter-alpha (globulin) inhibitor H4 (plasma Kallikrein- sensitive glycoprotein) (ITIH4), transferrin (TFR), and/or beta-2 microglobin (B2M).
- biomarkers assess a patient's survival status after having developed ovarian cancer and could potentially provide additional information to physicians for clinical decision-making. This is supported by Cox multivariate analysis in an independent validation. For example, several large-scale studies have suggested that ovarian cancer patients with surgical procedures operated by gynecological oncologists tend to have a better long-term survival. However, other studies concluded that currently only about one third of ovarian cancer patients undergoing surgical procedures in the US are treated by gynecological oncologists. With the current total number of gynecological oncologists available, it is still not practical to have all patients undergoing surgery for suspected ovarian cancer be operated by gynecologic oncologists. The biomarkers have the potential to be used to identify patients with the lower probability of surviving ovarian cancer and recommend them for treatment by gynecologic oncologists.
- ITIH4 fragment 1 SEQ ID NO: 5
- MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF ITIH4 fragment 2
- PGVLSSRQLGLPGPPDVPDHAAYHPF ITIH4 fragment 3
- G VLS SRQLGLPGPPD VPDH A A YHPF The present invention also includes all other known fragments of ITIHA4.
- ITIH4 precursor is a 930 amino acid protein (SwissProt Q 14624).
- ITIH4 fragment 1 spans amino acids 658-687 of human ITIH4 precursor.
- ITIH4 fragment 2 spans amino acids 662-687 of ITIH4 precursor.
- ITIH4 fragment 3 spans amino acids 663-687 of ITIH4 precursor.
- Transferrrin is described as a biomarker for ovarian cancer in US patent publication 2005-0214760 Al.
- Transferrrin is a 679 amino acid protein derived from a 698 amino acid precursor (GenBank Accession No. NP_001054 GL4557871; SwissProt Accesion No. P02787) (SEQ ID NO: 10).
- Transferrrin is recognized by antibodies available from, e.g., Dako (catalog A006) (www.dako.com, Glostrup, Denmark). Transferrin is glycosylated. Therefore, the measured molecular weight is higher than the theoretical weight, which does not take glycosylation into account.
- a band containing the biomarker is cut out and the protein is subject to protease digestion. Individual protein fragments are separated by a first mass spectrometer. The fragment is then subjected to collision-induced cooling, which fragments the peptide and produces a polypeptide ladder. A polypeptide ladder is then analyzed by the second mass spectrometer of the tandem MS. The difference in masses of the members of the polypeptide ladder identifies the amino acids in the sequence. An entire protein can be sequenced this way, or a sequence fragment can be subjected to database mining to find identity candidates.
- Pre-translational modified forms include allelic variants, slice variants and RNA editing forms.
- Post- translationally modified forms include forms resulting from proteolytic cleavage (e.g., fragments of a parent protein), glycosylation, phosphorylation, lipidation, oxidation, methylation, cystinylation, sulphonation and acetylation.
- the captured proteins can be detected by SELDI mass spectrometry or by eluting the proteins from the capture reagent and detecting the eluted proteins by traditional MALDI or by SELDI.
- SELDI mass spectrometry is especially attractive because it can distinguish and quantify modified forms of a protein based on mass and without the need for labeling.
- the biospecific capture reagent is bound to a solid phase, such as a bead, a plate, a membrane or a chip.
- a solid phase such as a bead, a plate, a membrane or a chip.
- Methods of coupling biomolecules, such as antibodies, to a solid phase are well known in the art. They can employ, for example, bifunctional linking agents, or the solid phase can be derivatized with a reactive group, such as an epoxide or an imidizole, that will bind the molecule on contact.
- Biospecific capture reagents against different target proteins can be mixed in the same place, or they can be attached to solid phases in different physical or addressable locations. For example, one can load multiple columns with derivatized beads, each column able to capture a single protein cluster.
- the surfaces of biochips can be derivatized with the capture reagents directed against protein clusters either in the same location or in physically different addressable locations.
- One advantage of capturing different clusters in different addressable locations is that the analysis becomes simpler.
- Samples are collected from women who have been diagnosed with ovarian cancer in whom the test is being used to determine their prognosis. Samples may be collected from women who had been diagnosed with ovarian cancer and received treatment to eliminate the cancer, or perhaps are in remission. In a preferred embodiment, the subjects are women who have been previously diagnosed as having ovarian cancer.
- the markers can be measured in different types of biological samples.
- the sample is preferably a biological fluid sample.
- a biological fluid sample useful in this invention include blood, blood serum, plasma, vaginal secretions, urine, ovarian cyst fluid, tears, saliva, etc. Because all of the markers are found in blood serum, blood serum is a preferred sample source for embodiments of the invention.
- sample preparation involves fractionation of the sample and collection of fractions determined to contain the biomarkers.
- Methods of pre- fractionation include, for example, size exclusion chromatography, ion exchange chromatography, heparin chromatography, affinity chromatography, sequential extraction, gel electrophoresis and liquid chromatography.
- the analytes also may be modified prior to detection. These methods are useful to simplify the sample for further analysis. For example, it can be useful to remove high abundance proteins, such as albumin, from blood before analysis. Examples of methods of fractionation are described in PCT/US03/00531 (incorporated herein in its entirety).
- the sample is pre-fractionated by anion exchange chromatography.
- the serum samples are fractionated via anion exchange chromatography.
- Signal suppression of lower abundance proteins by high abundance proteins presents a significant challenge to SELDI mass spectrometry.
- Fractionation of a sample reduces the complexity of the constituents of each fraction. This method can also be used to attempt to isolate high abundance proteins into a fraction, and thereby reduce its signal suppression effect on lower abundance proteins.
- Anion exchange fractionation separates proteins by their isoelectric point (pi).
- two-dimensional gel electrophoresis is used to generate two-dimensional array of spots of biomolecules, including one or more markers. See, e.g., Jungblut and Thiede, Mass Spectr. Rev. 16:145-162 (1997).
- the two-dimensional gel electrophoresis can be performed using methods known in the art. See, e.g., Deutscher ed., Methods In Enzymology vol. 182.
- biomolecules in a sample are separated by, e.g., isoelectric focusing, during which biomolecules in a sample are separated in a pH gradient until they reach a spot where their net charge is zero (i.e., isoelectric point).
- This first separation step results in one-dimensional array of biomolecules.
- the biomolecules in one-dimensional array is further separated using a technique generally distinct from that used in the first separation step.
- biomolecules separated by isoelectric focusing are further separated using a polyacrylamide gel, such as polyacrylamide gel electrophoresis in the presence of sodium dodecyl sulfate (SDS- PAGE).
- SDS-PAGE gel allows further separation based on molecular mass of biomolecules.
- two-dimensional gel electrophoresis can separate chemically different biomolecules in the molecular mass range from 1000-200,000 Da within complex mixtures. The pi range of these gels is about 3-10 (wide range gels).
- Biomolecules in the two-dimensional array can be detected using any suitable methods known in the art.
- biomolecules in a gel can be labeled or stained (e.g., Coomassie Blue or silver staining). If gel electrophoresis generates spots that correspond to the molecular weight of one or more markers of the invention, the spot can be further analyzed by gas phase ion spectrometry. For example, spots can be excised from the gel and analyzed by gas phase ion
- HPLC High performance liquid chromatography
- HPLC instruments typically consist of a reservoir of mobile phase, a pump, an injector, a separation column, and a detector. Biomolecules in a sample are separated by injecting an aliquot of the sample onto the column.
- a fraction that corresponds to the molecular weight and/or physical properties of one or more markers can be collected.
- the fraction can then be analyzed by gas phase ion spectrometry to detect markers.
- the spots can be analyzed using either MALDI or SELDI (e.g., using ProteinChip array) as described herein.
- a marker can be modified before analysis to improve its resolution or to determine its identity.
- the markers may be subject to proteolytic digestion before analysis. Any protease can be used. Proteases, such as trypsin, that are likely to cleave the markers into a discrete number of fragments are particularly useful. The fragments that result from digestion function as a fingerprint for the markers, thereby enabling their detection indirectly. This is particularly useful where there are markers with similar molecular masses that might be confused for the marker in question. Also, proteolytic fragmentation is useful for high molecular weight markers because smaller markers are more easily resolved by mass
- biomolecules can be modified to improve detection resolution.
- neuraminidase can be used to remove terminal sialic acid residues from glycoproteins to improve binding to an anionic adsorbent (e.g., cationic exchange ProteinChip arrays) and to improve detection resolution.
- the markers can be modified by the attachment of a tag of particular molecular weight that specifically bind to molecular markers, further distinguishing them.
- the identity of the markers can be further determined by matching the physical and chemical characteristics of the modified markers in a protein database (e.g., SwissProt).
- Biomarkers can be captured with capture reagents immobilized to a solid support, such as any biochip described herein, a multiwell microtiter plate or a resin.
- the biomarkers of this invention are preferably captured on SELDI protein biochips. Capture can be on a chromatographic surface or a biospecific surface. Any of the SELDI protein biochips comprising reactive surfaces can be used to capture and detect the biomarkers of this invention. However, the biomarkers of this invention bind well to immobilized metal chelates.
- the IMAC-3 and IMAC 30 biochips which nitriloacetic acid functionalities that adsorb transition metal ions, such as Cu ++ and Ni ++ , by chelation, are the preferred SELDI biochips for capturing the biomarkers of this invention.
- Any of the SELDI protein biochips comprising reactive surfaces can be used to capture and detect the biomarkers of this invention.
- These biochips can be derivatized with the antibodies that specifically capture the biomarkers, or they can be derivatized with capture reagents, such as protein A or protein G that bind immunoglobulins. Then the biomarkers can be captured in solution using specific antibodies and the captured markers isolated on chip through the capture reagent.
- a sample containing the biomarkers such as serum
- a suitable eluant such as phosphate buffered saline.
- phosphate buffered saline a suitable eluant
- markers can be detected and/or measured by a variety of detection methods including for example, gas phase ion spectrometry methods, optical methods, electrochemical methods, atomic force microscopy and radio frequency methods. Using these methods, one or more markers can be detected.
- SELDI refers to a method of desorption/ionization gas phase ion spectrometry (e.g., mass spectrometry) in which the analyte is captured on the surface of a SELDI probe that engages the probe interface.
- gas phase ion spectrometer is a mass spectrometer. SELDI technology is described in more detail above.
- an immunoassay can be used to detect and analyze markers in a sample. This method comprises: (a) providing an antibody that specifically binds to a marker; (b) contacting a sample with the antibody; and (c) detecting the presence of a complex of the antibody bound to the marker in the sample.
- An immunoassay is an assay that uses an antibody to specifically bind an antigen (e.g. , a marker).
- the immunoassay is characterized by the use of specific binding properties of a particular antibody to isolate, target, and/or quantify the antigen.
- the specified antibodies bind to a particular protein at least two times the background and do not substantially bind in a significant amount to other proteins present in the sample.
- Specific binding to an antibody under such conditions may require an antibody that is selected for its specificity for a particular protein.
- polyclonal antibodies raised to a marker from specific species such as rat, mouse, or human can be selected to obtain only those polyclonal antibodies that are specifically immunoreactive with that marker and not with other proteins, except for polymorphic variants and alleles of the marker. This selection may be achieved by subtracting out antibodies that cross-react with the marker molecules from other species.
- antibodies that specifically bind to a marker can be prepared using any suitable methods known in the art. See, e.g., Coligan, Current Protocols in Immunology (1991); Harlow & Lane, Antibodies: A Laboratory Manual (1988); Goding, Monoclonal Antibodies:
- Such techniques include, but are not limited to, antibody preparation by selection of antibodies from libraries of recombinant antibodies in phage or similar vectors, as well as preparation of polyclonal and monoclonal antibodies by immunizing rabbits or mice ⁇ see, e.g., Huse et ah, Science 246:1275-1281 (1989); Ward et ah, Nature 341:544-546 (1989)).
- a specific or selective reaction will be at least twice background signal or noise and more typically more than 10 to 100 times background.
- a sample obtained from a subject can be contacted with the antibody that specifically binds the marker.
- the antibody can be fixed to a solid support to facilitate washing and subsequent isolation of the complex, prior to contacting the antibody with a sample.
- solid supports include glass or plastic in the form of, e.g., a microtiter plate, a stick, a bead, or a microbead.
- Antibodies can also be attached to a probe substrate or ProteinChip ® array described above.
- the sample is preferably a biological fluid sample taken from a subject.
- biological fluid samples include blood, serum, plasma, nipple aspirate, urine, tears, saliva etc.
- the biological fluid comprises blood serum.
- the sample can be diluted with a suitable eluant before contacting the sample to the antibody.
- the mixture is washed and the antibody-marker complex formed can be detected.
- This detection reagent may be, e.g., a second antibody which is labeled with a detectable label.
- detectable labels include magnetic beads ⁇ e.g., DYNABEADSTM), fluorescent dyes, radiolabels, enzymes ⁇ e.g., horse radish peroxide, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic beads.
- the marker in the sample can be detected using an indirect assay, wherein, for example, a second, labeled antibody is used to detect bound marker- specific antibody, and/or in a competition or inhibition assay wherein, for example, a monoclonal antibody which binds to a distinct epitope of the marker is incubated simultaneously with the mixture.
- an indirect assay wherein, for example, a second, labeled antibody is used to detect bound marker- specific antibody, and/or in a competition or inhibition assay wherein, for example, a monoclonal antibody which binds to a distinct epitope of the marker is incubated simultaneously with the mixture.
- Methods for measuring the amount of, or presence of, antibody-marker complex include, for example, detection of fluorescence, luminescence,
- chemiluminescence absorbance, reflectance, transmittance, birefringence or refractive index (e.g., surface plasmon resonance, ellipsometry, a resonant mirror method, a grating coupler waveguide method or interferometry).
- Optical methods include microscopy (both confocal and non-confocal), imaging methods and non- imaging methods.
- Electrochemical methods include voltametry and amperometry methods.
- Radio frequency methods include multipolar resonance spectroscopy. Methods for performing these assays are readily known in the art.
- Useful assays include, for example, an enzyme immune assay (EIA) such as enzyme-linked immunosorbent assay (ELISA), a radioimmune assay (RIA), a Western blot assay, or a slot blot assay.
- EIA enzyme immune assay
- ELISA enzyme-linked immunosorbent assay
- RIA radioimmune assay
- Western blot assay or a slot blot assay.
- Immunoassays can be used to determine presence or absence of a marker in a sample as well as the quantity of a marker in a sample.
- the amount of an antibody- marker complex can be determined by comparing to a standard.
- a standard can be, e.g., a known compound or another protein known to be present in a sample.
- the test amount of marker need not be measured in absolute units, as long as the unit of measurement can be compared to a control.
- the methods for detecting these markers in a sample have many applications. For example, one or more markers can be measured to aid human cancer diagnosis or prognosis. In another example, the methods for detection of the markers can be used to monitor responses in a subject to cancer treatment. In another example, the methods for detecting markers can be used to assay for and to identify compounds that modulate expression of these markers in vivo or in vitro. In a preferred example, the biomarkers are used to differentiate between the different stages of tumor progression, thus aiding in determining appropriate treatment and extent of metastasis of the tumor.
- the software can comprise code that converts signal from the mass spectrometer into computer readable form.
- the software also can include code that applies an algorithm to the analysis of the signal to determine whether the signal represents a "peak" in the signal corresponding to a marker of this invention, or other useful markers.
- the software also can include code that executes an algorithm that compares signal from a test sample to a typical signal characteristic of "normal” and human cancer and determines the closeness of fit between the two signals.
- the software also can include code indicating which the test sample is closest to, thereby providing a probable diagnosis.
- multiple biomarkers are measured.
- the use of multiple biomarkers increases the predictive value of the test and provides greater utility in diagnosis, toxicology, patient stratification and patient monitoring.
- the process called "Pattern recognition" detects the patterns formed by multiple biomarkers greatly improves the sensitivity and specificity of clinical proteomics for predictive medicine.
- Subtle variations in data from clinical samples e.g., obtained using SELDI, indicate that certain patterns of protein expression can predict phenotypes such as the presence or absence of a certain disease, a particular stage of cancer progression, or a positive or adverse response to drug treatments.
- Data generation in mass spectrometry begins with the detection of ions by an ion detector as described above. Ions that strike the detector generate an electric potential that is digitized by a high speed time-array recording device that digitally captures the analog signal.
- Ciphergen's ProteinChip ® system employs an analog-to- digital converter (ADC) to accomplish this.
- ADC analog-to- digital converter
- the ADC integrates detector output at regularly spaced time intervals into time-dependent bins. The time intervals typically are one to four nanoseconds long. Furthermore, the time-of-flight spectrum
- TOF-to-M/Z transformation involves the application of an algorithm that transforms times-of-flight into mass-to-charge ratio (M/Z).
- M/Z mass-to-charge ratio
- the signals are converted from the time domain to the mass domain. That is, each time-of-flight is converted into mass-to-charge ratio, or M/Z.
- Calibration can be done internally or externally.
- the sample analyzed contains one or more analytes of known M/Z. Signal peaks at times-of-flight representing these massed analytes are assigned the known M/Z. Based on these assigned M/Z ratios, parameters are calculated for a mathematical function that converts times-of-flight to M/Z.
- a function that converts times-of-flight to M/Z such as one created by prior internal calibration, is applied to a time-of-flight spectrum without the use of internal calibrants.
- Baseline subtraction improves data quantification by eliminating artificial, reproducible instrument offsets that perturb the spectrum. It involves calculating a spectrum baseline using an algorithm that incorporates parameters such as peak width, and then subtracting the baseline from the mass spectrum.
- a typical smoothing function applies a moving average function to each time-dependent bin.
- the moving average filter is a variable width digital filter in which the bandwidth of the filter varies as a function of, e.g., peak bandwidth, generally becoming broader with increased time-of-flight. See, e.g., WO 00/70648, November 23, 2000 (Gavin et al., "Variable Width Digital Filter for Time-of-flight Mass Spectrometry").
- Peak selection can, of course, be done by eye.
- Peak data from one or more spectra can be subject to further analysis by, for example, creating a spreadsheet in which each row represents a particular mass spectrum, each column represents a peak in the spectra defined by mass, and each cell includes the intensity of the peak in that particular spectrum.
- Various statistical or pattern recognition approaches can applied to the data.
- Ciphergen' s Biomarker PatternsTM Software is used to detect a pattern in the spectra that are generated.
- the data is classified using a pattern recognition process that uses a classification model.
- the spectra will represent samples from at least two different groups for which a classification algorithm is sought.
- the groups can be pathological v. non-pathological (e.g., cancer v. non-cancer), drug responder v. drug non-responder, toxic response v. non-toxic response, progressor to disease state v. non-progressor to disease state, phenotypic condition present v. phenotypic condition absent.
- the spectra that are generated in embodiments of the invention can be classified using a pattern recognition process that uses a classification model.
- data derived from the spectra e.g. , mass spectra or time-of-flight spectra
- samples such as "known samples”
- a "known sample” is a sample that is pre-classified (e.g. , cancer or not cancer).
- Data derived from the spectra e.g., mass spectra or time- of-flight spectra
- a "known sample” is a sample that is pre- classified.
- the data that are derived from the spectra and are used to form the classification model can be referred to as a "training data set”.
- the classification model can recognize patterns in data derived from spectra generated using unknown samples.
- the classification model can then be used to classify the unknown samples into classes. This can be useful, for example, in predicting whether or not a particular biological sample is associated with a certain biological condition (e.g., diseased vs. non diseased).
- Classification models can be formed using any suitable statistical
- supervised classification training data containing examples of known categories are presented to a learning mechanism, which learns one more sets of relationships that define each of the known classes. New data may then be applied to the learning mechanism, which then classifies the new data using the learned relationships.
- supervised classification processes include linear regression processes (e.g., multiple linear regression (MLR), partial least squares (PLS) regression and principal components regression (PCR)), binary decision trees (e.g., recursive partitioning processes such as CART - classification and regression trees), artificial neural networks such as backpropagation networks, discriminant analyses (e.g., Bayesian classifier or Fischer analysis), logistic classifiers, and support vector classifiers (support vector machines).
- linear regression processes e.g., multiple linear regression (MLR), partial least squares (PLS) regression and principal components regression (PCR)
- binary decision trees e.g., recursive partitioning processes such as CART - classification and regression trees
- artificial neural networks such as backpropagation networks
- discriminant analyses e.g.
- a preferred supervised classification method is a recursive partitioning process.
- Recursive partitioning processes use recursive partitioning trees to classify spectra derived from unknown samples. Further details about recursive partitioning processes are provided in U.S. 2002 0138208 Al (Paulse et al., "Method for analyzing mass spectra," September 26, 2002.
- the peak intensity data of samples from cancer patients and healthy controls were used as a "discovery set.” This data were combined and randomly divided into a training set and a test set to construct and test multivariate predictive models.
- the generation of the classification, i.e., diagnostic, algorithm is dependent upon the assay protocol used to analyze samples and generate the data obtained in Section IV above. It is imperative that the protocol for the detection and/or measurement of the markers (e.g., in step IV) must be the same as that used to obtain the data used for developing the classification algorithm.
- the assay conditions which must be maintained throughout the training and classification systems include chip type and mass spectrometer parameters, as well as general protocols for sample preparation and testing. If the protocol for the detection and/or measurement of the markers (step IV) is changed, the learning algorithm and classification algorithm must also change. Similarly, if the learning algorithm and classification algorithm change, then the protocol for the detection and/or measurement of markers (step IV) must also change to be consistent with that used to generate classification algorithm.
- a serum sample is collected from a patient and then fractionated using an anion exchange resin as described above.
- the biomarkers in the sample are captured using an IMAC copper ProteinChip array.
- the markers can then be detected using SELDI.
- IMIH4 plasma Kallikrein- sensitive glycoprotein
- TFR transferrin
- B2M beta-2 microglobin
- the results are then entered into a computer system, which contains an algorithm that is designed using the same parameters that were used in the learning algorithm and classification algorithm to originally determine the biomarkers.
- the algorithm produces a diagnosis based upon the data received relating to each biomarker. For example, the algorithm can determine the chances of progression free survival (PFS) or overall survival (OS).
- PFS progression free survival
- OS overall survival
- the data from the sample may be fed directly from the detection means into a computer containing the diagnostic algorithm.
- the data obtained can be fed manually, or via an automated means, into a separate computer that contains the diagnostic algorithm.
- kits for qualifying ovarian cancer status e.g., for determining the prognosis of a subject
- the kits can be used to measure the markers of the present invention.
- the kits can be used to measure the panel of markers described herein, which are useful in
- kits can be prepared from the materials described above, and the previous discussion of these materials (e.g. , probe substrates, capture reagents, adsorbents, washing solutions, etc.) is fully applicable to this section and will not be repeated.
- OC Epithelial ovarian cancer
- DGCD Danish Gynecologic Cancer Database
- proteomic techniques will likely provide insights into a patient's prognosis. Since patients with gross similarities in their disease burden do not share the same prognosis, differences in the tumor microenvironment likely contribute to their disparate outcomes. To clarify this, proteomics may provide additional information about potential confounding variables.
- Serum CA125 was measured using a commercially available immuno assay, the CA125II assay (Kryptor reagents on the BRAHMS Kryptor, Immunodiagnostic systems, using the TRACE (Time Resolved Amplified Cryptate Emission) technology, based on non-radioactive transfer of energy.
- the proteomic index was then constructed as the linear combination of the selected variables using the estimated regression coefficients.
- the chosen model was assessed using cross validation techniques [18].
- the index values have been standardized by the mean value and standard deviation.
- Kaplan-Meier estimates of survival probabilities were calculated by grouping patients using the index tertiles as cutpoints. The equality of strata were tested using the log rank test.
- Multivariable Cox proportional hazard regression was done including the proteomic xb-pro index and adjusting for International Federation of Gynaecology and Obstetrics' (FIGO) stage (I, II, III and IV), residual tumor after primary surgery (yes/no), performance status (1, 2, 3, 4), age at diagnosis (linear), histological type of tumor (serous, mucinous, other types), serum CA125 levels and chemotherapy (yes/no).
- the results for each variable are presented by the hazard ratio (HR) and their 95% confidence intervals (95% CI).
- HR hazard ratio
- 95% CI 95% confidence intervals
- Example 2 Description of the seven markers: APOl, TT, HEPC, ITIH4, B2M, CTAP3 and TrF.
- the patients included in the study were slightly older (65 years, range: 30-87) than the median age for Danish patients diagnosed with OC (60 year) [1]. Similarly with respect to stage and histology this study may reflect the group of women all treated at a University Hospital.
- the median peak intensity was 6.97 for APOA1 (range: 4.65-8.20), 4.25 for TT (range: 1.66-5.69), 7.36 for HEPC (range: 6.64-10.28), 3.32 for ITIH4 (range: 3.32-8.32), 2.90 for B2M (range: 1.53- 5.56), 2.48 for CTAP3 (range: 0.97-4.10) and 1.15 for TrF (range: 0.32-2.21).
- the median serum CA125 level was 558.5 U/ml (range: 6-17275). Representative spectra from non-progressing OC patients and from progressing OC patients are shown in Figures 1A-1D.
- the type III tests show that the largest chi-square was the xb-pro index (18.49), chemotherapy (13.66), radicality after primary surgery (12.02), age at diagnosis (6.39), FIGO stage (4.96), histological type of tumor (4.23), performance status (3.02) and CA125 (0.56).
- the Cox survival analysis including the xb-pro index and the clinical covariates with independent prognostic value did not change the results.
- the other 5 serum proteomic markers were found of no value to predict progression-free survival.
- Cross validation suggested robust estimates of the linear predictor.
- Protein expression profiling using proteomics techniques can be used to discover novel modified forms of proteins and to determine which combinations of proteins are most specifically associated with clinical conditions such as patient predictive value and prognosis. Because of its high mortality, OC has received much attention from proteomics analysis [13-16]. It is hoped that proteomics will allow the development of personalized patient therapy and monitoring of disease. Numerous markers have proven useful in individual studies. However, few have proven useful when applied to other different populations. This is one factor in determining the clinical relevance of candidate biomarkers. ApoAl, TT, and TrF are some of the biomarkers that have been successfully reproduced in other studies [15, 19-21].
- the biomarker B2M has been found predictive in patients with OC [26] .
- B2M is included in the proteomic xb-pro index and therefore the effect of this index on progression-free survival was analysed.
- the optimal proteomic index (xb-pfs) was composed of two biomarkers, B2M and CTAP3, with the strongest effect from B2M. Therefore, these findings support the earlier observation of B2M as a predictive independent marker of OC.
- proteomic index xb-pro
- proteomic index xb-pfs
- the proteomic index had a very strong independent prognostic value for overall survival - even stronger than FIGO stage and B2M as reported earlier.
- the panel of three biomarkers provides surprisingly accurate predictive results of survival independent of the stage of the cancer.
- Example 2 Prognostic panels of biomarkers were analyzed for efficacy.
- APOAl_D and CTAP_D are 0.66, 0.56, 0.33 and 0.35 (for OS).
- the following table presents univariable analyses of these peaks for Progression Free Survival (PFS) and overall survival (OS).
- Example 3 A panel including B2M_B, Trf_PR and ITH4_D had prognostic value
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Hospice & Palliative Care (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Oncology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Microbiology (AREA)
- General Health & Medical Sciences (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Other Investigation Or Analysis Of Materials By Electrical Means (AREA)
- Peptides Or Proteins (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2011316844A AU2011316844A1 (en) | 2010-10-22 | 2011-10-21 | Prognostic biomarkers in patients with ovarian cancer |
CA2818593A CA2818593A1 (fr) | 2010-10-22 | 2011-10-21 | Biomarqueurs pronostiques chez des patientes atteintes d'un cancer ovarien |
EP11835211.1A EP2630498A4 (fr) | 2010-10-22 | 2011-10-21 | Biomarqueurs pronostiques chez des patientes atteintes d'un cancer ovarien |
JP2013535113A JP2013541716A (ja) | 2010-10-22 | 2011-10-21 | 卵巣癌の患者における予後予測バイオマーカー |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US40604410P | 2010-10-22 | 2010-10-22 | |
US61/406,044 | 2010-10-22 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2012054824A2 true WO2012054824A2 (fr) | 2012-04-26 |
WO2012054824A3 WO2012054824A3 (fr) | 2012-07-19 |
Family
ID=45975910
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2011/057271 WO2012054824A2 (fr) | 2010-10-22 | 2011-10-21 | Biomarqueurs pronostiques chez des patientes atteintes d'un cancer ovarien |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP2630498A4 (fr) |
JP (2) | JP2013541716A (fr) |
AU (1) | AU2011316844A1 (fr) |
CA (1) | CA2818593A1 (fr) |
WO (1) | WO2012054824A2 (fr) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2014182896A1 (fr) * | 2013-05-10 | 2014-11-13 | Johns Hopkins University | Compositions présentant une grande spécificité pour l'évaluation du cancer de l'ovaire |
US10324084B2 (en) | 2014-04-23 | 2019-06-18 | Nichirei Biosciences Inc. | Combination product for detecting target marker |
WO2019088709A3 (fr) * | 2017-10-31 | 2019-06-27 | 국립암센터 | Procédé de fourniture d'informations pour la prédiction d'un pronostic pour le cancer de l'ovaire utilisant le gène nc886 |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3435379A1 (fr) * | 2017-07-27 | 2019-01-30 | Roche Diagnostics GmbH | Augmentation des valeurs de mesure d'échantillons biologiques |
JP7272627B2 (ja) * | 2019-01-24 | 2023-05-12 | 公立大学法人和歌山県立医科大学 | 卵巣腫瘍の評価用バイオマーカー |
Family Cites Families (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101692090B (zh) * | 2002-08-06 | 2014-06-25 | 约翰霍普金斯大学 | 用于检测卵巢癌的生物标记的用途 |
EP2199801B1 (fr) * | 2004-07-14 | 2013-05-29 | The Regents of The University of California | Biomarqueurs pour la détection précoce du cancer des ovaires |
JP5069214B2 (ja) * | 2005-03-11 | 2012-11-07 | ヴァーミリオン インコーポレイテッド | 卵巣癌及び子宮内膜癌のバイオマーカー:ヘプシジン |
EP2993474B1 (fr) * | 2005-06-24 | 2019-06-12 | Vermillion, Inc. | Biomarqueurs pour le cancer de l'ovaire: la beta-2-microglobuline |
WO2008060376A2 (fr) * | 2006-10-04 | 2008-05-22 | The Johns Hopkins University | Algorithmes pour modèles multivariants pour combiner un panel de biomarqueurs afin d'évaluer le risque de développer un cancer ovarien |
WO2008048508A2 (fr) * | 2006-10-13 | 2008-04-24 | Vermillion, Inc. | Biomarqueurs pronostiques chez des patientes souffrant d'un cancer des ovaires |
EP2171453A4 (fr) * | 2007-06-29 | 2010-10-06 | Correlogic Systems Inc | Marqueurs predictifs du cancer des ovaires |
JP5391400B2 (ja) * | 2007-10-01 | 2014-01-15 | 公益財団法人ヒューマンサイエンス振興財団 | α−アクチニン−4遺伝子のコピー数または発現レベルを指標とした膵癌の検出を補助する方法および診断のためのキット |
WO2009058331A2 (fr) * | 2007-10-29 | 2009-05-07 | Vermilllion, Inc. | Biomarqueurs permettant la détection du cancer des ovaires à un stade précoce |
US8632984B2 (en) * | 2009-02-16 | 2014-01-21 | Atlas Antibodies Ab | RBM3 as a marker for malignant melanoma prognosis |
-
2011
- 2011-10-21 JP JP2013535113A patent/JP2013541716A/ja active Pending
- 2011-10-21 AU AU2011316844A patent/AU2011316844A1/en not_active Abandoned
- 2011-10-21 CA CA2818593A patent/CA2818593A1/fr not_active Abandoned
- 2011-10-21 EP EP11835211.1A patent/EP2630498A4/fr not_active Ceased
- 2011-10-21 WO PCT/US2011/057271 patent/WO2012054824A2/fr active Application Filing
-
2016
- 2016-08-04 JP JP2016153332A patent/JP2016212116A/ja active Pending
Non-Patent Citations (1)
Title |
---|
See references of EP2630498A4 * |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2014182896A1 (fr) * | 2013-05-10 | 2014-11-13 | Johns Hopkins University | Compositions présentant une grande spécificité pour l'évaluation du cancer de l'ovaire |
US10324084B2 (en) | 2014-04-23 | 2019-06-18 | Nichirei Biosciences Inc. | Combination product for detecting target marker |
US11156602B2 (en) | 2014-04-23 | 2021-10-26 | Nichirei Biosciences Inc. | Combination product for detecting target marker |
WO2019088709A3 (fr) * | 2017-10-31 | 2019-06-27 | 국립암센터 | Procédé de fourniture d'informations pour la prédiction d'un pronostic pour le cancer de l'ovaire utilisant le gène nc886 |
Also Published As
Publication number | Publication date |
---|---|
AU2011316844A1 (en) | 2013-06-06 |
JP2016212116A (ja) | 2016-12-15 |
CA2818593A1 (fr) | 2012-04-26 |
JP2013541716A (ja) | 2013-11-14 |
EP2630498A4 (fr) | 2014-10-01 |
WO2012054824A3 (fr) | 2012-07-19 |
EP2630498A2 (fr) | 2013-08-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR101107765B1 (ko) | 난소암의 검출을 위한 생물 마커의 용도 | |
US8682591B2 (en) | Biomarkers for ovarian cancer | |
US20210181207A1 (en) | Biomarkers for Ovarian Cancer: B2 Microglobulin | |
US20170089906A1 (en) | Biomarkers for ovarian cancer | |
US20100055690A1 (en) | Prognostic biomarkers in patients with ovarian cancer | |
US20090142332A1 (en) | Identification of Biomarkers by Serum Protein Profiling | |
US20140038837A1 (en) | Biomarkers for the detection of early stage ovarian cancer | |
JP2016212116A (ja) | 卵巣癌の患者における予後予測バイオマーカー | |
US20100068818A1 (en) | Algorithms for multivariant models to combine a panel of biomarkers for assessing the risk of developing ovarian cancer | |
WO2014182896A1 (fr) | Compositions présentant une grande spécificité pour l'évaluation du cancer de l'ovaire | |
US20150126384A1 (en) | Prognostic Biomarkers in Patients with Ovarian Cancer | |
WO2020036938A2 (fr) | Compositions pour l'évaluation du cancer de l'ovaire | |
WO2006071843A2 (fr) | Biomarqueurs destines au cancer du sein | |
US20150153348A1 (en) | BIOMARKERS FOR OVARIAN CANCER: Beta 2 MICROGLOBULIN |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11835211 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 2013535113 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2818593 Country of ref document: CA |
|
REEP | Request for entry into the european phase |
Ref document number: 2011835211 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2011835211 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2011316844 Country of ref document: AU Date of ref document: 20111021 Kind code of ref document: A |