WO2012035519A1 - Immunogenic compositions - Google Patents

Immunogenic compositions Download PDF

Info

Publication number
WO2012035519A1
WO2012035519A1 PCT/IB2011/054069 IB2011054069W WO2012035519A1 WO 2012035519 A1 WO2012035519 A1 WO 2012035519A1 IB 2011054069 W IB2011054069 W IB 2011054069W WO 2012035519 A1 WO2012035519 A1 WO 2012035519A1
Authority
WO
WIPO (PCT)
Prior art keywords
gbs
capsular saccharide
conjugate
immunogenic composition
iii
Prior art date
Application number
PCT/IB2011/054069
Other languages
French (fr)
Inventor
Francesco Berti
Mario Contorni
Paolo Costantino
Oretta Finco
Guido Grandi
Domenico Maione
John Telford
Original Assignee
Novartis Ag
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=43824889&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2012035519(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to JP2013528820A priority Critical patent/JP6093302B2/en
Priority to BR112013006396A priority patent/BR112013006396A2/en
Priority to US13/824,041 priority patent/US20130273091A1/en
Priority to RU2013117082A priority patent/RU2608905C2/en
Priority to AU2011303478A priority patent/AU2011303478B2/en
Priority to CA2811305A priority patent/CA2811305C/en
Priority to SG2013017850A priority patent/SG188499A1/en
Priority to CN201180054731.9A priority patent/CN103209708B/en
Priority to ES11768149.4T priority patent/ES2677358T3/en
Priority to MX2013002841A priority patent/MX349930B/en
Application filed by Novartis Ag filed Critical Novartis Ag
Priority to EP11768149.4A priority patent/EP2616099B1/en
Priority to KR1020137009242A priority patent/KR20130098362A/en
Publication of WO2012035519A1 publication Critical patent/WO2012035519A1/en
Priority to ZA2013/01908A priority patent/ZA201301908B/en
Priority to US14/662,429 priority patent/US20150283232A1/en
Priority to US15/705,873 priority patent/US20180036402A1/en

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/09Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/09Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
    • A61K39/092Streptococcus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/6415Toxins or lectins, e.g. clostridial toxins or Pseudomonas exotoxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/646Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6037Bacterial toxins, e.g. diphteria toxoid [DT], tetanus toxoid [TT]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/62Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
    • A61K2039/627Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker

Definitions

  • This invention is in the field of immunogenic compositions comprising conjugates of Streptococcus agalactiae capsular saccharides and carrier proteins.
  • the compositions are useful for immunisation.
  • the capsular saccharides of bacteria have been used for many years in vaccines against capsulated bacteria. As saccharides are T-independent antigens, however, they are poorly immunogenic. Conjugation to a carrier can convert T-independent antigens into T-dependent antigens, thereby enhancing memory responses and allowing protective immunity to develop.
  • the most effective saccharide vaccines are therefore based on glycoconjugates, and the prototype conjugate vaccine was against Haemophilus influenzae type b ('Hib') [e.g. see chapter 14 of ref. 84].
  • Streptococcus agalactiae also known as 'group B streptococcus', or simply as 'GBS'.
  • Much of this work has been performed by Dennis Kasper and colleagues, and is described in documents such as references 1 to 9.
  • Conjugate vaccines for each of GBS serotypes la, lb, II, III, and V have been shown to be safe and immunogenic in humans [10]. However, there remains a need for further and improved GBS conjugate vaccines.
  • the invention makes use of one or more conjugates that are capsular saccharides from GBS serotypes la, lb, III or V conjugated to a carrier protein.
  • the invention provides immunogenic compositions comprising one or more of these conjugates.
  • the compositions may be used as vaccines for preventing infection by these GBS serotype(s).
  • the invention provides a method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof.
  • the conjugate is one of the GBS conjugates in an immunogenic composition of the first aspect of the invention.
  • the invention provides an immunogenic composition comprising a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein.
  • the invention provides an immunogenic composition comprising a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein.
  • the invention provides an immunogenic composition comprising a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
  • the invention provides an immunogenic composition comprising a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
  • the immunogenic compositions may comprise more than one conjugate.
  • Embodiments of the invention comprising two, three or four conjugates are described below.
  • the inventors have found that compositions comprising a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein may confer protection against GBS serotype la in addition to GBS serotype lb. This observation is in contrast to the teaching of reference 1 1 , which suggests that type lb conjugates are not capable of inducing antibodies that can kill type la bacteria.
  • the embodiments described below that comprise a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein may be advantageous in that they provide enhanced protection against serotype la (when the composition also comprises a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein), and may even provide protection when the composition does not comprise a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein.
  • the immunogenic compositions may comprise two conjugates.
  • the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein
  • the second conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein.
  • the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein
  • the second conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
  • the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
  • the first conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
  • the first conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
  • the first conjugate is a capsular saccharide from GB S serotype III conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
  • the immunogenic compositions may comprise three conjugates.
  • the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein
  • the second conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein
  • the third conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
  • the inventors have found that such compositions (e.g. as exemplified below) are particularly suitable for use as vaccines to prevent infection by GBS. This embodiment is therefore a preferred embodiment of the invention.
  • the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein
  • the second conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein
  • the third conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein
  • the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein
  • the second conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein
  • the third conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
  • the first conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein
  • the second conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein
  • the third conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
  • the immunogenic compositions may comprise four conjugates.
  • the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein
  • the second conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein
  • the third conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein
  • the fourth conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
  • the immunogenic compositions described above will not comprise any conjugates other than those specifically mentioned, particularly conjugates comprising capsular saccharides from GBS serotypes other than those specifically mentioned.
  • the compositions may comprise other conjugates, including conjugates comprising capsular saccharides from other GBS serotypes.
  • the compositions may comprise a conjugate that is a capsular saccharide from GBS serotype II conjugated to a carrier protein.
  • the compositions may comprise a conjugate that is a capsular saccharide from GBS serotype VI conjugated to a carrier protein.
  • the compositions may comprise a conjugate that is a capsular saccharide from GBS serotype VIII conjugated to a carrier protein.
  • the immunogenic compositions described above may comprise any suitable amount of the capsular saccharide(s) per unit dose. Suitable amounts of the capsular saccharide(s) may be from 0.1 to 50 ⁇ g per unit dose. Typically, each GBS capsular saccharide is present at an amount from 1 to 30 ⁇ g, for example from 2 to 25 ⁇ g, and in particular from 5 to 20 ⁇ g. Suitable amounts of the capsular saccharide(s) may include 5, 10 and 20 ⁇ g per unit dose. The inventors have found that these amounts are suitable, particularly when the immunogenic composition comprises capsular saccharides from GBS serotypes la, lb and/or III.
  • Suitable amounts per unit dose of each capsular saccharide in the embodiments described above may therefore be selected from the numbered options in the following tables, wherein the relevant embodiment is indicated by reference to the serotype(s) from which the capsular saccharide(s) in the composition are derived: Table A - Immunogenic compositions comprising one conjugate
  • the inventors have found that options 1, 14 and 27 are effective, particularly when the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
  • These dosing options are therefore preferred for use in the invention, particularly for this embodiment. It may be advantageous to minimise the total amount of capsular saccharide(s) per unit dose in order to reduce potential toxicity. Accordingly, dosing option 1 is particularly preferred.
  • capsular saccharide(s) may be from 0.1 to 5 ⁇ g per unit dose.
  • suitable amounts of the capsular saccharide(s) may be from 0.1 to 5 ⁇ g per unit dose.
  • each GBS capsular saccharide may therefore be present at an amount from 0.1 to 5 ⁇ g, e.g. 0.5, 2.5 or 5 ⁇ g, per unit dose.
  • each GBS capsular saccharide may be present at an amount from 0.5 to 5 ⁇ g, 1 to 4 ⁇ g, 2 to 3 ⁇ g, or about 2.5 ⁇ g per unit dose.
  • the immunogenic composition comprises a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
  • Suitable amounts per unit dose of each capsular saccharide in this embodiment may therefore be selected from the numbered options in the table below:
  • the ratio of the mass of a given capsular saccharide to the mass of the other capsular saccharide(s) may vary. Suitable ratios (w/w) for each capsular saccharide in the embodiments described above may therefore be selected from the numbered options in the following tables, wherein the relevant embodiment is indicated by reference to the serotype(s) from which the capsular saccharide(s) in the composition are derived:
  • option 1 is effective, particularly when the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
  • This ratio option is therefore preferred for use in the invention, particularly for this embodiment.
  • the invention relates in part to immunogenic compositions comprising a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
  • the inventors have found that the immune response to the capsular saccharide from GBS serotype V in these compositions may be diminished if the immunogenic composition comprises one or more further antigen(s). Without wishing to be bound by theory, it is thought that the presence of the further antigen(s) results in "immune interference", with the response to the capsular saccharide from GBS serotype V being diminished.
  • the invention provides an immunogenic composition comprising: a) a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein; b) one or more antigens that do not comprise a capsular saccharide from GBS serotype V; and c) an adjuvant.
  • the antigen(s) of component b) may be conjugate(s) comprising capsular saccharide(s) from other GBS serotype(s).
  • these conjugate(s) may be capsular saccharide(s) from GBS serotype(s) la, lb and/or III conjugated to carrier protein(s).
  • this embodiment of the invention encompasses any of the immunogenic compositions described herein that comprise a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein and further comprise one or more conjugates that are capsular saccharides from GBS serotypes la, lb and/or III conjugated to carrier proteins, wherein the composition further comprises an adjuvant.
  • the antigen(s) of component b) may be other kind(s) of antigen, e.g. the antigens described under the headings "Combinations of conjugates and other antigens" and "GBS protein antigens” below.
  • this embodiment of the invention also encompasses any of the immunogenic compositions described herein that include a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein and one or more antigens that do not comprise conjugates comprising capsular saccharide(s) from other GBS serotype(s), wherein the composition further comprises an adjuvant.
  • the adjuvant in this embodiment of the invention may, for example, be an aluminium salt, as described below. The skilled person would be capable of identifying other adjuvants that may be used in these compositions.
  • the response to the capsular saccharide from GBS serotype V may be improved if the dose of this capsular saccharide is increased.
  • the immunogenic composition comprises a conjugate that is a capsular saccharide from a GBS serotype other than type V conjugated to a carrier protein, then the response to the type V capsular saccharide may be improved if the dose of the type V capsular saccharide is greater than the dose of the capsular saccharide from the other GBS serotype.
  • the present invention provides an immunogenic composition
  • an immunogenic composition comprising: a) a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein; b) one or more conjugates, each of which is a capsular saccharide from a GBS serotype other than type V conjugated to a carrier protein; wherein the dose of the type V capsular saccharide is greater than the total dose(s) of the capsulesular saccharide(s) from the other GBS serotype(s), or is greater than at least one of the doses or the mean dose of the capsular sacchardes from the other GBS serotypes.
  • the dose of the type V capsular saccharide may be 1.1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 times greater.
  • component b) comprises more than one conjugate, it is typical for the dose of the type V capsular saccharide to be greater than the mean dose of the capsular saccharides from the other GBS serotypes.
  • the conjugate(s) of component b) may be conjugates comprising capsular saccharides from any GBS serotype other than type V.
  • these conjugate(s) may be capsular saccharide(s) from GBS serotype(s) la, lb and/or III conjugated to carrier protein(s).
  • this embodiment of the invention encompasses any of the immunogenic compositions described herein that comprise a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein and further comprises one or more conjugates that are capsular saccharides from GBS serotypes la, lb and/or III conjugated to carrier proteins; wherein the dose of the type V capsular saccharide is greater than the total dose(s) of the capsulesular saccharide(s) from the other GBS serotype(s), or is greater than at least one of the doses or the mean dose of the capsular sacchardes from the other GBS serotypes .
  • the inventors have also found that the immune response to the capsular saccharides from the other GBS serotype(s) in these compositions may be diminished by the greater dose of the type V capsular saccharide. This consequence may be reduced if the composition comprises an adjuvant, as described above. Again, this observation is in contrast to the teaching of reference 12, which suggests that adjuvants may not improve the immune response to GBS conjugates.
  • the immunogenic compositions of the invention may be administered in single or multiple doses.
  • the inventors have found that the administration of a single dose of the immunogenic compositions of the invention is effective, particularly when the immunogenic composition comprises capsular saccharides from GBS serotypes la, lb and/or III; and more particularly when the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
  • Administration of a single dose is therefore preferred in the invention, particularly for these embodiments.
  • one unit dose followed by a second unit dose may be effective.
  • the second (or third, fourth, fifth etc.) unit dose is identical to the first unit dose.
  • the second unit dose may be administered at any suitable time after the first unit dose, in particular after 1 , 2 or 3 months.
  • the immunogenic composition comprises capsular saccharides from GBS serotypes la, lb and/or III
  • the second unit dose may be administered 3 months after the first unit dose.
  • the immunogenic composition comprises capsular saccharides from GBS serotypes V
  • the second unit dose may be administered 1 month after the first unit dose.
  • the immunogenic compositions of the invention will be administered intramuscularly, e.g. by intramuscular administration to the thigh or the upper arm as described below.
  • immunogenic compositions of the invention may include one or more adjuvants.
  • the inventors have found that the us e o f unadjuvanted compositions is effective, particularly when the immunogenic composition comprises capsular saccharides from GBS serotypes la, lb and/or III; and more particularly when the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GB S serotype III conjugated to a carrier protein.
  • immunogenic compositions that do not contain any adjuvant (especially that do not contain any aluminium salt adjuvant) are preferred for use in the invention, particularly for these embodiments.
  • the capsular saccharide especially that do not contain any aluminium salt adjuvant.
  • the invention is based on the capsular saccharide of Streptococcus agalactiae.
  • the capsular saccharide is covalently linked to the peptidoglycan backbone of GBS, and is distinct from the group B antigen, which is another saccharide that is attached to the peptidoglycan backbone.
  • GBS capsular saccharides are chemically related, but are antigenically very different. All GBS capsular psaccharides share the following trisaccharide core:
  • the various GBS serotypes differ by the way in which this core is modified.
  • the difference between serotypes la and III arises from the use of either the GlcNAc (la) or the Gal (III) in this core for linking consecutive trisaccharide cores ( Figure 1).
  • Serotypes la and lb both have a [a-D-Neu/?NAc(2 ⁇ 3)P-D-Gal/ (l ⁇ ] disaccharide linked to the GlcNAc in the core, but the linkage is either 1 ⁇ 4 (la) or 1 ⁇ 3 (lb).
  • GBS-related disease arises primarily from serotypes la, lb, II, III, IV, V, VI, VII, and VIII, with over 85% being caused by five serotypes: la, lb, III & V.
  • the invention preferably uses a saccharide from one or more of these four serotypes, particularly from one or more of serotypes: la, lb & III.
  • the capsular saccharides of each of these four serotypes include: (a) a terminal N- acetyl-neuraminic acid (NeuNAc) residue (commonly referred to as sialic acid), which in all cases is linked 2 ⁇ 3 to a galactose residue; and (b) a N-acetyl-glucosamine residue (GlcNAc) within the trisaccharide core.
  • NeuroNAc N- acetyl-neuraminic acid
  • sialic acid commonly referred to as sialic acid
  • GlcNAc N-acetyl-glucosamine residue
  • All four saccharides include galactose residues within the trisaccharide core, but serotypes la, lb, II & III also contain additional galactose residues in each repeating unit.
  • Saccharides used according to the invention may be in their native form, or may have been modified.
  • the saccharide may be shorter than the native capsular saccharide, or may be chemically modified.
  • the serotype V capsular saccharide used in the invention may be modified as described in refs. 13 and 14.
  • a serotype V capsular saccharide that has been substantially desialylated ( Figure 3) as described in refs. 13 and 14 is specifically envisaged for use in the present invention.
  • Desialylated GBS serotype V capsular saccharide may be prepared by treating purified GBS serotype V capsular saccharide under mildly acidic conditions (e.g.
  • a preferred method for preparaing desialylated GBS serotype V capsular saccharide is by treating the purified saccharide with 1M acetic acid at 81°C +/-3C° for 2h.
  • the saccharide used according to the invention may be a substantially full-length capsular polysaccharide, as found in nature, or it may be shorter than the natural length. Full-length polysaccharides may be depolymerised to give shorter fragments for use with the invention e.g. by hydrolysis in mild acid, by heating, by sizing chromatography, etc.
  • the serotype II and/or III capsular saccharides used in the invention may be depolymerised as described in refs. 15 and 16. These documents describe the partial depolymerization of type II and type III capsular saccharides by mild deaminative cleavage to antigenic fragments with reducing-terminal 2,5-anhydro-D-mannose residues. Briefly, the capsular saccharide is dissolved in 0.5 N NaOH and heated at 70°C for between about l-4h. The length of this incubation controls the degree of depolymerisation, which may be determined by standard methods (e.g. by HPLC as described in reference 15).
  • the sample is chilled in an ice-water bath before glacial acetic acid is added to bring the pH to 4.
  • the partially N-deacylated product is then deaminated by the addition of 5% (wt/vol) NaNC>2 with stirring at 4°C for 2h.
  • the free aldehydes of the newly formed 2,5-anhydro-D-mannose residues may be used for conjugation to a carrier protein, as described below.
  • a serotype la saccharide with MW about 200 kDa or about 260 kDa is used.
  • serotype lb it is preferred to use polysaccharides with a MW in the range of 150-300kDa, particularly 175-250 kDa.
  • a serotype lb saccharide with MW about 200 kDa or about 230 kDa is used.
  • serotype III it is preferred to use polysaccharides with a MW in the range of 50-200kDa, particularly 80-150kDa.
  • a serotype III saccharide with MW about 100 kDa or about 140kDa is used.
  • serotype V it is also preferred to use polysaccharides with a MW up to ⁇ 50kDa. Typically, a serotype V saccharide with MW about 100 kDa is used. These molecular masses can be measured by gel filtration relative to dextran standards, such as those available from Polymer Standard Service [18].
  • the saccharide may be chemically modified relative to the capsular saccharide as found in nature.
  • the saccharide may be de-O-acetylated (partially or fully), de-N-acetylated (partially or fully), N-propionated (partially or fully), etc.
  • De-acetylation may occur before, during or after conjugation, but preferably occurs before conjugation.
  • de-acetylation may or may not affect immunogenicity.
  • O-acetylation on GBS saccharides in various serotypes is discussed in reference 19, and in some embodiments O-acetylation of sialic acid residues at positions 7, 8 and/or 9 is retained before, during and after conjugation e.g.
  • the GBS saccharide used in the present invention has substantially no O-acetylation of sialic acid residues at positions 7, 8 and/or 9.
  • O-acetylation is typically lost (ref. 19). The effect of de-acetylation etc. can be assessed by routine assays.
  • Capsular saccharides can be purified by known techniques, as described in the references herein such as refs. 2 and 20.
  • a typical process involves base extraction, centrifugation, filtration, RNase/DNase treatment, protease treatment, concentration, size exclusion chromatography, ultrafiltration, anion exchange chromatography, and further ultrafiltration.
  • Treatment of GBS cells with the enzyme mutanolysin, which cleaves the bacterial cell wall to free the cell wall components, is also useful.
  • the purification process described in reference 21 can be used. This involves base extraction, ethanol/CaCi 2 treatment, CTAB precipitation, and re-solubilisation. A further alternative process is described in reference 22.
  • the invention is not limited to saccharides purified from natural sources, however, and the saccharides may be obtained by other methods, such as total or partial synthesis.
  • the invention involves conjugates that are capsular saccharides from GBS serotypes la, lb, III or V conjugated to a carrier protein
  • covalent conjugation of saccharides to carriers enhances the immunogenicity of saccharides as it converts them from T-independent antigens to T-dependent antigens, thus allowing priming for immunological memory.
  • Conjugation is particularly useful for paediatric vaccines [e.g. ref. 23] and is a well known technique [e.g. reviewed in refs. 24 to 32].
  • the processes of the invention may include the further step of conjugating the purified saccharide to a carrier molecule.
  • GBS saccharides Conjugation of GBS saccharides has been widely reported e.g. see references 1 to 9.
  • the typical prior art process for GBS saccharide conjugation typically involves reductive amination of a purified saccharide to a carrier protein such as tetanus toxoid (TT) or CRM 197 [2].
  • the reductive amination involves an amine group on the side chain of an amino acid in the carrier and an aldehyde group in the saccharide.
  • GBS capsular saccharides do not include an aldehyde group in their natural form then this is typically generated before conjugation by oxidation (e.g. periodate oxidation) of a portion (e.g.
  • Conjugate vaccines prepared in this manner have been shown to be safe and immunogenic in humans for each of GB S serotypes la, lb, II, III, and V [10]. Typically, all of the conjugates in the immunogenic compositions of the present invention have been prepared in this manner. However, when the invention uses a serotype V capsular saccharide that is desialylated, then an aldehyde group may be generated in this saccharide before conjugation by oxidation (e.g. periodate oxidation) of a portion (e.g.
  • the free aldehydes groups of terminal 2,5-anhydro-D-mannose residues from depolymerization of type II or type III capsular saccharides by mild deaminative cleavage are used for conjugation by reductive amination.
  • one or more of the conjugates in the immunogenic compositions of the present invention have been prepared in this manner.
  • the invention involves the use of carrier molecules, which are typically proteins.
  • Useful carrier proteins include bacterial toxins or toxoids, such as diphtheria toxoid or tetanus toxoid. Fragments of toxins or toxoids can also be used e.g. fragment C of tetanus toxoid [35].
  • the CRM197 mutant of diphtheria toxin [36-38] is a particularly useful with the invention.
  • suitable carrier proteins include the N. meningitidis outer membrane protein [39], synthetic peptides [40,41], heat shock proteins [42,43], pertussis proteins [44,45], cytokines [46], lymphokines [46], hormones [46], growth factors [46], human serum albumin (preferably recombinant), artificial proteins comprising multiple human CD4 + T cell epitopes from various pathogen-derived antigens [47] such as N19 [48], protein D from H.influenzae [49,50], pneumococcal surface protein PspA [51], pneumolysin [52], iron- uptake proteins [53], toxin A or B from C.difficile [54], recombinant Pseudomonas aeruginosa exoprotein A (rEPA) [55], a GBS protein (see below; particularly GBS67) [206], etc
  • Attachment to the carrier is preferably via a -NH 2 group e.g. in the side chain of a lysine residue in a carrier protein, or of an arginine residue, or at the N-terminus. Attachment may also be via a -SH group e.g. in the side chain of a cysteine residue.
  • carrier protein e.g. to reduce the risk of carrier suppression.
  • different carrier proteins can be used for different GBS serotypes e.g. serotype la saccharides might be conjugated to CRM 197 while serotype lb saccharides might be conjugated to tetanus toxoid.
  • more than one carrier protein for a particular saccharide antigen e.g. serotype III saccharides might be in two groups, with some conjugated to CRM 197 and others conjugated to tetanus toxoid. In general, however, it is preferred to use the same carrier protein for all saccharides.
  • a single carrier protein might carry more than one saccharide antigen [56,57].
  • a single carrier protein might have conjugated to it saccharides from serotypes la and lb.
  • different saccharides can be mixed prior to the conjugation reaction.
  • the separate conjugates may be based on the same carrier.
  • Conjugates with a saccharide :protein ratio (w/w) of between 1 :5 ⁇ i.e. excess protein) and 5:1 ⁇ i.e. excess saccharide) are typically used, in particular ratios between 1 :5 and 2: 1.
  • the saccharide:protein ratio (w/w) is typically between about 1 : 1 to 1 :2, particularly about 1 : 1.3.
  • the ratio is typically between about 1 : 1 to 1 :2, particularly about 1 : 1.3.
  • the saccharide:protein ratio (w/w) is typically between about 3: 1 to 1 : 1 , particularly about 2: 1.
  • GBS serotype III conjugated to a carrier protein with a saccharide:protein ratio (w/w) of about 1 : 1 to 1 :5, particularly about 1 :3.3, may also be used.
  • the ratio is typically between about 2: 1 to 1 : 1, particularly about 1.1 : 1.
  • a weight excess of saccharide is typical, particularly with longer saccharide chains.
  • compositions may include a small amount of free carrier [58].
  • the unconjugated form is preferably no more than 5% of the total amount of the carrier protein in the composition as a whole, and more preferably present at less than 2% by weight.
  • composition of the invention includes a depolymerised oligosaccharide, it is preferred that depolymerisation precedes conjugation.
  • the immunogenic compositions of the invention may comprise one or more further antigens.
  • the further antigen(s) may comprise further GBS conjugates.
  • the different GBS conjugates may include different types of conjugate from the same GBS serotype and/or conjugates from different GBS serotypes.
  • the composition will typically be produced by preparing separate conjugates (e.g. a different conjugate for each serotype) and then combining the conjugates.
  • the further antigen(s) may comprise GBS amino acid sequences, as set out below.
  • compositions of the invention may further comprise one or more non-GBS antigens, including additional bacterial, viral or parasitic antigens. These may be selected from the following:
  • N. meningitidis serogroup B such as those in refs. 62 to 68, with protein '287' (see below) and derivatives (e.g. 'AG287') being particularly preferred.
  • OMV outer-membrane vesicle
  • a saccharide antigen from N. meningitidis serogroup A, C, W135 and/or Y such as the oligosaccharide disclosed in ref. 73 from serogroup C or the oligosaccharides of ref. 74.
  • an antigen from hepatitis A virus such as inactivated virus [e.g. 78, 79; chapter 15 of ref. 84].
  • an antigen from hepatitis B virus such as the surface and/or core antigens [e.g. 79,80; chpater 16 of ref. 84].
  • an antigen from hepatitis C virus [e.g. 81].
  • an antigen from Bordetella pertussis such as pertussis holotoxin (PT) and filamentous haemagglutinin (FHA) from B. pertussis, optionally also in combination with pertactin and/or agglutinogens 2 and 3 [e.g. refs. 82 & 83; chapter 21 of ref. 84].
  • diphtheria antigen such as a diphtheria toxoid [e.g. chapter 13 of ref. 84].
  • tetanus antigen such as a tetanus toxoid [e.g. chapter 27 of ref. 84].
  • N .gonorrhoeae an antigen from N .gonorrhoeae [e.g. 62, 63, 64].
  • an antigen from Chlamydia pneumoniae e.g. 85, 86, 87, 88, 89, 90, 91].
  • rabies antigen(s) e.g. 96
  • lyophilised inactivated virus e.g.97, RabAvertTM
  • influenza antigen(s) e.g. chapters 17 & 18 of ref. 84
  • haemagglutinin and/or neuraminidase surface proteins such as the haemagglutinin and/or neuraminidase surface proteins.
  • Streptococcus pyogenes group A streptococcus [e.g. 99, 100, 101].
  • a saccharide or carbohydrate antigen is used, it is preferably conjugated to a carrier in order to enhance immunogenicity. Conjugation of H.influenzae B, meningococcal and pneumococcal saccharide antigens is well known.
  • Toxic protein antigens may be detoxified where necessary (e.g. detoxification of pertussis toxin by chemical and/or genetic means [83]).
  • diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens. Similarly, where a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens. Similarly, where a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.
  • Antigens may be adsorbed to an aluminium salt. Where there is more than one conjugate in a composition, not all conjugates need to be adsorbed.
  • One type of preferred composition includes further antigens from sexually-transmitted pathogens, such as: herpesvirus; N. gonorrhoeae; C. trachomatis; etc.
  • Another type of preferred composition includes further antigens that affect the elderly and/or the immunocompromised, and so the GBS antigens of the invention can be combined with one or more antigens from the following non-GBS pathogens: influenza virus, Enterococcus faecalis, Staphylococcus aureus, Staphylococcus epidermis, Pseudomonas aeruginosa, Legionella pneumophila, Listeria monocytogenes, Neisseria meningitidis, and parainfluenza virus.
  • Antigens in the composition will typically be present at a concentration of at least ⁇ g/ml each. In general, the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.
  • nucleic acid encoding the antigen may be used [e.g. refs. 103 to 111]. Protein components of the compositions of the invention may thus be replaced by nucleic acid (preferably DNA e.g. in the form of a plasmid) that encodes the protein.
  • the number of antigens included in compositions of the invention may be less than 20, less than 19, less than 18, less than 17, less than 16, less than 15, less than 14, less than 13, less than 12, less than 11 , less than 10, less than 9, less than 8, less than 7, less than 6, less than 5, less than 4, less than 3, or less than 2.
  • the number of GBS antigens in a composition of the invention may be less than 6, less than 5, less than 4, less than 3, or less than 2.
  • the immunogenic compositions of the invention may further comprise a pharmaceutically acceptable carrier.
  • Typical 'pharmaceutically acceptable carriers' include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition.
  • Suitable carriers are typically large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose [112], trehalose [113], lactose, and lipid aggregates (such as oil droplets or liposomes).
  • Such carriers are well known to those of ordinary skill in the art.
  • the vaccines may also contain diluents, such as water, saline, glycerol, etc.
  • auxiliary substances such as wetting or emulsifying agents, pH buffering substances, and the like, may be present.
  • Sterile pyrogen- free, phosphate-buffered physiologic saline is a typical carrier. A thorough discussion of pharmaceutically acceptable excipients is available in reference 114.
  • compositions of the invention may be in aqueous form ⁇ i.e. solutions or suspensions) or in a dried form ⁇ e.g. lyophilised). If a dried vaccine is used then it will be reconstituted into a liquid medium prior to injection. Lyophilisation of conjugate vaccines is known in the art e.g. the MenjugateTM product is presented in lyophilised form.
  • the immunogenic compositions of the invention include conjugates comprising capsular saccharides from more than one GBS serotypes, it is typical for the conjugates to be prepared separately, mixed and then lyophilised. In this way, lyophilised compositions comprising two, three or four etc. conjugates as described herein may be prepared.
  • a sugar alcohol ⁇ e.g. mannitol
  • a disaccharide ⁇ e.g. sucrose or trehalose
  • sucrose has been recommended as a stabiliser for GBS conjugate vaccines (ref. 115).
  • the stabiliser of the present invention it is typical for the stabiliser of the present invention to be mannitol.
  • the concentration of residual mannitol will typically be about 2-20mg/ml, e.g.
  • mannitol is advantageous because mannitol is chemically distinct from the monosaccharide subunits of the GBS capsular saccharides. This means that detection of the capsular saccharides, e.g. for quality control analysis, can be based on the presence of the subunits of the saccharides without intereference from the mannitol. In contrast, a stabiliser like sucrose contains glucose, which may interfere with the detection of glucose subunits in the saccharides.
  • compositions may be presented in vials, or they may be presented in ready-filled syringes.
  • the syringes may be supplied with or without needles.
  • a syringe will include a single dose of the composition, whereas a vial may include a single dose or multiple doses.
  • compositions of the invention are also suitable for reconstituting other vaccines from a lyophilised form.
  • the invention provides a kit, which may comprise two vials, or may comprise one ready- filled syringe and one vial, with the contents of the syringe being used to reactivate the contents of the vial prior to injection.
  • compositions of the invention may be packaged in unit dose form or in multiple dose form.
  • vials are preferred to pre-filled syringes.
  • Effective dosage volumes can be routinely established, but a typical human dose of the composition has a volume of 0.5ml e.g. for for intramuscular injection.
  • the pH of the composition is preferably between 6 and 8, preferably about 7. Stable pH may be maintained by the use of a buffer.
  • the immunogenic compositions of the invention typically comprise a potassium dihydrogen phosphate buffer.
  • the potassium dihydrogen phosphate buffer may comprise about 1-10 mM potassium dihydrogen phosphate, e.g. 1.25 mM, 2.5 mM or 5.0 mM. If a composition comprises an aluminium hydroxide salt, it is preferred to use a histidine buffer [116].
  • the composition may be sterile and/or pyrogen- free.
  • Compositions of the invention may be isotonic with respect to humans.
  • compositions of the invention are immunogenic, and are more preferably vaccine compositions.
  • Vaccines according to the invention may either be prophylactic ⁇ i.e. to prevent infection) or therapeutic ⁇ i.e. to treat infection), but will typically be prophylactic.
  • Immunogenic compositions used as vaccines comprise an immunologically effective amount of antigen(s), as well as any other components, as needed.
  • 'immunologically effective amount' it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated ⁇ e.g.
  • non-human primate, primate, etc. the capacity of the individual's immune system to synthesise antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
  • the quantity of an individual saccharide antigen will generally be between 0.1- 50 ⁇ g (measured as mass of saccharide), particularly between 1-50 ⁇ g or 0.5-25 ⁇ g, more particularly 2.5-7 ⁇ g, e.g. about ⁇ g, about 2 ⁇ g, about 5 ⁇ g, about 10 ⁇ g, about 15 ⁇ g, about 20 ⁇ g or about 25 ⁇ g.
  • the total quantity of GBS capsular saccharides will generally be ⁇ 70 ⁇ g (measured as mass of saccharide), e.g. ⁇ 60 ⁇ g. In particular, the total quantity may be ⁇ 40 ⁇ g (e.g. ⁇ 30 ⁇ g) or ⁇ 20 ⁇ g (e.g. ⁇ 15 ⁇ g).
  • the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
  • These total quantities are therefore preferred for use in the invention, particularly for this embodiment. It may be advantageous to minimise the total quantity of capsular saccharide(s) per unit dose in order to reduce potential toxicity. Accordingly, a total quantity of ⁇ 20 ⁇ g is preferred, e.g. ⁇ 15 ⁇ g, ⁇ 7.5 ⁇ g or ⁇ 1.5 ⁇ g.
  • compositions of the invention may be prepared in various forms.
  • the compositions may be prepared as injectables, either as liquid solutions or suspensions.
  • the composition may be prepared for pulmonary administration e.g. as an inhaler, using a fine powder or a spray.
  • the composition may be prepared as a suppository or pessary.
  • the composition may be prepared for nasal, aural or ocular administration e.g. as spray, drops, gel or powder [e.g. refs 117 & 118].
  • Success with nasal administration of pneumococcal saccharides [119,120], Hib saccharides [121], MenC saccharides [122], and mixtures of Hib and MenC saccharide conjugates [123] has been reported.
  • compositions of the invention may include an antimicrobial, particularly when packaged in multiple dose format.
  • compositions of the invention may comprise detergent e.g. a Tween (polysorbate), such as Tween 80.
  • Detergents are generally present at low levels e.g. ⁇ 0.01%.
  • compositions of the invention may include sodium salts (e.g. sodium chloride) to give tonicity.
  • a concentration of 10+2mg/ml NaCl is typical.
  • a concentration of 4-10mg/ml NaCl may be used, e.g. 9.0, 7.0, 6.75 or 4.5 mg/ml.
  • compositions of the invention will generally include a buffer.
  • a phosphate buffer is typical.
  • compositions of the invention may be administered in conjunction with other immunoregulatory agents.
  • compositions may include one or more adjuvants.
  • adjuvants include, but are not limited to: A. Mineral-containing compositions
  • Mineral containing compositions suitable for use as adjuvants in the invention include mineral salts, such as aluminium salts and calcium salts (or mixtures thereof).
  • Calcium salts include calcium phosphate (e.g. the "CAP" particles disclosed in ref. 124).
  • Aluminum salts include hydroxides, phosphates, sulfates, etc. , with the salts taking any suitable form (e.g. gel, crystalline, amorphous, etc.). Adsorption to these salts is preferred.
  • the mineral containing compositions may also be formulated as a particle of metal salt [ 125].
  • the adjuvants known as aluminum hydroxide and aluminum phosphate may be used. These names are conventional, but are used for convenience only, as neither is a precise description of the actual chemical compound which is present (e.g. see chapter 9 of reference 126).
  • the invention can use any of the "hydroxide” or "phosphate” adjuvants that are in general use as adjuvants.
  • the adjuvants known as "aluminium hydroxide” are typically aluminium oxyhydroxide salts, which are usually at least partially crystalline.
  • the adjuvants known as "aluminium phosphate” are typically aluminium hydroxypho sphates , o ften also containing a small amount o f sulfate (i.e. aluminium hydroxyphosphate sulfate). They may be obtained by precipitation, and the reaction conditions and concentrations during precipitation influence the degree of substitution of phosphate for hydroxyl in the salt.
  • a fibrous morphology (e.g. as seen in transmission electron micrographs) is typical for aluminium hydroxide adjuvants.
  • the pi of aluminium hydroxide adjuvants is typically about 1 1 i. e. the adjuvant itself has a positive surface charge at physiological pH.
  • Adsorptive capacities of between 1.8-2.6 mg protein per mg Al +++ at pH 7.4 have been reported for aluminium hydroxide adjuvants.
  • Aluminium phosphate adjuvants generally have a PO 4 /AI molar ratio between 0.3 and 1.2, preferably between 0.8 and 1.2, and more preferably 0.95+0.1.
  • the aluminium phosphate will generally be amorphous, particularly for hydroxyphosphate salts.
  • a typical adjuvant is amorphous aluminium hydroxyphosphate with PO 4 /AI molar ratio between 0.84 and 0.92, included at 0.6mg Al 3+ /ml.
  • the aluminium phosphate will generally be particulate (e.g. plate-like morphology as seen in transmission electron micrographs). Typical diameters of the particles are in the range 0.5-20 ⁇ (e.g. about 5-10 ⁇ ) after any antigen adsorption.
  • Adsorptive capacities of between 0.7-1.5 mg protein per mg Al +++ at pH 7.4 have been reported for aluminium phosphate adjuvants.
  • a suspension may include free aqueous phosphate ions e.g. present at a concentration between 1.0 and 20 mM, preferably between 5 and 15 mM, and more preferably about 10 mM.
  • the suspensions may also comprise sodium chloride.
  • the invention can use a mixture of both an aluminium hydroxide and an aluminium phosphate.
  • there may be more aluminium phosphate than hydroxide e.g. a weight ratio of at least 2: 1 e.g. >5:l, >6: l, >7:l, >8:l, >9:l, efc.
  • the concentration of Al +++ in a composition for administration to a patient is preferably less than lOmg/ml e.g. ⁇ 5 mg/ml, ⁇ 4 mg/ml, ⁇ 3 mg/ml, ⁇ 2 mg/ml, ⁇ 1 mg/ml, etc.
  • a preferred range is between 0.3 and lmg/ml.
  • a maximum of 0.85mg/dose is preferred.
  • a typical adjuvant aluminium phosphate adjuvant is amorphous aluminium hydroxyphosphate with PO 4 /AI molar ratio between 0.84 and 0.92, included at 0.6mg Al 3+ /ml. Adsorption with a low dose of aluminium phosphate may be used e.g. between 50 and 100 ⁇ g Al 3+ per conjugate per dose.
  • Oil emulsion compositions suitable for use as adjuvants in the invention include squalene-water emulsions, such as MF59 (5% Squalene, 0.5% Tween 80, and 0.5% Span 85, formulated into submicron particles using a microfluidizer) [Chapter 10 of ref. 126; see also refs. 127-129]. MF59 is used as the adjuvant in the FLU ADTM influenza virus trivalent subunit vaccine.
  • Particularly preferred adjuvants for use in the compositions are submicron oil-in-water emulsions.
  • Preferred submicron oil-in-water emulsions for use herein are squalene/water emulsions optionally containing varying amounts of MTP-PE, such as a submicron oil-in-water emulsion containing 4-5%) w/v squalene, 0.25-1.0%) w/v Tween 80 (polyoxyelthylenesorbitan monooleate), and/or 0.25-1.0%) Span 85 (sorbitan trioleate), and, optionally, N-acetylmuramyl-L-alanyl-D-isogluatminyl-L-alanine- 2-(l'-2'-dipalmitoyl-sn-glycero-3-hydroxyphosphophoryloxy)-ethylamine (MTP-PE).
  • MTP-PE N-acetylmuramyl-L-al
  • CFA Complete Freund's adjuvant
  • IF A incomplete Freund's adjuvant
  • Saponin formulations may also be used as adjuvants in the invention.
  • Saponins are a heterologous group of sterol glycosides and triterpenoid glycosides that are found in the bark, leaves, stems, roots and even flowers of a wide range of plant species. Saponins isolated from the bark of the Quillaia saponaria Molina tree have been widely studied as adjuvants. Saponin can also be commercially obtained from Smilax ornata (sarsaprilla), Gypsophilla paniculata (brides veil), and Saponaria officianalis (soap root).
  • Saponin adjuvant formulations include purified formulations, such as QS21 , as well as lipid formulations, such as ISCOMs.
  • Saponin compositions have been purified using HPLC and RP-HPLC. Specific purified fractions using these techniques have been identified, including QS7, QS17, QS18, QS21 , QH-A, QH-B and QH-C.
  • the saponin is QS21.
  • a method of production of QS21 is disclosed in ref. 132.
  • Saponin formulations may also comprise a sterol, such as cholesterol [133].
  • ISCOMs immunostimulating complexs
  • the ISCOM typically also include a phospholipid such as phosphatidylethanolamine or phosphatidylcholine. Any known saponin can be used in ISCOMs.
  • the ISCOM includes one or more of QuilA, QHA and QHC. ISCOMs are further described in refs. 133-135.
  • the ISCOMS may be devoid of additional detergent(s) [136].
  • Virosomes and virus-like particles can also be used as adjuvants in the invention.
  • These structures generally contain one or more proteins from a virus optionally combined or formulated with a phospholipid. They are generally non-pathogenic, non-replicating and generally do not contain any of the native viral genome.
  • the viral proteins may be recombinantly produced or isolated from whole viruses.
  • viral proteins suitable for use in virosomes or VLPs include proteins derived from influenza virus (such as HA or NA), Hepatitis B virus (such as core or capsid proteins), Hepatitis E virus, measles virus, Sindbis virus, Rotavirus, Foot-and-Mouth Disease virus, Retrovirus, Norwalk virus, human Papilloma virus, HIV, RNA-phages, QB-phage (such as coat proteins), GA- phage, fr-phage, AP205 phage, and Ty (such as retrotransposon Ty protein pi).
  • VLPs are discussed further in refs. 139-144.
  • Virosomes are discussed further in, for example, ref. 145 E. Bacterial or microbial derivatives
  • Adjuvants suitable for use in the invention include bacterial or microbial derivatives such as non-toxic derivatives of enterobacterial lipopolysaccharide (LPS), Lipid A derivatives, immunostimulatory oligonucleotides and ADP-ribosylating toxins and detoxified derivatives thereof.
  • LPS enterobacterial lipopolysaccharide
  • Lipid A derivatives Lipid A derivatives
  • immunostimulatory oligonucleotides and ADP-ribosylating toxins and detoxified derivatives thereof.
  • Non-toxic derivatives of LPS include monophosphoryl lipid A (MPL) and 3-O-deacylated MPL (3dMPL).
  • 3dMPL is a mixture of 3 de-O-acylated monophosphoryl lipid A with 4, 5 or 6 acylated chains.
  • a preferred "small particle" form of 3 De-O-acylated monophosphoryl lipid A is disclosed in ref. 146. Such "small particles" of 3dMPL are small enough to be sterile filtered through a 0.22 ⁇ membrane [146].
  • Other non-toxic LPS derivatives include monophosphoryl lipid A mimics, such as aminoalkyl glucosaminide phosphate derivatives e.g. RC-529 [147,148].
  • Lipid A derivatives include derivatives of lipid A from Escherichia coli such as OM-174.
  • OM-174 is described for example in refs. 149 & 150.
  • Immunostimulatory oligonucleotides suitable for use as adjuvants in the invention include nucleotide sequences containing a CpG motif (a dinucleotide sequence containing an unmethylated cytosine linked by a phosphate bond to a guanosine). Double-stranded RNAs and oligonucleotides containing palindromic or poly(dG) sequences have also been shown to be immunostimulatory.
  • the CpG's can include nucleotide modifications/analogs such as phosphorothioate modifications and can be double-stranded or single-stranded.
  • References 151, 152 and 153 disclose possible analog substitutions e.g. replacement of guanosine with 2'-deoxy-7-deazaguanosine.
  • the adjuvant effect of CpG oligonucleotides is further discussed in refs. 154-159.
  • the CpG sequence may be directed to TLR9, such as the motif GTCGTT or TTCGTT [160].
  • the CpG sequence may be specific for inducing a Thl immune response, such as a CpG-A ODN, or it may be more specific for inducing a B cell response, such a CpG-B ODN.
  • CpG-A and CpG-B ODNs are discussed in refs. 161-163.
  • the CpG is a CpG-A ODN.
  • the CpG oligonucleotide is constructed so that the 5' end is accessible for receptor recognition.
  • two CpG oligonucleotide sequences may be attached at their 3' ends to form "immunomers". See, for example, refs. 160 & 164-166.
  • Bacterial ADP-ribosylating toxins and detoxified derivatives thereof may be used as adjuvants in the invention.
  • the protein is derived from E.coli ⁇ E.coli heat labile enterotoxin "LT"), cholera ("CT"), or pertussis ("PT").
  • LT E.coli ⁇ E.coli heat labile enterotoxin
  • CT cholera
  • PT pertussis
  • the use of detoxified ADP-ribosylating toxins as mucosal adjuvants is described in ref. 167 and as parenteral adjuvants in ref. 168.
  • the toxin or toxoid is preferably in the form of a holotoxin, comprising both A and B subunits.
  • the A subunit contains a detoxifying mutation; preferably the B subunit is not mutated.
  • the adjuvant is a detoxified LT mutant such as LT-K63, LT-R72, and LT-G 192.
  • LT-K63, LT-R72, and LT-G 192 are used as adjuvants.
  • ADP-ribosylating toxins and detoxified derivaties thereof, particularly LT-K63 and LT-R72, as adjuvants can be found in refs. 169-176.
  • Numerical reference for amino acid substitutions is preferably based on the alignments of the A and B subunits of ADP-ribosylating toxins set forth in ref. 177, specifically incorporated herein by reference in its entirety.
  • Human immunomodulators suitable for use as adjuvants in the invention include cytokines, such as interleukins ⁇ e.g. IL-1 , IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 [178], etc.) [179], interferons (e.g. inter feron- ⁇ ), macrophage colony stimulating factor, and tumor necrosis factor.
  • cytokines such as interleukins ⁇ e.g. IL-1 , IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 [178], etc.) [179]
  • interferons e.g. inter feron- ⁇
  • macrophage colony stimulating factor e.g. inter feron- ⁇
  • tumor necrosis factor e.g. tumor necrosis factor
  • Bioadhesives and mucoadhesives may also be used as adjuvants in the invention.
  • Suitable bioadhesives include esterified hyaluronic acid microspheres [180] or mucoadhesives such as cross-linked derivatives of poly(acrylic acid), polyvinyl alcohol, polyvinyl pyrollidone, polysaccharides and carboxymethylcellulose. Chitosan and derivatives thereof may also be used as adjuvants in the invention [181].
  • Microparticles may also be used as adjuvants in the invention.
  • Microparticles ⁇ i.e. a particle of -lOOnm to ⁇ 150 ⁇ in diameter, more preferably ⁇ 200nm to ⁇ 30 ⁇ in diameter, and most preferably ⁇ 500nm to - ⁇ in diameter) formed from materials that are biodegradable and non-toxic ⁇ e.g. a poly(a-hydroxy acid), a polyhydroxybutyric acid, a polyorthoester, a polyanhydride, a polycaprolactone, etc.), with poly(lactide-co-glycolide) are preferred, optionally treated to have a negatively-charged surface ⁇ e.g. with SDS) or a positively-charged surface ⁇ e.g. with a cationic detergent, such as CTAB).
  • a negatively-charged surface ⁇ e.g. with SDS
  • a positively-charged surface ⁇ e.g. with a cationic detergent, such as CTAB
  • liposome formulations suitable for use as adjuvants are described in refs. 182-184.
  • Adjuvants suitable for use in the invention include polyoxyethylene ethers and polyoxyethylene esters [185] . Such formulations further include polyoxyethylene sorbitan ester surfactants in combination with an octoxynol [ 186] as well as polyoxyethylene alkyl ethers or ester surfactants in combination with at least one additional non-ionic surfactant such as an octoxynol [ 187].
  • Preferred polyoxyethylene ethers are selected from the following group: polyoxyethylene-9-lauryl ether (laureth 9), polyoxyethylene-9-steoryl ether, polyoxytheylene-8-steoryl ether, polyoxyethylene-4- lauryl ether, polyoxyethylene-35-lauryl ether, and polyoxyethylene-23-lauryl ether.
  • PCPP formulations are described, for example, in refs. 188 and 189.
  • muramyl peptides suitable for use as adjuvants in the invention include N-acetyl- muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor- MDP), and N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-( -2'-dipalmitoyl-5 , n-glycero-3- hydroxyphosphoryloxy)-ethylamine MTP-PE).
  • thr-MDP N-acetyl- muramyl-L-threonyl-D-isoglutamine
  • nor- MDP N-acetyl-normuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-( -2'-dipalmitoyl
  • imidazoquinolone compounds suitable for use adjuvants in the invention include Imiquamod and its homologues ⁇ e,g. "Resiquimod 3M"), described further in refs. 190 and 191.
  • thiosemicarbazone compounds as well as methods of formulating, manufacturing, and screening for compounds all suitable for use as adjuvants in the invention include those described in ref. 192.
  • the thiosemicarbazones are particularly effective in the stimulation of human peripheral blood mononuclear cells for the production of cytokines, such as TNF-a.
  • tryptanthrin compounds as well as methods of formulating, manufacturing, and screening for compounds all suitable for use as adjuvants in the invention include those described in ref. 193.
  • the tryptanthrin compounds are particularly effective in the stimulation of human peripheral blood mononuclear cells for the production of cytokines, such as TNF-a.
  • the invention may also comprise combinations of aspects of one or more of the adjuvants identified above.
  • the following combinations may be used as adjuvant compositions in the invention: (1) a saponin and an oil-in- water emulsion [ 194]; (2) a saponin (e.g. QS21) + a non-toxic LPS derivative (e.g. 3dMPL) [195]; (3) a saponin (e.g. QS21) + a non-toxic LPS derivative (e.g. 3dMPL) + a cholesterol; (4) a saponin (e.g.
  • RibiTM adjuvant system (RAS), (Ribi Immunochem) containing 2% squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL + CWS (DetoxTM); and (8) one or more mineral salts (such as an aluminum salt) + a non-toxic derivative of LPS (such as 3dMPL).
  • MPL monophosphorylipid A
  • TDM trehalose dimycolate
  • CWS cell wall skeleton
  • LPS such as 3dMPL
  • aluminium salt adjuvants is particularly preferred, and antigens are generally adsorbed to such salts. It is possible in compositions of the invention to adsorb some antigens to an aluminium hydroxide but to have other antigens in association with an aluminium phosphate. In general, however, it is preferred to use only a single salt e.g. a hydroxide or a phosphate, but not both. Not all conjugates need to be adsorbed i.e. some or all can be free in solution.
  • the invention also provides a method for raising an immune response in a mammal, comprising administering a pharmaceutical composition of the invention to the mammal.
  • the immune response is preferably protective and preferably involves antibodies.
  • the method may raise a booster response.
  • the mammal is preferably a human.
  • the human is preferably a child (e.g. a toddler or infant) or a teenager; where the vaccine is for therapeutic use, the human is preferably an adult.
  • a vaccine intended for children may also be administered to adults e.g. to assess safety, dosage, immunogenicity, etc.
  • a preferred class of humans for treatment are females of child-bearing age (e.g. teenagers and above). Another preferred class is pregnant females.
  • Elderly patients e.g. those above 50, 60, 70, 80 or 90 etc. years of age, particularly over 65 years of age), especially those living in nursing homes where the risk of GBS infection may be increased ([198]), are another preferred class of humans for treatment.
  • the human has an undetectable level of antibodies against capsular saccharide from GB S serotype la prior to administration of the pharmaceutical composition. In other embodiments, the human has an undetectable level of antibodies against capsular saccharide from GBS serotype lb prior to administration of the pharmaceutical composition. In other embodiments, the human has an undetectable level of antibodies against capsular saccharide from GBS serotype III prior to administration of the pharmaceutical composition. In particular, the human may have an undetectable level of antibodies against capsular saccharide from GBS serotype la and an undetectable level of antibodies against capsular saccharide from GBS serotype lb prior to administration of the pharmaceutical composition.
  • the human may have an undetectable level of antibodies against capsular saccharide from GBS serotype III prior to administration of the pharmaceutical composition.
  • the level(s) of antibodies against the capsular saccharide(s) may be determined using the ELISA described in Human study (1) below.
  • the level(s) of antibodies may be as of one month prior to administration, particularly within one month prior to administration ⁇ e.g. within two weeks, within one week or on the day of administration).
  • Women with these undetectable level(s) of antibodies against the capsular saccharide(s) may have higher rates of GBS infection in their newborns. This is because higher levels of maternal antibodies against GBS capsular saccharides are correleated with reduced risk of disease in newborns [refs. 199 and 200]. Accordingly, administration to these women is specifically envisaged in the present invention.
  • the patient has been pre-immunised with a diphtheria toxoid or derivative thereof, e.g. as described below with respect to the second aspect of the invention in the section The pre-immunised patient.
  • at least one conjugate in the immunogenic composition is preferred for at least one conjugate in the immunogenic composition to be a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof.
  • the inventors have found that the immune response to the capsular saccharide may be improved by presenting the saccharide on a diphtheria toxoid or derivative thereof, when the patient has been pre-immunised with a diphtheria toxoid or derivative thereof.
  • the capsular saccharide conjugated to the diphtheria toxoid or derivative thereof in the composition may for example be from GBS serotype la, lb or III.
  • the capsular saccharide may be from GBS serotype III (as exemplified below).
  • the carrier or pre-immunisation antigen is a derivative of a diphtheria toxoid then that derivative preferably remains immunologically cross-reactive with Dt, and is preferably CRM197.
  • the patient has been pre-immunised with a tetanus toxoid or derivative thereof, e.g. as described below with respect to the second aspect of the invention in the sections
  • the pre-immunised patient and Tetanus toxoid carriers it is preferred for at least one conjugate in the immunogenic composition to be a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof.
  • the immune response to the capsular saccharide may be improved by presenting the saccharide on a tetanus toxoid or derivative thereof, when the patient has been pre-immunised with a tetanus toxoid or derivative thereof.
  • the capsular saccharide conjugated to the tetanus toxoid or derivative thereof in the composition may for example be from GBS serotype la, lb or III.
  • the capsular saccharide may be from GB S serotype III.
  • the invention also provides a composition of the invention for use as a medicament.
  • the medicament is preferably able to raise an immune response in a mammal (i.e. it is an immunogenic composition) and is more preferably a vaccine.
  • the invention also provides the use of a composition of the invention in the manufacture of a medicament for raising an immune response in a mammal.
  • These uses and methods are preferably for the prevention and/or treatment of a disease caused by S.agalactiae e.g. neonatal sepsis or bacteremia, neonatal pneumonia, neonatal meningitis, endometritis, osteomyelitis, septic arthritis, etc.
  • a disease caused by S.agalactiae e.g. neonatal sepsis or bacteremia, neonatal pneumonia, neonatal meningitis, endometritis, osteomyelitis, septic arthritis, etc.
  • a conjugate may be administered to a female (before or during pregnancy) in order to protect offspring (so-called 'maternal immunisation' [201-203]).
  • One way of checking efficacy of therapeutic treatment involves monitoring GBS infection after administration of the composition of the invention.
  • One way of checking efficacy of prophylactic treatment involves monitoring immune responses against the GBS antigens after administration of the composition.
  • compositions of the invention can confer an antibody titre in a patient that is superior to the criterion for seroprotection for each antigenic component for an acceptable percentage of human subj ects.
  • Antigens with an associated antibody titre above which a host is considered to be seroconverted against the antigen are well known, and such titres are published by organisations such as WHO.
  • Preferably more than 80% of a statistically significant sample of subjects is seroconverted, more preferably more than 90%, still more preferably more than 93%) and most preferably 96-100%).
  • Compositions of the invention will generally be administered directly to a patient. Direct delivery may be accomplished by parenteral injection (e.g.
  • Intramuscular administration to the thigh or the upper arm is preferred. Injection may be via a needle (e.g. a hypodermic needle), but needle-free injection may alternatively be used.
  • a typical intramuscular dose is 0.5 ml.
  • the invention may be used to elicit systemic and/or mucosal immunity.
  • Dosage treatment can be a single dose schedule or a multiple dose schedule. Multiple doses may be used in a primary immunisation schedule and/or in a booster immunisation schedule. A primary dose schedule may be followed by a booster dose schedule. Suitable timing between priming doses (e.g. between 4-16 weeks), and between priming and boosting, can be routinely determined.
  • GBS proteins can be included in compositions of the invention. These may be used as carrier proteins for conjugates of the invention, carrier proteins for other conjugates, or as unconjugated protein antigens.
  • GBS protein antigens for use with the invention include those disclosed in references 99 and 204- 206. Two preferred GBS protein antigens for use with the invention are known as: GBS67; and GBS80 [see ref. 99]. A further preferred GBS protein antigen for use with the invention is known as Spbl [see ref. 207]. Further details of these three antigens are given below.
  • compositions of the invention may thus include (a) a polypeptide comprising an amino acid sequence selected from SEQ ID NOs 1 to 3, and/or (b) a polypeptide comprising (i) an amino acid sequence that has sequence identity to one or more of SEQ ID NOs 1 to 3 and/or (ii) a fragment of SEQ ID NOs 1 to 3.
  • Compositions of the invention may also comprise mixtures of these GBS protein antigens.
  • compositions of the invention may include:
  • polypeptide comprising an amino acid sequence of SEQ ID NO 1
  • polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 1 and/or (ii) a fragment of SEQ ID NO 1 ;
  • polypeptide comprising an amino acid sequence of SEQ ID NO 2
  • polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 2 and/or (ii) a fragment of SEQ ID NO 2.
  • compositions of the invention may include:
  • polypeptide comprising an amino acid sequence of SEQ ID NO 1
  • polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 1 and/or (ii) a fragment of SEQ ID NO 1 ;
  • compositions of the invention may include:
  • compositions of the invention may include:
  • polypeptide comprising an amino acid sequence of SEQ ID NO 1, and/or (bi) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 1 and/or (ii) a fragment of SEQ ID NO 1;
  • polypeptide comprising an amino acid sequence of SEQ ID NO 3, and/or (bi) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 3 and/or (ii) a fragment of SEQ ID NO 3.
  • GBS 104 Three other preferred GBS protein antigens for use with the invention are known as: GBS 104; GBS276; and GBS322 [see ref. 99].
  • the wild-type GBS104 amino acid sequence from serotype V isolated strain 2603 V/R is given in reference 21 as SEQ ID NO: 3 therein. Where embodiments of the present invention are defined herein by reference to SEQ ID NO: 1 , the references to SEQ ID NO: 1 may be substituted by references to SEQ ID NO: 3 from reference 21.
  • the wild-type GBS276 amino acid sequence from serotype V isolated strain 2603 V/R is given in reference 21 as SEQ ID NO: 4 therein.
  • references to SEQ ID NO: 2 may be substituted by references to SEQ ID NO: 4 from reference 21.
  • the wild-type GBS322 amino acid sequence from serotype V isolated strain 2603 V/R is given in reference 21 as SEQ ID NO: 5 therein.
  • the references to SEQ ID NO: 3 may be substituted by references to SEQ ID NO: 5 from reference 21.
  • the degree of sequence identity in (i) is preferably greater than 50% (e.g. 60%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more).
  • polypeptides include homologs, orthologs, allelic variants and functional mutants.
  • 50% identity or more between two polypeptide sequences is considered to be an indication of functional equivalence.
  • the fragments of (ii) should comprise at least n consecutive amino acids from the sequences and, depending on the particular sequence, n is 7 or more (e.g. 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more).
  • the fragment may comprise at least one T-cell or, preferably, a B-cell epitope of the sequence.
  • T- and B-cell epitopes can be identified empirically (e.g. using PEPSCAN [208,209] or similar methods), or they can be predicted (e.g.
  • Preferred fragments of a particular protein can bind to an antibody that can bind to the full-length particular protein e.g. can bind to an antibody that binds to SEQ ID NO: 1 , 2 or 3.
  • SEQ ID NOs 4 to 13 Some useful fragments are given below (SEQ ID NOs 4 to 13).
  • polypeptides may, compared to SEQ ID NOs 1 to 3, include one or more (e.g. 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) conservative amino acid replacements i.e. replacements of one amino acid with another which has a related side chain.
  • conservative amino acid replacements i.e. replacements of one amino acid with another which has a related side chain.
  • Genetically-encoded amino acids are generally divided into four families: (1) acidic i.e. aspartate, glutamate; (2) basic i. e. lysine, arginine, histidine; (3) non- polar i.e. alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar i.e.
  • the polypeptides may also include one or more (e.g. 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) single amino acid deletions relative to SEQ ID NOs 1 to 3.
  • the polypeptides may also include one or more (e.g. 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) insertions (e.g. each of 1 , 2, 3, 4 or 5 amino acids) relative to the SEQ ID NOs 1 to 3.
  • Polypeptides of the invention can be prepared in many ways e.g. by chemical synthesis (in whole or in part), by digesting longer polypeptides using proteases, by translation from RNA, by purification from cell culture (e.g. from recombinant expression), from the organism itself (e.g. after bacterial culture, or direct from patients), etc.
  • a preferred method for production of peptides ⁇ 40 amino acids long involves in vitro chemical synthesis [221 ,222] .
  • Solid-phase peptide synthesis is particularly preferred, such as methods based on tBoc or Fmoc [223] chemistry.
  • Enzymatic synthesis [224] may also be used in part or in full.
  • biological synthesis may be used e.g.
  • the polypeptides may be produced by translation. This may be carried out in vitro or in vivo. Biological methods are in general restricted to the production of polypeptides based on L-amino acids, but manipulation of translation machinery (e.g. of aminoacyl tRNA molecules) can be used to allow the introduction of D-amino acids (or of other non natural amino acids, such as iodotyrosine or methylphenylalanine, azidohomoalanine, etc.) [225]. Where D-amino acids are included, however, it is preferred to use chemical synthesis. Polypeptides of the invention may have covalent modifications at the C-terminus and/or N-terminus.
  • GBS proteins can take various forms (e.g. native, fusions, glycosylated, non-glycosylated, lipidated, non-lipidated, phosphorylated, non-phosphorylated, myristoylated, non-myristoylated, monomeric, multimeric, particulate, denatured, etc.). They are preferably used in purified or substantially purified form i.e. substantially free from other polypeptides (e.g. free from naturally-occurring polypeptides), particularly from other GBS or host cell polypeptides).
  • Nucleotide and amino acid sequence of GBS67 sequenced from serotype V strain 2603 V/R are set forth in ref. 99 as SEQ ID NOs 3745 & 3746.
  • the amino acid sequence is SEQ ID NO: 1 herein: MRKYQKFSKILTLSLFCLSQI PLNTNVLGESTVPENGAKGKLWKKTDDQNKPLSKATFVLKTTAHPESKIEKVTAELT
  • GBS67 contains a C-terminus transmembrane region which is indicated by the underlined region closest to the C-terminus of SEQ ID NO: 1 above. One or more amino acids from the transmembrane region may be removed, or the amino acid may be truncated before the transmembrane region.
  • SEQ ID NO: 4 An example of such a GBS67 fragment is set forth below as SEQ ID NO: 4.
  • GBS67 contains an amino acid motif indicative of a cell wall anchor, shown in italics in SEQ ID NO: 1 above. In some recombinant host cell systems, it may be preferable to remove this motif to facilitate secretion of a recombinant GBS67 protein from the host cell. Accordingly, in one preferred fragment of GBS67 for use in the invention, the transmembrane and the cell wall anchor motif are removed from GBS67.
  • SEQ ID NO: 5 An example of such a GBS67 fragment is set forth below as SEQ ID NO: 5.
  • the cell wall anchor motif to anchor the recombinantly expressed protein to the cell wall.
  • the extracellular domain of the expressed protein may be cleaved during purification or the recombinant protein may be left attached to either inactivated host cells or cell membranes in the final composition.
  • GBS67 Three pilin motifs, containing conserved lysine residues have been identified in GBS67.
  • conserved lysine residues are at amino acid residues 478 and 488, at amino acid residues 340 and 342, and at amino acid residues 703 and 717.
  • the pilin sequences, in particular the conserved lysine residues, are thought to be important for the formation of oligomeric, pilus-like structures of GBS67.
  • Preferred fragments of GBS 67 include at least one conserved lysine residue.
  • Two E boxes containing conserved glutamic residues have also been identified in GBS67.
  • Preferred fragments of GBS 67 include at least one conserved glutamic acid residue.
  • GBS67 contains several regions predicted to form alpha helical structures.
  • GBS67 also contains a region which is homologous to the Cna_B domain of the S.aureus collagen-binding surface protein (pfam05738). This may form a beta sandwich structure. GBS67 contains a region which is homologous to a von Willebrand factor (vWF) type A domain.
  • vWF von Willebrand factor
  • amino acid sequence of GBS67 sequenced from serotype lb strain H36B is set forth in ref. 226 as SEQ ID NO 20906.
  • the amino acid sequence is SEQ ID NO: 24 herein:
  • this variant of GBS67 may be used. Accordingly, where embodiments of the present invention are defined herein by reference to SEQ ID NO: 1, the references to SEQ ID NO: 1 may be substituted by references to SEQ ID NO: 24.
  • GBS67 sequenced from serotype V strain 2603 V/R contains a C-terminus transmembrane region which is indicated by the underlined region closest to the C-terminus of SEQ ID NO: 24 above.
  • One or more amino acids from the transmembrane region may be removed, or the amino acid may be truncated before the transmembrane region.
  • SEQ ID NO: 25 An example of such a GBS67 fragment is set forth below as SEQ ID NO: 25.
  • GBS67 sequenced from serotype V strain 2603 V/R contains an amino acid motif indicative of a cell wall anchor, shown in italics in SEQ ID NO: 24 above. Accordingly, in one preferred fragment of GBS67 for use in the invention, the transmembrane and the cell wall anchor motif are removed from GBS67.
  • SEQ ID NO: 26 An example of such a GBS67 fragment is set forth below as SEQ ID NO: 26.
  • GBS80 refers to a putative cell wall surface anchor family protein. Nucleotide and amino acid sequence of GBS80 sequenced from serotype V isolated strain 2603 V/R are set forth in ref. 99 as SEQ ID NOs 8779 & 8780. The amino acid sequence is set forth below as SEQ ID NO: 2:
  • GBS80 contains a N-terminal leader or signal sequence region which is indicated by the underlined sequence above. One or more amino acids from the leader or signal sequence region of GBS80 can be removed.
  • An example of such a GBS80 fragment is set forth below as SEQ ID NO: 6:
  • GBS80 contains a C-terminal transmembrane region which is indicated by the underlined sequence near the end of SEQ ID NO: 2 above.
  • One or more amino acids from the transmembrane region and/or a cytoplasmic region may be removed.
  • An example of such a fragment is set forth below as
  • GBS80 contains an amino acid motif indicative of a cell wall anchor, shown in italics in SEQ ID NO: 2 above. In some recombinant host cell systems, it may be preferable to remove this motif to facilitate secretion of a recombinant GBS80 protein from the host cell. Thus the transmembrane and/or cytoplasmic regions and the cell wall anchor motif may be removed from GBS80.
  • SEQ ID NO: 8 An example of such a fragment is set forth below as SEQ ID NO: 8.
  • the cell wall anchor motif to anchor the recombinantly expressed protein to the cell wall.
  • the extracellular domain of the expressed protein may be cleaved during purification or the recombinant protein may be left attached to either inactivated host cells or cell membranes in the final composition.
  • the leader or signal sequence region, the transmembrane and cytoplasmic regions and the cell wall anchor motif are removed from the GBS80 sequence.
  • An example of such a GBS80 fragment is set forth below as SEQ ID NO: 9:
  • a particularly immunogenic fragment of GBS80 is located towards the N-terminus of the protein, and is given herein as SEQ ID NO: 10:
  • the wild-type Spbl sequence from serotype III strain COH1 is SEQ ID NO: 3 herein:
  • Spbl contains a N-terminal leader or signal sequence region which is indicated by the underlined sequence above (aa 1-29).
  • One or more amino acids from the leader or signal sequence region of Spbl can be removed.
  • An example of such a Spbl fragment is set forth below as SEQ ID NO: 11 :
  • the wild-type Spbl sequence contains an amino acid motif indicative of a cell wall anchor (LPSTG).
  • LSTG cell wall anchor
  • the cell wall anchor motif and sequence C-terminal to this motif may be removed from Spbl.
  • SEQ ID NO: 12 An example of such a fragment is set forth below as SEQ ID NO:
  • the cell wall anchor motif to anchor the recombinantly expressed protein to the cell wall.
  • the extracellular domain of the expressed protein may be cleaved during purification or the recombinant protein may be left attached to either inactivated host cells or cell membranes in the final composition.
  • the leader or signal sequence region, the cell wall anchor motif and sequence C-terminal to this motif are removed from Spbl.
  • Spbl An example of such a Spbl fragment is set forth below as SEQ ID NO: 13:
  • An E box containing a conserved glutamic residue has also been identified in Spbl (underlined), with a conserved glutamic acid at residue 423 (bold).
  • the E box motif may be important for the formation of oligomeric pilus-like structures, and so useful fragments of Spbl may include the conserved glutamic acid residue.
  • the wild- type Spb 1 sequence includes an internal methionine codon (Met- 162) that has an upstream 12-mer TAATGGAGCTGT sequence (SEQ ID NO: 14) that includes the core sequence (underlined) of a Shine-Dalgarno sequence.
  • This Shine-Dalgarno sequence has been found to initiate translation of a truncated Spb l sequence. To prevent translation initiation at this site the Shine-Dalgarno sequence can be disrupted in a Spbl -coding sequence used for expression.
  • the sequence includes a GGA glycine codon that is both part of the Shine-Dalgarno core and in-frame with the internal methionine codon.
  • the third base in this codon can be mutated to C, G or T without changing the encoded glycine, thereby avoiding any change in Spbl sequence.
  • compositions of the invention may also include a polypeptide defined in refererence [227] by the amino acid sequence NH 2 -W-X-L-Y-Z-CO 2 H, wherein: X is a Spbl sequence; L is an optional linker; and Y is a GBS80 sequence; W is an optional N-terminal sequence; and Z is an optional C-terminal sequence. Further details of this polypeptide are given below.
  • compositions of the invention may include (a) a polypeptide of amino acid sequence NH 2 -W-X-L-Y-Z-CO 2 H; and (bi) a polypeptide comprising an amino acid sequence of SEQ ID NO 1 as described above, and/or 2) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 1 as described above and/or (ii) a fragment of SEQ ID NO 1 as described above, Polypeptide NH?-W-X-L-Y-Z-CO?H
  • the polypeptide comprises an amino acid sequence X-L-Y, wherein: X is a Spb l sequence; L is an optional linker; and Y is a GBS80 sequence.
  • the X moiety is a Spbl sequence.
  • This Spbl sequence will, when administered to a subject, elicit an antibody response comprising antibodies that bind to wild- type Spbl protein e.g. to the S.agalactiae protein having amino acid sequence SEQ ID NO: 3 (the full-length wild-type sequence from strain COH1).
  • the Spbl sequence may comprise an amino acid sequence having at least a% identity to SEQ ID NO: 13.
  • the value of a may be selected from 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99 or more.
  • the Spbl sequence may comprise SEQ ID NO: 13.
  • the Spbl sequence may comprise a fragment of SEQ ID NO: 3 and/or of SEQ ID NO:13.
  • the fragment will usually include at least b amino acids of SEQ ID NO: 3/13, wherein b is selected from 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 24, 26, 28, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 175, 200 or more.
  • the fragment will usually include at least one T-cell or, preferably, a B-cell epitope of SEQ ID NO: 3/13. T- and B- cell epitopes can be identified by the methods described above.
  • SEQ ID NO: 13 is itself a fragment of SEQ ID NO: 3, as explained above.
  • the Spbl sequence may comprise an amino acid sequence that has both at least a% identity to SEQ ID NO: 13 and comprises a fragment of SEQ ID NO: 13, as defined above.
  • the X moiety will usually be at least c amino acids long, where c is selected from 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 320, 340, 360, 380, 400 or more.
  • the X moiety will usually be no longer than d amino acids long, where d is selected from 500, 480, 460, 440, 420, 400, 380, 360, 340, 320, 300, 280, 260, 240, 220, 200 or less.
  • the X moiety will usually be between 300-500 amino acids long e.g. 350-480, 400-460, 430-450.
  • the wild-type Spbl sequence from serotype III strain COH1 is SEQ ID NO: 3 above.
  • the specific derivatives thereof described in section "SpbF above are applicable to the Spbl sequence of this embodiment of the invention.
  • the Y moiety is a GBS80 sequence.
  • This GBS80 sequence will, when administered to a subject, elicit an antibody response comprising antibodies that bind to wild-type GBS80 protein e.g. to the S.agalactiae protein having amino acid sequence SEQ ID NO: 2 (the full-length wild-type sequence from strain 2603V/R).
  • the GBS80 sequence may comprise an amino acid sequence having at least e% identity to SEQ ID NO: 9.
  • the value of e may be selected from 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99 or more.
  • the GBS80 sequence may comprise SEQ ID NO: 9.
  • the GBS80 sequence may comprise a fragment of SEQ ID NO: 2 or of SEQ ID NO: 9.
  • the fragment will usually include at least / amino acids of SEQ ID NO: 2/9, wherein /is selected from 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 24, 26, 28, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 175, 200 or more.
  • the fragment will usually include at least one T-cell or, preferably, B-cell epitope of SEQ ID NO: 2/9.
  • SEQ ID NO: 9 is itself a fragment of SEQ ID NO: 2, as explained above.
  • the GBS80 sequence may comprise an amino acid sequence that has both at least e% identity to SEQ ID NO: 9 and comprises a fragment of SEQ ID NO: 9, as defined above.
  • the Y moiety will usually be at least g amino acids long, where g is selected from 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 320, 340, 360, 380, 400, 420, 440, 460, 480, 500, 520, 540, 560, 580, 600 or more.
  • the Y moiety will usually be no longer than h amino acids long, where h is selected from 600, 580, 560, 540, 520, 500, 480, 460, 440, 420, 400, 380, 360, 340, 320, 300, 280, 260, 240, 220, 200 or less.
  • the Y moiety will usually be between 350-550 amino acids long e.g. 400-520, 450-500, 470-490.
  • the wild-type GBS80 sequence from serotype V isolated strain 2603 V/R is SEQ ID NO: 2 above.
  • the specific derivatives thereof described in section "GBSSO" above are applicable to the GBS80 sequence of this embodiment of the invention.
  • the polypeptide optionally includes a L moiety to link the X and Y moieties.
  • the L moiety is typically a short amino acid sequence e.g. in the range of 2-40 amino acids e.g. consisting of 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39 or 40 amino acids.
  • Linkers will usually contain at least one glycine residue, thereby facilitating structural flexibility.
  • the linker may contain, for example, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more glycine residues.
  • Linkers may be encoded by codons found in the recognition sequences of restriction enzymes. For example, a 6-mer sequence that is the target of a particular restriction enzyme can code for a dipeptide. Thus the recognition sequence for BamHI (GGATCC) encodes Gly-Ser, and so a linker may include a Gly-Ser dipeptide sequence. Such sequences facilitate cloning and manipulation.
  • Useful linker sequences include SEQ ID NO 15 above and SEQ ID Nos 16, 17 and 18 below:
  • preferred linkers do not include a sequence that shares 10 or more contiguous amino acids in common with a human polypeptide sequence.
  • one glycine-rich linker sequence that can be used with the invention is the 14mer SEQ ID NO: 16.
  • this 14mer is also found in a human RNA binding protein (gi: 8051631) and so it is preferably avoided within the L moiety.
  • W N-terminal sequence
  • the X moiety may be at the N-terminus of the polypeptide, but it is also possible to have amino acids upstream of X. These optional amino acids form a W moiety.
  • the W moiety is typically a short amino acid sequence e.g. in the range of 2-40 amino acids e.g. consisting of 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39 or 40 amino acids.
  • Other suitable N-terminal amino acid sequences will be apparent to those skilled in the art.
  • the W moiety can provide the polypeptide's N-terminal methionine (formyl-methionine, fMet, in bacteria).
  • N-terminal methionine formyl-methionine, fMet, in bacteria.
  • One or more amino acids may be cleaved from the N-terminus of a nascent W moiety, however, such that the W moiety in a polypeptide of the invention does not necessarily include a N-terminal methionine.
  • Useful W moieties include SEQ ID NO 19:
  • the Y moiety may be at the C-terminus of the polypeptide, but it is also possible to have amino acids downstream of Y. These optional amino acids form a Z moiety.
  • the Z moiety is typically a short amino acid sequence e.g. in the range of 2-40 amino acids e.g. consisting of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 amino acids.
  • Other suitable C-terminal amino acid sequences will be apparent to those skilled in the art, such as a glutathione-S-transferase, thioredoxin, 14kDa fragment of S.aureus protein A, a biotinylated peptide, a maltose-binding protein, an enterokinase flag, etc.
  • One useful Z moiety comprises SEQ ID NO 20:
  • the polypeptide may comprise an amino acid sequence having at least i% sequence identity to SEQ ID NO: 21.
  • the value of z may be selected from 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99 or more.
  • the polypeptide may comprise SEQ ID NO: 21.
  • the polypeptide may comprise an amino acid sequence having at least i% sequence identity to SEQ ID NO: 23.
  • the value of may be selected from 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99 or more.
  • the polypeptide may comprise SEQ ID NO: 23.
  • a polypeptide used with the invention may comprise an amino acid sequence that:
  • (c) has 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 (or more) single amino acid alterations (deletions, insertions, substitutions), which may be at separate locations or may be contiguous, as compared to the sequences of (a) or (b); and
  • each moving window of x amino acids from N-terminus to C-terminus (such that for an alignment that extends to p amino acids, where p>x, there are p-x+1 such windows) has at least xy identical aligned amino acids, where: x is selected from 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200; y is selected from 0.50, 0.60, 0.70, 0.75, 0.80, 0.85, 0.90, 0.91 , 0.92, 0.93, 0.94, 0.95, 0.96, 0.97, 0.98, 0.99; and if xy is not an integer then it is rounded up to the nearest integer.
  • deletions or substitutions may be at the N-terminus and/or C-terminus, or may be between the two termini.
  • a truncation is an example of a deletion. Truncations may involve deletion of up to 40 (or more) amino acids at the N-terminus and/or C-terminus.
  • the Spbl and GBS80 sequences in the polypeptides may be derived from one or more GBS strains.
  • SEQ ID NOs: 21 and 23 include Spb l sequence from strain COH1 and GBS80 sequence from strain 2603V/R.
  • polypeptides, or individual moieties may, compared to SEQ ID NOs: 2, 3, 9, 10, 13, 21 or 23, include one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) conservative amino acid replacements i.e. replacements of one amino acid with another which has a related side chain.
  • Genetically-encoded amino acids are generally divided into four families: (1) acidic i.e. aspartate, glutamate; (2) basic i.e. lysine, arginine, histidine; (3) non-polar i.e. alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar i.e.
  • the polypeptides may have one or more ⁇ e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) single amino acid deletions relative to a reference sequence.
  • the polypeptides may also include one or more ⁇ e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) insertions ⁇ e.g. each of 1, 2, 3, 4 or 5 amino acids) relative to a reference sequence.
  • the polypeptides can be prepared in many ways, as described above.
  • the polypeptides can also take various forms ⁇ e.g. native, fusions, glycosylated, non-glycosylated, lipidated, non-lipidated, phosphorylated, non-phosphorylated, myristoylated, non-myristoylated, monomeric, multimeric, particulate, denatured, etc.), as described above.
  • the polypeptides are preferably provided in purified or substantially purified form, as described above.
  • polypeptide refers to amino acid polymers of any length.
  • the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
  • Polypeptides can occur as single chains or associated chains.
  • the polypeptides can be naturally or non-naturally glycosylated ⁇ i.e. the polypeptide has a glycosylation pattern that differs from the glycosylation pattern found in the corresponding naturally occurring polypeptide).
  • the polypeptides may be at least 40 amino acids long ⁇ e.g. at least 40, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 350, 400, 450, 500 or more).
  • the polypeptides may be shorter than 1100 amino acids.
  • the invention provides a method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof.
  • the conjugate is one of the GBS conjugates in an immunogenic composition of the first aspect of the invention, as described above.
  • immunogenic compositions of the first aspect of the invention wherein at least one conjugate is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof may be used in the second aspect of the invention.
  • the capsular saccharide conjugated to the diphtheria toxoid or derivative thereof in the composition may for example be from GBS serotype la, lb or III.
  • the capsular saccharide may be from GBS serotype III (as exemplified below).
  • GBS serotype III as exemplified below.
  • the carrier or pre-immunisation antigen is a derivative of a diphtheria toxoid then that derivative preferably remains immunologically cross-reactive with Dt, and is preferably CRM 197.
  • conjugates that are capsular saccharides from GBS conjugated to a diphtheria toxoid or derivative thereof do not seem to suffer from carrier-induced epitopic suppression (or "carrier suppression", as it is generally known), particularly suppression arising from carrier priming.
  • carrier suppression is the phenomenon whereby pre-immunisation of an animal with a carrier protein prevents it from later eliciting an immune response against a new antigenic epitope that is presented on that carrier [230].
  • the inventors have found that the immune response to GBS capsular saccharide-diphtheria toxoid or derivative thereof conjugates may in fact be improved by pre-immunisation with the diphtheria toxoid or derivative thereof.
  • Reference 232 reports how a combination of D-T-P vaccines with a Hib conjugate vaccine was adversely affected where the carrier for the Hib conjugate was the same as the tetanus antigen from the D-T-P vaccine. The authors concludes that this "carrier suppression" phenomenon, arising from interference by a common protein carrier, should be taken into account when introducing vaccines that include multiple conjugates.
  • reference 233 reported that priming with tetanus toxoid had no negative impact on the immune response against a subsequently-administered Hib-Tt conjugate, but suppression was seen in patients with maternally acquired anti-Tt antibodies. In reference 234, however, an "epitopic suppression" effect was reported for a Tt-based peptide conjugate in patients having existing anti-Tt antibodies resulting from tetanus vaccination.
  • pre-immunisation with a diphtheria or tetanus toxoid carrier protein reduced the increase in anti-Hib antibody levels after a subsequent immunisation with the Hib capsular saccharide conjugated to those carriers, with IgG l and IgG2 being equally affected.
  • Responses to the carrier portions of the conjugates were also suppressed.
  • a more general non-epitope-specific suppression was seen, as pre-immunisation with one conjugate was seen to affect immune responses against both the carrier and saccharide portions of a second conjugate that was administered four weeks later.
  • This second aspect of the invention therefore provides a method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof.
  • This aspect also provides a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof for use in immunising a patient against infection by GBS, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof.
  • This aspect further provides the use of a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof in the manufacture of a medicaument for immunising a patient against infection by GBS, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof.
  • This patient to be immunised has been pre-immunised with a diphtheria toxoid or derivative thereof.
  • the diphtheria toxoid or derivative thereof may have been administered as the carrier in a conjugate of a capsular saccharide of an organism other than GBS and a diphtheria toxoid or derivative thereof.
  • Typical pre-immunisation will have included: a diphtheria toxoid antigen; a Hib capsular saccharide conjugate using a diphtheria toxoid or CRM197 carrier; and/or a pneumococcal capsular saccharide conjugate using a diphtheria toxoid or CRM 197 carrier.
  • the patient will have received at least one (e.g. 1 , 2, 3 or more) dose of the pre-immunisation antigen(s), and that dose (or the earliest of multiple doses) will have been administered to the patient at least six (e.g. 6, 9, 12, 15, 18, 21 , 24, 36, 48, 60, 120, 180, 240, 300 or more) months before the immunisation with the GBS conjugates according to this aspect of invention.
  • the pre-immunisation took place within 3 years of birth e.g. within 2 years of birth, within 1 year of birth, within 6 months of birth, or even within 3 months, 2 months or 1 month of birth. Suitable patients to be immunised according to this aspect of the invention are described above in the section Methods of treatment.
  • pre-immunisation antigen is a diphtheria toxoid
  • the patient will typically have received the toxoid as the 'D' antigen in a D-T-P or a D-T pre-immunisation.
  • immunisations are typically given to newborn children at ages 2, 3, and 4 months.
  • the immunisation includes a pertussis vaccine
  • that vaccine may be a whole cell or cellular pertussis vaccine ('Pw'), but is preferably an acellular pertussis vaccine ('Pa').
  • Pre-immunisation Pa vaccines will generally include one, two or three of the following well-known and well-characterised B.
  • pertussis antigens (1) pertussis toxoid (' ⁇ '), detoxified either by chemical means or by site-directed mutagenesis e.g. the '9K/129G' mutant [242]; (2) filamentous haemagglutinin ('FHA'); (3) pertactin (also known as '69 kiloDalton outer membrane protein').
  • Acellular pertussis vaccines may also include agglutinogen 2 and/or agglutinogen 3.
  • the 'T' antigen in a D-T-P pre-immunisation is typically a tetanus toxoid.
  • the patient may also or alternatively have received the toxoid as the carrier protein of a protein-saccharide conjugate.
  • conjugates include the 'PRP-D' Hib conjugate [see Table 14-7 of ref. [243] e.g. the ProHIBITTM product.
  • the patient will typically have been pre-immunised with a Hib conjugate and/or a multivalent pneumococcal conjugate. Such immunisations are typically given to newborn children at ages 2, 3, and 4 months.
  • Hib conjugates that use a CRM197 carrier include the 'HbOC conjugates [Table 14-7 of ref. 243] e.g. the HibTITERTM product.
  • Pneumococcal conjugates that use a CRM 197 carrier include the 7-valent PCV7 mixtures e.g. the PrevNarTM vaccine [244].
  • the patient may also have been pre-immunised with a serogroup C meningococcal ('MenC') conjugate.
  • MenC conjugates that use CRM197 carrier include MeninvactTM/MenjugateTM [245] and MeningitecTM.
  • Diphtheria toxoid is a well known and well characterised protein [e.g. see chapter 13 of ref. 243] that can be obtained by treating the ADP-ribosylating exotoxin of Corynebacterium diphtheriae with an inactivating chemical, such as formalin or formaldehyde.
  • CRM 197 is also well known and well characterised [246-249], and has been widely used as a carrier in conjugated saccharide vaccines. CRM197 and Dt share many carrier epitopes. The result of the pre-immunisation is that the patient's immune system has been exposed to the pre-immunisation antigens.
  • pre-immunisation with diphtheria toxoid this generally means that the patient will have raised an anti-Dt antibody response (typically to give an anti-Dt titer >0.01 IU/ml) and will possess memory B and/or T lymphocytes specific for Dt i.e. pre-immunisation with Dt is typically adequate to elicit an anamnestic anti-Dt immune response in the patient.
  • Dt or derivative
  • the pre-immunisation will have raised an anti-saccharide response and the patient will possess memory B and/or T lymphocytes specific for the saccharide i.e. the pre-immunisation is typically adequate to elicit an anamnestic anti-saccharide immune response in the patient.
  • the pre-immunisation was preferably adequate to elicit protective immunity in the patient e.g. against diphtheria disease.
  • the patients to be immunised according to this aspect of the invention are distinct from patients in general, as they are members of a subset of the general population whose immune systems have already mounted an immune response to the pre-immunisation antigens, such that immunisation according to this aspect with a GBS conjugate that includes a diphtheria toxoid (or derivative thereof) carrier elicits a different immune response in the subset than in patients who have not previously mounted an immune response to the pre-immunisation antigens.
  • Patients who have been pre-immunised with Dt (or derivative) as the carrier of a conjugate (particularly of a Hib conjugate) are preferred.
  • Particularly preferred patients have been pre-immunised with Dt (or derivative) as the carrier of a conjugate and also with Dt as an unconjugated immunogen.
  • the patient may have been pre-immunised with other antigens.
  • antigens include, but are not limited to: pertussis antigen(s) - see above; tetanus toxoid - see above; Haemophilus influenzae type B - see above; hepatitis B surface antigen (HBsAg); poliovirus, such as an inactivated poliovirus vaccine (IPV); Streptococcus pneumoniae - see above; influenza virus; BCG; hepatitis A virus antigens; measles virus; mumps virus; rubella virus; varicella virus; etc.
  • the patient may or may not have been pre-immunised with one or more GBS conjugate(s).
  • they at the time when a patient first receives a GBS conjugate, they have already been pre-immunised with Dt (or derivative).
  • a GBS conjugate is administered to a patient who has already been pre-immunised with both (i) Dt or a derivative and (ii) a GBS conjugate.
  • the second aspect of the invention provides a method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof, wherein the patient has been pre-immunised with a tetanus toxoid or derivative thereof.
  • This aspect also provides a conjugate that is a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof for use in immunising a patient against infection by GB S, wherein the patient has been pre-immunised with a tetanus toxoid or derivative thereof.
  • This aspect further provides the use of a conjugate that is a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof in the manufacture of a medicaument for immunising a patient against infection by GBS, wherein the patient has been pre-immunised with a tetanus toxoid or derivative thereof.
  • Conjugates that are capsular saccharides from GBS conjugated to a tetanus toxoid or derivative thereof may not suffer from carrier suppression, particularly suppression arising from carrier priming.
  • the immune response to GBS capsular saccharide-tetanus toxoid or derivative thereof conjugates may in fact be improved by pre-immunisation with the tetanus toxoid or derivative thereof.
  • the conjugate is one of the GBS conjugates in an immunogenic composition of the first aspect of the invention, as described above.
  • immunogenic compositions of the first aspect of the invention wherein at least one conjugate is a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof may be used in the second aspect of the invention.
  • the capsular saccharide conjugated to the tetanus toxoid or derivative thereof in the composition may for example be from GBS serotype la, lb or III.
  • the capsular saccharide may be from GBS serotype III.
  • it is typical for all of the capsular saccharides from GBS in the composition to be conjugated to a tetanus toxoid or derivative thereof.
  • Tetanus toxoid is a well known protein [e.g. see chapter 27 of ref. 243], and can be obtained by inactivating the ADP-ribosylating exotoxin of Clostridium tetani. Patients will typically have received tetanus toxoid as the 'T' antigen in a D-T-P or a D-T pre-immunisation, or as the carrier protein in a conjugate.
  • conjugates include the 'PRP-T' Hib conjugate [see Table 14-7 of ref. 243] e.g. the ActHIBTM, OmniHIBTM and HIBEPJXTM products.
  • composition comprising X may consist exclusively of X or may include something additional e.g. X + Y.
  • sugar rings can exist in open and closed form and that, whilst closed forms are shown in structural formulae herein, open forms are also encompassed by the invention.
  • sugars can exist in pyranose and furanose forms and that, whilst pyranose forms are shown in structural formulae herein, furanose forms are also encompassed.
  • Different anomeric forms of sugars are also encompassed.
  • a process comprising a step of mixing two or more components does not require any specific order of mixing.
  • components can be mixed in any order. Where there are three components then two components can be combined with each other, and then the combination may be combined with the third component, etc.
  • Antibodies will generally be specific for their target. Thus they will have a higher affinity for the target than for an irrelevant control protein, such as bovine serum albumin.
  • Figure 1 shows the difference between the repeating structures in GBS serotypes la and III.
  • Figure 2 shows the repeating structures of capsular saccharides in GBS serotypes la, lb, II, III & V.
  • Figure 3 shows the repeating structure of the desialylated form of the capsular saccharide from GBS serotype V.
  • Figure 4 shows the effect of priming with CRM197 prior to administration of a conjugate of GBS serotype III capsular saccharide and CRM 197, with and without adjuvant.
  • Purified capsular saccharides from Streptococcus agalactiae serotypes la, lb and III were conjugated to a carrier protein by periodate oxidation followed by reductive amination (ref. 2).
  • Purified, desialylated capsular saccharide from Streptococcus agalactiae serotype V was conjugated to a carrier protein by periodate oxidation followed by reductive amination (ref. 14).
  • the carrier protein in most cases was CRM197. Tetanus toxoid was used as a carrier protein where specifically indicated.
  • the maternal-neonatal challenge mouse model adapted from the reference 250, is used to to assess the efficacy in neonates of specific antibodies acquired transplacentally from actively vaccinated dams.
  • female CD-I mice aged between 5-6 weeks from Charles River Laboratories (Calco, Italy), are vaccinated by intra-peritoneal injection with two or three immunizations on days 1, 21 and eventually 35, with or without adjuvant. After the last immunization, mice are bred and kept until delivery. An inoculum of a GBS strain (0.05 mL of Todd-Hewitt broth), lethal for 90% of non- immunized pups (100-1000 fold LD50), is used to challenge the neonatal mice.
  • the ELISA assay is performed to determine the titer of GBS-specific antibodies produced following immunization. ELISA is also used to quantify the total IgG against each capsular saccharde antigen. Serum from each individual mouse is analyzed and the Geometric Mean Titer (GMT) calculated for each group. Antibody titers for capsular saccharde types la, lb and III are expressed as Mouse ELISA Unit (MEU) and are calculated based on the Reference Line Assay Method.
  • MMT Geometric Mean Titer
  • the Opsonophagocytosis assay is performed to evaluate the titer of vaccine-induced antibodies capable of complement-mediated GBS killing (using the approach described in reference 251).
  • the assay is performed by combining the following components: bacteria, phagocytic cells (PMNs extracted from human blood or the differentiated HL-60 cell line), complement and immune sera. Aliquots of the reaction mix are plated before and after a lh incubation at 37 °C to determine the remaining colony forming units (CFU). The amount of opsonophagocytic killing (log kill) is determined by subtracting the log of the surviving colony number from the log of the CFU number present at the initial time-point. A pre-immune serum, and heat-inactivated complement without PMNs, is used as negative control. Bactericidal titer is expressed as reciprocal serum dilution leading to reduction in 50% of bacteria.
  • Table 1 Determination of the protection level and antibody titers obtained with GBS serotype la, lb and III/CRM197 conjugates in the presence of aluminum hydroxide or MF59 in the active maternal-neonatal challenge mouse model.
  • mice were immunized with three doses of combinations at 1 ⁇ g of each conjugate in the presence of adjuvant on days 0, 21 and 35.
  • the neonates were challenged with type specific strains as shown below in Table 2.
  • Table 2 Determination of the protection level and antibody titers obtained with combinations of GBS serotype la, lb and III/CRM197 conjugates in the presence or absence of adjuvant in the active maternal-neonatal challenge mouse model.
  • Table 3 Determination of the protection level, antibody titers and bactericidal titers achieved by the serotype la, lb and III/CRM197 conjugates, when administered to mice as liquid or lyophilized antigen in the presence or absence of aluminum hydroxide in the active maternal- neonatal challenge mouse model.
  • mice were immunized with two doses of the combination at 0.2, 1 or 5 ⁇ g of each of the GBS serotype la, lb, III and V conjugates without adjuvant on days 0 and 21.
  • the neonates were challenged with type specific strains as shown below in Table 5 below.
  • Table 5 Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates in the active maternal-neonatal challenge mouse model.
  • mice were immunized with one, two or three doses (1 ⁇ g of each conjugate) of the combination in the presence of an alum adjuvant on days 0, 21 and 35 as appropriate.
  • the neonates were challenged with type specific strains as shown below in Table 6 below.
  • Table 6 Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates in the presence of adjuvant in the active maternal-neonatal challenge mouse model.
  • Table 7 Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates or GBS serotype V conjugate alone in the presence of adjuvant in the active maternal-neonatal challenge mouse model.
  • Table 8 Determination of the protection level, antibody titers and bactericidal titers obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates or GBS serotype V conjugate alone in the presence or absence of adjuvant in the active maternal-neonatal challenge mouse model.
  • Table 9 Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates in the presence of adjuvant at with different doses of GBS serotype V conjugate in the active maternal-neonatal challenge mouse model.
  • Antigen Adjuvant 090 (la) H36B (lb) M781 (III) CJB111 (V)
  • Antibody titers were measured following administration of the mixture of serotype la, lb, III and V conjugates and GBS67 and GBS80 proteins in this study. Results from five separate experiments are shown below:
  • Table 12 Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates, GBS67 protein and a SpbI-GBS80 fusion protein protein in the active maternal-neonatal challenge mouse model.
  • the conjugate comprising capsular saccharide from GBS serotype lb conferred protection against GBS serotype la in addition to GBS serotype lb.
  • mice were immunized with two doses of 1 ⁇ g each of GBS serotype la, lb and III conjugates with aluminum hydroxide adjuvant on days 0 and 21. The neonates were challenged with specific strain types as shown below in Table 14.
  • TT tetanus toxoid
  • Table 14 Determination of the protection achieved by GBS serotype la, lb and III capsular saccharide conjugated to TT or CRM in the active maternal-neonatal challenge mouse model.
  • Table 15 Determination of the protection level, antibody titers and bactericidal titers of GBS serotype la and III capsular saccharide conjugated either to TT or CRM197 and different percentage of oxidation using the active maternal-neonatal challenge mouse model.
  • CRM- III 27.5 S12 co (in) 7 ⁇ ⁇ '' ⁇ 3 3 150
  • CRM- III 01,8 S690 co an) 75 85 m 1 0
  • a combination of the three conjugates with aluminum hydroxide adjuvant was administered by intramuscular injection at a clinical dose of 20/20/20 ⁇ g (based on mass of each saccharide) on days -35, -21 and -7 relative to mating on day 0 (pre-mating period) and on gestation days 7 and 20 or on gestation days 7 or 20 only.
  • Treatment resulted in neither maternal toxicity, effects on mating nor evidence of embryo lethality, fetotoxicity or teratogenicity at any dose level.
  • Test groups of 10 subjects were administered 1 or 2 injections at 5, 10 or 20 ⁇ g (measured as mass of saccharide) doses.
  • Placebo groups of 3 and 2 subjects received 1 and 2 injections of saline respectively.
  • Blood was drawn from each subject at screening and a month after the first injection for analysis by ELISA. Additionally, at 3 months into the study, the 2-injection groups had a blood draw at the time they received the second injection, and then returned a month later for another blood draw. Further blood draws were carried out at 6, 12 and 24 months after the last injection the subject had received.
  • the ELISA measures the concentration of specific antibodies against GBS la (or lb and III in the studies described below) capsular saccharides.
  • Microtiter plates were coated with 1 ⁇ g/ml of the appropriate GBS saccharide (conjugated to HSA) and were incubated with sera from study subjects for lh at 37°C. After 3 washes, the plates were incubated with an alkaline phosphatase (AP) labeled anti-human IgG secondary antibody for 90 min at 37°C followed by additional 3 washes. The substrate (pNPP) was added to the plate and incubated for 30 min at room temperature.
  • AP alkaline phosphatase
  • pNPP alkaline phosphatase
  • the AP catalyzes the hydrolysis of the substrate generating a colorimetric reaction which can be quantified by an ELISA reader at 405 nm (reference filter 650 nm).
  • the evaluation of the antibody concentration was done using a standard curve.
  • a summary of the geometric mean concentration ⁇ g/ml) of anti-la antibodies for each group is given in table 16 below:
  • Table 16 Geometric mean concentrations (and geometric mean ratios) for monovalent GBS serotype la capsular saccharide-CRMl 97 conjugate vaccine study.
  • the number of subjects with antibody levels > 3 ⁇ g/mL showed similar numbers of "responders" across the different doses (1 1, 13 and 12 out of 20 for 5, 10 and 20 doses respectively), and different vaccination schedules (18 out of 20 for both), at a month after the last vaccination (data not shown),.
  • the percentage of subjects with antibody levels > 5 ⁇ g/mL confirmed the same observations (data not shown).
  • These cut-offs were intended to allow responses to be assessed in the context of potential serologic correlates of protection (based on ref. 252). These data suggest that there is no observable contribution by either a second vaccination or a higher vaccine dose. As no dose-response was observed, it is possible that a dose of 5 ⁇ g or lower may be an optimal dose in an adult population.
  • Safety analysis was assessed based on a number of different criteria. No safety issues stood out, and no dose dependent response was noticeable.
  • Test groups of 10 subects were administered 1 or 2 injections at 5, 10 or 20 ⁇ g (measured as mass of saccharide) doses.
  • Placebo groups of 3 and 2 subjects received 1 and 2 injections of saline respectively.
  • Blood was drawn from each subject at screening and a month after the first injection for analysis by ELISA. Additionally, at 3 months into the study, the 2-injection groups had a blood draw at the time they received the second injection, and then returned a month later for another blood draw. Further blood draws were carried out at 6, 12 and 24 months after the last injection the subject had received.
  • Table 17 Geometric mean concentrations (and geometric mean ratios) for monovalent GBS serotype III and lb capsular saccharide-CRMl 97 conjugate vaccines study.
  • Two different vaccine formulations were studied, each combining the three saccharides in equal proportions.
  • Two different doses (5 ⁇ g and 20 ⁇ g, measured as mass of each saccharide, in 0.5 ml) were tested with and without alum adjuvant.
  • the study also evaluated intramuscular 1- and 2-injection (30 days apart) schedules for each formulation.
  • the vaccine also included 4.5 mg sodium choloride, 0.34 mg potassium dihydrogen phosphate and 7.5 mg mannitol.
  • the study groups are summarised in Table 18 below.
  • a placebo group two 0.9% saline injections, 30 days apart) with 20 subjects was also tested.
  • Table 18 Study groups for trivalent GBS serotype la, lb and III capsular saccharide-CRM 197 conjugate vaccine study
  • Table 19 Geometric mean concentrations (and geometric mean ratios) for trivalent GBS serotype la, lb and III capsular saccharide-CRM 197 conjugate vaccine study.
  • the vaccine was immunogenic, inducing in between 80% and 100% of the subjects at least a 2-fold increase in GBS specific antibodies across the different serotypes.
  • a comparison of the GMCs from the eight groups revealed a) no contribution from a second injection compared to a single injection only; b) no contribution from the inclusion of alum adjuvant compared to no adjuvant; and c) no contribution from the higher dose of 20/20/20 ⁇ g versus 5/5/5 ⁇ g.
  • GMC ranged from 2-7 ⁇ g/ml on day 61 of the study and showed no contribution of alum (GMC range [2-4 ⁇ g/ml] compared to no alum (GMC range [4-7 ⁇ g/ml] (95% CI all overlapping)).
  • the data allows an evaluation of the two doses (5 vs 20 ⁇ g of each of the three saccharides in the conjugates).
  • the results suggest that the higher dose (20 ⁇ g) does not induce a higher antibody response.
  • the ratios of GMC for subjects receiving 5 ⁇ g (across all groups) and subjects receiving 20 ⁇ g (across all groups) are 1.2 [95% CI (0.7, 2.1)] for GBS la; 0.7 [95% CI (0.4, 1.2)] for GBS lb and 1.4 [95% CI (0.9, 2.5)] for GBS III.
  • These ratios are close to 1 and the p-values of the statistical test for equality to 1 , are > 0. 15 for all three serotypes, suggesting no discernable differences in the level of induced antibodies between the two dose regimens.
  • Safety was measured by the incidence of local and systemic reactogenicity, adverse events and serious adverse events, as well as clinical laboratory results.
  • the trivalent GBS vaccine was found safe and well tolerated in all of the eight vaccine study groups when compared to placebo. Safety was evaluated by: percentages of subjects with solicited local (i.e injection site pain, ecchymosis, erythema, induration, and swelling) and solicited systemic (i.e.
  • subjects with undetectable Ab levels at study entry also fail to show additional benefit from 2 injections (vs 1 injection), from a higher dosage (vs lower dosage) or from inclusion of alum (vs no adjuvant).
  • the ratio of GMC (on day 61) for all 1 injection vs all 2 injection subjects was 1.1 (0.6-1.8; serotype la), 0.7 (0.3-1.5; serotype III) and 0.9 (0.5-1.4; serotype lb); for all 5 ⁇ g vs.
  • mice were primed with CRM 197 and aluminium hydroxide adjuvant or aluminium hydroxide adjuvant alone at day 0 and then immunized with a GBS serotype Ill/CRM 197 conjugate with or without the adjuvant aluminium hydroxide adjuvant at days 21 and 35. Blood was drawn on day 0 and before vaccination on days 21 and 35. IgG/IgM serum titers to the GBS serotype III polysaccharide and CRM197 carrier protein were measured from the blood samples.
  • priming with the CRM197 carrier resulted in a significantly higher IgG antibody response to the carrier after one and two doses of the vaccine (with or without adjuvant) compared to unprimed mice (P ⁇ 0.0002).
  • Priming also resulted in a good antibody response against the GBS serotype III polysaccharide after two doses of vaccine (with or without adjuvant).
  • Unprimed mice required the adjuvant in order to reach an anti-polysaccharide antibody titer comparable to that observed in primed mice.
  • the glycoconjugate vaccine was administered without adjuvant, the antibody titer was significantly lower than in the other groups (P ⁇ 0.03).
  • Subcutaneous administration of the trivalent vaccine to female rats on study days 1, 15, 29 (premating period) and/or on gestation days 6, 12 and 17 at a dose of 20 ⁇ g with or without aluminum hydroxide resulted in no maternal toxicity or effects on reproductive function or embryofetal development. No differences were noted between groups treated with three or six injections of the trivalent vaccine with or without aluminum hydroxide adjuvant. Additionally, there was no effect on the Fl generation pup survival, clinical condition or body weight or reproductive ability.
  • Intramuscular administration of the trivalent vaccine plus aluminum hydroxide to female rabbits at a dose of 20 ⁇ g on study days 1 , 15 and 29 (premating period) and/or on gestation days 7 and 20, resulted in neither maternal toxicity, effects on mating nor evidence of embryolethality, fetotoxicity or teratogenicity. There were no differences between the adult F l generation of control and vaccine-treated does.
  • the stability of the trivalent GBS serotype la, lb and III capsular saccharide-CRM197 conjugate vaccine was measured during 1 month of storage at two different temperatures.
  • the vaccine was formulated by pooling the three glycoconjugates, each one present at 80 ⁇ g saccharide/ml in 10 mM KH 2 PO 4 and 3% mannitol. 3-ml single dose vials were filled with 0.3 ml of solution, partially capped with bromobuthyl siliconized rubber stopper and submitted to a freeze-drying cycle. Once the lyophilization process was over, the vials were stored at 2-8 °C or 36-38 °C.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Molecular Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Virology (AREA)
  • Toxicology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)

Abstract

The invention provides an immunogenic composition comprising: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein. The invention also provides a method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof.

Description

IMMUNOGENIC COMPOSITIONS
This application claims the benefit of U.S. Provisional Application Serial No. 61/383,668, filed on 16th September 2010; and UK Patent Application No. 1101665.6, filed on 31 st January 2011 , both of which are incorporated by reference herein in their entirety. TECHNICAL FIELD
This invention is in the field of immunogenic compositions comprising conjugates of Streptococcus agalactiae capsular saccharides and carrier proteins. The compositions are useful for immunisation.
BACKGROUND ART
The capsular saccharides of bacteria have been used for many years in vaccines against capsulated bacteria. As saccharides are T-independent antigens, however, they are poorly immunogenic. Conjugation to a carrier can convert T-independent antigens into T-dependent antigens, thereby enhancing memory responses and allowing protective immunity to develop. The most effective saccharide vaccines are therefore based on glycoconjugates, and the prototype conjugate vaccine was against Haemophilus influenzae type b ('Hib') [e.g. see chapter 14 of ref. 84].
Another bacterium for which conjugate vaccines have been described is Streptococcus agalactiae, also known as 'group B streptococcus', or simply as 'GBS'. Much of this work has been performed by Dennis Kasper and colleagues, and is described in documents such as references 1 to 9. Conjugate vaccines for each of GBS serotypes la, lb, II, III, and V have been shown to be safe and immunogenic in humans [10]. However, there remains a need for further and improved GBS conjugate vaccines.
DISCLOSURE OF THE INVENTION
In a first aspect, the invention makes use of one or more conjugates that are capsular saccharides from GBS serotypes la, lb, III or V conjugated to a carrier protein. In particular, the invention provides immunogenic compositions comprising one or more of these conjugates. The compositions may be used as vaccines for preventing infection by these GBS serotype(s).
In a second aspect, the invention provides a method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof. Typically, the conjugate is one of the GBS conjugates in an immunogenic composition of the first aspect of the invention.
Immunogenic compositions
In one embodiment, the invention provides an immunogenic composition comprising a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein. In a second embodiment, the invention provides an immunogenic composition comprising a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein. In a third embodiment, the invention provides an immunogenic composition comprising a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein. In a fourth embodiment, the invention provides an immunogenic composition comprising a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
The immunogenic compositions may comprise more than one conjugate. Embodiments of the invention comprising two, three or four conjugates are described below. Of these compositions, the inventors have found that compositions comprising a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein may confer protection against GBS serotype la in addition to GBS serotype lb. This observation is in contrast to the teaching of reference 1 1 , which suggests that type lb conjugates are not capable of inducing antibodies that can kill type la bacteria. Accordingly, the embodiments described below that comprise a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein may be advantageous in that they provide enhanced protection against serotype la (when the composition also comprises a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein), and may even provide protection when the composition does not comprise a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein.
As described above, the immunogenic compositions may comprise two conjugates. In one embodiment, the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein. In a second embodiment, the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein. In a third embodiment, the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein. In a fourth embodiment, the first conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein. In a fifth embodiment, the first conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein. In a sixth embodiment, the first conjugate is a capsular saccharide from GB S serotype III conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
Similarly, the immunogenic compositions may comprise three conjugates. In one embodiment, the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein and the third conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein. The inventors have found that such compositions (e.g. as exemplified below) are particularly suitable for use as vaccines to prevent infection by GBS. This embodiment is therefore a preferred embodiment of the invention. In a second embodiment, the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein and the third conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein. In a third embodiment, the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein and the third conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein. In a fourth embodiment, the first conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein and the third conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
In the same way, the immunogenic compositions may comprise four conjugates. In one embodiment, the first conjugate is a capsular saccharide from GBS serotype la conjugated to a carrier protein, while the second conjugate is a capsular saccharide from GBS serotype lb conjugated to a carrier protein, the third conjugate is a capsular saccharide from GBS serotype III conjugated to a carrier protein and the fourth conjugate is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
Typically, the immunogenic compositions described above will not comprise any conjugates other than those specifically mentioned, particularly conjugates comprising capsular saccharides from GBS serotypes other than those specifically mentioned. However, in some embodiments, the compositions may comprise other conjugates, including conjugates comprising capsular saccharides from other GBS serotypes. For example, the compositions may comprise a conjugate that is a capsular saccharide from GBS serotype II conjugated to a carrier protein. Similarly, the compositions may comprise a conjugate that is a capsular saccharide from GBS serotype VI conjugated to a carrier protein. In another possibility, the compositions may comprise a conjugate that is a capsular saccharide from GBS serotype VIII conjugated to a carrier protein.
The immunogenic compositions described above may comprise any suitable amount of the capsular saccharide(s) per unit dose. Suitable amounts of the capsular saccharide(s) may be from 0.1 to 50 μg per unit dose. Typically, each GBS capsular saccharide is present at an amount from 1 to 30μg, for example from 2 to 25 μg, and in particular from 5 to 20 μg. Suitable amounts of the capsular saccharide(s) may include 5, 10 and 20 μg per unit dose. The inventors have found that these amounts are suitable, particularly when the immunogenic composition comprises capsular saccharides from GBS serotypes la, lb and/or III. Suitable amounts per unit dose of each capsular saccharide in the embodiments described above may therefore be selected from the numbered options in the following tables, wherein the relevant embodiment is indicated by reference to the serotype(s) from which the capsular saccharide(s) in the composition are derived: Table A - Immunogenic compositions comprising one conjugate
Figure imgf000005_0001
Table B - Immunogenic compositions comprising two conjugates
Figure imgf000005_0002
Table C - Immunogenic compositions comprising three conjugates
Figure imgf000005_0003
III: 10 V: 10 μ§ V: 10 μ§ V: 10 μ§ la: 5 μg la: 5 μg la: 5 μg lb: 5 μg
9 lb: 20 lb: 20 μg III: 20 μg III: 20 μg
III: 20 g V: 20 μ§ V: 20 μ§ V: 20 μ§ la: 10 μg la: 10 μg la: 10 μg lb: 10 μg
10 lb: 5 μg lb: 5 μg III: 5 μ§ III: 5 μ§
III: 5 μ§ ν: 5 μ§ ν: 5 μ§ ν: 5 μ§ la: 10 μg la: 10 μg la: 10 μg lb: 10 μg
11 lb: 5 μg lb: 5 μg III: 5 μ§ III: 5 μ§
III: 10 μg V: 10 μ§ V: 10 μ§ V: 10 μ§ la: 10 μg la: 10 μg la: 10 μg lb: 10 μg
12 lb: 5 μg lb: 5 μg III: 5 μ§ III: 5 μ§
III: 20 μg V: 20 μ§ V: 20 μ§ V: 20 μ§ la: 10 μg la: 10 μg la: 10 μg lb: 10 μg
13 lb: 10 μg lb: 10 μg III: 10 μg III: 10 μg
III: 5 μ§ ν: 5 μ§ ν: 5 μ§ ν: 5 μ§ la: 10 μg la: 10 μg la: 10 μg lb: 10 μg
14 lb: 10 μg lb: 10 μg III: 10 μg III: 10 μg
III: 10 μg V: 10 μ§ V: 10 μ§ V: 10 μ§ la: 10 μg la: 10 μg la: 10 μg lb: 10 μg
15 lb: 10 μg lb: 10 μg III: 10 μg III: 10 μg
III: 20 μg V: 20 μ§ V: 20 μ§ V: 20 μ§ la: 10 μg la: 10 μg la: 10 μg lb: 10 μg
16 lb: 20 μg lb: 20 μg III: 20 μg III: 20 μg
III: 5 μ§ ν: 5 μ§ ν: 5 μ§ ν: 5 μ§ la: 10 μg la: 10 μg la: 10 μg lb: 10 μg
17 lb: 20 μg lb: 20 μg III: 20 μg III: 20 μg
III: 10 μg V: 10 μ§ V: 10 μ§ V: 10 μ§ la: 10 μg la: 10 μg la: 10 μg lb: 10 μg
18 lb: 20 μg lb: 20 μg III: 20 μg III: 20 μg
III: 20 μg V: 20 μ§ V: 20 μ§ V: 20 μ§ la: 20 μg la: 20 μg la: 20 μg lb: 20 μg
19 lb: 5 μg lb: 5 μg III: 5 μ§ III: 5 μ§
III: 5 μ§ ν: 5 μ§ ν: 5 μ§ ν: 5 μ§ la: 20 μg la: 20 μg la: 20 μg lb: 20 μg
20 lb: 5 μg lb: 5 μg III: 5 μ§ III: 5 μ§
III: 10 μg V: 10 μ§ V: 10 μ§ V: 10 μ§ la: 20 μg la: 20 μg la: 20 μg lb: 20 μg
21 lb: 5 μg lb: 5 μg III: 5 μ§ III: 5 μ§
III: 20 μg V: 20 μ§ V: 20 μ§ V: 20 μ§ la: 20 μg la: 20 μg la: 20 μg lb: 20 μg
22 lb: 10 μg lb: 10 μg III: 10 μg III: 10 μg
III: 5 μ§ ν: 5 μ§ ν: 5 μ§ ν: 5 μ§ la: 20 μg la: 20 μg la: 20 μg lb: 20 μg
23 lb: 10 μg lb: 10 μg III: 10 μg III: 10 μg
III: 10 μg V: 10 μ§ V: 10 μ§ V: 10 μ§ la: 20 μg la: 20 μg la: 20 μg lb: 20 μg
24 lb: 10 μg lb: 10 μg III: 10 μg III: 10 μg
III: 20 μg V: 20 μ§ V: 20 μ§ V: 20 μ§ la: 20 μg la: 20 μg la: 20 μg lb: 20 μg
25 lb: 20 μg lb: 20 μg III: 20 μg III: 20 μg
III: 5 μ§ ν: 5 μ§ ν: 5 μ§ ν: 5 μ§ la: 20 μg la: 20 μg la: 20 μg lb: 20 μg
26 lb: 20 μg lb: 20 μg III: 20 μg III: 20 μg
III: 10 μg V: 10 μ§ V: 10 μ§ V: 10 μ§ la: 20 μg la: 20 μg la: 20 μg lb: 20 μg
27 lb: 20 μg lb: 20 μg III: 20 μg III: 20 μg
III: 20 μg V: 20 μ§ V: 20 μ§ V: 20 μ§ Of the dosing options described in Table C, the inventors have found that options 1, 14 and 27 are effective, particularly when the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein. These dosing options are therefore preferred for use in the invention, particularly for this embodiment. It may be advantageous to minimise the total amount of capsular saccharide(s) per unit dose in order to reduce potential toxicity. Accordingly, dosing option 1 is particularly preferred.
It may be possible to further minimise the amount of capsular saccharide(s) per unit dose. In particular, suitable amounts of the capsular saccharide(s) may be from 0.1 to 5 μg per unit dose. Typically, each GBS capsular saccharide may therefore be present at an amount from 0.1 to 5 μg, e.g. 0.5, 2.5 or 5 μg, per unit dose. For example, each GBS capsular saccharide may be present at an amount from 0.5 to 5 μg, 1 to 4 μg, 2 to 3 μg, or about 2.5 μg per unit dose. The inventors envisage that these amounts will be suitable, particularly when the immunogenic composition comprises a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein. Suitable amounts per unit dose of each capsular saccharide in this embodiment may therefore be selected from the numbered options in the table below:
Table C - Immunogenic compositions comprising capsular saccharides from GBS serotypes la, lb and III
Figure imgf000007_0001
21 5 0.5 5
22 5 2.5 0.5
23 5 2.5 2.5
24 5 2.5 5
25 5 5 0.5
26 5 5 2.5
27 5 5 5
Of the dosing options described in Table C, the inventors particulary envisage options 1 , 14 and 27. In these options, the amount of each GBS capsular saccharide is the same (e.g. as in the higher dose compositions exemplified below).
Table D - Immunogenic compositions comprising four conjugates
Figure imgf000008_0001
Figure imgf000009_0001
Figure imgf000010_0001
In the embodiments described above wherein the immunogenic composition comprises more than one conjugate, the ratio of the mass of a given capsular saccharide to the mass of the other capsular saccharide(s) may vary. Suitable ratios (w/w) for each capsular saccharide in the embodiments described above may therefore be selected from the numbered options in the following tables, wherein the relevant embodiment is indicated by reference to the serotype(s) from which the capsular saccharide(s) in the composition are derived:
Table E - Immunogenic compositions comprising two conjugates
Figure imgf000010_0002
Table F - Immunogenic compositions comprising three conjugates
Figure imgf000010_0003
Of the ratio options described in Table F, the inventors have found that option 1 is effective, particularly when the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein. This ratio option is therefore preferred for use in the invention, particularly for this embodiment.
Table G - Immunogenic compositions comprising four conjugates
Figure imgf000011_0001
As discussed above, the invention relates in part to immunogenic compositions comprising a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein. The inventors have found that the immune response to the capsular saccharide from GBS serotype V in these compositions may be diminished if the immunogenic composition comprises one or more further antigen(s). Without wishing to be bound by theory, it is thought that the presence of the further antigen(s) results in "immune interference", with the response to the capsular saccharide from GBS serotype V being diminished.
The inventors have found that the response to the capsular saccharide from GBS serotype V in these immunogenic compositions may be improved if the composition comprises an adjuvant. This observation is in contrast to the teaching of reference 12, which suggests that adjuvants may not improve the immune response to GBS conjugates. Accordingly, in another embodiment the invention provides an immunogenic composition comprising: a) a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein; b) one or more antigens that do not comprise a capsular saccharide from GBS serotype V; and c) an adjuvant. The antigen(s) of component b) may be conjugate(s) comprising capsular saccharide(s) from other GBS serotype(s). For example, these conjugate(s) may be capsular saccharide(s) from GBS serotype(s) la, lb and/or III conjugated to carrier protein(s). Accordingly, this embodiment of the invention encompasses any of the immunogenic compositions described herein that comprise a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein and further comprise one or more conjugates that are capsular saccharides from GBS serotypes la, lb and/or III conjugated to carrier proteins, wherein the composition further comprises an adjuvant. Alternatively, the antigen(s) of component b) may be other kind(s) of antigen, e.g. the antigens described under the headings "Combinations of conjugates and other antigens" and "GBS protein antigens" below. Accordingly, this embodiment of the invention also encompasses any of the immunogenic compositions described herein that include a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein and one or more antigens that do not comprise conjugates comprising capsular saccharide(s) from other GBS serotype(s), wherein the composition further comprises an adjuvant. The inventors have found that the adjuvant in this embodiment of the invention may, for example, be an aluminium salt, as described below. The skilled person would be capable of identifying other adjuvants that may be used in these compositions.
The inventors have also found that the response to the capsular saccharide from GBS serotype V may be improved if the dose of this capsular saccharide is increased. In particular, if the immunogenic composition comprises a conjugate that is a capsular saccharide from a GBS serotype other than type V conjugated to a carrier protein, then the response to the type V capsular saccharide may be improved if the dose of the type V capsular saccharide is greater than the dose of the capsular saccharide from the other GBS serotype. Accordingly, in another embodiment the present invention provides an immunogenic composition comprising: a) a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein; b) one or more conjugates, each of which is a capsular saccharide from a GBS serotype other than type V conjugated to a carrier protein; wherein the dose of the type V capsular saccharide is greater than the total dose(s) of the capulsular saccharide(s) from the other GBS serotype(s), or is greater than at least one of the doses or the mean dose of the capsular sacchardes from the other GBS serotypes. The dose of the type V capsular saccharide may be 1.1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 times greater. When component b) comprises more than one conjugate, it is typical for the dose of the type V capsular saccharide to be greater than the mean dose of the capsular saccharides from the other GBS serotypes. The conjugate(s) of component b) may be conjugates comprising capsular saccharides from any GBS serotype other than type V. For example, these conjugate(s) may be capsular saccharide(s) from GBS serotype(s) la, lb and/or III conjugated to carrier protein(s). Accordingly, this embodiment of the invention encompasses any of the immunogenic compositions described herein that comprise a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein and further comprises one or more conjugates that are capsular saccharides from GBS serotypes la, lb and/or III conjugated to carrier proteins; wherein the dose of the type V capsular saccharide is greater than the total dose(s) of the capulsular saccharide(s) from the other GBS serotype(s), or is greater than at least one of the doses or the mean dose of the capsular sacchardes from the other GBS serotypes . The inventors have also found that the immune response to the capsular saccharides from the other GBS serotype(s) in these compositions may be diminished by the greater dose of the type V capsular saccharide. This consequence may be reduced if the composition comprises an adjuvant, as described above. Again, this observation is in contrast to the teaching of reference 12, which suggests that adjuvants may not improve the immune response to GBS conjugates.
Methods of administering the immunogenic compositions of the invention are discussed below. Briefly, the immunogenic compositions of the invention may be administered in single or multiple doses. The inventors have found that the administration of a single dose of the immunogenic compositions of the invention is effective, particularly when the immunogenic composition comprises capsular saccharides from GBS serotypes la, lb and/or III; and more particularly when the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein. Administration of a single dose is therefore preferred in the invention, particularly for these embodiments.
Alternatively, one unit dose followed by a second unit dose may be effective. Typically, the second (or third, fourth, fifth etc.) unit dose is identical to the first unit dose. The second unit dose may be administered at any suitable time after the first unit dose, in particular after 1 , 2 or 3 months. For example, if the immunogenic composition comprises capsular saccharides from GBS serotypes la, lb and/or III, then the second unit dose may be administered 3 months after the first unit dose. In another example, if the immunogenic composition comprises capsular saccharides from GBS serotypes V, then the second unit dose may be administered 1 month after the first unit dose. Typically, the the immunogenic compositions of the invention will be administered intramuscularly, e.g. by intramuscular administration to the thigh or the upper arm as described below.
As described below, immunogenic compositions of the invention may include one or more adjuvants. However, the inventors have found that the us e o f unadjuvanted compositions is effective, particularly when the immunogenic composition comprises capsular saccharides from GBS serotypes la, lb and/or III; and more particularly when the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GB S serotype III conjugated to a carrier protein. It may be advantageous to omit adjuvants in order to reduce potential toxicity. Accordingly, immunogenic compositions that do not contain any adjuvant (especially that do not contain any aluminium salt adjuvant) are preferred for use in the invention, particularly for these embodiments. The capsular saccharide
The invention is based on the capsular saccharide of Streptococcus agalactiae. The capsular saccharide is covalently linked to the peptidoglycan backbone of GBS, and is distinct from the group B antigen, which is another saccharide that is attached to the peptidoglycan backbone.
The GBS capsular saccharides are chemically related, but are antigenically very different. All GBS capsular psaccharides share the following trisaccharide core:
-D-Glc NAc(l→3) -D-Gal (l→4) -D-Glc
The various GBS serotypes differ by the way in which this core is modified. The difference between serotypes la and III, for instance, arises from the use of either the GlcNAc (la) or the Gal (III) in this core for linking consecutive trisaccharide cores (Figure 1). Serotypes la and lb both have a [a-D-Neu/?NAc(2→3)P-D-Gal/ (l→] disaccharide linked to the GlcNAc in the core, but the linkage is either 1→4 (la) or 1→3 (lb).
GBS-related disease arises primarily from serotypes la, lb, II, III, IV, V, VI, VII, and VIII, with over 85% being caused by five serotypes: la, lb, III & V. The invention preferably uses a saccharide from one or more of these four serotypes, particularly from one or more of serotypes: la, lb & III. As shown in Figure 2, the capsular saccharides of each of these four serotypes include: (a) a terminal N- acetyl-neuraminic acid (NeuNAc) residue (commonly referred to as sialic acid), which in all cases is linked 2→3 to a galactose residue; and (b) a N-acetyl-glucosamine residue (GlcNAc) within the trisaccharide core.
All four saccharides include galactose residues within the trisaccharide core, but serotypes la, lb, II & III also contain additional galactose residues in each repeating unit.
Saccharides used according to the invention may be in their native form, or may have been modified. For example, the saccharide may be shorter than the native capsular saccharide, or may be chemically modified. In particular, the serotype V capsular saccharide used in the invention may be modified as described in refs. 13 and 14. For example, a serotype V capsular saccharide that has been substantially desialylated (Figure 3) as described in refs. 13 and 14 is specifically envisaged for use in the present invention. Desialylated GBS serotype V capsular saccharide may be prepared by treating purified GBS serotype V capsular saccharide under mildly acidic conditions (e.g. 0.1M sulphuric acid at 80°C for 60 minutes) or by treatment with neuraminidase, as described in reference 13. A preferred method for preparaing desialylated GBS serotype V capsular saccharide is by treating the purified saccharide with 1M acetic acid at 81°C +/-3C° for 2h.Thus the saccharide used according to the invention may be a substantially full-length capsular polysaccharide, as found in nature, or it may be shorter than the natural length. Full-length polysaccharides may be depolymerised to give shorter fragments for use with the invention e.g. by hydrolysis in mild acid, by heating, by sizing chromatography, etc. Chain length has been reported to affect immunogenicity of GBS saccharides in rabbits [4]. In particular, the serotype II and/or III capsular saccharides used in the invention may be depolymerised as described in refs. 15 and 16. These documents describe the partial depolymerization of type II and type III capsular saccharides by mild deaminative cleavage to antigenic fragments with reducing-terminal 2,5-anhydro-D-mannose residues. Briefly, the capsular saccharide is dissolved in 0.5 N NaOH and heated at 70°C for between about l-4h. The length of this incubation controls the degree of depolymerisation, which may be determined by standard methods (e.g. by HPLC as described in reference 15). The sample is chilled in an ice-water bath before glacial acetic acid is added to bring the pH to 4. The partially N-deacylated product is then deaminated by the addition of 5% (wt/vol) NaNC>2 with stirring at 4°C for 2h. The free aldehydes of the newly formed 2,5-anhydro-D-mannose residues may be used for conjugation to a carrier protein, as described below.
Depolymerisation of the serotype III capsular saccharide by endo- -galactosidase has been reported [refs. 1 & 4-6], including using the depolymerised material to form conjugates with a tetanus toxoid carrier. Ozonolysis of capsular polysaccharides from GBS serotypes III and VIII has also been used for depolymerisation [17]. It is preferred to use saccharides with MW>30kDa, and substantially full- length capsular polysaccharides can be used. For serotype la, it is preferred to use polysaccharides with a MW in the range of 150-300kDa, particularly 175-275 kDa. Typically, a serotype la saccharide with MW about 200 kDa or about 260 kDa is used. For serotype lb, it is preferred to use polysaccharides with a MW in the range of 150-300kDa, particularly 175-250 kDa. Typically, a serotype lb saccharide with MW about 200 kDa or about 230 kDa is used. For serotype III, it is preferred to use polysaccharides with a MW in the range of 50-200kDa, particularly 80-150kDa. Typically, a serotype III saccharide with MW about 100 kDa or about 140kDa is used. For serotype V, it is also preferred to use polysaccharides with a MW up to ~50kDa. Typically, a serotype V saccharide with MW about 100 kDa is used. These molecular masses can be measured by gel filtration relative to dextran standards, such as those available from Polymer Standard Service [18].
The saccharide may be chemically modified relative to the capsular saccharide as found in nature. For example, the saccharide may be de-O-acetylated (partially or fully), de-N-acetylated (partially or fully), N-propionated (partially or fully), etc. De-acetylation may occur before, during or after conjugation, but preferably occurs before conjugation. Depending on the particular saccharide, de-acetylation may or may not affect immunogenicity. The relevance of O-acetylation on GBS saccharides in various serotypes is discussed in reference 19, and in some embodiments O-acetylation of sialic acid residues at positions 7, 8 and/or 9 is retained before, during and after conjugation e.g. by protection/de-protection, by re-acetylation, etc. However, typically the GBS saccharide used in the present invention has substantially no O-acetylation of sialic acid residues at positions 7, 8 and/or 9. In particular, when the GBS saccharide has been purified by base extraction as described below, then O-acetylation is typically lost (ref. 19). The effect of de-acetylation etc. can be assessed by routine assays.
Capsular saccharides can be purified by known techniques, as described in the references herein such as refs. 2 and 20. A typical process involves base extraction, centrifugation, filtration, RNase/DNase treatment, protease treatment, concentration, size exclusion chromatography, ultrafiltration, anion exchange chromatography, and further ultrafiltration. Treatment of GBS cells with the enzyme mutanolysin, which cleaves the bacterial cell wall to free the cell wall components, is also useful.
As an alternative, the purification process described in reference 21 can be used. This involves base extraction, ethanol/CaCi2 treatment, CTAB precipitation, and re-solubilisation. A further alternative process is described in reference 22.
The invention is not limited to saccharides purified from natural sources, however, and the saccharides may be obtained by other methods, such as total or partial synthesis.
Conjugation
The invention involves conjugates that are capsular saccharides from GBS serotypes la, lb, III or V conjugated to a carrier protein In general, covalent conjugation of saccharides to carriers enhances the immunogenicity of saccharides as it converts them from T-independent antigens to T-dependent antigens, thus allowing priming for immunological memory. Conjugation is particularly useful for paediatric vaccines [e.g. ref. 23] and is a well known technique [e.g. reviewed in refs. 24 to 32]. Thus the processes of the invention may include the further step of conjugating the purified saccharide to a carrier molecule.
Conjugation of GBS saccharides has been widely reported e.g. see references 1 to 9. The typical prior art process for GBS saccharide conjugation typically involves reductive amination of a purified saccharide to a carrier protein such as tetanus toxoid (TT) or CRM 197 [2]. The reductive amination involves an amine group on the side chain of an amino acid in the carrier and an aldehyde group in the saccharide. As GBS capsular saccharides do not include an aldehyde group in their natural form then this is typically generated before conjugation by oxidation (e.g. periodate oxidation) of a portion (e.g. between 5 and 40%, particularly between 10 and 30%, preferably about 20%) of the saccharide's sialic acid residues [2,33]. Conjugate vaccines prepared in this manner have been shown to be safe and immunogenic in humans for each of GB S serotypes la, lb, II, III, and V [10]. Typically, all of the conjugates in the immunogenic compositions of the present invention have been prepared in this manner. However, when the invention uses a serotype V capsular saccharide that is desialylated, then an aldehyde group may be generated in this saccharide before conjugation by oxidation (e.g. periodate oxidation) of a portion (e.g. between 5 and 40%, particularly between 10 and 30%), preferably about 20%>) of the saccharide's galactose residues [14]. An alternative conjugation process involves the use of -NH2 groups in the saccharide (either from de-N-acetylation, or after introduction of amines) in conjunction with bifunctional linkers, as described in ref. 34. In some embodiments, one or more of the conjugates in the immunogenic compositions of the present invention have been prepared in this manner. A further alternative process is described in refs. 15 and 16. In this process, the free aldehydes groups of terminal 2,5-anhydro-D-mannose residues from depolymerization of type II or type III capsular saccharides by mild deaminative cleavage are used for conjugation by reductive amination. In some embodiments, one or more of the conjugates in the immunogenic compositions of the present invention have been prepared in this manner. The invention involves the use of carrier molecules, which are typically proteins. Useful carrier proteins include bacterial toxins or toxoids, such as diphtheria toxoid or tetanus toxoid. Fragments of toxins or toxoids can also be used e.g. fragment C of tetanus toxoid [35]. The CRM197 mutant of diphtheria toxin [36-38] is a particularly useful with the invention. Other suitable carrier proteins include the N. meningitidis outer membrane protein [39], synthetic peptides [40,41], heat shock proteins [42,43], pertussis proteins [44,45], cytokines [46], lymphokines [46], hormones [46], growth factors [46], human serum albumin (preferably recombinant), artificial proteins comprising multiple human CD4+ T cell epitopes from various pathogen-derived antigens [47] such as N19 [48], protein D from H.influenzae [49,50], pneumococcal surface protein PspA [51], pneumolysin [52], iron- uptake proteins [53], toxin A or B from C.difficile [54], recombinant Pseudomonas aeruginosa exoprotein A (rEPA) [55], a GBS protein (see below; particularly GBS67) [206], etc.
Attachment to the carrier is preferably via a -NH2 group e.g. in the side chain of a lysine residue in a carrier protein, or of an arginine residue, or at the N-terminus. Attachment may also be via a -SH group e.g. in the side chain of a cysteine residue.
It is possible to use more than one carrier protein e.g. to reduce the risk of carrier suppression. Thus different carrier proteins can be used for different GBS serotypes e.g. serotype la saccharides might be conjugated to CRM 197 while serotype lb saccharides might be conjugated to tetanus toxoid. It is also possible to use more than one carrier protein for a particular saccharide antigen e.g. serotype III saccharides might be in two groups, with some conjugated to CRM 197 and others conjugated to tetanus toxoid. In general, however, it is preferred to use the same carrier protein for all saccharides.
A single carrier protein might carry more than one saccharide antigen [56,57]. For example, a single carrier protein might have conjugated to it saccharides from serotypes la and lb. To achieve this goal, different saccharides can be mixed prior to the conjugation reaction. In general, however, it is preferred to have separate conjugates for each serogroup, with the different saccharides being mixed after conjugation. The separate conjugates may be based on the same carrier.
Conjugates with a saccharide :protein ratio (w/w) of between 1 :5 {i.e. excess protein) and 5:1 {i.e. excess saccharide) are typically used, in particular ratios between 1 :5 and 2: 1. When the invention uses a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein, then the saccharide:protein ratio (w/w) is typically between about 1 : 1 to 1 :2, particularly about 1 : 1.3. Similarly, when the invention uses a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein, then the ratio is typically between about 1 : 1 to 1 :2, particularly about 1 : 1.3. When the invention uses a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein, then the saccharide:protein ratio (w/w) is typically between about 3: 1 to 1 : 1 , particularly about 2: 1. However, GBS serotype III conjugated to a carrier protein with a saccharide:protein ratio (w/w) of about 1 : 1 to 1 :5, particularly about 1 :3.3, may also be used. Finally, when the invention uses a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein, then the ratio is typically between about 2: 1 to 1 : 1, particularly about 1.1 : 1. Thus a weight excess of saccharide is typical, particularly with longer saccharide chains.
Compositions may include a small amount of free carrier [58]. When a given carrier protein is present in both free and conjugated form in a composition of the invention, the unconjugated form is preferably no more than 5% of the total amount of the carrier protein in the composition as a whole, and more preferably present at less than 2% by weight.
After conjugation, free and conjugated saccharides can be separated. There are many suitable methods, including hydrophobic chromatography, tangential ultrafiltration, diafiltration etc. [see also refs. 59 & 60, etc.]. A preferred method is described in reference 61.
Where the composition of the invention includes a depolymerised oligosaccharide, it is preferred that depolymerisation precedes conjugation.
Combinations of conjugates and other antigens
The immunogenic compositions of the invention may comprise one or more further antigens.
The further antigen(s) may comprise further GBS conjugates. The different GBS conjugates may include different types of conjugate from the same GBS serotype and/or conjugates from different GBS serotypes. The composition will typically be produced by preparing separate conjugates (e.g. a different conjugate for each serotype) and then combining the conjugates.
The further antigen(s) may comprise GBS amino acid sequences, as set out below.
The further antigen(s) may comprise antigens from non-GBS pathogens. Thus the compositions of the invention may further comprise one or more non-GBS antigens, including additional bacterial, viral or parasitic antigens. These may be selected from the following:
- a protein antigen from N. meningitidis serogroup B, such as those in refs. 62 to 68, with protein '287' (see below) and derivatives (e.g. 'AG287') being particularly preferred.
- an outer-membrane vesicle (OMV) preparation from N. meningitidis serogroup B, such as those disclosed in refs. 69, 70, 71, 72 etc.
- a saccharide antigen from N. meningitidis serogroup A, C, W135 and/or Y, such as the oligosaccharide disclosed in ref. 73 from serogroup C or the oligosaccharides of ref. 74.
- a saccharide antigen from Streptococcus pneumoniae [e.g. refs. 75-77; chapters 22 & 23 of ref. 84].
- an antigen from hepatitis A virus, such as inactivated virus [e.g. 78, 79; chapter 15 of ref. 84].
- an antigen from hepatitis B virus, such as the surface and/or core antigens [e.g. 79,80; chpater 16 of ref. 84].
- an antigen from hepatitis C virus [e.g. 81]. - an antigen from Bordetella pertussis, such as pertussis holotoxin (PT) and filamentous haemagglutinin (FHA) from B. pertussis, optionally also in combination with pertactin and/or agglutinogens 2 and 3 [e.g. refs. 82 & 83; chapter 21 of ref. 84].
- a diphtheria antigen, such as a diphtheria toxoid [e.g. chapter 13 of ref. 84].
- a tetanus antigen, such as a tetanus toxoid [e.g. chapter 27 of ref. 84].
- a saccharide antigen from Haemophilus influenzae B [e.g. chapter 14 of ref. 84]
- an antigen from N .gonorrhoeae [e.g. 62, 63, 64].
- an antigen from Chlamydia pneumoniae [e.g. 85, 86, 87, 88, 89, 90, 91].
- an antigen from Chlamydia trachomatis [e.g. 92].
- an antigen from Porphyromonas gingivalis [e.g. 93].
- polio antigen(s) [e.g. 94, 95; chapter 24 of ref. 84] such as IPV.
- rabies antigen(s) [e.g. 96] such as lyophilised inactivated virus [e.g.97, RabAvert™].
- measles, mumps and/or rubella antigens [e.g. chapters 19, 20 and 26 of ref. 84].
- influenza antigen(s) [e.g. chapters 17 & 18 of ref. 84], such as the haemagglutinin and/or neuraminidase surface proteins.
- an antigen from Moraxella catarrhalis [e.g. 98].
- an antigen from Streptococcus pyogenes (group A streptococcus) [e.g. 99, 100, 101].
- an antigen from Staphylococcus aureus [e.g. 102].
Where a saccharide or carbohydrate antigen is used, it is preferably conjugated to a carrier in order to enhance immunogenicity. Conjugation of H.influenzae B, meningococcal and pneumococcal saccharide antigens is well known.
Toxic protein antigens may be detoxified where necessary (e.g. detoxification of pertussis toxin by chemical and/or genetic means [83]).
Where a diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens. Similarly, where a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens. Similarly, where a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.
Antigens may be adsorbed to an aluminium salt. Where there is more than one conjugate in a composition, not all conjugates need to be adsorbed.
One type of preferred composition includes further antigens from sexually-transmitted pathogens, such as: herpesvirus; N. gonorrhoeae; C. trachomatis; etc. Another type of preferred composition includes further antigens that affect the elderly and/or the immunocompromised, and so the GBS antigens of the invention can be combined with one or more antigens from the following non-GBS pathogens: influenza virus, Enterococcus faecalis, Staphylococcus aureus, Staphylococcus epidermis, Pseudomonas aeruginosa, Legionella pneumophila, Listeria monocytogenes, Neisseria meningitidis, and parainfluenza virus. Antigens in the composition will typically be present at a concentration of at least ^g/ml each. In general, the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.
As an alternative to using proteins antigens in the composition of the invention, nucleic acid encoding the antigen may be used [e.g. refs. 103 to 111]. Protein components of the compositions of the invention may thus be replaced by nucleic acid (preferably DNA e.g. in the form of a plasmid) that encodes the protein.
In practical terms, there may be an upper limit to the number of antigens included in compositions of the invention. The number of antigens (including GBS antigens) in a composition of the invention may be less than 20, less than 19, less than 18, less than 17, less than 16, less than 15, less than 14, less than 13, less than 12, less than 11 , less than 10, less than 9, less than 8, less than 7, less than 6, less than 5, less than 4, less than 3, or less than 2. The number of GBS antigens in a composition of the invention may be less than 6, less than 5, less than 4, less than 3, or less than 2.
Pharmaceutical methods and uses
The immunogenic compositions of the invention may further comprise a pharmaceutically acceptable carrier. Typical 'pharmaceutically acceptable carriers' include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Suitable carriers are typically large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose [112], trehalose [113], lactose, and lipid aggregates (such as oil droplets or liposomes). Such carriers are well known to those of ordinary skill in the art. The vaccines may also contain diluents, such as water, saline, glycerol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present. Sterile pyrogen- free, phosphate-buffered physiologic saline is a typical carrier. A thorough discussion of pharmaceutically acceptable excipients is available in reference 114.
Compositions of the invention may be in aqueous form {i.e. solutions or suspensions) or in a dried form {e.g. lyophilised). If a dried vaccine is used then it will be reconstituted into a liquid medium prior to injection. Lyophilisation of conjugate vaccines is known in the art e.g. the Menjugate™ product is presented in lyophilised form. When the immunogenic compositions of the invention include conjugates comprising capsular saccharides from more than one GBS serotypes, it is typical for the conjugates to be prepared separately, mixed and then lyophilised. In this way, lyophilised compositions comprising two, three or four etc. conjugates as described herein may be prepared. To stabilise conjugates during lyophilisation, it may be preferred to include a sugar alcohol {e.g. mannitol) and/or a disaccharide {e.g. sucrose or trehalose) e.g. at between lmg/ml and 30mg/ml {e.g. about 25 mg/ml) in the composition. The use of sucrose has been recommended as a stabiliser for GBS conjugate vaccines (ref. 115). However, it is typical for the stabiliser of the present invention to be mannitol. When the dried vaccine is reconstituted into a liquid medium prior to injection, the concentration of residual mannitol will typically be about 2-20mg/ml, e.g. 3.75mg/ml, 7.5mg/ml or 15mg/ml. The use of mannitol is advantageous because mannitol is chemically distinct from the monosaccharide subunits of the GBS capsular saccharides. This means that detection of the capsular saccharides, e.g. for quality control analysis, can be based on the presence of the subunits of the saccharides without intereference from the mannitol. In contrast, a stabiliser like sucrose contains glucose, which may interfere with the detection of glucose subunits in the saccharides.
Compositions may be presented in vials, or they may be presented in ready-filled syringes. The syringes may be supplied with or without needles. A syringe will include a single dose of the composition, whereas a vial may include a single dose or multiple doses.
Aqueous compositions of the invention are also suitable for reconstituting other vaccines from a lyophilised form. Where a composition of the invention is to be used for such extemporaneous reconstitution, the invention provides a kit, which may comprise two vials, or may comprise one ready- filled syringe and one vial, with the contents of the syringe being used to reactivate the contents of the vial prior to injection.
Compositions of the invention may be packaged in unit dose form or in multiple dose form. For multiple dose forms, vials are preferred to pre-filled syringes. Effective dosage volumes can be routinely established, but a typical human dose of the composition has a volume of 0.5ml e.g. for for intramuscular injection.
The pH of the composition is preferably between 6 and 8, preferably about 7. Stable pH may be maintained by the use of a buffer. The immunogenic compositions of the invention typically comprise a potassium dihydrogen phosphate buffer. The potassium dihydrogen phosphate buffer may comprise about 1-10 mM potassium dihydrogen phosphate, e.g. 1.25 mM, 2.5 mM or 5.0 mM. If a composition comprises an aluminium hydroxide salt, it is preferred to use a histidine buffer [116]. The composition may be sterile and/or pyrogen- free. Compositions of the invention may be isotonic with respect to humans.
Compositions of the invention are immunogenic, and are more preferably vaccine compositions. Vaccines according to the invention may either be prophylactic {i.e. to prevent infection) or therapeutic {i.e. to treat infection), but will typically be prophylactic. Immunogenic compositions used as vaccines comprise an immunologically effective amount of antigen(s), as well as any other components, as needed. By 'immunologically effective amount', it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated {e.g. non-human primate, primate, etc.), the capacity of the individual's immune system to synthesise antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
Within each dose, the quantity of an individual saccharide antigen will generally be between 0.1- 50 μg (measured as mass of saccharide), particularly between 1-50 μg or 0.5-25μg, more particularly 2.5-7^g, e.g. about ^g, about 2^g, about 5μg, about 10μg, about 15μg, about 20μg or about 25 μg. Within each dose, the total quantity of GBS capsular saccharides will generally be < 70 μg (measured as mass of saccharide), e.g. < 60 μg. In particular, the the total quantity may be < 40 μg (e.g. < 30 μg) or < 20 μg (e.g. < 15 μg). The inventors have found that these total quantities are effective, particularly when the immunogenic composition comprises: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein. These total quantities are therefore preferred for use in the invention, particularly for this embodiment. It may be advantageous to minimise the total quantity of capsular saccharide(s) per unit dose in order to reduce potential toxicity. Accordingly, a total quantity of < 20 μg is preferred, e.g. < 15 μg, < 7.5 μg or < 1.5 μg.
GBS affects various areas of the body and so the compositions of the invention may be prepared in various forms. For example, the compositions may be prepared as injectables, either as liquid solutions or suspensions. The composition may be prepared for pulmonary administration e.g. as an inhaler, using a fine powder or a spray. The composition may be prepared as a suppository or pessary. The composition may be prepared for nasal, aural or ocular administration e.g. as spray, drops, gel or powder [e.g. refs 117 & 118]. Success with nasal administration of pneumococcal saccharides [119,120], Hib saccharides [121], MenC saccharides [122], and mixtures of Hib and MenC saccharide conjugates [123] has been reported.
Compositions of the invention may include an antimicrobial, particularly when packaged in multiple dose format.
Compositions of the invention may comprise detergent e.g. a Tween (polysorbate), such as Tween 80. Detergents are generally present at low levels e.g. <0.01%.
Compositions of the invention may include sodium salts (e.g. sodium chloride) to give tonicity. A concentration of 10+2mg/ml NaCl is typical. In some embodiments, a concentration of 4-10mg/ml NaCl may be used, e.g. 9.0, 7.0, 6.75 or 4.5 mg/ml.
Compositions of the invention will generally include a buffer. A phosphate buffer is typical.
Compositions of the invention may be administered in conjunction with other immunoregulatory agents. In particular, compositions may include one or more adjuvants. Such adjuvants include, but are not limited to: A. Mineral-containing compositions
Mineral containing compositions suitable for use as adjuvants in the invention include mineral salts, such as aluminium salts and calcium salts (or mixtures thereof). Calcium salts include calcium phosphate (e.g. the "CAP" particles disclosed in ref. 124). Aluminum salts include hydroxides, phosphates, sulfates, etc. , with the salts taking any suitable form (e.g. gel, crystalline, amorphous, etc.). Adsorption to these salts is preferred. The mineral containing compositions may also be formulated as a particle of metal salt [ 125].
The adjuvants known as aluminum hydroxide and aluminum phosphate may be used. These names are conventional, but are used for convenience only, as neither is a precise description of the actual chemical compound which is present (e.g. see chapter 9 of reference 126). The invention can use any of the "hydroxide" or "phosphate" adjuvants that are in general use as adjuvants. The adjuvants known as "aluminium hydroxide" are typically aluminium oxyhydroxide salts, which are usually at least partially crystalline. The adjuvants known as "aluminium phosphate" are typically aluminium hydroxypho sphates , o ften also containing a small amount o f sulfate (i.e. aluminium hydroxyphosphate sulfate). They may be obtained by precipitation, and the reaction conditions and concentrations during precipitation influence the degree of substitution of phosphate for hydroxyl in the salt.
A fibrous morphology (e.g. as seen in transmission electron micrographs) is typical for aluminium hydroxide adjuvants. The pi of aluminium hydroxide adjuvants is typically about 1 1 i. e. the adjuvant itself has a positive surface charge at physiological pH. Adsorptive capacities of between 1.8-2.6 mg protein per mg Al+++ at pH 7.4 have been reported for aluminium hydroxide adjuvants.
Aluminium phosphate adjuvants generally have a PO4/AI molar ratio between 0.3 and 1.2, preferably between 0.8 and 1.2, and more preferably 0.95+0.1. The aluminium phosphate will generally be amorphous, particularly for hydroxyphosphate salts. A typical adjuvant is amorphous aluminium hydroxyphosphate with PO4/AI molar ratio between 0.84 and 0.92, included at 0.6mg Al3+/ml. The aluminium phosphate will generally be particulate (e.g. plate-like morphology as seen in transmission electron micrographs). Typical diameters of the particles are in the range 0.5-20μηι (e.g. about 5-10μηι) after any antigen adsorption. Adsorptive capacities of between 0.7-1.5 mg protein per mg Al+++ at pH 7.4 have been reported for aluminium phosphate adjuvants.
The point of zero charge (PZC) of aluminium phosphate is inversely related to the degree of substitution of phosphate for hydroxyl, and this degree of substitution can vary depending on reaction conditions and concentration of reactants used for preparing the salt by precipitation. PZC is also altered by changing the concentration of free phosphate ions in solution (more phosphate = more acidic PZC) or by adding a buffer such as a histidine buffer (makes PZC more basic). Aluminium phosphates used according to the invention will generally have a PZC of between 4.0 and 7.0, more preferably between 5.0 and 6.5 e.g. about 5.7. Suspensions of aluminium salts used to prepare compositions of the invention may contain a buffer (e.g. a phosphate or a histidine or a Tris buffer), but this is not always necessary. The suspensions are preferably sterile and pyrogen-free. A suspension may include free aqueous phosphate ions e.g. present at a concentration between 1.0 and 20 mM, preferably between 5 and 15 mM, and more preferably about 10 mM. The suspensions may also comprise sodium chloride.
The invention can use a mixture of both an aluminium hydroxide and an aluminium phosphate. In this case there may be more aluminium phosphate than hydroxide e.g. a weight ratio of at least 2: 1 e.g. >5:l, >6: l, >7:l, >8:l, >9:l, efc.
The concentration of Al+++ in a composition for administration to a patient is preferably less than lOmg/ml e.g. <5 mg/ml, <4 mg/ml, <3 mg/ml, <2 mg/ml, <1 mg/ml, etc. A preferred range is between 0.3 and lmg/ml. A maximum of 0.85mg/dose is preferred.
A typical adjuvant aluminium phosphate adjuvant is amorphous aluminium hydroxyphosphate with PO4/AI molar ratio between 0.84 and 0.92, included at 0.6mg Al3+/ml. Adsorption with a low dose of aluminium phosphate may be used e.g. between 50 and 100μg Al3+ per conjugate per dose. B. Oil Emulsions
Oil emulsion compositions suitable for use as adjuvants in the invention include squalene-water emulsions, such as MF59 (5% Squalene, 0.5% Tween 80, and 0.5% Span 85, formulated into submicron particles using a microfluidizer) [Chapter 10 of ref. 126; see also refs. 127-129]. MF59 is used as the adjuvant in the FLU AD™ influenza virus trivalent subunit vaccine.
Particularly preferred adjuvants for use in the compositions are submicron oil-in-water emulsions. Preferred submicron oil-in-water emulsions for use herein are squalene/water emulsions optionally containing varying amounts of MTP-PE, such as a submicron oil-in-water emulsion containing 4-5%) w/v squalene, 0.25-1.0%) w/v Tween 80 (polyoxyelthylenesorbitan monooleate), and/or 0.25-1.0%) Span 85 (sorbitan trioleate), and, optionally, N-acetylmuramyl-L-alanyl-D-isogluatminyl-L-alanine- 2-(l'-2'-dipalmitoyl-sn-glycero-3-hydroxyphosphophoryloxy)-ethylamine (MTP-PE). Submicron oil-in-water emulsions, methods of making the same and immunostimulating agents, such as muramyl peptides, for use in the compositions, are described in detail in references 127 & 130-131.
Complete Freund's adjuvant (CFA) and incomplete Freund's adjuvant (IF A) may also be used as adjuvants in the invention. C. Saponin formulations [chapter 22 of ref. 126]
Saponin formulations may also be used as adjuvants in the invention. Saponins are a heterologous group of sterol glycosides and triterpenoid glycosides that are found in the bark, leaves, stems, roots and even flowers of a wide range of plant species. Saponins isolated from the bark of the Quillaia saponaria Molina tree have been widely studied as adjuvants. Saponin can also be commercially obtained from Smilax ornata (sarsaprilla), Gypsophilla paniculata (brides veil), and Saponaria officianalis (soap root). Saponin adjuvant formulations include purified formulations, such as QS21 , as well as lipid formulations, such as ISCOMs.
Saponin compositions have been purified using HPLC and RP-HPLC. Specific purified fractions using these techniques have been identified, including QS7, QS17, QS18, QS21 , QH-A, QH-B and QH-C. Preferably, the saponin is QS21. A method of production of QS21 is disclosed in ref. 132. Saponin formulations may also comprise a sterol, such as cholesterol [133].
Combinations of saponins and cholesterols can be used to form unique particles called immunostimulating complexs (ISCOMs) [chapter 23 of ref. 126]. ISCOMs typically also include a phospholipid such as phosphatidylethanolamine or phosphatidylcholine. Any known saponin can be used in ISCOMs. Preferably, the ISCOM includes one or more of QuilA, QHA and QHC. ISCOMs are further described in refs. 133-135. Optionally, the ISCOMS may be devoid of additional detergent(s) [136].
A review of the development of saponin based adjuvants can be found in refs. 137 & 138.
D. Virosomes and virus-like particles
Virosomes and virus-like particles (VLPs) can also be used as adjuvants in the invention. These structures generally contain one or more proteins from a virus optionally combined or formulated with a phospholipid. They are generally non-pathogenic, non-replicating and generally do not contain any of the native viral genome. The viral proteins may be recombinantly produced or isolated from whole viruses. These viral proteins suitable for use in virosomes or VLPs include proteins derived from influenza virus (such as HA or NA), Hepatitis B virus (such as core or capsid proteins), Hepatitis E virus, measles virus, Sindbis virus, Rotavirus, Foot-and-Mouth Disease virus, Retrovirus, Norwalk virus, human Papilloma virus, HIV, RNA-phages, QB-phage (such as coat proteins), GA- phage, fr-phage, AP205 phage, and Ty (such as retrotransposon Ty protein pi). VLPs are discussed further in refs. 139-144. Virosomes are discussed further in, for example, ref. 145 E. Bacterial or microbial derivatives
Adjuvants suitable for use in the invention include bacterial or microbial derivatives such as non-toxic derivatives of enterobacterial lipopolysaccharide (LPS), Lipid A derivatives, immunostimulatory oligonucleotides and ADP-ribosylating toxins and detoxified derivatives thereof.
Non-toxic derivatives of LPS include monophosphoryl lipid A (MPL) and 3-O-deacylated MPL (3dMPL). 3dMPL is a mixture of 3 de-O-acylated monophosphoryl lipid A with 4, 5 or 6 acylated chains. A preferred "small particle" form of 3 De-O-acylated monophosphoryl lipid A is disclosed in ref. 146. Such "small particles" of 3dMPL are small enough to be sterile filtered through a 0.22μηι membrane [146]. Other non-toxic LPS derivatives include monophosphoryl lipid A mimics, such as aminoalkyl glucosaminide phosphate derivatives e.g. RC-529 [147,148].
Lipid A derivatives include derivatives of lipid A from Escherichia coli such as OM-174. OM-174 is described for example in refs. 149 & 150. Immunostimulatory oligonucleotides suitable for use as adjuvants in the invention include nucleotide sequences containing a CpG motif (a dinucleotide sequence containing an unmethylated cytosine linked by a phosphate bond to a guanosine). Double-stranded RNAs and oligonucleotides containing palindromic or poly(dG) sequences have also been shown to be immunostimulatory.
The CpG's can include nucleotide modifications/analogs such as phosphorothioate modifications and can be double-stranded or single-stranded. References 151, 152 and 153 disclose possible analog substitutions e.g. replacement of guanosine with 2'-deoxy-7-deazaguanosine. The adjuvant effect of CpG oligonucleotides is further discussed in refs. 154-159.
The CpG sequence may be directed to TLR9, such as the motif GTCGTT or TTCGTT [160]. The CpG sequence may be specific for inducing a Thl immune response, such as a CpG-A ODN, or it may be more specific for inducing a B cell response, such a CpG-B ODN. CpG-A and CpG-B ODNs are discussed in refs. 161-163. Preferably, the CpG is a CpG-A ODN.
Preferably, the CpG oligonucleotide is constructed so that the 5' end is accessible for receptor recognition. Optionally, two CpG oligonucleotide sequences may be attached at their 3' ends to form "immunomers". See, for example, refs. 160 & 164-166.
Bacterial ADP-ribosylating toxins and detoxified derivatives thereof may be used as adjuvants in the invention. Preferably, the protein is derived from E.coli {E.coli heat labile enterotoxin "LT"), cholera ("CT"), or pertussis ("PT"). The use of detoxified ADP-ribosylating toxins as mucosal adjuvants is described in ref. 167 and as parenteral adjuvants in ref. 168. The toxin or toxoid is preferably in the form of a holotoxin, comprising both A and B subunits. Preferably, the A subunit contains a detoxifying mutation; preferably the B subunit is not mutated. Preferably, the adjuvant is a detoxified LT mutant such as LT-K63, LT-R72, and LT-G 192. The use of ADP-ribosylating toxins and detoxified derivaties thereof, particularly LT-K63 and LT-R72, as adjuvants can be found in refs. 169-176. Numerical reference for amino acid substitutions is preferably based on the alignments of the A and B subunits of ADP-ribosylating toxins set forth in ref. 177, specifically incorporated herein by reference in its entirety.
F. Human immunomodulators
Human immunomodulators suitable for use as adjuvants in the invention include cytokines, such as interleukins {e.g. IL-1 , IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 [178], etc.) [179], interferons (e.g. inter feron-γ), macrophage colony stimulating factor, and tumor necrosis factor.
G. Bioadhesives and Mucoadhesives
Bioadhesives and mucoadhesives may also be used as adjuvants in the invention. Suitable bioadhesives include esterified hyaluronic acid microspheres [180] or mucoadhesives such as cross-linked derivatives of poly(acrylic acid), polyvinyl alcohol, polyvinyl pyrollidone, polysaccharides and carboxymethylcellulose. Chitosan and derivatives thereof may also be used as adjuvants in the invention [181]. H. Microparticles
Microparticles may also be used as adjuvants in the invention. Microparticles {i.e. a particle of -lOOnm to ~150μηι in diameter, more preferably ~200nm to ~30μηι in diameter, and most preferably ~500nm to -ΙΟμηι in diameter) formed from materials that are biodegradable and non-toxic {e.g. a poly(a-hydroxy acid), a polyhydroxybutyric acid, a polyorthoester, a polyanhydride, a polycaprolactone, etc.), with poly(lactide-co-glycolide) are preferred, optionally treated to have a negatively-charged surface {e.g. with SDS) or a positively-charged surface {e.g. with a cationic detergent, such as CTAB).
I. Liposomes (Chapters 13 & 14 of ref. 126)
Examples of liposome formulations suitable for use as adjuvants are described in refs. 182-184.
J. Polyoxyethylene ether and polyoxyethylene ester formulations
Adjuvants suitable for use in the invention include polyoxyethylene ethers and polyoxyethylene esters [185] . Such formulations further include polyoxyethylene sorbitan ester surfactants in combination with an octoxynol [ 186] as well as polyoxyethylene alkyl ethers or ester surfactants in combination with at least one additional non-ionic surfactant such as an octoxynol [ 187]. Preferred polyoxyethylene ethers are selected from the following group: polyoxyethylene-9-lauryl ether (laureth 9), polyoxyethylene-9-steoryl ether, polyoxytheylene-8-steoryl ether, polyoxyethylene-4- lauryl ether, polyoxyethylene-35-lauryl ether, and polyoxyethylene-23-lauryl ether.
K. Polvphosphazene fPCPP)
PCPP formulations are described, for example, in refs. 188 and 189.
L. Muramyl peptides
Examples of muramyl peptides suitable for use as adjuvants in the invention include N-acetyl- muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor- MDP), and N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-( -2'-dipalmitoyl-5,n-glycero-3- hydroxyphosphoryloxy)-ethylamine MTP-PE).
M. Imidazoquinolone Compounds.
Examples of imidazoquinolone compounds suitable for use adjuvants in the invention include Imiquamod and its homologues {e,g. "Resiquimod 3M"), described further in refs. 190 and 191.
N. Thiosemicarbazone Compounds.
Examples of thiosemicarbazone compounds, as well as methods of formulating, manufacturing, and screening for compounds all suitable for use as adjuvants in the invention include those described in ref. 192. The thiosemicarbazones are particularly effective in the stimulation of human peripheral blood mononuclear cells for the production of cytokines, such as TNF-a.
O. Tryptanthrin Compounds.
Examples of tryptanthrin compounds, as well as methods of formulating, manufacturing, and screening for compounds all suitable for use as adjuvants in the invention include those described in ref. 193. The tryptanthrin compounds are particularly effective in the stimulation of human peripheral blood mononuclear cells for the production of cytokines, such as TNF-a.
The invention may also comprise combinations of aspects of one or more of the adjuvants identified above. For example, the following combinations may be used as adjuvant compositions in the invention: (1) a saponin and an oil-in- water emulsion [ 194]; (2) a saponin (e.g. QS21) + a non-toxic LPS derivative (e.g. 3dMPL) [195]; (3) a saponin (e.g. QS21) + a non-toxic LPS derivative (e.g. 3dMPL) + a cholesterol; (4) a saponin (e.g. QS21) + 3dMPL + IL-12 (optionally + a sterol) [ 196]; (5) combinations of 3dMPL with, for example, QS21 and/or oil-in-water emulsions [ 197]; (6) SAF, containing 10% squalane, 0.4% Tween 80™, 5% pluronic-block polymer L121 , and thr-MDP, either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion. (7) Ribi™ adjuvant system (RAS), (Ribi Immunochem) containing 2% squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL + CWS (Detox™); and (8) one or more mineral salts (such as an aluminum salt) + a non-toxic derivative of LPS (such as 3dMPL).
Other substances that act as immunostimulating agents are disclosed in chapter 7 of ref. 126.
The use of aluminium salt adjuvants is particularly preferred, and antigens are generally adsorbed to such salts. It is possible in compositions of the invention to adsorb some antigens to an aluminium hydroxide but to have other antigens in association with an aluminium phosphate. In general, however, it is preferred to use only a single salt e.g. a hydroxide or a phosphate, but not both. Not all conjugates need to be adsorbed i.e. some or all can be free in solution.
Methods of treatment
The invention also provides a method for raising an immune response in a mammal, comprising administering a pharmaceutical composition of the invention to the mammal. The immune response is preferably protective and preferably involves antibodies. The method may raise a booster response.
The mammal is preferably a human. Where the vaccine is for prophylactic use, the human is preferably a child (e.g. a toddler or infant) or a teenager; where the vaccine is for therapeutic use, the human is preferably an adult. A vaccine intended for children may also be administered to adults e.g. to assess safety, dosage, immunogenicity, etc. A preferred class of humans for treatment are females of child-bearing age (e.g. teenagers and above). Another preferred class is pregnant females. Elderly patients (e.g. those above 50, 60, 70, 80 or 90 etc. years of age, particularly over 65 years of age), especially those living in nursing homes where the risk of GBS infection may be increased ([198]), are another preferred class of humans for treatment. In some embodiments, the human has an undetectable level of antibodies against capsular saccharide from GB S serotype la prior to administration of the pharmaceutical composition. In other embodiments, the human has an undetectable level of antibodies against capsular saccharide from GBS serotype lb prior to administration of the pharmaceutical composition. In other embodiments, the human has an undetectable level of antibodies against capsular saccharide from GBS serotype III prior to administration of the pharmaceutical composition. In particular, the human may have an undetectable level of antibodies against capsular saccharide from GBS serotype la and an undetectable level of antibodies against capsular saccharide from GBS serotype lb prior to administration of the pharmaceutical composition. Alternatively or in addition, the human may have an undetectable level of antibodies against capsular saccharide from GBS serotype III prior to administration of the pharmaceutical composition. The level(s) of antibodies against the capsular saccharide(s) may be determined using the ELISA described in Human study (1) below. The level(s) of antibodies may be as of one month prior to administration, particularly within one month prior to administration {e.g. within two weeks, within one week or on the day of administration). Women with these undetectable level(s) of antibodies against the capsular saccharide(s) may have higher rates of GBS infection in their newborns. This is because higher levels of maternal antibodies against GBS capsular saccharides are correleated with reduced risk of disease in newborns [refs. 199 and 200]. Accordingly, administration to these women is specifically envisaged in the present invention.
In some embodiments, the patient has been pre-immunised with a diphtheria toxoid or derivative thereof, e.g. as described below with respect to the second aspect of the invention in the section The pre-immunised patient. In these embodiments, it is preferred for at least one conjugate in the immunogenic composition to be a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof. The inventors have found that the immune response to the capsular saccharide may be improved by presenting the saccharide on a diphtheria toxoid or derivative thereof, when the patient has been pre-immunised with a diphtheria toxoid or derivative thereof. The capsular saccharide conjugated to the diphtheria toxoid or derivative thereof in the composition may for example be from GBS serotype la, lb or III. In particular, the capsular saccharide may be from GBS serotype III (as exemplified below). In these embodiments, it is typical for all of the capsular saccharides from GBS in the composition to be conjugated to a diphtheria toxoid or derivative thereof. Where the carrier or pre-immunisation antigen is a derivative of a diphtheria toxoid then that derivative preferably remains immunologically cross-reactive with Dt, and is preferably CRM197.
In other embodiments, the patient has been pre-immunised with a tetanus toxoid or derivative thereof, e.g. as described below with respect to the second aspect of the invention in the sections The pre-immunised patient and Tetanus toxoid carriers. In these embodiments, it is preferred for at least one conjugate in the immunogenic composition to be a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof. The immune response to the capsular saccharide may be improved by presenting the saccharide on a tetanus toxoid or derivative thereof, when the patient has been pre-immunised with a tetanus toxoid or derivative thereof. The capsular saccharide conjugated to the tetanus toxoid or derivative thereof in the composition may for example be from GBS serotype la, lb or III. In particular, the capsular saccharide may be from GB S serotype III. In these embodiments, it is typical for all of the capsular saccharides from GBS in the composition to be conjugated to a tetanus toxoid or derivative thereof.
The invention also provides a composition of the invention for use as a medicament. The medicament is preferably able to raise an immune response in a mammal (i.e. it is an immunogenic composition) and is more preferably a vaccine.
The invention also provides the use of a composition of the invention in the manufacture of a medicament for raising an immune response in a mammal.
These uses and methods are preferably for the prevention and/or treatment of a disease caused by S.agalactiae e.g. neonatal sepsis or bacteremia, neonatal pneumonia, neonatal meningitis, endometritis, osteomyelitis, septic arthritis, etc.
The subject in which disease is prevented may not be the same as the subject that receives the conjugate of the invention. For instance, a conjugate may be administered to a female (before or during pregnancy) in order to protect offspring (so-called 'maternal immunisation' [201-203]).
One way of checking efficacy of therapeutic treatment involves monitoring GBS infection after administration of the composition of the invention. One way of checking efficacy of prophylactic treatment involves monitoring immune responses against the GBS antigens after administration of the composition.
Preferred compositions of the invention can confer an antibody titre in a patient that is superior to the criterion for seroprotection for each antigenic component for an acceptable percentage of human subj ects. Antigens with an associated antibody titre above which a host is considered to be seroconverted against the antigen are well known, and such titres are published by organisations such as WHO. Preferably more than 80% of a statistically significant sample of subjects is seroconverted, more preferably more than 90%, still more preferably more than 93%) and most preferably 96-100%). Compositions of the invention will generally be administered directly to a patient. Direct delivery may be accomplished by parenteral injection (e.g. subcutaneously, intraperitoneally, intravenously, intramuscularly, or to the interstitial space of a tissue), or by rectal, oral, vaginal, topical, transdermal, intranasal, ocular, aural, pulmonary or other mucosal administration. Intramuscular administration to the thigh or the upper arm is preferred. Injection may be via a needle (e.g. a hypodermic needle), but needle-free injection may alternatively be used. A typical intramuscular dose is 0.5 ml.
The invention may be used to elicit systemic and/or mucosal immunity.
Dosage treatment can be a single dose schedule or a multiple dose schedule. Multiple doses may be used in a primary immunisation schedule and/or in a booster immunisation schedule. A primary dose schedule may be followed by a booster dose schedule. Suitable timing between priming doses (e.g. between 4-16 weeks), and between priming and boosting, can be routinely determined.
GBS protein antigens
As mentioned above, GBS proteins can be included in compositions of the invention. These may be used as carrier proteins for conjugates of the invention, carrier proteins for other conjugates, or as unconjugated protein antigens.
GBS protein antigens for use with the invention include those disclosed in references 99 and 204- 206. Two preferred GBS protein antigens for use with the invention are known as: GBS67; and GBS80 [see ref. 99]. A further preferred GBS protein antigen for use with the invention is known as Spbl [see ref. 207]. Further details of these three antigens are given below.
The full-length sequences for these three GBS proteins are SEQ ID NOs 1 to 3 herein. Compositions of the invention may thus include (a) a polypeptide comprising an amino acid sequence selected from SEQ ID NOs 1 to 3, and/or (b) a polypeptide comprising (i) an amino acid sequence that has sequence identity to one or more of SEQ ID NOs 1 to 3 and/or (ii) a fragment of SEQ ID NOs 1 to 3. Compositions of the invention may also comprise mixtures of these GBS protein antigens.
In particular, compositions of the invention may include:
(ai) a polypeptide comprising an amino acid sequence of SEQ ID NO 1 , and/or (bi) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 1 and/or (ii) a fragment of SEQ ID NO 1 ; and
(a2) a polypeptide comprising an amino acid sequence of SEQ ID NO 2, and/or (b2) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 2 and/or (ii) a fragment of SEQ ID NO 2.
Similarly, compositions of the invention may include:
(ai) a polypeptide comprising an amino acid sequence of SEQ ID NO 1 , and/or (bi) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 1 and/or (ii) a fragment of SEQ ID NO 1 ; and
(a2) a polypeptide comprising an amino acid sequence of SEQ ID NO 3, and/or (b2) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 3 and/or (ii) a fragment of SEQ ID NO 3. In the same way, compositions of the invention may include:
(ai) a polypeptide comprising an amino acid sequence of SEQ ID NO 2, and/or (bi) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 2 and/or (ii) a fragment of SEQ ID NO 2; and (a2) a polypeptide comprising an amino acid sequence of SEQ ID NO 3, and/or (b2) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 3 and/or (ii) a fragment of SEQ ID NO 3.
Compositions of the invention may include:
(ai) a polypeptide comprising an amino acid sequence of SEQ ID NO 1, and/or (bi) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 1 and/or (ii) a fragment of SEQ ID NO 1;
(a2) a polypeptide comprising an amino acid sequence of SEQ ID NO 2, and/or (b2) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 2 and/or (ii) a fragment of SEQ ID NO 2; and
(a3) a polypeptide comprising an amino acid sequence of SEQ ID NO 3, and/or (bi) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 3 and/or (ii) a fragment of SEQ ID NO 3.
Three other preferred GBS protein antigens for use with the invention are known as: GBS 104; GBS276; and GBS322 [see ref. 99]. The wild-type GBS104 amino acid sequence from serotype V isolated strain 2603 V/R is given in reference 21 as SEQ ID NO: 3 therein. Where embodiments of the present invention are defined herein by reference to SEQ ID NO: 1 , the references to SEQ ID NO: 1 may be substituted by references to SEQ ID NO: 3 from reference 21. The wild-type GBS276 amino acid sequence from serotype V isolated strain 2603 V/R is given in reference 21 as SEQ ID NO: 4 therein. Where embodiments of the present invention are defined herein by reference to SEQ ID NO: 2, the references to SEQ ID NO: 2 may be substituted by references to SEQ ID NO: 4 from reference 21. The wild-type GBS322 amino acid sequence from serotype V isolated strain 2603 V/R is given in reference 21 as SEQ ID NO: 5 therein. Where embodiments of the present invention are defined herein by reference to SEQ ID NO: 3, the references to SEQ ID NO: 3 may be substituted by references to SEQ ID NO: 5 from reference 21.
Depending on the particular SEQ ID NO, the degree of sequence identity in (i) is preferably greater than 50% (e.g. 60%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more). These polypeptides include homologs, orthologs, allelic variants and functional mutants. Typically, 50% identity or more between two polypeptide sequences is considered to be an indication of functional equivalence. Identity between polypeptides is preferably determined by the Smith- Waterman homology search algorithm as implemented in the MPSRCH program (Oxford Molecular), using an affine gap search with parameters gap open penalty=12 and gap extension penalty=l.
Depending on the particular SEQ ID NO, the fragments of (ii) should comprise at least n consecutive amino acids from the sequences and, depending on the particular sequence, n is 7 or more (e.g. 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more). The fragment may comprise at least one T-cell or, preferably, a B-cell epitope of the sequence. T- and B-cell epitopes can be identified empirically (e.g. using PEPSCAN [208,209] or similar methods), or they can be predicted (e.g. using the Jameson-Wolf antigenic index [210] , matrix-based approaches [21 1], TEPITOPE [212], neural networks [213] , OptiMer & EpiMer [214, 215] , ADEPT [216], Tsites [217], hydrophilicity [218], antigenic index [219] or the methods disclosed in reference 220 etc.). Other preferred fragments are SEQ ID NOs 1 to 3 without their N-terminal amino acid residue or without their N-terminal signal peptide. Removal of one or more domains, such as a leader or signal sequence region, a transmembrane region, a cytoplasmic region or a cell wall anchoring motif can be used. Preferred fragments of a particular protein can bind to an antibody that can bind to the full-length particular protein e.g. can bind to an antibody that binds to SEQ ID NO: 1 , 2 or 3. Some useful fragments are given below (SEQ ID NOs 4 to 13).
These polypeptides may, compared to SEQ ID NOs 1 to 3, include one or more (e.g. 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) conservative amino acid replacements i.e. replacements of one amino acid with another which has a related side chain. Genetically-encoded amino acids are generally divided into four families: (1) acidic i.e. aspartate, glutamate; (2) basic i. e. lysine, arginine, histidine; (3) non- polar i.e. alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar i.e. glycine, asparagine, glutamine, cystine, serine, threonine, tyrosine. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids. In general, substitution of single amino acids within these families does not have a major effect on the biological activity. The polypeptides may also include one or more (e.g. 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) single amino acid deletions relative to SEQ ID NOs 1 to 3. The polypeptides may also include one or more (e.g. 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) insertions (e.g. each of 1 , 2, 3, 4 or 5 amino acids) relative to the SEQ ID NOs 1 to 3.
Polypeptides of the invention can be prepared in many ways e.g. by chemical synthesis (in whole or in part), by digesting longer polypeptides using proteases, by translation from RNA, by purification from cell culture (e.g. from recombinant expression), from the organism itself (e.g. after bacterial culture, or direct from patients), etc. A preferred method for production of peptides <40 amino acids long involves in vitro chemical synthesis [221 ,222] . Solid-phase peptide synthesis is particularly preferred, such as methods based on tBoc or Fmoc [223] chemistry. Enzymatic synthesis [224] may also be used in part or in full. As an alternative to chemical synthesis, biological synthesis may be used e.g. the polypeptides may be produced by translation. This may be carried out in vitro or in vivo. Biological methods are in general restricted to the production of polypeptides based on L-amino acids, but manipulation of translation machinery (e.g. of aminoacyl tRNA molecules) can be used to allow the introduction of D-amino acids (or of other non natural amino acids, such as iodotyrosine or methylphenylalanine, azidohomoalanine, etc.) [225]. Where D-amino acids are included, however, it is preferred to use chemical synthesis. Polypeptides of the invention may have covalent modifications at the C-terminus and/or N-terminus. If these GBS proteins are included in compositions of the invention then they can take various forms (e.g. native, fusions, glycosylated, non-glycosylated, lipidated, non-lipidated, phosphorylated, non-phosphorylated, myristoylated, non-myristoylated, monomeric, multimeric, particulate, denatured, etc.). They are preferably used in purified or substantially purified form i.e. substantially free from other polypeptides (e.g. free from naturally-occurring polypeptides), particularly from other GBS or host cell polypeptides).
GBS67
Nucleotide and amino acid sequence of GBS67 sequenced from serotype V strain 2603 V/R are set forth in ref. 99 as SEQ ID NOs 3745 & 3746. The amino acid sequence is SEQ ID NO: 1 herein: MRKYQKFSKILTLSLFCLSQI PLNTNVLGESTVPENGAKGKLWKKTDDQNKPLSKATFVLKTTAHPESKIEKVTAELT
GEATFDNLI PGDYTLSEETAPEGYKKTNQTWQVKVESNGKTTIQNSGDKNSTIGQNQEELDKQYPPTGIYEDTKESYKL EHVKGSVPNGKSEAKAVNPYSSEGEHIREI PEGTLSKRISEVGDLAHNKYKIELTVSGKTIVKPVDKQKPLDWFVLDN SNSMNNDGPNFQRHNKAKKAAEALGTAVKDILGANSDNRVALVTYGSDIFDGRSVDWKGFKEDDKYYGLQTKFTIQTE NYSHKQLTNNAEEI IKRIPTEAPKAKWGSTTNGLTPEQQKEYYLSKVGETFTMKAFMEADDILSQVNRNSQKI IVHVTD GVPTRSYAI NFKLGASYESQFEQMKKNGYLNKSNFLLTDKPEDIKGNGESYFLFPLDSYQTQI ISGNLQKLHYLDLNL
NYPKGTIYRNGPVKEHGTPTKLYI SLKQK YDIFNFGIDISGFRQVYNEEYKKNQDGTFQKLKEEAFKLSDGEITELM RSFSSKPEYYTPIVTSADTSNNEILSKIQQQFETILTKENSIVNGTIEDPMGDKINLQLGNGQTLQPSDYTLQGNDGSV MKDGIATGGPNNDGGILKGVKLEYIGNKLYVRGLNLGEGQKVTLTYDVKLDDSFISNKFYDTNGRTTLNPKSEDPNTLR DFPIPKIRDVREYPTITIKNEKKLGEIEFIKVDKDNNKLLLKGATFELQEFNEDYKLYLPIKNNNSKWTGENGKISYK DLKDGKYQLIEAVSPEDYQKITNKPILTFEWKGSIK I IAVNKQISEYHEEGDKHLITNTHI PPKGI IP TGGKGILS
FILIGGAMMSIAGGIYIWKRYKKSSDMSIKKD
GBS67 contains a C-terminus transmembrane region which is indicated by the underlined region closest to the C-terminus of SEQ ID NO: 1 above. One or more amino acids from the transmembrane region may be removed, or the amino acid may be truncated before the transmembrane region. An example of such a GBS67 fragment is set forth below as SEQ ID NO: 4.
MRKYQKFSKILTLSLFCLSQI PLNTNVLGESTVPENGAKGKLWKKTDDQNKPLSKATFVLKTTAHPESKIEKVTAELT GEATFDNLI PGDYTLSEETAPEGYKKTNQTWQVKVESNGKTTIQNSGDKNSTIGQNQEELDKQYPPTGIYEDTKESYKL EHVKGSVPNGKSEAKAVNPYSSEGEHIREI PEGTLSKRISEVGDLAHNKYKIELTVSGKTIVKPVDKQKPLDWFVLDN SNSMNNDGPNFQRHNKAKKAAEALGTAVKDILGANSDNRVALVTYGSDIFDGRSVDWKGFKEDDKYYGLQTKFTIQTE NYSHKQLTNNAEEI IKRIPTEAPKAKWGSTTNGLTPEQQKEYYLSKVGETFTMKAFMEADDILSQVNRNSQKI IVHVTD
GVPTRSYAINNFKLGASYESQFEQMKKNGYLNKSNFLLTDKPEDIKGNGESYFLFPLDSYQTQI ISGNLQKLHYLDLNL NYPKGTIYRNGPVKEHGTPTKLYINSLKQKNYDIFNFGIDISGFRQVYNEEYKKNQDGTFQKLKEEAFKLSDGEITELM RSFSSKPEYYTPIVTSADTSNNEILSKIQQQFETILTKENSIVNGTIEDPMGDKINLQLGNGQTLQPSDYTLQGNDGSV MKDGIATGGPNNDGGILKGVKLEYIGNKLYVRGLNLGEGQKVTLTYDVKLDDSFISNKFYDTNGRTTLNPKSEDPNTLR DFPI PKIRDVREYPTITIKNEKKLGEIEFIKVDKDNNKLLLKGATFELQEFNEDYKLYLPIKNNNSKWTGENGKISYK
DLKDGKYQLIEAVSPEDYQKITNKPILTFEWKGSIKNI IAVNKQISEYHEEGDKHLITNTHI PPKGI IPMTGGKGILS
GBS67 contains an amino acid motif indicative of a cell wall anchor, shown in italics in SEQ ID NO: 1 above. In some recombinant host cell systems, it may be preferable to remove this motif to facilitate secretion of a recombinant GBS67 protein from the host cell. Accordingly, in one preferred fragment of GBS67 for use in the invention, the transmembrane and the cell wall anchor motif are removed from GBS67. An example of such a GBS67 fragment is set forth below as SEQ ID NO: 5.
MRKYQKFSKILTLSLFCLSQI PLNTNVLGESTVPENGAKGKLWKKTDDQNKPLSKATFVLKTTAHPESKIEKVTAELT GEATFDNLI PGDYTLSEETAPEGYKKTNQTWQVKVESNGKTTIQNSGDKNSTIGQNQEELDKQYPPTGIYEDTKESYKL EHVKGSVPNGKSEAKAVNPYSSEGEHIREI PEGTLSKRISEVGDLAHNKYKIELTVSGKTIVKPVDKQKPLDWFVLDN SNSMNNDGPNFQRHNKAKKAAEALGTAVKDILGANSDNRVALVTYGSDIFDGRSVDWKGFKEDDKYYGLQTKFTIQTE NYSHKQLTNNAEEI IKRIPTEAPKAKWGSTTNGLTPEQQKEYYLSKVGETFTMKAFMEADDILSQVNRNSQKI IVHVTD GVPTRSYAINNFKLGASYESQFEQMKKNGYLNKSNFLLTDKPEDIKGNGESYFLFPLDSYQTQI ISGNLQKLHYLDLNL NYPKGTIYRNGPVKEHGTPTKLYINSLKQKNYDIFNFGIDISGFRQVYNEEYKKNQDGTFQKLKEEAFKLSDGEITELM RSFSSKPEYYTPIVTSADTSNNEILSKIQQQFETILTKENSIVNGTIEDPMGDKINLQLGNGQTLQPSDYTLQGNDGSV MKDGIATGGPNNDGGILKGVKLEYIGNKLYVRGLNLGEGQKVTLTYDVKLDDSFISNKFYDTNGRTTLNPKSEDPNTLR DFPIPKIRDVREYPTITIKNEKKLGEIEFIKVDKDNNKLLLKGATFELQEFNEDYKLYLPIKNNNSKWTGENGKISYK DLKDGKYQLIEAVSPEDYQKITNKPILTFEWKGSIK I IAV KQISEYHEEGDKHLITNTHI PPKGI
Alternatively, in some recombinant host cell systems, it may be preferable to use the cell wall anchor motif to anchor the recombinantly expressed protein to the cell wall. The extracellular domain of the expressed protein may be cleaved during purification or the recombinant protein may be left attached to either inactivated host cells or cell membranes in the final composition.
Three pilin motifs, containing conserved lysine residues have been identified in GBS67. Conserved lysine residues are at amino acid residues 478 and 488, at amino acid residues 340 and 342, and at amino acid residues 703 and 717. The pilin sequences, in particular the conserved lysine residues, are thought to be important for the formation of oligomeric, pilus-like structures of GBS67. Preferred fragments of GBS 67 include at least one conserved lysine residue. Two E boxes containing conserved glutamic residues have also been identified in GBS67. Preferred fragments of GBS 67 include at least one conserved glutamic acid residue. GBS67 contains several regions predicted to form alpha helical structures. Such alpha helical regions are likely to form coiled-coil structures and may be involved in oligomerization of GBS67. GBS67 also contains a region which is homologous to the Cna_B domain of the S.aureus collagen-binding surface protein (pfam05738). This may form a beta sandwich structure. GBS67 contains a region which is homologous to a von Willebrand factor (vWF) type A domain.
The amino acid sequence of GBS67 sequenced from serotype lb strain H36B is set forth in ref. 226 as SEQ ID NO 20906. The amino acid sequence is SEQ ID NO: 24 herein:
MRKYQKFSKILTLSLFCLSQI PLNTNVLGESTVPENGAKGKLVVKKTDDQNKPLSKATFVLKPTSHSESKVEKVTTEVT GEATFDNLTPGDYTLSEETAPEGYKKTTQTWQVKVESNGKTTIQNSDDKKSI IEQRQEELDKQYPLTGAYEDTKESYNL EHVKNSI PNGKLEAKAVNPYSSEGEHIREIQEGTLSKRISEVNDLDHNKYKIELTVSGKSI IKTINKDEPLDWFVLDN SNSMKNNGKNNKAKKAGEAVETI IKDVLGANVENRAALVTYGSDIFDGRTVKVIKGFKEDPYYGLETSFTVQTNDYSYK
KFT IAADI IKKI PKEAPEAKWGGTSLGLTPEKKREYDLSKVGETFTMKAFMEADTLLSSIQRKSRKI IVHLTDGVPTR SYAI SFVKGSTYANQFERIKEKGYLDKNNYFITDDPEKIKGNGESYFLFPLDSYQTQI ISGNLQKLHYLDLNLNYPKG TIYRNGPVREHGTPTKLYINSLKQKNYDIFNFGIDISGFRQVYNEDYKKNQDGTFQKLKEEAFELSDGEITELMNSFSS KPEYYTPIVTSADVSNNEILSKIQQQFEKILTKENSIVNGTIEDPMGDKINLHLGNGQTLQPSDYTLQGNDGSIMKDSI ATGGPNNDGGILKGVKLEYIKNKLYVRGLNLGEGQKVTLTYDVKLDDSFISNKFYDTNGRTTLNPKSEEPDTLRDFPIP KIRDVREYPTITIKNEKKLGEIEFTKVDKDNNKLLLKGATFELQEFNEDYKLYLPIKNNNSKWTGENGKISYKDLKDG KYQLIEAVSPKDYQKITNKPILTFEWKGSIQNI IAVNKQISEYHEEGDKHLITNTHI PPKGI IP ITGGKGILSFILIG GAMMSIAGGIYIWKRHKKSSDASIEKD
In some embodiments, this variant of GBS67 may be used. Accordingly, where embodiments of the present invention are defined herein by reference to SEQ ID NO: 1, the references to SEQ ID NO: 1 may be substituted by references to SEQ ID NO: 24.
Like GBS67 sequenced from serotype V strain 2603 V/R, GBS67 sequenced from serotype lb strain H36B contains a C-terminus transmembrane region which is indicated by the underlined region closest to the C-terminus of SEQ ID NO: 24 above. One or more amino acids from the transmembrane region may be removed, or the amino acid may be truncated before the transmembrane region. An example of such a GBS67 fragment is set forth below as SEQ ID NO: 25.
MRKYQKFSKILTLSLFCLSQI PLNTNVLGESTVPENGAKGKLWKKTDDQNKPLSKATFVLKPTSHSESKVEKVTTEVT GEATFDNLTPGDYTLSEETAPEGYKKTTQTWQVKVESNGKTTIQNSDDKKSI IEQRQEELDKQYPLTGAYEDTKESYNL EHVKNSI PNGKLEAKAVNPYSSEGEHIREIQEGTLSKRISEVNDLDHNKYKIELTVSGKSI IKTINKDEPLDWFVLDN SNSMKNNGKNNKAKKAGEAVETI IKDVLGANVENRAALVTYGSDIFDGRTVKVIKGFKEDPYYGLETSFTVQTNDYSYK KFT IAADI IKKI PKEAPEAKWGGTSLGLTPEKKREYDLSKVGETFTMKAFMEADTLLSSIQRKSRKI IVHLTDGVPTR SYAI SFVKGSTYANQFERIKEKGYLDKNNYFITDDPEKIKGNGESYFLFPLDSYQTQI ISGNLQKLHYLDLNLNYPKG TIYRNGPVREHGTPTKLYINSLKQKNYDIFNFGIDISGFRQVYNEDYKKNQDGTFQKLKEEAFELSDGEITELMNSFSS KPEYYTPIVTSADVSNNEILSKIQQQFEKILTKENSIVNGTIEDPMGDKINLHLGNGQTLQPSDYTLQGNDGSIMKDSI ATGGPNNDGGILKGVKLEYIKNKLYVRGLNLGEGQKVTLTYDVKLDDSFISNKFYDTNGRTTLNPKSEEPDTLRDFPIP KIRDVREYPTITIKNEKKLGEIEFTKVDKDNNKLLLKGATFELQEFNEDYKLYLPIKNNNSKWTGENGKISYKDLKDG KYQLIEAVSPKDYQKITNKPILTFEWKGSIQ I IAVNKQISEYHEEGDKHLITNTHI PPKGI I PMTGGKGILS
Like GBS67 sequenced from serotype V strain 2603 V/R, GBS67 sequenced from serotype lb strain H36B contains an amino acid motif indicative of a cell wall anchor, shown in italics in SEQ ID NO: 24 above. Accordingly, in one preferred fragment of GBS67 for use in the invention, the transmembrane and the cell wall anchor motif are removed from GBS67. An example of such a GBS67 fragment is set forth below as SEQ ID NO: 26.
MRKYQKFSKILTLSLFCLSQI PLNTNVLGESTVPENGAKGKLVVKKTDDQNKPLSKATFVLKPTSHSESKVEKVTTEVT GEATFDNLTPGDYTLSEETAPEGYKKTTQTWQVKVESNGKTTIQNSDDKKSI IEQRQEELDKQYPLTGAYEDTKESYNL EHVKNSI PNGKLEAKAVNPYSSEGEHIREIQEGTLSKRISEVNDLDHNKYKIELTVSGKSI IKTINKDEPLDWFVLDN SNSMKNNGKNNKAKKAGEAVETI IKDVLGANVENRAALVTYGSDIFDGRTVKVIKGFKEDPYYGLETSFTVQTNDYSYK KFTNIAADI IKKI PKEAPEAKWGGTSLGLTPEKKREYDLSKVGETFTMKAFMEADTLLSSIQRKSRKI IVHLTDGVPTR SYAINSFVKGSTYANQFERIKEKGYLDKNNYFITDDPEKIKGNGESYFLFPLDSYQTQI ISGNLQKLHYLDLNLNYPKG TIYRNGPVREHGTPTKLYINSLKQKNYDIFNFGIDISGFRQVYNEDYKKNQDGTFQKLKEEAFELSDGEITELMNSFSS KPEYYTPIVTSADVSNNEILSKIQQQFEKILTKENSIVNGTIEDPMGDKINLHLGNGQTLQPSDYTLQGNDGSIMKDSI ATGGPNNDGGILKGVKLEYIKNKLYVRGLNLGEGQKVTLTYDVKLDDSFISNKFYDTNGRTTLNPKSEEPDTLRDFPIP KIRDVREYPTITIKNEKKLGEIEFTKVDKDNNKLLLKGATFELQEFNEDYKLYLPIKNNNSKWTGENGKISYKDLKDG KYQLIEAVSPKDYQKITNKPILTFEWKGSIQNI IAVNKQISEYHEEGDKHLITNTHI PPKGI
GBS80
GBS80 refers to a putative cell wall surface anchor family protein. Nucleotide and amino acid sequence of GBS80 sequenced from serotype V isolated strain 2603 V/R are set forth in ref. 99 as SEQ ID NOs 8779 & 8780. The amino acid sequence is set forth below as SEQ ID NO: 2:
MKLSKKLLFSAAVLTMVAGSTVEPVAQFATGMSIVRAAEVSQERPAKTTVNIYKLQADSYKSEITSNGGIENKDGEVIS NYAKLGDNVKGLQGVQFKRYKVKTDISVDELKKLTTVEAADAKVGTILEEGVSLPQKTNAQGLWDALDSKSNVRYLYV EDLKNSPSNITKAYAVPFVLELPVANSTGTGFLSEINIYPKNWTDEPKTDKDVKKLGQDDAGYTIGEEFKWFLKSTI P ANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRDEHYTIDEPTVDNQNTLKITFKPEKFKEIAELLKGMTLVKNQD ALDKATANTDDAAFLEI PVASTINEKAVLGKAIENTFELQYDHTPDKADNPKPSNPPRKPEVHTGGKRFVKKDSTETQT LGGAEFDLLASDGTAVKWTDALIKANTNKNYIAGEAVTGQPIKLKSHTDGTFEIKGLAYAVDANAEGTAVTYKLKETKA PEGYVIPDKEIEFTVSQTSYNTKPTDITVDSADATPDTIKNNKRPSJPjV!TGGIGTAIFVAIGAAVMAFAVKGMKRRTKD N
GBS80 contains a N-terminal leader or signal sequence region which is indicated by the underlined sequence above. One or more amino acids from the leader or signal sequence region of GBS80 can be removed. An example of such a GBS80 fragment is set forth below as SEQ ID NO: 6:
AEVSQERPAKTTVNIYKLQADSYKSEITSNGGIENKDGEVISNYAKLGDNVKGLQGVQFKRYKVKTDISVDELKKLTTV EAADAKVGTILEEGVSLPQKTNAQGLWDALDSKSNVRYLYVEDLKNSPSNITKAYAVPFVLELPVANSTGTGFLSEIN IYPKNWTDEPKTDKDVKKLGQDDAGYTIGEEFKWFLKSTI PANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRD EHYTIDEPTVDNQNTLKITFKPEKFKEIAELLKGMTLVKNQDALDKATANTDDAAFLEIPVASTINEKAVLGKAIENTF ELQYDHTPDKADNPKPSNPPRKPEVHTGGKRFVKKDSTETQTLGGAEFDLLASDGTAVKWTDALIKANTNKNYIAGEAV TGQPIKLKSHTDGTFEIKGLAYAVDANAEGTAVTYKLKETKAPEGYVI PDKEIEFTVSQTSYNTKPTDITVDSADATPD TIKNNKRPSIPNTGGIGTAIFVAIGAAVMAFAVKGMKRRTKDN
GBS80 contains a C-terminal transmembrane region which is indicated by the underlined sequence near the end of SEQ ID NO: 2 above. One or more amino acids from the transmembrane region and/or a cytoplasmic region may be removed. An example of such a fragment is set forth below as
SEQ ID NO:7: MKLSKKLLFSAAVLTMVAGSTVEPVAQFATGMSIVRAAEVSQERPAKTTV IYKLQADSYKSEITSNGGIENKDGEVIS NYAKLGDNVKGLQGVQFKRYKVKTDISVDELKKLTTVEAADAKVGTILEEGVSLPQKTNAQGLWDALDSKSNVRYLYV EDLKNSPS ITKAYAVPFVLELPVANSTGTGFLSEINIYPKNVVTDEPKTDKDVKKLGQDDAGYTIGEEFKWFLKSTI P ANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRDEHYTIDEPTVDNQNTLKITFKPEKFKEIAELLKGMTLVKNQD ALDKATANTDDAAFLEI PVASTI EKAVLGKAIENTFELQYDHTPDKAD PKPS PPRKPEVHTGGKRFVKKDSTETQT
LGGAEFDLLASDGTAVKWTDALIKANTNKNYIAGEAVTGQPIKLKSHTDGTFEIKGLAYAVDANAEGTAVTYKLKETKA PEGYVIPDKEIEFTVSQTSYNTKPTDITVDSADATPDTIKNNKRPSIPWTG
GBS80 contains an amino acid motif indicative of a cell wall anchor, shown in italics in SEQ ID NO: 2 above. In some recombinant host cell systems, it may be preferable to remove this motif to facilitate secretion of a recombinant GBS80 protein from the host cell. Thus the transmembrane and/or cytoplasmic regions and the cell wall anchor motif may be removed from GBS80. An example of such a fragment is set forth below as SEQ ID NO: 8.
MKLSKKLLFSAAVLTMVAGSTVEPVAQFATGMSIVRAAEVSQERPAKTTVNIYKLQADSYKSEITSNGGIENKDGEVIS NYAKLGDNVKGLQGVQFKRYKVKTDISVDELKKLTTVEAADAKVGTILEEGVSLPQKTNAQGLWDALDSKSNVRYLYV EDLKNSPSNITKAYAVPFVLELPVANSTGTGFLSEINIYPKNVVTDEPKTDKDVKKLGQDDAGYTIGEEFKWFLKSTI P
ANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRDEHYTIDEPTVDNQNTLKITFKPEKFKEIAELLKGMTLVKNQD ALDKATANTDDAAFLEI PVASTINEKAVLGKAIENTFELQYDHTPDKADNPKPSNPPRKPEVHTGGKRFVKKDSTETQT LGGAEFDLLASDGTAVKWTDALIKANTNKNYIAGEAVTGQPIKLKSHTDGTFEIKGLAYAVDANAEGTAVTYKLKETKA PEGYVIPDKEIEFTVSQTSYNTKPTDITVDSADATPDTIKNNKRPS
Alternatively, in some recombinant host cell systems, it may be preferable to use the cell wall anchor motif to anchor the recombinantly expressed protein to the cell wall. The extracellular domain of the expressed protein may be cleaved during purification or the recombinant protein may be left attached to either inactivated host cells or cell membranes in the final composition.
In one embodiment, the leader or signal sequence region, the transmembrane and cytoplasmic regions and the cell wall anchor motif are removed from the GBS80 sequence. An example of such a GBS80 fragment is set forth below as SEQ ID NO: 9:
AEVSQERPAKTTVNIYKLQADSYKSEITSNGGIENKDGEVISNYAKLGDNVKGLQGVQFKRYKVKTDISVDELKKLTTV EAADAKVGTILEEGVSLPQKTNAQGLWDALDSKSNVRYLYVEDLKNSPSNITKAYAVPFVLELPVANSTGTGFLSEIN IYPKNWTDEPKTDKDVKKLGQDDAGYTIGEEFKWFLKSTIPANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRD EHYTIDEPTVDNQNTLKITFKPEKFKEIAELLKGMTLVKNQDALDKATANTDDAAFLEIPVASTINEKAVLGKAIENTF ELQYDHTPDKADNPKPSNPPRKPEVHTGGKRFVKKDSTETQTLGGAEFDLLASDGTAVKWTDALIKANTNKNYIAGEAV TGQPIKLKSHTDGTFEIKGLAYAVDANAEGTAVTYKLKETKAPEGYVI PDKEIEFTVSQTSYNTKPTDITVDSADATPD TIKNNKRPS
A particularly immunogenic fragment of GBS80 is located towards the N-terminus of the protein, and is given herein as SEQ ID NO: 10:
AEVSQERPAKTTVNIYKLQADSYKSEITSNGGIENKDGEVISNYAKLGDNVKGLQGVQFKRYKVKTDISVDELKKLTTV EAADAKVGTILEEGVSLPQKTNAQGLWDALDSKSNVRYLYVEDLKNSPSNITKAYAVPFVLELPVANSTGTGFLSEIN IYPKNWTDEPKTDKDVKKLGQDDAGYTIGEEFKWFLKSTIPANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRD EHYTIDEPTVDNQNTLKITFKPEKFKEIAELLKG
Svbl
The wild-type Spbl sequence from serotype III strain COH1 is SEQ ID NO: 3 herein:
MKKKMIQSLLVASLAFGMAVSPVTPIAFAAETGTITVQDTQKGATYKAYKVFDAEIDNANVSDSNKDGASYLIPQGKEA EYKASTDFNSLFTTTTNGGRTYVTKKDTASANEIATWAKSISANTTPVSTVTESNNDGTEVINVSQYGYYYVSSTVNNG AVIMVTSVTPNATIHEKNTDATWGDGGGKTVDQKTYSVGDTVKYTITYKNAVNYHGTEKVYQYVIKDTMPSASWDLNE GSYEVTITDGSGNITTLTQGSEKATGKYNLLEENNNFTITI PWAATNTPTGNTQNGANDDFFYKGINTITVTYTGVLKS
GAKPGSADLPENTNIATINPNTSNDDPGQKVTVRDGQITIKKIDGSTKASLQGAIFVLKNATGQFLNFNDTNNVEWGTE ANATEYTTGADGI ITITGLKEGTYYLVEKKAPLGYNLLDNSQKVILGDGATDTTNSDNLLVNPTVENNKGTELPS!TGGI GTTIFYI IGAILVIGAGIVLVARRRLRS Wild-type Spbl contains a N-terminal leader or signal sequence region which is indicated by the underlined sequence above (aa 1-29). One or more amino acids from the leader or signal sequence region of Spbl can be removed. An example of such a Spbl fragment is set forth below as SEQ ID NO: 11 :
AETGTITVQDTQKGATYKAYKVFDAEIDNANVSDSNKDGASYLI PQGKEAEYKASTDFNSLFTTTTNGGRTYVTKKDTA
SANEIATWAKSISANTTPVSTVTESNNDGTEVINVSQYGYYYVSSTV NGAVIMVTSVTPNATIHEKNTDATWGDGGGK TVDQKTYSVGDTVKYTITYKNAVNYHGTEKVYQYVIKDTMPSASWDLNEGSYEVTITDGSGNITTLTQGSEKATGKYN LLEENNNFTITIPWAATNTPTGNTQNGANDDFFYKGINTITVTYTGVLKSGAKPGSADLPENTNIATINPNTSNDDPGQ KVTVRDGQITIKKIDGSTKASLQGAIFVLKNATGQFLNFNDTNNVEWGTEANATEYTTGADGI ITITGLKEGTYYLVEK KAPLGYNLLDNSQKVILGDGATDTTNSDNLLVNPTVENNKGTELPS!TGGIGTTIFYIIGAILVIGAGIVLVARRRLRS
The wild-type Spbl sequence contains an amino acid motif indicative of a cell wall anchor (LPSTG). In some recombinant host cell systems, it may be preferable to remove this motif to facilitate secretion of a recombinant Spbl protein from the host cell. Thus the cell wall anchor motif and sequence C-terminal to this motif may be removed from Spbl. An example of such a fragment is set forth below as SEQ ID NO: 12:
MKKKMIQSLLVASLAFGMAVSPVTPIAFAAETGTITVQDTQKGATYKAYKVFDAEIDNANVSDSNKDGASYLIPQGKEA EYKASTDFNSLFTTTTNGGRTYVTKKDTASANEIATWAKSISANTTPVSTVTESNNDGTEVINVSQYGYYYVSSTVNNG AVIMVTSVTPNATIHEKNTDATWGDGGGKTVDQKTYSVGDTVKYTITYKNAVNYHGTEKVYQYVIKDTMPSASWDLNE GSYEVTITDGSGNITTLTQGSEKATGKYNLLEENNNFTITI PWAATNTPTGNTQNGANDDFFYKGINTITVTYTGVLKS GAKPGSADLPENTNIATINPNTSNDDPGQKVTVRDGQITIKKIDGSTKASLQGAIFVLKNATGQFLNFNDTNNVEWGTE ANATEYTTGADGI ITITGLKEGTYYLVEKKAPLGYNLLDNSQKVILGDGATDTTNSDNLLV PTVENNKGTE
Alternatively, in some recombinant host cell systems, it may be preferable to use the cell wall anchor motif to anchor the recombinantly expressed protein to the cell wall. The extracellular domain of the expressed protein may be cleaved during purification or the recombinant protein may be left attached to either inactivated host cells or cell membranes in the final composition.
In one embodiment, the leader or signal sequence region, the cell wall anchor motif and sequence C-terminal to this motif are removed from Spbl. An example of such a Spbl fragment is set forth below as SEQ ID NO: 13:
AETGTITVQDTQKGATYKAYKVFDAEIDNANVSDSNKDGASYLI PQGKEAEYKASTDFNSLFTTTTNGGRTYVTKKDTA SANEIATWAKSISANTTPVSTVTESNNDGTEVINVSQYGYYYVSSTVNNGAVIMVTSVTPNATIHEKNTDATWGDGGGK TVDQKTYSVGDTVKYTITYKNAVNYHGTEKVYQYVIKDTMPSASWDLNEGSYEVTITDGSGNITTLTQGSEKATGKYN LLEENNNFTITIPWAATNTPTGNTQNGANDDFFYKGINTITVTYTGVLKSGAKPGSADLPENTNIATINPNTSNDDPGQ KVTVRDGQITIKKIPGSTKASLQGAIFVLKNATGQFLNFNDTNNVEWGTEANATEYTTGADGI ITITGLKEGTYYLVEK KAPLGYNLLDNSQKVILGDGATDTTNSDNLLVNPTVENNKGTE
An E box containing a conserved glutamic residue has also been identified in Spbl (underlined), with a conserved glutamic acid at residue 423 (bold). The E box motif may be important for the formation of oligomeric pilus-like structures, and so useful fragments of Spbl may include the conserved glutamic acid residue.
The wild- type Spb 1 sequence includes an internal methionine codon (Met- 162) that has an upstream 12-mer TAATGGAGCTGT sequence (SEQ ID NO: 14) that includes the core sequence (underlined) of a Shine-Dalgarno sequence. This Shine-Dalgarno sequence has been found to initiate translation of a truncated Spb l sequence. To prevent translation initiation at this site the Shine-Dalgarno sequence can be disrupted in a Spbl -coding sequence used for expression. Although any suitable nucleotide can be mutated to prevent ribosome binding, the sequence includes a GGA glycine codon that is both part of the Shine-Dalgarno core and in-frame with the internal methionine codon. The third base in this codon can be mutated to C, G or T without changing the encoded glycine, thereby avoiding any change in Spbl sequence.
Compositions of the invention may also include a polypeptide defined in refererence [227] by the amino acid sequence NH2-W-X-L-Y-Z-CO2H, wherein: X is a Spbl sequence; L is an optional linker; and Y is a GBS80 sequence; W is an optional N-terminal sequence; and Z is an optional C-terminal sequence. Further details of this polypeptide are given below.
These compositions may also comprise one or more of the GBS protein antigens described above. In particular, compositions of the invention may include (a) a polypeptide of amino acid sequence NH2-W-X-L-Y-Z-CO2H; and (bi) a polypeptide comprising an amino acid sequence of SEQ ID NO 1 as described above, and/or 2) a polypeptide comprising (i) an amino acid sequence that has sequence identity to SEQ ID NO 1 as described above and/or (ii) a fragment of SEQ ID NO 1 as described above, Polypeptide NH?-W-X-L-Y-Z-CO?H
Typically, the polypeptide comprises an amino acid sequence X-L-Y, wherein: X is a Spb l sequence; L is an optional linker; and Y is a GBS80 sequence.
X: Spbl sequence
The X moiety is a Spbl sequence. This Spbl sequence will, when administered to a subject, elicit an antibody response comprising antibodies that bind to wild- type Spbl protein e.g. to the S.agalactiae protein having amino acid sequence SEQ ID NO: 3 (the full-length wild-type sequence from strain COH1).
The Spbl sequence may comprise an amino acid sequence having at least a% identity to SEQ ID NO: 13. The value of a may be selected from 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99 or more. The Spbl sequence may comprise SEQ ID NO: 13.
The Spbl sequence may comprise a fragment of SEQ ID NO: 3 and/or of SEQ ID NO:13. The fragment will usually include at least b amino acids of SEQ ID NO: 3/13, wherein b is selected from 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 24, 26, 28, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 175, 200 or more. The fragment will usually include at least one T-cell or, preferably, a B-cell epitope of SEQ ID NO: 3/13. T- and B- cell epitopes can be identified by the methods described above. SEQ ID NO: 13 is itself a fragment of SEQ ID NO: 3, as explained above.
The Spbl sequence may comprise an amino acid sequence that has both at least a% identity to SEQ ID NO: 13 and comprises a fragment of SEQ ID NO: 13, as defined above.
The X moiety will usually be at least c amino acids long, where c is selected from 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 320, 340, 360, 380, 400 or more. The X moiety will usually be no longer than d amino acids long, where d is selected from 500, 480, 460, 440, 420, 400, 380, 360, 340, 320, 300, 280, 260, 240, 220, 200 or less.
The X moiety will usually be between 300-500 amino acids long e.g. 350-480, 400-460, 430-450.
The wild-type Spbl sequence from serotype III strain COH1 is SEQ ID NO: 3 above. The specific derivatives thereof described in section "SpbF above are applicable to the Spbl sequence of this embodiment of the invention.
Y: GBS80 sequence
The Y moiety is a GBS80 sequence. This GBS80 sequence will, when administered to a subject, elicit an antibody response comprising antibodies that bind to wild-type GBS80 protein e.g. to the S.agalactiae protein having amino acid sequence SEQ ID NO: 2 (the full-length wild-type sequence from strain 2603V/R).
The GBS80 sequence may comprise an amino acid sequence having at least e% identity to SEQ ID NO: 9. The value of e may be selected from 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99 or more. The GBS80 sequence may comprise SEQ ID NO: 9.
The GBS80 sequence may comprise a fragment of SEQ ID NO: 2 or of SEQ ID NO: 9. The fragment will usually include at least / amino acids of SEQ ID NO: 2/9, wherein /is selected from 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 24, 26, 28, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 175, 200 or more. The fragment will usually include at least one T-cell or, preferably, B-cell epitope of SEQ ID NO: 2/9. SEQ ID NO: 9 is itself a fragment of SEQ ID NO: 2, as explained above.
The GBS80 sequence may comprise an amino acid sequence that has both at least e% identity to SEQ ID NO: 9 and comprises a fragment of SEQ ID NO: 9, as defined above.
The Y moiety will usually be at least g amino acids long, where g is selected from 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 320, 340, 360, 380, 400, 420, 440, 460, 480, 500, 520, 540, 560, 580, 600 or more.
The Y moiety will usually be no longer than h amino acids long, where h is selected from 600, 580, 560, 540, 520, 500, 480, 460, 440, 420, 400, 380, 360, 340, 320, 300, 280, 260, 240, 220, 200 or less.
The Y moiety will usually be between 350-550 amino acids long e.g. 400-520, 450-500, 470-490.
The wild-type GBS80 sequence from serotype V isolated strain 2603 V/R is SEQ ID NO: 2 above. The specific derivatives thereof described in section "GBSSO" above are applicable to the GBS80 sequence of this embodiment of the invention.
L: linker
The polypeptide optionally includes a L moiety to link the X and Y moieties. The L moiety is typically a short amino acid sequence e.g. in the range of 2-40 amino acids e.g. consisting of 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39 or 40 amino acids.
Linkers will usually contain at least one glycine residue, thereby facilitating structural flexibility. The linker may contain, for example, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more glycine residues. The glycines may be arranged to include at least two consecutive glycines in a Gly-Gly dipeptide sequence, or a longer oligo-Gly sequence i.e. Glyn where n = 2, 3, 4, 5, 6, 7, 8, 9, 10 or more, e.g. SEQ ID NO: 15:
GGGG
Linkers may be encoded by codons found in the recognition sequences of restriction enzymes. For example, a 6-mer sequence that is the target of a particular restriction enzyme can code for a dipeptide. Thus the recognition sequence for BamHI (GGATCC) encodes Gly-Ser, and so a linker may include a Gly-Ser dipeptide sequence. Such sequences facilitate cloning and manipulation.
Useful linker sequences include SEQ ID NO 15 above and SEQ ID NOs 16, 17 and 18 below:
GGGGSGGGGSGGGG ( SEQ I D NO : 1 6 )
GGGGSGGGGSGGGGSEL ( SEQ I D NO : 17 )
GSGGGG ( SEQ I D NO : 1 8 )
However, preferred linkers do not include a sequence that shares 10 or more contiguous amino acids in common with a human polypeptide sequence. For instance, one glycine-rich linker sequence that can be used with the invention is the 14mer SEQ ID NO: 16. However, this 14mer is also found in a human RNA binding protein (gi: 8051631) and so it is preferably avoided within the L moiety. W: N-terminal sequence
The X moiety may be at the N-terminus of the polypeptide, but it is also possible to have amino acids upstream of X. These optional amino acids form a W moiety.
The W moiety is typically a short amino acid sequence e.g. in the range of 2-40 amino acids e.g. consisting of 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31 , 32, 33, 34, 35, 36, 37, 38, 39 or 40 amino acids.
Examples of W moieties are leader sequences to direct protein trafficking, or comprise short peptide sequences which facilitate cloning or purification (e.g. histidine tags i.e. His„ where n = 3, 4, 5, 6, 7, 8, 9, 10 or more). Other suitable N-terminal amino acid sequences will be apparent to those skilled in the art.
In a nascent polypeptide the W moiety can provide the polypeptide's N-terminal methionine (formyl-methionine, fMet, in bacteria). One or more amino acids may be cleaved from the N-terminus of a nascent W moiety, however, such that the W moiety in a polypeptide of the invention does not necessarily include a N-terminal methionine.
Useful W moieties include SEQ ID NO 19:
MAS Z: C-terminal sequence
The Y moiety may be at the C-terminus of the polypeptide, but it is also possible to have amino acids downstream of Y. These optional amino acids form a Z moiety.
The Z moiety is typically a short amino acid sequence e.g. in the range of 2-40 amino acids e.g. consisting of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39 or 40 amino acids.
Examples of Z moieties include sequences to direct protein trafficking, short peptide sequences which facilitate cloning or purification {e.g. comprising histidine tags i.e. His„ where n = 3, 4, 5, 6, 7, 8, 9, 10 or more), or sequences which enhance protein stability. Other suitable C-terminal amino acid sequences will be apparent to those skilled in the art, such as a glutathione-S-transferase, thioredoxin, 14kDa fragment of S.aureus protein A, a biotinylated peptide, a maltose-binding protein, an enterokinase flag, etc. One useful Z moiety comprises SEQ ID NO 20:
HHHHHH
Useful combinations
Of the various X, Y and L moieties, useful combinations include, but are not limited to:
Figure imgf000042_0001
MASAETGTITVQDTQKGATYKAYKVFDAEIDNANVSDSNKDGASYLI PQGKEAEYKASTDFNSLFTTTTNGGRTYVTKK DTASANEIATWAKSISANTTPVSTVTESNNDGTEVINVSQYGYYYVSSTVNNGAVIMVTSVTPNATIHEKNTDATWGDG GGKTVDQKTYSVGDTVKYTITYKNAV YHGTEKVYQYVIKDTMPSASWDLNEGSYEVTITDGSG ITTLTQGSEKATG KYNLLEENNNFTITI PWAATNTPTGNTQNGANDDFFYKGI TITVTYTGVLKSGAKPGSADLPENTNIATI PNTSNDD PGQKVTVRDGQITIKKIDGSTKASLQGAIFVLKNATGQFLNFNDTNNVEWGTEANATEYTTGADGI ITITGLKEGTYYL VEKKAPLGYNLLDNSQKVILGDGATDTTNSDNLLVNPTVENNKGTEGGGGSGGGGSGGGGSELAEVSQERPAKTTVNIY KLQADSYKSEITSNGGIENKDGEVISNYAKLGDNVKGLQGVQFKRYKVKTDISVDELKKLTTVEAADAKVGTILEEGVS LPQKTNAQGLVVDALDSKSNVRYLYVEDLKNSPS ITKAYAVPFVLELPVANSTGTGFLSEI IYPKNWTDEPKTDKD VKKLGQDDAGYTIGEEFKWFLKSTIPANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRDEHYTIDEPTVDNQNTL KITFKPEKFKEIAELLKGMTLVKNQDALDKATANTDDAAFLEIPVASTINEKAVLGKAIENTFELQYDHTPDKADNPKP SNPPRKPEVHTGGKRFVKKDSTETQTLGGAEFDLLASDGTAVKWTDALIKANTNKNYIAGEAVTGQPIKLKSHTDGTFE IKGLAYAVDANAEGTAVTYKLKETKAPEGYVI PDKEIEFTVSQTSYNTKPTDITVDSADATPDTIKNNKRPS (SEQ ID NO:21)
MASAETGTITVQDTQKGATYKAYKVFDAEIDNANVSDSNKDGASYLI PQGKEAEYKASTDFNSLFTTTTNGGRTYVTKK DTASANEIATWAKSISANTTPVSTVTESNNDGTEVINVSQYGYYYVSSTVNNGAVIMVTSVTPNATIHEKNTDATWGDG GGKTVDQKTYSVGDTVKYTITYKNAVNYHGTEKVYQYVIKDTMPSASWDLNEGSYEVTITDGSGNITTLTQGSEKATG KYNLLEENNNFTITIPWAATNTPTGNTQNGANDDFFYKGINTITVTYTGVLKSGAKPGSADLPENTNIATINPNTSNDD PGQKVTVRDGQITIKKIDGSTKASLQGAIFVLKNATGQFLNFNDTNNVEWGTEANATEYTTGADGI ITITGLKEGTYYL VEKKAPLGYNLLDNSQKVILGDGATDTTNSDNLLVNPTVENNKGTEGGGGSGGGGSGGGGSELAEVSQERPAKTTVNIY KLQADSYKSEITSNGGIENKDGEVISNYAKLGDNVKGLQGVQFKRYKVKTDISVDELKKLTTVEAADAKVGTILEEGVS LPQKTNAQGLWDALDSKSNVRYLYVEDLKNSPSNITKAYAVPFVLELPVANSTGTGFLSEINIYPKNWTDEPKTDKD VKKLGQDDAGYTIGEEFKWFLKSTIPANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRDEHYTIDEPTVDNQNTL KITFKPEKFKEIAELLKGMTLVKNQDALDKATANTDDAAFLEI PVASTINEKAVLGKAIENTFELQYDHTPDKADNPKP SNPPRKPEVHTGGKRFVKKDSTETQTLGGAEFDLLASDGTAVKWTDALIKANTNKNYIAGEAVTGQPIKLKSHTDGTFE IKGLAYAVDANAEGTAVTYKLKETKAPEGYVI PDKEIEFTVSQTSYNTKPTDITVDSADATPDTIKNNKRPSHHHHHH
(SEQ ID NO:22)
MASAETGTITVQDTQKGATYKAYKVFDAEIDNANVSDSNKDGASYLI PQGKEAEYKASTDFNSLFTTTTNGGRTYVTKK DTASANEIATWAKSISANTTPVSTVTESNNDGTEVINVSQYGYYYVSSTVNNGAVIMVTSVTPNATIHEKNTDATWGDG GGKTVDQKTYSVGDTVKYTITYKNAWYHGTEKVYQYVIKDTMPSASWDLNEGSYEVTITDGSGNITTLTQGSEKATG KYNLLEENNNFTITIPWAATNTPTGNTQNGANDDFFYKGINTITVTYTGVLKSGAKPGSADLPENTNIATINPNTSNDD PGQKVTVRDGQITIKKIDGSTKASLQGAIFVLKNATGQFLNFNDTNNVEWGTEANATEYTTGADGI ITITGLKEGTYYL VEKKAPLGYNLLDNSQKVILGDGATDTTNSDNLLVNPTVENNKGTEGSGGGGELAEVSQERPAKTTVNIYKLQADSYKS EITSNGGIENKDGEVISNYAKLGDNVKGLQGVQFKRYKVKTDISVDELKKLTTVEAADAKVGTILEEGVSLPQKTNAQG LWDALDSKSNVRYLYVEDLKNSPS ITKAYAVPFVLELPVANSTGTGFLSEI IYPKNVVTDEPKTDKDVKKLGQDDA GYTIGEEFKWFLKSTIPANLGDYEKFEITDKFADGLTYKSVGKIKIGSKTLNRDEHYTIDEPTVDNQNTLKITFKPEKF KEIAELLKGMTLVKNQDALDKATANTDDAAFLEI PVASTI EKAVLGKAIENTFELQYDHTPDKAD PKPS PPRKPEV HTGGKRFVKKDSTETQTLGGAEFDLLASDGTAVKWTDALIKANTNKNYIAGEAVTGQPIKLKSHTDGTFEIKGLAYAVD ANAEGTAVTYKLKETKAPEGYVI PDKEIEFTVSQTSYNTKPTDITVDSADATPDTIKNNKRPS (SEQ ID NO: 23)
The polypeptide may comprise an amino acid sequence having at least i% sequence identity to SEQ ID NO: 21. The value of z may be selected from 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99 or more. The polypeptide may comprise SEQ ID NO: 21.
The polypeptide may comprise an amino acid sequence having at least i% sequence identity to SEQ ID NO: 23. The value of may be selected from 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99 or more. The polypeptide may comprise SEQ ID NO: 23.
A polypeptide used with the invention may comprise an amino acid sequence that:
(a) is identical {i.e. 100% identical) to SEQ ID NO: 21 or 23;
(b) shares sequence identity SEQ ID NO: 21 or 23;
(c) has 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 (or more) single amino acid alterations (deletions, insertions, substitutions), which may be at separate locations or may be contiguous, as compared to the sequences of (a) or (b); and
(d) when aligned SEQ ID 21 or 23 using a pairwise alignment algorithm, each moving window of x amino acids from N-terminus to C-terminus (such that for an alignment that extends to p amino acids, where p>x, there are p-x+1 such windows) has at least xy identical aligned amino acids, where: x is selected from 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200; y is selected from 0.50, 0.60, 0.70, 0.75, 0.80, 0.85, 0.90, 0.91 , 0.92, 0.93, 0.94, 0.95, 0.96, 0.97, 0.98, 0.99; and if xy is not an integer then it is rounded up to the nearest integer. The preferred pairwise alignment algorithm is the Needleman-Wunsch global alignment algorithm [228], using default parameters (e.g. with Gap opening penalty = 10.0, and with Gap extension penalty = 0.5, using the EBLOSUM62 scoring matrix). This algorithm is conveniently implemented in the needle tool in the EMBOSS package [229].
Within group (c), deletions or substitutions may be at the N-terminus and/or C-terminus, or may be between the two termini. Thus a truncation is an example of a deletion. Truncations may involve deletion of up to 40 (or more) amino acids at the N-terminus and/or C-terminus.
The Spbl and GBS80 sequences in the polypeptides may be derived from one or more GBS strains. For instance, SEQ ID NOs: 21 and 23 include Spb l sequence from strain COH1 and GBS80 sequence from strain 2603V/R.
Polypeptides
The polypeptides, or individual moieties, may, compared to SEQ ID NOs: 2, 3, 9, 10, 13, 21 or 23, include one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) conservative amino acid replacements i.e. replacements of one amino acid with another which has a related side chain. Genetically-encoded amino acids are generally divided into four families: (1) acidic i.e. aspartate, glutamate; (2) basic i.e. lysine, arginine, histidine; (3) non-polar i.e. alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar i.e. glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids. In general, substitution of single amino acids within these families does not have a major effect on the biological activity. The polypeptides may have one or more {e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) single amino acid deletions relative to a reference sequence. The polypeptides may also include one or more {e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) insertions {e.g. each of 1, 2, 3, 4 or 5 amino acids) relative to a reference sequence.
The polypeptides can be prepared in many ways, as described above. The polypeptides can also take various forms {e.g. native, fusions, glycosylated, non-glycosylated, lipidated, non-lipidated, phosphorylated, non-phosphorylated, myristoylated, non-myristoylated, monomeric, multimeric, particulate, denatured, etc.), as described above. The polypeptides are preferably provided in purified or substantially purified form, as described above.
The term "polypeptide" refers to amino acid polymers of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art. Polypeptides can occur as single chains or associated chains. The polypeptides can be naturally or non-naturally glycosylated {i.e. the polypeptide has a glycosylation pattern that differs from the glycosylation pattern found in the corresponding naturally occurring polypeptide).
The polypeptides may be at least 40 amino acids long {e.g. at least 40, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 350, 400, 450, 500 or more). The polypeptides may be shorter than 1100 amino acids.
Pre-im m un isation
In a second aspect, the invention provides a method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof. Typically, the conjugate is one of the GBS conjugates in an immunogenic composition of the first aspect of the invention, as described above. In other words, immunogenic compositions of the first aspect of the invention wherein at least one conjugate is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof may be used in the second aspect of the invention. The capsular saccharide conjugated to the diphtheria toxoid or derivative thereof in the composition may for example be from GBS serotype la, lb or III. In particular, the capsular saccharide may be from GBS serotype III (as exemplified below). In this aspect it is typical for all of the capsular saccharides from GBS in the composition to be conjugated to a diphtheria toxoid or derivative thereof. Where the carrier or pre-immunisation antigen is a derivative of a diphtheria toxoid then that derivative preferably remains immunologically cross-reactive with Dt, and is preferably CRM 197. The inventors have found that conjugates that are capsular saccharides from GBS conjugated to a diphtheria toxoid or derivative thereof do not seem to suffer from carrier-induced epitopic suppression (or "carrier suppression", as it is generally known), particularly suppression arising from carrier priming. As discussed below, "carrier suppression" is the phenomenon whereby pre-immunisation of an animal with a carrier protein prevents it from later eliciting an immune response against a new antigenic epitope that is presented on that carrier [230]. In contrast to this known phenomenon, the inventors have found that the immune response to GBS capsular saccharide-diphtheria toxoid or derivative thereof conjugates may in fact be improved by pre-immunisation with the diphtheria toxoid or derivative thereof.
As reported in reference 231 , where several vaccine antigens contain the same protein component (being used as an immunogen and/or as a carrier protein in a conjugate) then there is the potential for interference between those antigens. In reference 231 , the immune response against an antigen that was conjugated to a tetanus toxoid (Tt) carrier was suppressed by pre-existing immunity against Tt.
Reference 232 reports how a combination of D-T-P vaccines with a Hib conjugate vaccine was adversely affected where the carrier for the Hib conjugate was the same as the tetanus antigen from the D-T-P vaccine. The authors concludes that this "carrier suppression" phenomenon, arising from interference by a common protein carrier, should be taken into account when introducing vaccines that include multiple conjugates.
In contrast to references 231 and 232, reference 233 reported that priming with tetanus toxoid had no negative impact on the immune response against a subsequently-administered Hib-Tt conjugate, but suppression was seen in patients with maternally acquired anti-Tt antibodies. In reference 234, however, an "epitopic suppression" effect was reported for a Tt-based peptide conjugate in patients having existing anti-Tt antibodies resulting from tetanus vaccination.
In reference 235, it was suggested that a conjugate having CRM 197 (a detoxified mutant of diphtheria toxin) as the carrier may be ineffective in children that had not previously received diphtheria toxin as part of a vaccine (e.g. as part of a D-T-P or D-T vaccine). This work was further developed in reference 236, where a carrier priming effect by D-T immunisation was seen to persist for subsequent immunisation with Hib conjugates.
In reference 237, the authors found that pre-immunisation with a diphtheria or tetanus toxoid carrier protein reduced the increase in anti-Hib antibody levels after a subsequent immunisation with the Hib capsular saccharide conjugated to those carriers, with IgG l and IgG2 being equally affected. Responses to the carrier portions of the conjugates were also suppressed. Furthermore, a more general non-epitope-specific suppression was seen, as pre-immunisation with one conjugate was seen to affect immune responses against both the carrier and saccharide portions of a second conjugate that was administered four weeks later.
The use of different carrier proteins in a single multivalent pneumococcal conjugate vaccine is reported in reference 238, with multiple carriers being used in order to avoid carrier suppression. The authors predict that there is a maximum load of a carrier protein that can be tolerated in a multivalent conjugate vaccine without giving rise to negative interference. In reference 239 it was reported that pneumococcal conjugate vaccines including mixed carrier proteins elicited, in parallel to the anti- pneumococcus response, unintentional booster responses to the carriers.
In reference 240, an investigation of whether diphtheria and tetanus boosters could be administered with monovalent meningococcal serogroup C conjugates, it was found that titres against the meningococcal conjugate were reduced where the carrier was tetanus toxoid carrier and the patient had received prior immunisation with a tetanus-containing vaccine.
In addition to the problem of priming with a carrier having a negative impact on immune responses against saccharide conjugates, the reverse can also occur i.e. immunisation with a conjugate can have a negative impact on immune responses against the carrier [241].
This second aspect of the invention therefore provides a method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof. This aspect also provides a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof for use in immunising a patient against infection by GBS, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof. This aspect further provides the use of a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof in the manufacture of a medicaument for immunising a patient against infection by GBS, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof.
The pre-immunised patient
This patient to be immunised has been pre-immunised with a diphtheria toxoid or derivative thereof. The diphtheria toxoid or derivative thereof may have been administered as the carrier in a conjugate of a capsular saccharide of an organism other than GBS and a diphtheria toxoid or derivative thereof. Typical pre-immunisation will have included: a diphtheria toxoid antigen; a Hib capsular saccharide conjugate using a diphtheria toxoid or CRM197 carrier; and/or a pneumococcal capsular saccharide conjugate using a diphtheria toxoid or CRM 197 carrier.
The patient will have received at least one (e.g. 1 , 2, 3 or more) dose of the pre-immunisation antigen(s), and that dose (or the earliest of multiple doses) will have been administered to the patient at least six (e.g. 6, 9, 12, 15, 18, 21 , 24, 36, 48, 60, 120, 180, 240, 300 or more) months before the immunisation with the GBS conjugates according to this aspect of invention. In a preferred group of patients, the pre-immunisation took place within 3 years of birth e.g. within 2 years of birth, within 1 year of birth, within 6 months of birth, or even within 3 months, 2 months or 1 month of birth. Suitable patients to be immunised according to this aspect of the invention are described above in the section Methods of treatment.
Where the pre-immunisation antigen is a diphtheria toxoid then the patient will typically have received the toxoid as the 'D' antigen in a D-T-P or a D-T pre-immunisation. Such immunisations are typically given to newborn children at ages 2, 3, and 4 months. Where the immunisation includes a pertussis vaccine, that vaccine may be a whole cell or cellular pertussis vaccine ('Pw'), but is preferably an acellular pertussis vaccine ('Pa'). Pre-immunisation Pa vaccines will generally include one, two or three of the following well-known and well-characterised B. pertussis antigens: (1) pertussis toxoid ('ΡΤ'), detoxified either by chemical means or by site-directed mutagenesis e.g. the '9K/129G' mutant [242]; (2) filamentous haemagglutinin ('FHA'); (3) pertactin (also known as '69 kiloDalton outer membrane protein'). Acellular pertussis vaccines may also include agglutinogen 2 and/or agglutinogen 3. The 'T' antigen in a D-T-P pre-immunisation is typically a tetanus toxoid.
Where the pre-immunisation antigen is a diphtheria toxoid then the patient may also or alternatively have received the toxoid as the carrier protein of a protein-saccharide conjugate. Such conjugates include the 'PRP-D' Hib conjugate [see Table 14-7 of ref. [243] e.g. the ProHIBIT™ product.
Where the pre-immunisation antigen is CRM197 then the patient will typically have been pre-immunised with a Hib conjugate and/or a multivalent pneumococcal conjugate. Such immunisations are typically given to newborn children at ages 2, 3, and 4 months. Hib conjugates that use a CRM197 carrier include the 'HbOC conjugates [Table 14-7 of ref. 243] e.g. the HibTITER™ product. Pneumococcal conjugates that use a CRM 197 carrier include the 7-valent PCV7 mixtures e.g. the PrevNar™ vaccine [244]. The patient may also have been pre-immunised with a serogroup C meningococcal ('MenC') conjugate. MenC conjugates that use CRM197 carrier include Meninvact™/Menjugate™ [245] and Meningitec™.
Where pre-immunisation was with a conjugated antigen then the patient will almost inevitably have also received a small amount of free diphtheria toxoid (or derivative) as a result of low-level contamination of the conjugate {e.g. caused by hydrolysis of the conjugate during storage), but this small amount will not typically have been adequate to provide a significant immune response.
Diphtheria toxoid is a well known and well characterised protein [e.g. see chapter 13 of ref. 243] that can be obtained by treating the ADP-ribosylating exotoxin of Corynebacterium diphtheriae with an inactivating chemical, such as formalin or formaldehyde. CRM 197 is also well known and well characterised [246-249], and has been widely used as a carrier in conjugated saccharide vaccines. CRM197 and Dt share many carrier epitopes. The result of the pre-immunisation is that the patient's immune system has been exposed to the pre-immunisation antigens. For pre-immunisation with diphtheria toxoid (Dt), this generally means that the patient will have raised an anti-Dt antibody response (typically to give an anti-Dt titer >0.01 IU/ml) and will possess memory B and/or T lymphocytes specific for Dt i.e. pre-immunisation with Dt is typically adequate to elicit an anamnestic anti-Dt immune response in the patient. For pre-immunisation where Dt (or derivative) is a carrier for a saccharide within a conjugate then the pre-immunisation will have raised an anti-saccharide response and the patient will possess memory B and/or T lymphocytes specific for the saccharide i.e. the pre-immunisation is typically adequate to elicit an anamnestic anti-saccharide immune response in the patient. The pre-immunisation was preferably adequate to elicit protective immunity in the patient e.g. against diphtheria disease.
Thus the patients to be immunised according to this aspect of the invention are distinct from patients in general, as they are members of a subset of the general population whose immune systems have already mounted an immune response to the pre-immunisation antigens, such that immunisation according to this aspect with a GBS conjugate that includes a diphtheria toxoid (or derivative thereof) carrier elicits a different immune response in the subset than in patients who have not previously mounted an immune response to the pre-immunisation antigens. Patients who have been pre-immunised with Dt (or derivative) as the carrier of a conjugate (particularly of a Hib conjugate) are preferred. Particularly preferred patients have been pre-immunised with Dt (or derivative) as the carrier of a conjugate and also with Dt as an unconjugated immunogen.
As well as having been pre-immunised with a diphtheria toxoid (or derivative), in conjugated or non-conjugated form, the patient may have been pre-immunised with other antigens. Such antigens include, but are not limited to: pertussis antigen(s) - see above; tetanus toxoid - see above; Haemophilus influenzae type B - see above; hepatitis B surface antigen (HBsAg); poliovirus, such as an inactivated poliovirus vaccine (IPV); Streptococcus pneumoniae - see above; influenza virus; BCG; hepatitis A virus antigens; measles virus; mumps virus; rubella virus; varicella virus; etc.
The patient may or may not have been pre-immunised with one or more GBS conjugate(s). In some preferred embodiments, at the time when a patient first receives a GBS conjugate, they have already been pre-immunised with Dt (or derivative). In other embodiments, a GBS conjugate is administered to a patient who has already been pre-immunised with both (i) Dt or a derivative and (ii) a GBS conjugate.
Tetanus toxoid carriers
Although this second aspect of the invention has been described above in relation to diphtheria toxoid carriers (and their derivatives), with tetanus toxoid preferably not being used, alternative embodiments of this aspect use a tetanus toxoid (or derivative) carrier, with diphtheria toxoid preferably not being used. In these alternative embodiments then the above definitions can be modified accordingly. For instance, the second aspect of the invention provides a method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof, wherein the patient has been pre-immunised with a tetanus toxoid or derivative thereof. This aspect also provides a conjugate that is a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof for use in immunising a patient against infection by GB S, wherein the patient has been pre-immunised with a tetanus toxoid or derivative thereof. This aspect further provides the use of a conjugate that is a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof in the manufacture of a medicaument for immunising a patient against infection by GBS, wherein the patient has been pre-immunised with a tetanus toxoid or derivative thereof. Conjugates that are capsular saccharides from GBS conjugated to a tetanus toxoid or derivative thereof may not suffer from carrier suppression, particularly suppression arising from carrier priming. The immune response to GBS capsular saccharide-tetanus toxoid or derivative thereof conjugates may in fact be improved by pre-immunisation with the tetanus toxoid or derivative thereof.
Typically, the conjugate is one of the GBS conjugates in an immunogenic composition of the first aspect of the invention, as described above. In other words, immunogenic compositions of the first aspect of the invention wherein at least one conjugate is a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof may be used in the second aspect of the invention. The capsular saccharide conjugated to the tetanus toxoid or derivative thereof in the composition may for example be from GBS serotype la, lb or III. In particular, the capsular saccharide may be from GBS serotype III. In this aspect it is typical for all of the capsular saccharides from GBS in the composition to be conjugated to a tetanus toxoid or derivative thereof.
Tetanus toxoid is a well known protein [e.g. see chapter 27 of ref. 243], and can be obtained by inactivating the ADP-ribosylating exotoxin of Clostridium tetani. Patients will typically have received tetanus toxoid as the 'T' antigen in a D-T-P or a D-T pre-immunisation, or as the carrier protein in a conjugate. Such conjugates include the 'PRP-T' Hib conjugate [see Table 14-7 of ref. 243] e.g. the ActHIB™, OmniHIB™ and HIBEPJX™ products.
General
The term "comprising" encompasses "including" as well as "consisting" e.g. a composition "comprising" X may consist exclusively of X or may include something additional e.g. X + Y.
The term "about" in relation to a numerical value x means, for example, x+10%.
The word "substantially" does not exclude "completely" e.g. a composition which is "substantially free" from Y may be completely free from Y. Where necessary, the word "substantially" may be omitted from the definition of the invention.
It will be appreciated that sugar rings can exist in open and closed form and that, whilst closed forms are shown in structural formulae herein, open forms are also encompassed by the invention. Similarly, it will be appreciated that sugars can exist in pyranose and furanose forms and that, whilst pyranose forms are shown in structural formulae herein, furanose forms are also encompassed. Different anomeric forms of sugars are also encompassed.
Unless specifically stated, a process comprising a step of mixing two or more components does not require any specific order of mixing. Thus components can be mixed in any order. Where there are three components then two components can be combined with each other, and then the combination may be combined with the third component, etc.
Antibodies will generally be specific for their target. Thus they will have a higher affinity for the target than for an irrelevant control protein, such as bovine serum albumin.
Unless otherwise stated, identity between polypeptide sequences is preferably determined by the Smith- Waterman homology search algorithm as implemented in the MPSRCH program (Oxford Molecular), using an affine gap search with parameters gap open penalty=12 and gap extension penalty=l.
BRIEF DESCRIPTION OF DRAWINGS
Figure 1 shows the difference between the repeating structures in GBS serotypes la and III.
Figure 2 shows the repeating structures of capsular saccharides in GBS serotypes la, lb, II, III & V.
Figure 3 shows the repeating structure of the desialylated form of the capsular saccharide from GBS serotype V.
Figure 4 shows the effect of priming with CRM197 prior to administration of a conjugate of GBS serotype III capsular saccharide and CRM 197, with and without adjuvant.
MODES FOR CARRYING OUT THE INVENTION
Conjugate production
Purified capsular saccharides from Streptococcus agalactiae serotypes la, lb and III were conjugated to a carrier protein by periodate oxidation followed by reductive amination (ref. 2). Purified, desialylated capsular saccharide from Streptococcus agalactiae serotype V was conjugated to a carrier protein by periodate oxidation followed by reductive amination (ref. 14). The carrier protein in most cases was CRM197. Tetanus toxoid was used as a carrier protein where specifically indicated.
Mouse study (1).
In this study, the effect of the adjuvant on the efficacy and immunogenicity of GBS serotype la, lb and III conjugates, either as monovalent or combination vaccines, was evaluated in an active maternal-neonatal challenge mouse model.
The maternal-neonatal challenge mouse model, adapted from the reference 250, is used to to assess the efficacy in neonates of specific antibodies acquired transplacentally from actively vaccinated dams. Specifically, female CD-I mice, aged between 5-6 weeks from Charles River Laboratories (Calco, Italy), are vaccinated by intra-peritoneal injection with two or three immunizations on days 1, 21 and eventually 35, with or without adjuvant. After the last immunization, mice are bred and kept until delivery. An inoculum of a GBS strain (0.05 mL of Todd-Hewitt broth), lethal for 90% of non- immunized pups (100-1000 fold LD50), is used to challenge the neonatal mice. Challenge is by the intra-peritoneal route within 48 hours of birth. The number of surviving pups at 72 hours is recorded and survival rates are compared in all treated groups using the Fisher's exact test. In a control group, dams receive PBS by the same route and using the same dosing schedule. Two weeks after the last immunization, blood samples are collected for immunogenicity assessment using two in vitro assays (the ELISA and Opsonophagocytosis assays described below).
The ELISA assay is performed to determine the titer of GBS-specific antibodies produced following immunization. ELISA is also used to quantify the total IgG against each capsular saccharde antigen. Serum from each individual mouse is analyzed and the Geometric Mean Titer (GMT) calculated for each group. Antibody titers for capsular saccharde types la, lb and III are expressed as Mouse ELISA Unit (MEU) and are calculated based on the Reference Line Assay Method.
The Opsonophagocytosis assay (OPA) is performed to evaluate the titer of vaccine-induced antibodies capable of complement-mediated GBS killing (using the approach described in reference 251). The assay is performed by combining the following components: bacteria, phagocytic cells (PMNs extracted from human blood or the differentiated HL-60 cell line), complement and immune sera. Aliquots of the reaction mix are plated before and after a lh incubation at 37 °C to determine the remaining colony forming units (CFU). The amount of opsonophagocytic killing (log kill) is determined by subtracting the log of the surviving colony number from the log of the CFU number present at the initial time-point. A pre-immune serum, and heat-inactivated complement without PMNs, is used as negative control. Bactericidal titer is expressed as reciprocal serum dilution leading to reduction in 50% of bacteria.
In this study, female CD1 mice were immunized with two doses (1 μg each) of the three different conjugates in the presence of adjuvant (aluminum hydroxide or MF59) on days 0 and 21. The neonates were challenged with type specific strains as shown below in Table 1.
Table 1: Determination of the protection level and antibody titers obtained with GBS serotype la, lb and III/CRM197 conjugates in the presence of aluminum hydroxide or MF59 in the active maternal-neonatal challenge mouse model.
Challenge Alive/Treated Survival
Antigen Adjuvant GMT titers
Strain (type) (%)
CRM-la Al-H 281 A909 (la) 77/80 96
CRM-la MF59 1253 A909 (la) 66/75 88
PBS - - A909 (la) 1/65 1
CRM-lb Al-H 1097 7357B (lb) 65/70 93
CRM-lb MF59 7843 7357B (lb) 47/60 78
PBS - - 7357B (lb) 6/70 8
CRM-Ill Al-H 234 COH1 (III) 44/45 98
CRM-Ill MF59 898 COH1 (III) 68/80 85
PBS - - COH1 (III) 0/68 0
- Not applicable
High levels of protection were achieved with the monovalent vaccines for all three serotypes with both aluminum hydroxide and MF59. However, slightly lower survival rates were obtained with the adjuvant MF59 even in presence of higher antibody titers.
In an additional experiment, mice were immunized with three doses of combinations at 1 μg of each conjugate in the presence of adjuvant on days 0, 21 and 35. The neonates were challenged with type specific strains as shown below in Table 2.
Table 2: Determination of the protection level and antibody titers obtained with combinations of GBS serotype la, lb and III/CRM197 conjugates in the presence or absence of adjuvant in the active maternal-neonatal challenge mouse model.
Challenge Alive/Treated Survival
Antigen Adjuvant GMT titers
Strain (type) (%)
Combo Al-H 1279 090 (la) 27/30 90
Combo MF59 4592 090 (la) 61/65 94
Combo No-Adjuvant 218 090 (la) 59/77 77
PBS - - 090 (la) 0/70 0
Combo Al-H 2086 H36B (lb) 64/70 91
Combo MF59 5921 H36B (lb) 65/80 81
Combo No-Adjuvant 386 H36B (lb) 56/70 80
PBS - - H36B (lb) 6/79 7
Combo Al-H 596 M781 (III) 30/40 75
Combo MF59 1978 M781 (III) 70/70 100
Combo No-Adjuvant 163 M781 (III) 60/79 76
PBS - - M781 (III) 3/77 4
Combo = CRM197-Ia + CRM197-Ib + CRM197-III; - : Not applicable
High levels of protection were achieved with the combination vaccines in all three formulations in the presence or absence of adjuvant, although lower antibody titers were achieved in the absence of adjuvant.
Mouse study (2)
In this study, the effect of lyophilization on the efficacy and immunogenicity of the serotype la, lb and III/CRM197 conjugates in the active maternal-neonatal challenge mouse model was evaluated. Mice were immunized with two doses (1 μg each) of the three different conjugates, in the presence or absence of adjuvant on days 0, and 21. The neonates were challenged with type specific strains as shown below in Table 3.
Table 3: Determination of the protection level, antibody titers and bactericidal titers achieved by the serotype la, lb and III/CRM197 conjugates, when administered to mice as liquid or lyophilized antigen in the presence or absence of aluminum hydroxide in the active maternal- neonatal challenge mouse model.
Bactericidal Challenge Alive/ Survival
Antigen Adjuvant GMT titer
titer Strain (type) Treated
(%)
CRM-la
Lyophilized PBS 48 < 100 090 (la) 46/78 59
CRM-la
Lyophilized Al-H 1201 567 090 (la) 47/51 92
CRM-la Liquid PBS 14 < 100 090 (la) 11/60 18
CRM-la Liquid Al-H 901 436 090 (la) 58/60 96
PBS Al-H - - 090 (la) 1/57 2
CRM-lb
Lyophilized PBS 23 366 H36B (lb) ND ND
CRM-lb
Lyophilized Al-H 172 2146 H36B (lb) ND ND
CRM-lb Liquid PBS 27 375 H36B (lb) 12/40 30
CRM-lb Liquid Al-H 169 1756 H36B (lb) 73/78 93
PBS Al-H - - H36B (lb) 6/72 8
CRM-Ill
Lyophilized PBS 59 419 M781 (III) ND ND
CRM-Ill
Lyophilized Al-H 429 1861 M781 (III) ND ND
CRM-Ill Liquid PBS 127 1707 M781 (III) 48/50 96
CRM-Ill Liquid Al-H 198 1100 M781 (III) 44/45 98
PBS Al-H - - M781 (III) 5/66 7
- Not applicable; ND: not determined
The lyophilization process did not affect the immunogenicity of the GBS conjugates. Antibody titers and bactericidal titers were comparable in mice that received both liquid and lyophilized formulations.
Mouse study (3)
In this study, the effect of lyophilization on the efficacy of the serotype V/CRM197 conjugate in the active maternal-neonatal challenge mouse model was evaluated. Mice were immunized with two doses (1, 5 or 10 μg each) of the conjugates in the presence or absence of adjuvant on days 0 and 21. The neonates were challenged with a type V strain. The results are shown in Table 4 below. Table 4: Determination of the protection level achieved by the serotype V/CRM197 conjugate, when administered to mice as liquid or lyophilized antigen in presence or absence of aluminum hydroxide in the active maternal-neonatal challenge mouse model.
Figure imgf000055_0001
The lyophilization process did not affect the immunogenicity of the GBS conjugate. Survial rates were comparable in mice that received both liquid and lyophilized formulations.
Mouse study (4)
In this study, the effect of different doses on the efficacy of a mixture of the GBS serotype la, lb, III and V conjugates was evaluated in the active maternal-neonatal challenge mouse model. Mice were immunized with two doses of the combination at 0.2, 1 or 5 μg of each of the GBS serotype la, lb, III and V conjugates without adjuvant on days 0 and 21. The neonates were challenged with type specific strains as shown below in Table 5 below.
Table 5: Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates in the active maternal-neonatal challenge mouse model.
Challenge Strain (type)
Antigen Doses
090 (la) H36B (lb) M781 (III) CJB111 (V)
Dead/treated (°/ Ό survival)
Combo 5 μg each 17/60 (72) 13/70 (81) 18/70 (74) 20/68 (70)
Combo 1 μg each 23/70 (67) 18/70 (74) 6/60 (90) 44/66 (33)
Combo 0.2 μg each 14/51 (72) 25/79 (68) 18/78 (77) 41/60 (32)
PBS 0 57/58 (2) 49/50 (2) 49/50 (2) 45/50 (10)
Combo = CRM197-Ia + CRM197-Ib + CRM197-III + CRM197-V
Higher dosage of GBS serotype V conjugate raised the level of protection. Mouse study (5)
In this study, the effect of different numbers of doses on the efficacy of a mixture of the GBS serotype la, lb, III and V conjugates was evaluated in the active maternal-neonatal challenge mouse model. Mice were immunized with one, two or three doses (1 μg of each conjugate) of the combination in the presence of an alum adjuvant on days 0, 21 and 35 as appropriate. The neonates were challenged with type specific strains as shown below in Table 6 below.
Table 6: Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates in the presence of adjuvant in the active maternal-neonatal challenge mouse model.
Challenge Strain (type)
Antigen Doses
090 (la) H36B (lb) M781 (III) CJB111 (V)
Dead/treated (°/ Ό survival)
Combo 3 5/80 (94) 4/60 (93) 1/50 (98) 32/70 (54)
Combo 2 6/80 (92) 11/60 (82) 1/70 (98) 42/57 (26)
Combo 1 61/90 (32) 21/50 (58) 4/60 (93) 52/58 (10)
PBS 3 50/50 (0) 49/50 (2) 52/58 (10) 59/60 (2)
Combo = CRM197-Ia + CRM197-Ib + CRM197-III + CRM197-V
Bactericidial titers were measured following administration of the mixture of serotype la, lb, III and V conjugates in this study. OPA titers are shown below:
Figure imgf000056_0001
The number of immunizations strongly affected the immune response to the GBS serotype V conjugate.
Mouse study (6)
In this study, the efficacy of a mixture of the GBS serotype la, lb, III and V conjugates compared to the GBS serotype V conjugate alone was evaluated in the active maternal- neonatal challenge mouse model. Mice were immunized with three doses of combinations at 1 μg of each conjugate or GBS serotype V conjugate at 1 μg in the presence of alum adjuvant on days 0, 21 and 35. The neonates were challenged with the CJB111 and 2603 V/R type V strains. The results are shown in Table 7 below. Table 7: Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates or GBS serotype V conjugate alone in the presence of adjuvant in the active maternal-neonatal challenge mouse model.
Figure imgf000057_0001
Combo = CRM197-Ia + CRM197-Ib + CRM197-III + CRM197-V
The immune response to the capsular saccharide from GBS serotype V was diminished when GBS serotype la, lb and III conjugates were also present in the composition.
Mouse study (7)
In this study, the effect of adjuvant on the immunogenicity and efficacy of a mixture of the GBS serotype la, lb, III and V conjugates compared to the GBS serotype V conjugate alone was evaluated in the active maternal- neonatal challenge mouse model. Mice were immunized with three doses of combinations at 1 μg of each conjugate or GBS serotype V conjugate at 1 μg in the presence or absence of adjuvant on days 0, 21 and 35. The neonates were challenged with the CJB11 1 type V strain. The results are shown in Table 8 below.
Table 8: Determination of the protection level, antibody titers and bactericidal titers obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates or GBS serotype V conjugate alone in the presence or absence of adjuvant in the active maternal-neonatal challenge mouse model.
Figure imgf000057_0002
Once again, the immune response to the capsular saccharide from GBS serotype V was diminished when GBS serotype la, lb and III conjugates were also present in the composition. Survival was improved by addition of adjuvant, even though addition of adjuvant to the GBS serotype V conjugate alone did not have this effect in this experiment. Mouse study (8)
In this study, the effect of increasing the dose of GBS serotype V conjugate on the efficacy of a mixture of the GBS serotype la, lb, III and V conjugates was evaluated in the active maternal- neonatal challenge mouse model. Mice were immunized with two doses of combinations at 1 μg of each conjugate or two doses of combinations at 1 μg of the the GBS serotype la, lb, III conjugates and 5 μg of the GBS serotype V conjugate in the presence or absence of adjuvant on days 0 and 21. The neonates were challenged with type specific strains as shown below in Table 9 below.
Table 9: Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates in the presence of adjuvant at with different doses of GBS serotype V conjugate in the active maternal-neonatal challenge mouse model.
Challenge Strain (type)
Antigen Adjuvant 090 (la) H36B (lb) M781 (III) CJB111 (V)
Dead/treated (% survival)
Combo PBS 20/59 (66) 12/50 (76) 1/40 (97) 49/50 (2)
Combo Alum 36/50 (28) 10/30 (67) 1/40 (97) 22/40 (45)
Combo 40/40 (0) 23/26 (11) 37/40 (7) 31/38 (18)
PBS
plus
Combo 13/45 (71) 15/40 (62) 0/50 (100) 26/50 (48)
Alum
plus
Combo = CRM197-Ia + CRM197-Ib + CRM197-III + CRM197-V (all at 1 )
Combo plus = CRM197-Ia + CRM197-Ib + CRM197-III + CRM197-V (all at 1 except for CRM197-V at 5
In this experiment, the immune response to the capsular saccharide from GBS serotype V in the mixture was once again improved by addition of adjuvant. The response was also improved by increasing the dose of this capsular saccharide in the composition. However, the presence of a high dose of capsular saccharide from GBS serotype V seemed to reduce the response to the capsular saccharides from GBS serotype la, lb and III. This consequence was reduced by addition of adjuvant. Mouse study (9)
In this study, the efficacy of a mixture of the GBS serotype la, lb and III conjugates with GBS67 and GBS80 proteins was evaluated in the active maternal-neonatal challenge mouse model. Mice were immunized with combinations in the presence or absence of various different adjuvants. The neonates were challenged with type specific strains as shown below in Table 10 below. Table 10: Determination of the protection level obtained with combinations of GBS serotype la, lb and III/CRM197 conjugates and GBS67 and GBS80 proteins in the active maternal-neonatal challenge mouse model.
Challenge Strain (type)
JM9130013
Ag Adjuvant 090 (la) H36B (lb) 3050 (II) M781 (III) CJBlll(V)
(VIII)
Dead/treated (% survival)
Alum 9/60 (85) 6/60 (90) 12/58(79) 0/60 (100) 11/55 (80) 28/56 (50)
Combo hydroxide/
saline
Alum 19/78 (76) 5/57 (91) 16/66 (76) 4/53 (92) 55/80 (31)
Combo hydroxide/
PBS
Combo MF59 4/60 (93) 12/57 (79) 18/60 (70) 3/77 (96) 45/70 (36)
Combo None 13/80 (84) 11/70 (84) 28/60 (53) 14/77 (82) 47/59 (20)
Alum 60/60 (0) 74/77 (4) 36/56 (36) 73/80 (9) 86/99 (13) 53/69 (23)
PBS hydroxide/
saline
PBS None 70/70 (0) 73/79 (7) 42/54 (22) 74/77 (4) 63/74 (15)
Combo = CRM197-Ia + CRM197-Ib + CRM197-III + GBS67 + GBS80
Antibody titers were measured following administration of the mixture of serotype la, lb, III and V conjugates and GBS67 and GBS80 proteins in this study. Results from five separate experiments are shown below:
Figure imgf000059_0001
Mouse study (10)
In this study, the efficacy of a mixture of the GBS serotype la, lb and III conjugates with GBS67 and GBS80 proteins was evaluated in the active maternal-neonatal challenge mouse model. Mice were immunized with three doses of combinations in the presence or absence of various different adjuvants at days 0, 21 and 35. The neonates were challenged with type specific strains as shown below in Table 11 below. Table 11: Determination of the protection level obtained with combinations of GBS serotype la, lb and III/CRM197 conjugates and GBS67 and GBS80 proteins in the active maternal-neonatal challenge mouse model.
Figure imgf000060_0001
Combo = CRM197-Ia + CRM197-Ib + CRM197-III + GBS67 + GBS80
Mouse study (11)
In this study, the efficacy of a mixture of the GBS serotype la, lb, III and V conjugates with GBS67 protein and a SpbI-GBS80 fusion protein was evaluated in the active maternal- neonatal challenge mouse model. Mice were immunized with the combination in the presence of adjuvant. The neonates were challenged with type specific strains as shown below in Table 12 below.
Table 12: Determination of the protection level obtained with combinations of GBS serotype la, lb, III and V/CRM197 conjugates, GBS67 protein and a SpbI-GBS80 fusion protein protein in the active maternal-neonatal challenge mouse model.
Figure imgf000060_0002
protein
Mouse study (12)
In this study, the efficacy of GBS serotype la, lb, III and V conjugates was evaluated in the active maternal-neonatal challenge mouse model. Mice were immunized at 1 μg of each conjugate. The neonates were challenged with type specific strains as shown below in Table 13 below. The experiment was repeated twice. Table 13: Determination of the protection level obtained with GBS serotype la, lb, III and V/CRM197 conjugates in the active maternal-neonatal challenge mouse model.
Challenge Strain (type)
Expt Antigen 090 (la) H36B (lb) M781 (III) CJB111 (V)
Dead/treated (% survival)
CRM197-Ia 10/70 (86) 64/70 (9) 76/80 (5)
CRM197-Ib 48/94 (51) 12/99 (88)
1 CRM197-III 69/70 (1) 3/60 (95) 60/68 (12)
CRM197-V 80/89 (10) 5/100 (95)
PBS/Alum 50/50 (0) 39/40 (2) 61/69 (12) 10/10 (0)
CRM197-Ia 14/78 (82) 68/70 (2) 41/42 (2)
CRM197-Ib 66/110 (40) 2/110 (98)
2 CRM197-III 70/80 (12) 1/60 (98)
CRM197-V 38/192 (80)
PBS/Alum 45/45 (0) 57/58 (2) 32/36 (11) 50/58 (14)
The conjugate comprising capsular saccharide from GBS serotype lb conferred protection against GBS serotype la in addition to GBS serotype lb.
Mouse study (13)
In this study, capsular saccharide conjugated to either tetanus toxoid (TT) carrier protein or CRM 197 carrier protein were tested and compared for their immunogenicity. Female CD1 mice were immunized with two doses of 1 μg each of GBS serotype la, lb and III conjugates with aluminum hydroxide adjuvant on days 0 and 21. The neonates were challenged with specific strain types as shown below in Table 14.
Table 14: Determination of the protection achieved by GBS serotype la, lb and III capsular saccharide conjugated to TT or CRM in the active maternal-neonatal challenge mouse model.
Figure imgf000061_0001
*% Survival (Alive/treated)
The survival rates in the groups immunized with CRM197 conjugates of all three serotypes were comparable to the survival rates observed in the immunized group with TT conjugates. Based on these results, CRM 197 was selected as the carrier protein for further development.
Mouse study (14)
In this study, the impact of the level of capsular saccharide oxidation during the covalent conjugation process on immunogenicity was evaluated. Several batches of GBS serotype la, lb and III conjugates were obtained with the saccharides prepared at different percentages of oxidation conjugated either to TT and/or to CRM197 and tested in female CD1 mice for their immunogenicity. Mice were immunized with two doses (1 μg each) of the three different conjugates in the presence of aluminum hydroxide adjuvant on days 0 and 21. The neonates were challenged with type specific strains as shown below in Table 15.
Table 15: Determination of the protection level, antibody titers and bactericidal titers of GBS serotype la and III capsular saccharide conjugated either to TT or CRM197 and different percentage of oxidation using the active maternal-neonatal challenge mouse model.
Figure imgf000062_0001
Figure imgf000062_0002
CRM- III 43 972 com (in;; 64/100 6 127
CRM- III 27.5 S12 co (in) 7Τ·''δ3 3 150
CRM- III 40.9 2484 com (in) 98/107 91 183
CRM- III 01,8 S690 co an) 75 85 m 1 0
CRM- III 78.9 5S629 co an) 67/80 84 150
PBS - - CQHi (ΙΠ) 0/73 o -
- not applicable
The survival rates reached a peak when the dams were immunized with conjugates prepared from saccharides oxidized at 15-20%. The antibody titers increased with increasing levels of oxidation without any impact on the function. The bactericidal titers did not increase with higher antibody titers. Based on these results and on additional experiments (data not shown), the optimal percentage of CPS oxidation for all three serotypes was defined as being between 10 and 30%.
Reproductive and developmental toxicology studies in rabbits and rats
Results from two species showed no effect of the serotype la, lb and III/CRM197 conjugates on embryonic or fetal development.
In rabbits, a combination of the three conjugates with aluminum hydroxide adjuvant was administered by intramuscular injection at a clinical dose of 20/20/20 μg (based on mass of each saccharide) on days -35, -21 and -7 relative to mating on day 0 (pre-mating period) and on gestation days 7 and 20 or on gestation days 7 or 20 only. Treatment resulted in neither maternal toxicity, effects on mating nor evidence of embryo lethality, fetotoxicity or teratogenicity at any dose level.
In rats, there was similarly no maternal toxicity or evidence of effects on reproductive function and embryo-fetal development when the combination was administered, and no difference was noted between groups administered the combination in saline versus the combination in aluminum hydroxide adjuvant in 3 (during gestation only) or 6 (prior to gestation and during gestation) injections. Injections were given on days -35, -21 and -7 relative to mating on day 0 as well as on days 6, 12 and 17 of gestation or only on days 6, 12 and 17 of gestation. There was no effect on the Fl generation pup survival, clinical condition or body weight during the pre-weaning period.
Human study (1)
This study investigated a monovalent GBS serotype la capsular saccharide-CRMl 97 conjugate vaccine. Test groups of 10 subjects were administered 1 or 2 injections at 5, 10 or 20 μg (measured as mass of saccharide) doses. Placebo groups of 3 and 2 subjects received 1 and 2 injections of saline respectively. Blood was drawn from each subject at screening and a month after the first injection for analysis by ELISA. Additionally, at 3 months into the study, the 2-injection groups had a blood draw at the time they received the second injection, and then returned a month later for another blood draw. Further blood draws were carried out at 6, 12 and 24 months after the last injection the subject had received.
The ELISA measures the concentration of specific antibodies against GBS la (or lb and III in the studies described below) capsular saccharides. Microtiter plates were coated with 1 μg/ml of the appropriate GBS saccharide (conjugated to HSA) and were incubated with sera from study subjects for lh at 37°C. After 3 washes, the plates were incubated with an alkaline phosphatase (AP) labeled anti-human IgG secondary antibody for 90 min at 37°C followed by additional 3 washes. The substrate (pNPP) was added to the plate and incubated for 30 min at room temperature. The AP catalyzes the hydrolysis of the substrate generating a colorimetric reaction which can be quantified by an ELISA reader at 405 nm (reference filter 650 nm). The evaluation of the antibody concentration was done using a standard curve. A summary of the geometric mean concentration ^g/ml) of anti-la antibodies for each group is given in table 16 below:
Table 16: Geometric mean concentrations (and geometric mean ratios) for monovalent GBS serotype la capsular saccharide-CRMl 97 conjugate vaccine study.
Placebo Placebo+ GBS la 5 GBS la 5+ GBS IalO GBS Ial0+ GBS Ia20 GBS Ia20+
N=3 N=2 N=10 N=10 N=10 N=10 N=10 N=10
Baseline (visit 0) 0.84 0.16 1.05 0.42 1.25 0.37 0.54 0.2
(0.12- (0.015- (0.36-3.05) (0.14-1.29) (0.38-4.1) (0.1-1.32) (0.19-1.57) (0.07-0.59)
5.86) 1.77) N=9 N=8 N=7
1 month after last 0.8 0.16 43 5.94 7.94 14 25 6.88 immunization (0.034- (0.0007- (7.6-240) (1.06-33) (1.41-45) (2.52-79) (4.45-140) (1.12-42)
19) 38) N=9
N=l
1 month after last 0.96 1 41 16 10 53 46 33 immunization to (0.093- (0.018-57) (11-146) (4.05-60) (2.4-42) (12-246) (13-166) (8.55-127)
Baseline (visit 0) 9.92) N=l N=9 N=8 N=7 N=9
6 months after last 0.73 0.16 19 3.08 12 7.03 14 4.21 immunization (0.05-11) (0.0016- (4.43-83) (0.71-13) (2.66-50) (1.63-30) (3.22-60) (0.9-20)
17) N=9
N=l
6 months after last 0.87 1 18 7.9 13 27 26 20 immunization to (0.12- (0.032-31) (6.14-54) (2.5-25) (3.71-43) (7.2-98) (8.67-77) (6.39-64)
Baseline (visit 0) 6.39) N=l N=9 N=8 N=7 N=9
12 months after 0.79 0.16 14 2.23 7.28 7.17 9.96 3.24 last immunization (0.054- (0.0016- (3.3-62) (0.51-9.68) (1.68-32) (1.53-34) (2.29-43) (0.63-17)
12) 17) N=9 N=8
N=l
12 months after 0.94 1 14 5.59 8.02 19 18 17 last immunization (0.14- (0.036-28) (4.76-39) (1.84-17) (2.46-26) (5.49-68) (6.43-53) (5.31-56) to 6.46) N=l N=9 N=8 N=7 N=8
Baseline (visit 0)
24 months after 0.66 3.57 2.74 10 5.05 8.63 3.46 last immunization (0.043- (0.59-21) (0.56-13) (1.74-63) (0.84-30) (1.78-42) (0.65-19)
10) N=7 N=9 N=7 N=7 N=9 N=8
24 months after 0.79 7.47 6.51 7.88 14 14 16 last immunization (0.11- (2-28) (1.9-22) (1.9-33) (3.26-56) (4.38-45) (4.68-55) to 5.95) N=7 N=8 N=6 N=6 N=9 N=8
Baseline (visit 0) + two injections
Overall the GMC data show a significant increase between baseline and later timepoints (e.g. GMC range from 6 to 43 μg/ml one month after the last vaccination) and although there was a decline over time, 24 months into the study, the group GMC were still multiple-fold higher than at baseline (the GMR ranges from 7 to 14 at 24 months). Judging by the GMC point estimate, the group receiving the 5 μg dose as a single vaccination had the highest overall response at a month after the last vaccination.
The number of subjects with antibody levels > 3 μg/mL showed similar numbers of "responders" across the different doses (1 1, 13 and 12 out of 20 for 5, 10 and 20 doses respectively), and different vaccination schedules (18 out of 20 for both), at a month after the last vaccination (data not shown),. The percentage of subjects with antibody levels > 5 μg/mL confirmed the same observations (data not shown). These cut-offs were intended to allow responses to be assessed in the context of potential serologic correlates of protection (based on ref. 252). These data suggest that there is no observable contribution by either a second vaccination or a higher vaccine dose. As no dose-response was observed, it is possible that a dose of 5 μg or lower may be an optimal dose in an adult population. No sustained advantage was observed from administering 2 injections compared to 1 injection for the groups receiving 5 and 20 μg. The group receiving 10 μg dose showed higher peak responses (at 1 month post vaccination) after two vs one injection, but this trend was reversed at subsequent (steady- state) time-points.
Safety analysis was assessed based on a number of different criteria. No safety issues stood out, and no dose dependent response was noticeable.
Human study (2)
This study investigated monovalent GBS serotype lb and III capsular saccharide-CRM197 conjugate vaccines. Test groups of 10 subects were administered 1 or 2 injections at 5, 10 or 20 μg (measured as mass of saccharide) doses. Placebo groups of 3 and 2 subjects received 1 and 2 injections of saline respectively. Blood was drawn from each subject at screening and a month after the first injection for analysis by ELISA. Additionally, at 3 months into the study, the 2-injection groups had a blood draw at the time they received the second injection, and then returned a month later for another blood draw. Further blood draws were carried out at 6, 12 and 24 months after the last injection the subject had received. A summary of the geometric mean concentration of anti-lb and III antibodies for each group is given in table 17 below. Table 17: Geometric mean concentrations (and geometric mean ratios) for monovalent GBS serotype III and lb capsular saccharide-CRMl 97 conjugate vaccines study.
Placebo Placebo+ GBS lb 5 GBS lb 5+ GBS IblO GBS I 0+ GBS Ib20 GBS Ib20+
N=2 N=2 N=8 N=10 N=9 N=ll N=9 N=10
Baseline (visit 0) 0.1 0.042 0.27 0.24 0.088 0.44 0.38 0.2
(0.0042- (0.0017- (0.066- (0.08-0.75) (0.021- (0.16-1.21) (0.11-1.25) (0.074-0.55)
2.38) 0.99) 1.13) N=8 0.36) N=10 N=7
N=l N=l N=5 N=5
1 month after last 0.3 0.53 1.89 11 2.63 18 14 10 immunization (0.0019- (0.015-19) (0.32-11) (1.77-63) (0.49-14) (3.82-81) (2.6-76) (2.11-52)
47) N=8
N=l
1 month after last 9.64 60 47 46 48 68 56 immunization to (0.26-359) (9.78-364) (11-208) (9.13-232) (15-152) (17-267) (17-186)
Baseline (visit 0) N=l N=4 N=6 N=5 N=10 N=7 N=9
6 months after last 0.091 0.3 1.53 7.52 5.45 11 6.23 9.2 immunization (0.0051- (0.0051- (0.36- (2.07-27) (1.4-21) (3.09-36) (1.6-24) (2.53-33)
1.63) 18) 6.48)
N=l
6 months after last 0.42 32 36 97 28 26 47 immunization to (0.031- (8.56-116) (14-91) (30-310) (12-63) (9.61-69) (20-112)
Baseline (visit 0) 5.64) N=4 N=8 N=5 N=10 N=7 N=9
N=l
12 months after last 0.091 0.4 1.29 5.77 3.24 9.52 4.98 6.67 immunization (0.0054- (0.0074- (0.31- (1.53-22) (0.79-13) (2.86-32) (1.32-19) (1.89-24)
1.53) 22) 5.26) N=9 N=8
N=l
12 months after last 0.42 22 29 45 26 23 34 immunization to (0.036- (6.52-76) (12-75) (13-152) (12-57) (8.96-57) (15-78)
Baseline (visit 0) 4.85) N=4 N=7 N=4 N=10 N=7 N=9
N=l
24 months after last 0.091 0.1 1.34 3.8 2.58 9.49 3.22 3.92 immunization (0.004- (0.0012- (0.28-6.4) (0.94-15) (0.59-11) (2.35-38) (0.53-20) (0.9-17)
2.07) 8.29) N=10 N=6 N=9 N=l
24 months after last 27 19 53 25 15 22 immunization to (6.49-111) (7.07-53) (15-188) (9.65-64) (3.55-61) (7.95-59)
Baseline (visit 0) N=4 N=8 N=5 N=9 N=4 N=8
N=3 N=2 N=8 N=10 N=10 N=9 N=9 N=10
Baseline (visit 0) 0.034 0.27 0.27 1.64 0.23 0.65 0.89 1.93
(0.0007- (0.018- (0.057- (0.46-5.86) (0.065- (0.18-2.34) (0.21-3.77) (0.58-6.47)
1.55) 3.98) 1.3) N=9 0.83) N=7
N=l N=6 N=9
1 month after last 0.14 0.88 13 31 2.72 31 22 22 immunization (0.0099- (0.033-24) (2.44-65) (7.07-134) (0.63-12) (6.64-147) (4.73-105) (5.03-95)
2.11)
ca
1 month after last 8.82 3.31 44 31 10 42 63 14 immunization to (0.64- (0.51-21) (15-130) (12-84) (4.26-25) (16-106) (23-172) (5.94-34)
Baseline (visit 0) 122) N=6 N=7 N=9 N=8 N=7 N=9
N=l
6 months after last 0.034 1.9 4.97 21 2.7 19 18 15 immunization (0.0005- (0.031- (1.04-24) (5.57-76) (0.73-9.95) (4.89-77) (4.43-69) (3.84-60)
2.11) 118) N=7 N=9
N=l N=l 6 months after last 0.9 23 22 11 25 33 9.86 immunization to (0.086- (8.85-60) (8.87-52) (5-24) (11-58) (14-80) (4.3-23)
Baseline (visit 0) 9.48) N=6 N=7 N=9 N=8 N=7 N=8
N=l
12 months after last 0.1 2 3.7 16 2.56 15 13 13 immunization (0.01- (0.036- (0.81-17) (4.39-55) (0.72-9.09) (3.97-57) (3.35-48) (3.05-52)
1.02) 110) N=7 N=8
N=l
12 months after last 8.82 0.95 18 17 10 20 22 9.54 immunization to (0.75- (0.081-11) (6.41-48) (6.51-42) (4.61-24) (8.35-48) (8.81-57) (3.76-24)
Baseline (visit 0) 104) N=l N=6 N=7 N=9 N=8 N=7 N=7
N=l
24 months after last 0.034 0.4 0.33 13 0.71 24 11 6.15 immunization (0.0008- (0.029- (0.039- (3.92-41) (0.14-3.73) (4.62-127) (2.11-58) (1.66-23)
1.39) 5.51) 2.81) N=5 N=5 N=5 N=8
N=l N=3
24 months after last 1 1.5 2.45 14 6.55 23 13 6.21 immunization to (0.092- (0.28-8.1) (0.45-13) (5.57-34) (2.25-19) (8.06-68) (4.39-37) (2.52-15)
Baseline (visit 0) 11) N=2 N=7 N=5 N=5 N=5 N=7
N=l
+ two injections
Once again, no significant dose-response or advantage from administering two injections compared to one was observed in this small study.
Safety analysis was assessed based on a number of different criteria. No safety issues stood out, and no dose dependent response was noticeable. Among the reactogenicity indicators, pain on injection site (15 occurrences out of 98 injections for serotype lb, and 14 occurrences out of 96 injections for serotype III) was the most common complaint in the solicited local reactions for both serotypes, and headache was the one in the solicited systemic reactions, but no obvious differences between placebo and the vaccinated individuals were observed.
Human study (3)
This study investigated a trivalent GBS serotype la, lb and III capsular saccharide-CRM197 conjugate vaccine in healthy, non-pregnant women. Two different vaccine formulations were studied, each combining the three saccharides in equal proportions. Two different doses (5 μg and 20 μg, measured as mass of each saccharide, in 0.5 ml) were tested with and without alum adjuvant. The study also evaluated intramuscular 1- and 2-injection (30 days apart) schedules for each formulation. The vaccine also included 4.5 mg sodium choloride, 0.34 mg potassium dihydrogen phosphate and 7.5 mg mannitol. The study groups are summarised in Table 18 below. A placebo group (two 0.9% saline injections, 30 days apart) with 20 subjects was also tested. Table 18: Study groups for trivalent GBS serotype la, lb and III capsular saccharide-CRM 197 conjugate vaccine study
Figure imgf000068_0001
Blood was drawn from each subject at screening and a month after the first injection for analysis of immunogenicity by ELISA. The 2-injection groups received the second injection after the blood draw at the one-month timepoint. Blood was also drawn from all groups at 3 months into the study. A summary of the geometric mean concentration of anti-la, lb and III antibodies for each group (adjusted for baseline antibody concentrations and excluding the placebo group) is given in table 19 below.
Table 19: Geometric mean concentrations (and geometric mean ratios) for trivalent GBS serotype la, lb and III capsular saccharide-CRM 197 conjugate vaccine study.
5 na 5+ na 20 na 20+ na 5 adv 5+ adv 20 adv 20+ adv
N=40 N=40 N=38 N=39 N=40 N=40 N=39 N=39
Screening 0.71 0.65 0.48 0.49 0.57 0.71 0.59 0.45
(0.41- (0.37- (0.27- (0.28- (0.32- (0.4- (0.33- (0.26-
1.21) 1.16) 0.85) 0.87) 1.01) 1.27) 1.05) 0.79)
N=35 N=35 N=37 N=36 N=35 N=35 N=37
Day 31 13 12 20 18 16 8.26 12 8.88
(7.06-25) (5.99-23) (10-41) (9.41-36) (8.02- (4.19- (6.12-24) (4.57-17)
30) 16)
N=39
03 Day 31 to 23 20 34 31 27 14 21 15
o Screening (12-44) (10-40) (17-66) (16-61) (14-52) (7.32- (11-41) (7.62-28)
N=35 N=34 N=36 N=36 28) N=35 N=37
N=35
Day 61 16 15 18 23 18 12 13 11
(9.34-28) (8.63-27) (10-33) (13-40) (10-32) (6.79- (7.3-23) (6.01-19)
22) N=38
Day 61 to 28 26 31 39 31 20 23 18
Screening (16-47) (15-47) (17-55) (22-69) (18-55) (11-36) (13-40) (10-32)
N=35 N=34 N=36 N=36 N=35 N=35 N=36
N=39 N=40 N=38 N=39 N=40 N=40 N=39 N=37
Screening 0.15 0.12 0.1 0.12 0.14 0.11 0.12 0.081
(0.091- (0.072- (0.063- (0.072- (0.082- (0.068- (0.074- (0.048-
0.25) 0.2) 0.17) 0.2) 0.22) 0.19) 0.21) 0.14)
03 N=37 N=34 N=36 N=37 N=37 N=34 N=34 N=34
a Day 31 4.92 4.21 4.59 4.12 3.94 3.25 3.31 2.87
(2.67- (2.24- (2.51- (2.23-7.6) (2.15- (1.73- (1.74- (1.48-5.6)
9.06) 7.91) 8.41) N=35 7.23) 6.1) 6.28) N=36
N=38 N=39 N=39 N=39 N=37 Day 31 to 45 35 35 33 34 27 30 19
Screening (24-85) (18-69) (19-67) (17-63) (18-64) (14-53) (15-59) (9.43-37)
N=36 N=33 N=36 N=35 N=36 N=33 N=32 N=31
Day 61 5.17 5.29 4.69 5.35 4.1 4.09 3.74 3.39
(3.17- (3.19- (2.84- (3.26- (2.52- (2.47- (2.26- (1.98-5.8)
8.45) 8.78) 7.73) 8.76) 6.68) 6.79) 6.22)
Day 61 to 47 46 38 45 35 35 33 24
Screening (29-78) (27-77) (23-64) (27-75) (21-59) (21-59) (20-56) (14-41)
N=37 N=34 N=35 N=36 N=37 N=34 N=34 N=32
N=34 N=36 N=38 N=36 N=35 N=36 N=35 N=36
Screening 0.3 0.16 0.17 0.14 0.18 0.38 0.15 0.24
(0.16- (0.088- (0.096- (0.078- (0.1- (0.21- (0.082- (0.13-
0.54) 0.29) 0.3) 0.25) 0.34) 0.69) 0.27) 0.43)
N=34 N=34
Day 31 7.82 5.48 8.13 8.31 5.5 5.36 8.51 6.03
(4.24-14) (3.03- (4.66-14) (4.47-15) (3-10) (2.88- (4.45-16) (3.41-11)
9.91) N=37 N=34 N=34 10) N=31
N=34
Day 31 to 34 25 36 34 26 24 35 29
Screening (19-63) (14-45) (21-64) (19-62) (14-47) (14-44) (19-66) (16-51)
N=31 N=32 N=36 N=31 N=30 N=32 N=28 N=34
Day 61 7.5 8.71 8.48 9.59 5.35 7.75 8.23 7.79
(4.43-13) (5.31-14) (5.26-14) (5.72-16) (3.2- (4.58- (4.77-14) (4.74-13)
N=33 N=37 N=35 8.93) 13) N=32 N=35
Day 61 to 33 43 39 43 26 33 38 38
Screening (20-55) (26-70) (25-64) (26-71) (15-43) (20-54) (22-64) (23-62)
N=31 N=34 N=36 N=33 N=31 N=33 N=29 N=33
+ two injections
na - no adjuvant
adv - with adjuvant
The vaccine was immunogenic, inducing in between 80% and 100% of the subjects at least a 2-fold increase in GBS specific antibodies across the different serotypes. A comparison of the GMCs from the eight groups revealed a) no contribution from a second injection compared to a single injection only; b) no contribution from the inclusion of alum adjuvant compared to no adjuvant; and c) no contribution from the higher dose of 20/20/20 μg versus 5/5/5 μg.
More specifically, there was no consistent increase in antibody response among subjects receiving two vaccine injections compared to those receiving only one vaccine injection against any of the GBS serotypes (la, lb or III). This lack of contribution of the second vaccine injection was observed regardless of the dose (5/5/5 or 20/20/20 μg) or the formulation (no alum or alum adjuvant). For GBS la, GMC measurements for each of the eight groups ranged from 7 to 20 μg/ml on day 61 of the study. From these results, no contribution of two injections (GMC range [7-16 μg/ml]) was observed compared to one injection (GMC range [9-20 μg/ml] (95%) CI all overlapping)). Moreover, the ratio of one vs two injections was 1.2 [95%> CI (0.7, 2.0)]. This result indicates practical equivalence of one vs two injections (p-value = 0.5). For GBS lb, GMC measurements for each of the eight groups ranged from 2-7 μg/ml on day 61 of the study. No contribution of two injections (GMC range [2-5 μg/ml]) was observed compared to one injection (GMC range [4-7 μg/ml] (95%) CI all overlapping)). This time, the ratio of one vs two injections was 1.2 [95%> CI (0.7, 2.0)]. Once again, this result indicates practical equivalence (p-value = 0.5). For GBS III, measurements for each of the eight groups ranged from 5-13 μg/ml on day 61 of the study. No contribution of two injections (GMC range [5-1 1 μg/ml]) was observed compared to one injection (GMC range [5-13 μg/ml] (95% CI all overlapping)). The ratio of one vs two injections was 0.94 [95% CI (0.55, 1.66], indicating equivalence (p-value = 0.8).
Similarly, there was no added contribution to GMC from the inclusion of alum compared to no alum. This lack of contribution of alum adjuvant was observed regardless of the dose (5/5/5 or 20/20/20 μg) or the injection number and was seen across all three serotypes (la, lb and III). For GBS la, the GMC across the eight groups ranged from 7-20 μg/ml on day 61 of the study and showed no contribution of alum (GMC range [7-15 μg/ml] compared to no alum (GMC range [13-16 μg/ml] (95%) CI all overlapping)). The ratio of group GMC for the no alum group compared to the alum group was 1.6 [95%> CI (0.9, 2.6)], which suggests that the response without alum is potentially higher relative to the vaccine formulation with alum (p-value = 0.1 1). For GBS lb, GMC ranged from 2-7 μg/ml on day 61 of the study and showed no contribution of alum (GMC range [2-4 μg/ml] compared to no alum (GMC range [4-7 μg/ml] (95% CI all overlapping)). The ratio of group GMC for the no alum group compared to the alum group was 1.4 [95%> CI (0.8, 2.4)] implying near equivalence in GMC values (p-value = 0.2). For GBS III, GMC ranged from 5-13 μg/ml on day 61 of the study and showed no contribution of alum (GMC range [5-1 1 μg/ml] compared to no alum (GMC range [5-13 μg/ml] (95% CI all overlapping)). The ratio of group GMC for the no alum group compared to the alum group was 1.09 [95%> CI (0.6, 1.9)] implying near equivalence in GMC values (p-value = 0.7).
Finally, the data allows an evaluation of the two doses (5 vs 20 μg of each of the three saccharides in the conjugates). The results suggest that the higher dose (20 μg) does not induce a higher antibody response. In particular, the ratios of GMC for subjects receiving 5 μg (across all groups) and subjects receiving 20 μg (across all groups) are 1.2 [95% CI (0.7, 2.1)] for GBS la; 0.7 [95% CI (0.4, 1.2)] for GBS lb and 1.4 [95% CI (0.9, 2.5)] for GBS III. These ratios are close to 1 and the p-values of the statistical test for equality to 1 , are > 0. 15 for all three serotypes, suggesting no discernable differences in the level of induced antibodies between the two dose regimens.
Safety was measured by the incidence of local and systemic reactogenicity, adverse events and serious adverse events, as well as clinical laboratory results. The trivalent GBS vaccine was found safe and well tolerated in all of the eight vaccine study groups when compared to placebo. Safety was evaluated by: percentages of subjects with solicited local (i.e injection site pain, ecchymosis, erythema, induration, and swelling) and solicited systemic (i.e. chills, nausea, malaise, myalgia, headache, fatigue, arthralgia, rash, fever [defined as axillary temperature > 38 °C], and other) reactions occurring during the 7 days following each vaccination together with severity of reactions; all of other adverse events reported from day 1 to day 23 after each vaccination; percentages of subjects with reported serious adverse events and/or adverse events resulting in withdrawal from the study, per vaccine group for up to Day 61. Human study (4)
The responses of subjects with antibody (Ab) levels below detection at study entry (0.4, 0.084 and 0.068 μg/ml for serotypes la, lb and III respectively) were of particular interest. This subset analysis was carried out on the data from Human study (3) above. For each serotype, data were assessed as:
(a) GMC for each injection/formulation/dose group, and the corresponding 95% CI
(b) GMC over all subjects receiving (i) 1 injection regardless of a group assignment and this was compared to the GMC of all subjects receiving 2 injections. Similarly, the GMC of subjects receiving no adjuvant compared to the GMC of subjects receiving alum, as well as GMC receiving 5/5/5 μg dose compared to the GMC of all subjects receiving 20/20/20 μg. The assessment was based on the ratio of GMC, together with the two-sided 95%> CI around the calculated ratio.
(c) Proportion of subjects with at least 4-fold change from baseline, assumed as half the lowest level of detection (lid)
In general, approximately 25%> and 50%) of women presented with Ab levels below the limit of detection for serotypes III and Ia/Ib respectively. The percentage of subjects in this subset achieving >4-fold increase in Ab level at day 61 compared to baseline (where baseline value is assigned half lid) range from 64-95% (serotype la), 80-100% (serotype III) and 81-100% (serotype lb).
Similarly to results from the full study cohort, subjects with undetectable Ab levels at study entry also fail to show additional benefit from 2 injections (vs 1 injection), from a higher dosage (vs lower dosage) or from inclusion of alum (vs no adjuvant). The ratio of GMC (on day 61) for all 1 injection vs all 2 injection subjects was 1.1 (0.6-1.8; serotype la), 0.7 (0.3-1.5; serotype III) and 0.9 (0.5-1.4; serotype lb); for all 5 μg vs. all 20 μg dosage subjects was 1.3 (0.8-2.1; serotype la), 1.4 (0.7-2.8; serotype III) and 1.4 (0.9-2.3; serotype lb); for all no adjuvant subjects vs all alum subjects was 1.4 (0.8-2.4; serotype la), 1 (0.5-2.0; serotype III) and 1.7 (1.1-2.7; serotype lb) Mouse study (15)
Mice were primed with CRM 197 and aluminium hydroxide adjuvant or aluminium hydroxide adjuvant alone at day 0 and then immunized with a GBS serotype Ill/CRM 197 conjugate with or without the adjuvant aluminium hydroxide adjuvant at days 21 and 35. Blood was drawn on day 0 and before vaccination on days 21 and 35. IgG/IgM serum titers to the GBS serotype III polysaccharide and CRM197 carrier protein were measured from the blood samples.
As shown in Figure 4, priming with the CRM197 carrier resulted in a significantly higher IgG antibody response to the carrier after one and two doses of the vaccine (with or without adjuvant) compared to unprimed mice (P< 0.0002). Priming also resulted in a good antibody response against the GBS serotype III polysaccharide after two doses of vaccine (with or without adjuvant). Unprimed mice required the adjuvant in order to reach an anti-polysaccharide antibody titer comparable to that observed in primed mice. In unprimed mice, when the glycoconjugate vaccine was administered without adjuvant, the antibody titer was significantly lower than in the other groups (P< 0.03).
Priming with CRM197 therefore seems to have a positive influence on the subsequent antibody response to the GBS capsular saccharide component of the conjugate, even when administered without an adjuvant.
Rat and rabbit studies
Studies to assess potential reproductive and developmental toxicity of the trivalent GBS serotype la, lb and III capsular saccharide-CRM197 conjugate vaccine were carried out in rats and rabbits.
The rat study was carried out according to table 20 below:
Table 20: Rat study
Figure imgf000072_0001
+ to serotype Ia/Ib/III
aluminum hydroxide, 2 mg/mL
Subcutaneous administration of the trivalent vaccine to female rats on study days 1, 15, 29 (premating period) and/or on gestation days 6, 12 and 17 at a dose of 20 μg with or without aluminum hydroxide resulted in no maternal toxicity or effects on reproductive function or embryofetal development. No differences were noted between groups treated with three or six injections of the trivalent vaccine with or without aluminum hydroxide adjuvant. Additionally, there was no effect on the Fl generation pup survival, clinical condition or body weight or reproductive ability.
The rabbit study was carried out according to table 21 below: Table 21: Rabbit study
Figure imgf000073_0001
+ to serotype Ia/Ib/III
aluminum hydroxide, 2 mg/mL
Intramuscular administration of the trivalent vaccine plus aluminum hydroxide to female rabbits, at a dose of 20 μg on study days 1 , 15 and 29 (premating period) and/or on gestation days 7 and 20, resulted in neither maternal toxicity, effects on mating nor evidence of embryolethality, fetotoxicity or teratogenicity. There were no differences between the adult F l generation of control and vaccine-treated does.
These studies showed that the trivalent vaccine was immunogenic and did not have any prenatal or postnatal effects on pregnant rats or rabbits or their offspring.
Stabilty study
The stability of the trivalent GBS serotype la, lb and III capsular saccharide-CRM197 conjugate vaccine was measured during 1 month of storage at two different temperatures. The vaccine was formulated by pooling the three glycoconjugates, each one present at 80 μg saccharide/ml in 10 mM KH2PO4 and 3% mannitol. 3-ml single dose vials were filled with 0.3 ml of solution, partially capped with bromobuthyl siliconized rubber stopper and submitted to a freeze-drying cycle. Once the lyophilization process was over, the vials were stored at 2-8 °C or 36-38 °C. A slight increase in free saccharide content was detected (using HPAEC-PAD) upon storage at 36-38°C. However, overall the trivalent vaccine was stable upon storage up to one month at both 2-8 °C and at 36-38°C. It will be understood that the invention has been described by way of example only and modifications may be made whilst remaining within the scope and spirit of the invention. REFERENCES
[I] Paoletti et al. (1990) J Biol Chem 265:18278-83.
[2] Wessels et al. (1990) J Clin Invest 86:1428-33.
[3] Paoletti et al. (1992) Infect Immun 60:4009-14.
[4] Paoletti et al. (1992) J Clin Invest 89:203-9.
[5] Wessels et al. (1987) Proc Natl Acad Sci USA 84:9170-4.
[6] Wang et al. (2003) Vaccine 21 :1112-7.
[7] Wessels et al. (1993) Infect Immun 61 :4760-6
[8] Wessels et al. (1995) J Infect Dis 171 :879-84.
[9] Baker et al. (2004) J Infect Dis 189:1103-12.
[10] Paoletti & Kasper (2003) Expert Opin Biol Ther 3:975-84.
[I I] Brigtsen et al. (2002) JID, 185 :1277-84.
[12] Paoletti et al. (2001) Infection and Immunity, 69:6696-6701
[13] WO2006/050341
[14] Guttormsen et al. (2008) Proc Natl Acad Sci U S A. 105(15):5903-8. Epub 2008 Mar 31.
[15] WO96/40795
[16] Michon ei «/. (2006) Clin Vaccine Immunol. 2006 Aug;13(8):936-43.
[17] US patents 6027733 & 6274144.
[18] www.polymer.de
[19] Lewis et al. (2004) PNAS USA 101 :11123-8.
[20] Wessels et al. (1989) Infect Immun 57:1089-94.
[21] WO2006/082527.
[22] US patent application US 61/008,941, entitled "FERMENTATION PROCESSES FOR
CULTIVATING STREPTOCOCCI AND PURIFICATION PROCESSES FOR OBTAINING CPS
THEREFROM" filed on 20th December 2007 and international patent application WO 2009/081276.
[23] Ramsay et al. (2001) Lancet 357(9251):195-196.
[24] Lindberg (1999) Vaccine 17 Suppl 2:S28-36.
[25] Buttery & Moxon (2000) JR Coll Physicians Lond 34:163-68.
[26] Ahmad & Chapnick (1999) Infect Dis Clin North Am 13:113-33, vii.
[27] Goldblatt (1998) J. Med. Microbiol. 47:563-7.
[28] European patent 0477508.
[29] US patent 5,306,492.
[30] W098/42721.
[31] Dick et al. in Conjugate Vaccines (eds. Cruse et al.) Karger, Basel, 1989, 10:48-114.
[32] Hermanson Bioconjugae Techniques, Academic Press, San Diego (1996) ISBN: 0123423368.
[33] US patent 4356170.
[34] WO2006/082530.
[35] WO2005/000346
[36] Anonymous (Jan 2002) Research Disclosure, 453077.
[37] Anderson (1983) Infect Immun 39(l):233-238.
[38] Anderson et al. (1985) J Clin Invest 76(l):52-59.
[39] EP-A-0372501.
[40] EP-A-0378881.
[41] EP-A-0427347.
[42] W093/17712
[43] WO94/03208. [44] W098/58668.
[45] EP-A-0471177.
[46] WO91/01146
[47] Falugi et al. (2001) Eur J Immunol 31:3816-24.
[48] Baraldo et al. (2004) Infect Immun 72:4884-87.
[49] EP-A-0594610.
[50] WO00/56360.
[51] WO02/091998.
[52] Kuo et al. (1995) Infect Immun 63:2706-13.
[53] WO01/72337
[54] WO00/61761.
[55] WO00/33882
[56] WO99/42130.
[57] WO2004/011027.
[58] WO96/40242.
[59] Lei et al. (2000) Dev Biol (Basel) 103:259-264.
[60] WO00/38711; US patent 6,146,902.
[61] International patent application PCT/IB2008/02690, 'CONJUGATE PURIFICATION', claiming priority from GB-0713880.3 (NOVARTIS AG), published as WO 2009/010877.
[62] W099/24578.
[63] W099/36544.
[64] WO99/57280.
[65] WO00/22430.
[66] Tettelin et al. (2000) Science 287:1809-1815.
[67] W096/29412.
[68] Pizza et al. (2000) Science 287:1816-1820.
[69] WO01/52885.
[70] Bjune et al. (1991) Lancet 338(8775):1093-1096.
[71] Fukasawa et al. (1999) Vaccine 17:2951-2958.
[72] Rosenqvist et al. (1998) e . Biol. Stand. 92:323-333.
[73] Costantino et al. (1992) Vaccine 10:691-698.
[74] WO03/007985.
[75] Watson (2000) Pediatr Infect Dis J 19:331-332.
[76] Rubin (2000) Pediatr Clin North Am 47:269-285, v.
[77] Jedrzejas (2001) Microbiol Mol Biol Rev 65: 187-207.
[78] Bell (2000) Pediatr Infect Dis J 19:1187-1188.
[79] Iwarson (1995) APMIS 103:321-326.
[80] Gerlich ei «/. (1990) Vaccine 8 Suppl:S63-68 & 79-80.
[81] Hsu et al. (1999) Clin Liver Dis 3:901-915.
[82] Gustafsson et al. (1996) N. Engl. J. Med. 334:349-355.
[83] Rappuoli et al. (1991) TIBTECH 9:232-238.
[84] Vaccines (2004) eds. Plotkin & Orenstein. ISBN 0-7216-9688-0.
[85] WO02/02606.
[86] Kalman et al. (1999) Nature Genetics 21 :385-389.
[87] Read et al. (2000) Nucleic Acids Res 28:1397-406.
[88] Shirai et al. (2000) J. Infect. Dis. 181(Suppl 3):S524-S527.
[89] WO99/27105. 92] W099/28475.
93] Ross et al. (2001) Vaccine 19:4135-4142.
94] Sutter et al. (2000) Pediatr Clin North Am 47:287-308.
95] Zimmerman & Spann (1999) Am Fam Physician 59:113-118, 125-126.
96] Dreesen (1997) Vaccine 15 Suppl:S2-6.
97] MMWR Morb Mortal Wkly Rep 1998 Jan 16;47(1):12, 19.
98] McMichael (2000) Vaccine 19 Suppl 1 :S 101-107.
99] WO02/34771.
100 Dale (1999) Infect Dis Clin North Am 13:227-43, viii.
101 Ferretti et al. (2001) PNAS USA 98: 4658-4663.
102 Kuroda et al. (2001) Lancet 357(9264):1225-1240; see also pages 1218-1219.
103 Robinson & Torres (1997) Seminars in Immunology 9:271-283.
104 Donnelly et al. (1997) Annu Rev Immunol 15:617-648.
105 Scott-Taylor & Dalgleish (2000) Expert Opin Investig Drugs 9:471-480.
106 Apostolopoulos & Plebanski (2000) Curr Opin Mol Ther 2:441-447.
107 Ilan (1999) Curr Opin Mol Ther 1 :116-120.
108 Dubensky et al. (2000) Mol Med 6:723-732.
109 Robinson & Pertmer (2000) Adv Virus Res 55:1-74.
110 Donnelly et al. (2000) Am J Respir Crit Care Med 162(4 Pt 2):S190-193.
111 Davis (1999) i. Sinai J. Med. 66:84-90.
112 Paoletti et al. (2001) Vaccine 19:2118-2126.
113 WO00/56365.
114 Gennaro (2000) Remington: The Science and Practice of Pharmacy. 20th edition, ISBN: 0683306472. 115 Paoletti (2001) Vaccine 19( 15-16) :2118-26.
116 WO03/009869.
117 Almeida & Alpar (1996) J. Drug Targeting 3:455-467.
118 Agarwal & Mishra (1999) Indian J Exp Biol 37:6-16.
119 WO00/53221.
120 Jakobsen et al. (2002) Infect Immun 70:1443-1452.
121 Bergquist et al. (1998) APMIS 106:800-806.
122 Baudner et al. (2002) Infect Immun 70:4785-4790.
123 Ugozzoli et al. (2002) J Infect Dis 186:1358-1361.
124 US patent 6355271.
125 WO00/23105.
126 Vaccine Design... (1995) eds. Powell & Newman. ISBN: 030644867X. Plenum.
127 WO90/14837.
128 Podda (2001) Vaccine 19:2673-80.
129 Frey et al. (2003) Vaccine 21 :4234-7.
130 US Patent 6,299,884.
131 US Patent 6,451,325.
132 US patent 5,057,540.
133 W096/33739.
134 EP-A-0109942.
135 W096/11711. Barr et al. (1998) Advanced Drug Delivery Reviews 32:247-271.
Sjolanderet et al. (1998) Advanced Drug Delivery Reviews 32:321-338.
Niikura ei «/. (2002) Virology 293:273-280.
Lenz et al. (2001) J Immunol 166:5346-5355.
Pinto et al. (2003) J Infect Dis 188:327-338.
Gerber ei fl/. (2001) Virol 75:4752-4760.
WO03/024480
WO03/024481
GXuc et al. (2002) Vaccine 20 :B10-B 16.
EP-A-0689454.
Johnson et al. (1999) Bioorg Med Chem Lett 9:2273-2278.
Evans et al. (2003) Expert Rev Vaccines 2:219-229.
Meraldi et al. (2003) Vaccine 21 :2485-2491.
Pajak ei fl/. (2003) Ffcccine 21 :836-842.
Kandimalla et al. (2003) Nucleic Acids Research 31 :2393-2400.
WO02/26757.
W099/62923.
Krieg (2003) Nature Medicine 9:831-835.
McCluskie et al. (2002) FEMS Immunology and Medical Microbiology 32:179-185.
WO98/40100.
US patent 6,207,646.
US patent 6,239,116.
US patent 6,429,199.
Kandimalla et al. (2003) Biochemical Society Transactions 31 (part 3):654-658. Blackwell et al. (2003) J Immunol 170:4061-4068.
Krieg (2002) Trends Immunol 23:64-65.
WO01/95935.
Kandimalla et al. (2003) BBRC 306:948-953.
Bhagat et al. (2003) BBRC 300:853-861.
WO03/035836.
W095/17211.
W098/42375.
Beignon et al. (2002) Infect Immun 70:3012-3019.
Pizza et al. (2001) Vaccine 19:2534-2541.
Pizza et al. (2000) Int J Med Microbiol 290:455-461.
Scharton-Kersten et al. (2000) Infect Immun 68:5306-5313.
Ryan et al. (1999) Infect Immun 67:6270-6280.
Partidos et al. (1999) Immunol Lett 67:209-216.
Peppoloni et al. (2003) Expert Rev Vaccines 2:285-293.
Pine et al. (2002) J Control Release 85:263-270.
Domenighini et al. (1995) Mol Microbiol 15:1165-1167.
WO99/40936.
W099/44636.
Singh et al] (2001) J Cont Release 70:267-276.
WO99/27960. US patent 6,090,406
US patent 5,916,588
EP-A-0626169.
W099/52549.
WO01/21207.
WOO 1/21152.
Andrianov et al. (1998) Biomaterials 19:109-115.
Payne et al. (1998) Adv Drug Delivery Review 31 : 185-196.
Stanley (2002) Clin Exp Dermatol 27:571-577.
Jones (2003) Curr Opin Investig Drugs 4:214-218.
WO04/60308
WO04/64759.
W099/11241.
WO94/00153.
W098/57659.
European patent applications 0835318, 0735898 and 0761231.
Hennings et al. (2001) J Infect Dis. 183(7):1138-42. Epub 2001 Mar 1.
Lin et al. (2001) J Infect Dis. 184(8):1022-8.
Lin et al. (2004) J Infect Dis. 190(5):928-34
Glezen & Alpers (1999) Clin. Infect. Dis. 28:219-224
Madoff et al. (1994) J Clin Invest 94:286-92.
Paoletti et al. (1994) Infect Immun 62:3236-43.
WO03/093306.
WO2004/018646.
WO2004/041157.
Adderson et al. (2003) Infection and Immunity 71(12):6857-6863.
Geysen et al. (1984) PNAS USA 81 :3998-4002.
Carter (1994) Methods Mol Biol 36:207-23.
Jameson, BA et al. 1988, CABIOS 4(1): 181-186.
Raddrizzani & Hammer (2000) Brief Bioinform 1(2): 179-89.
De Lalla e/ «/. (1999) J. Immunol. 163:1725-29.
Brusic et al. (1998) Bioinformatics 14(2):121-30
Meister e/ «/. (1995) Vaccine 13(6):581-91.
Roberts et al. (1996) AIDS Res Hum Retroviruses 12(7):593-610.
Maksyutov & Zagrebelnaya (1993) Comput Appl Biosci 9(3):291-7.
Feller & de la Cruz (1991) Nature 349(6311):720-1.
Hopp (1993) Peptide Research 6:183-190.
Welling et al. (1985) FEBS Lett. 188:215-218.
Davenport et al. (1995) Immunogenetics 42:392-297.
Bodanszky (1993) Principles of Peptide Synthesis (ISBN: 0387564314).
Fields et al. (1997) Meth Enzymol 289: Solid-Phase Peptide Synthesis. ISBN: 0121821900.
Chan & White (2000) Fmoc Solid Phase Peptide Synthesis. ISBN: 0199637245.
Kullmann (1987) Enzymatic Peptide Synthesis. ISBN: 0849368413.
Ibba (1996) Biotechnol Genet Eng Rev 13:197-216.
WO2006/069200
UK patent application 0802503.3, entitled "HYBRID POLYPEPTIDE" filed on 11th February , and international patent application WO2009/101403. [228] Needleman & Wunsch (1970) J. Mol. Biol. 48, 443-453.
[229] Rice et al. (2000) Trends Genet 16:276-277.
[230] Herzenberg et al. (1980) Nature 285: 664-667.
[231] Schutze et al. (1985) J Immunol 135:2319-2322.
[232] Dagan et al. (1998) Infect Immun 66:2093-2098.
[233] Barington et al. (1994) Infect Immun 62:9-14.
[234] Di ioh et al. (1989) Lancet 2(8677):1415-8.
[235] Granoff et al. (1993) Ffcccwie Suppll : S46-51.
[236] Granoff et al. {199 ) JAMA 272:1116-1121.
[237] Barington et al. (1993) Infect Immun 61 :432-438.
[238] Australian patent 748716 (granted from W098/51339).
[239] 01ander ei «/. (2001) Vaccine 20:336-341.
[240] Burrage et al. (2002) Infect Immun 70:4946-4954.
[241] Hoppenbrouwers et al. (1999) Vaccine 17:2588-98.
[242] Podda ei fl/. (1991) Vaccine 9:741-745.
[243] Vaccines, (eds. Plotkin & Orenstein). 4th edition, 2004, ISBN: 0-7216-9688-0
[244] Darkes & Plosker (2002) Paediatr Drugs 4:609-630.
[245] Jones (2001) Curr Opin Investig Drugs 2:47-49
[246] Del Guidice et al. (1998) Molecular Aspects of Medicine 19:1-70.
[247] Anonymous (Jan 2002) Research Disclosure, 453077.
[248] Anderson (1983) Infect Immun 39(l):233-238.
[249] Anderson et al. (1985) J Clin Invest 76(l):52-59.
[250] Rodewald et al. (1992) J Infect Dis. 166(3):635-9.
[251] Baltimore et al. (1977) J/mm««o/.118(2):673-8
[252] Lin et al. (2001) J Infect Dis. 184(8): 1022-8.

Claims

1. An immunogenic composition comprising: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein.
2. The immunogenic composition according to claim 1 , wherein the total quantity of GBS capsular saccharides is < 70 μg.
3. The immunogenic composition according to claim 1 or claim 2, wherein each GBS capsular saccharide is present at an amount from 1 to 30 μg per unit dose.
4. The immunogenic composition according to claim 3, wherein each GBS capsular saccharide is present at an amount of 5 μg, 10 μg or 20 μg per unit dose.
5. The immunogenic composition according to claim 4, wherein the amounts of the GBS serotype la, lb and III capsular saccharides per unit dose correspond to one of the dosing options described in the second column of Table C.
6. The immunogenic composition according to claim 5, wherein the amounts of the GBS serotype la, lb and III capsular saccharides per unit dose are selected from the group consisting of 20 μg, 20μg and 20μg; 10μg, 10μg and 10μg; and 5μg, 5μg and 5μg.
7. The immunogenic composition according to claim 6, wherein the amounts of the GBS serotype la, lb and III capsular saccharides per unit dose are 5μg, 5μg and 5μg.
8. The immunogenic composition according to claim 1 or claim 2, wherein each GBS capsular saccharide is present at an amount from 0.1 to 5 μg per unit dose.
9. The immunogenic composition according to claim 8, wherein each GBS capsular saccharide is present at an amount of 0.5, 2.5 or 5 μg per unit dose.
10. The immunogenic composition according to claim 9, wherein the amounts of the GBS serotype la, lb and III capsular saccharides per unit dose correspond to one of the dosing options described in Table C
11. The immunogenic composition according to any one of claims 1 to 10, wherein the ratio of the masses of the GBS serotype la, lb and III capsular saccharides correspond to one of the ratio options described in the second column of Table F.
12. The immunogenic composition according to claim 1 1, wherein the ratio of the masses of the GBS serotype la, lb and III capsular saccharides is 1 :1 :1.
13. The immunogenic composition according to any one of claims 1 to 12, wherein the composition is for administration in one unit dose followed by a second unit dose administered 3 months after the first unit dose.
14. The immunogenic composition according to any one of claims 1 to 12 further comprising: d) a conjugate that is a capsular saccharide from GBS serotype V conjugated to a carrier protein.
15. The immunogenic composition according to claim 14, wherein the composition is for administration in one unit dose followed by a second unit dose administered 1 month after the first unit dose.
16. The immunogenic composition according to any one of claims 1-12 and 14, wherein the composition is for administration in a single dose.
17. The immunogenic composition according to any one of the preceding claims, wherein the immunogenic composition does not contain an aluminium salt adjuvant.
18. The immunogenic composition according to any one of the preceding claims, wherein the immunogenic composition does not contain any adjuvant.
19. The immunogenic composition according to any one of the preceding claims, wherein the carrier protein in a), b) and/or c) is diphtheria toxoid, tetanus toxoid or CRM 197.
20. The immunogenic composition according to claim 19, wherein the carrier protein in a), b) and c) is CRM 197.
21. The immunogenic composition according to any one of the preceding claims, wherein the conjugate(s) are obtainable by reductive amination of aldehyde groups generated before conjugation by oxidation of between 10 and 30% of the saccharide(s)' sialic acid residues.
22. The immunogenic composition according to any one of the preceding claims, wherein the GBS capsular saccharide(s) have substantially no O-acetylation of sialic acid residues at positions 7, 8 and/or 9.
23. The immunogenic composition according to any one of the preceding claims, wherein the capsular saccharide from GBS serotype la has a MW in the range of 150-300kDa; the capsular saccharide from GBS serotype lb has a MW in the range of 150-300kDa; and/or the capsular saccharide from GBS serotype III has a MW in the range of 50-200kDa.
24. The immunogenic composition according to any one of the preceding claims, wherein the conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein has a saccharide :protein ratio (w/w) between about 1 :1 to 1 :2; the conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein has a saccharide :protein ratio (w/w) between about 1 :1 to 1 :2; and/or the conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein has a saccharide :protein ratio (w/w) between about 3: 1 to 1 :1.
25. The immunogenic composition according to any one of the preceding claims, wherein the composition is for administration intramuscularly.
26. The immunogenic composition according to any one of the preceding claims, wherein the composition further comprises: (a) a polypeptide comprising an amino acid sequence selected from SEQ ID NOs 1 to 3, and/or (b) a polypeptide comprising (i) an amino acid sequence that has sequence identity to one or more of SEQ ID NOs 1 to 3 and/or (ii) a fragment of SEQ ID NOs 1 to 3.
27. The immunogenic composition according to any one of the preceding claims, wherein the composition is an injectable liquid solution or suspension.
28. The immunogenic composition according to any one of claims 1-26, wherein the composition is lyophilised.
29. The immunogenic composition according to claim 28, wherein the composition comprises mannitol to stabilise the conjugate(s).
30. The immunogenic compositions according to any one of the preceding claims, wherein the composition comprises a potassium dihydrogen phosphate buffer.
31. The immunogenic compositions according to any one of the preceding claims, wherein the composition comprises sodium chloride.
32. The immunogenic composition according to any one of the preceding claims, wherein the composition is a vaccine.
33. The immunogenic composition according to any one of the preceding claims, wherein the composition is for administration to a human.
34. The immunogenic composition according to any one of the preceding claims, wherein the composition is for administration to humans selected from females of child-bearing age, pregnant females and elderly patients.
35. The immunogenic composition according to claim 34, wherein the composition is for administration to a pregnant female.
36. The immunogenic composition according to any one of claims 33-35, wherein prior to administration the human has undetectable levels of antibodies against capsular saccharide from GBS serotype la, capsular saccharide from GBS serotype lb, and/or capsular saccharide from GBS serotype III.
37. The immunogenic composition according to any one of the preceding claims, wherein the composition is for use as a medicament.
38. The immunogenic composition according to claim 37, wherein the composition is for the prevention and/or treatment of a disease caused by S.agalactiae.
39. The immunogenic composition according to claim 38, wherein the disease is neonatal sepsis, bacteremia, neonatal pneumonia, neonatal meningitis, endometritis, osteomyelitis or septic arthritis.
40. The immunogenic composition according to any one of the preceding claims, wherein the composition is for administration to a patient that has been pre-immunised with a diphtheria toxoid or derivative thereof and at least one conjugate in the immunogenic composition is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof.
41. A method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a diphtheria toxoid or derivative thereof, wherein the patient has been pre-immunised with a diphtheria toxoid or derivative thereof.
42. The method according to claim 41 , wherein the conjugate is in an immunogenic composition comprising: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein; and the capsular saccharide from GBS is the capsular saccharide from GBS serotype la, lb or III.
43. The method according to claim 42, wherein the capsular saccharide from GBS is the capsular saccharide from GBS serotype III.
44. The method according to claim 42 or claim 43, wherein the immunogenic composition has the features of any one of claims 1-39.
45. A method for immunising a patient against infection by GBS comprising the step of administering to the patient a conjugate that is a capsular saccharide from GBS conjugated to a tetanus toxoid or derivative thereof, wherein the patient has been pre-immunised with a tetanus toxoid or derivative thereof.
46. The method according to claim 45, wherein the conjugate is in an immunogenic composition comprising: a) a conjugate that is a capsular saccharide from GBS serotype la conjugated to a carrier protein; b) a conjugate that is a capsular saccharide from GBS serotype lb conjugated to a carrier protein; and c) a conjugate that is a capsular saccharide from GBS serotype III conjugated to a carrier protein; and the capsular saccharide from GBS is the capsular saccharide from GBS serotype la, lb or III.
47. The method according to claim 46, wherein the capsular saccharide from GBS is the capsular saccharide from GBS serotype III.
48. The method according to claim 46 or claim 47, wherein the immunogenic composition has the features of any one of claims 1-39.
PCT/IB2011/054069 2010-09-16 2011-09-16 Immunogenic compositions WO2012035519A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
KR1020137009242A KR20130098362A (en) 2010-09-16 2011-09-16 Immunogenic compositions
MX2013002841A MX349930B (en) 2010-09-16 2011-09-16 Immunogenic compositions.
ES11768149.4T ES2677358T3 (en) 2010-09-16 2011-09-16 Immunogenic compositions
RU2013117082A RU2608905C2 (en) 2010-09-16 2011-09-16 Immunogenic compositions
BR112013006396A BR112013006396A2 (en) 2010-09-16 2011-09-16 immunogenic compositions
CA2811305A CA2811305C (en) 2010-09-16 2011-09-16 Immunogenic compositions
SG2013017850A SG188499A1 (en) 2010-09-16 2011-09-16 Immunogenic compositions
JP2013528820A JP6093302B2 (en) 2010-09-16 2011-09-16 Immunogenic composition
US13/824,041 US20130273091A1 (en) 2010-09-16 2011-09-16 Immunogenic compositions
AU2011303478A AU2011303478B2 (en) 2010-09-16 2011-09-16 Immunogenic compositions
CN201180054731.9A CN103209708B (en) 2010-09-16 2011-09-16 Immunogenic composition
EP11768149.4A EP2616099B1 (en) 2010-09-16 2011-09-16 Immunogenic compositions
ZA2013/01908A ZA201301908B (en) 2010-09-16 2013-03-13 Immunogenic compositions
US14/662,429 US20150283232A1 (en) 2010-09-16 2015-03-19 Immunogenic compositions
US15/705,873 US20180036402A1 (en) 2010-09-16 2017-09-15 Immunogenic compositions

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US38366810P 2010-09-16 2010-09-16
US61/383,668 2010-09-16
GB1101665.6 2011-01-31
GBGB1101665.6A GB201101665D0 (en) 2011-01-31 2011-01-31 Immunogenic compositions

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/824,041 A-371-Of-International US20130273091A1 (en) 2010-09-16 2011-09-16 Immunogenic compositions
US14/662,429 Continuation US20150283232A1 (en) 2010-09-16 2015-03-19 Immunogenic compositions

Publications (1)

Publication Number Publication Date
WO2012035519A1 true WO2012035519A1 (en) 2012-03-22

Family

ID=43824889

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2011/054069 WO2012035519A1 (en) 2010-09-16 2011-09-16 Immunogenic compositions

Country Status (14)

Country Link
US (3) US20130273091A1 (en)
EP (1) EP2616099B1 (en)
JP (1) JP6093302B2 (en)
KR (1) KR20130098362A (en)
CN (1) CN103209708B (en)
AU (1) AU2011303478B2 (en)
BR (1) BR112013006396A2 (en)
CA (1) CA2811305C (en)
ES (1) ES2677358T3 (en)
GB (1) GB201101665D0 (en)
RU (1) RU2608905C2 (en)
SG (1) SG188499A1 (en)
TR (1) TR201811681T4 (en)
WO (1) WO2012035519A1 (en)

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014053607A1 (en) 2012-10-03 2014-04-10 Novartis Ag Immunogenic compositions
WO2013088378A3 (en) * 2011-12-12 2014-05-01 Novartis Ag Method of detecting the presence of an antibody in a sample
WO2014111344A1 (en) * 2013-01-15 2014-07-24 Novartis Ag Cycloalkyne derivatized saccharides
US8986710B2 (en) 2012-03-09 2015-03-24 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
JP2015512441A (en) * 2012-04-04 2015-04-27 ヴァックスフォーム エルエルシーVaxform Llc Improved adjuvant system for oral vaccine administration
EP3034516A1 (en) 2014-12-19 2016-06-22 Novartis AG Purification of streptococcal capsular polysaccharide
WO2016178123A1 (en) 2015-05-04 2016-11-10 Pfizer Inc. Group b streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof
WO2017001586A1 (en) * 2015-07-01 2017-01-05 Glaxosmithkline Biologicals S.A. Immunogenic compositions
US9556240B2 (en) 2010-08-23 2017-01-31 Wyeth Llc Stable formulations of Neisseria meningitidis rLP2086 antigens
WO2017062558A1 (en) * 2015-10-07 2017-04-13 Boehringer Ingelheim Vetmedica, Inc. Streptococcus suis polysaccharide-protein conjugate composition
US9623101B2 (en) 2001-10-11 2017-04-18 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US9757443B2 (en) 2010-09-10 2017-09-12 Wyeth Llc Non-lipidated variants of Neisseria meningitidis ORF2086 antigens
US9802987B2 (en) 2013-03-08 2017-10-31 Pfizer Inc. Immunogenic fusion polypeptides
US9822150B2 (en) 2013-09-08 2017-11-21 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
WO2018087635A1 (en) 2016-11-09 2018-05-17 Pfizer Inc. Immunogenic polysaccharide protein conjugated comprising a polysaccharide derived from b streptococcus gbs
WO2018229708A1 (en) 2017-06-16 2018-12-20 Glaxosmithkline Biologicals Sa Method of treatment
US10183070B2 (en) 2017-01-31 2019-01-22 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US10196429B2 (en) 2012-03-09 2019-02-05 Pfizer Inc. Neisseria meningitidis composition and methods thereof
WO2020229964A1 (en) 2019-05-10 2020-11-19 Glaxosmithkline Biologicals Sa Conjugate production
US10888611B2 (en) 2015-02-19 2021-01-12 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
WO2021099982A1 (en) 2019-11-22 2021-05-27 Glaxosmithkline Biologicals Sa Dosage and administration of a bacterial saccharide glycoconjugate vaccine
WO2021250626A2 (en) 2020-06-12 2021-12-16 Glaxosmithkline Biologicals Sa Dock tag system
WO2021250628A1 (en) 2020-06-12 2021-12-16 Glaxosmithkline Biologicals Sa Bacterial immunization using nanoparticle vaccine
WO2021250625A2 (en) 2020-06-12 2021-12-16 Glaxosmithkline Biologicals Sa Gbs ferritin nanoparticles
WO2022043855A1 (en) 2020-08-26 2022-03-03 Pfizer Inc. Group b streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof
RU2791468C2 (en) * 2016-11-09 2023-03-09 Пфайзер Инк. Immunogenic polysaccharide-protein conjugates containing a polysaccharide derived from group b streptococcus
WO2023111826A1 (en) 2021-12-14 2023-06-22 Glaxosmithkline Biologicals Sa Bacterial immunization using qbeta hairpin nanoparticle constructs
US11759511B2 (en) 2017-09-07 2023-09-19 Merck Sharp & Dohme Llc Pneumococcal polysaccharides and their use in immunogenic polysaccharide-carrier protein conjugates

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB0502095D0 (en) * 2005-02-01 2005-03-09 Chiron Srl Conjugation of streptococcal capsular saccharides
EP2662370A1 (en) * 2012-05-09 2013-11-13 Bayer CropScience AG 5-Halogenopyrazole benzofuranyl carboxamides
CN114053400B (en) * 2020-08-07 2023-12-26 辽宁成大生物股份有限公司 Vaccine for preventing novel coronavirus pneumonia COVID-19 and preparation method thereof

Citations (89)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4356170A (en) 1981-05-27 1982-10-26 Canadian Patents & Development Ltd. Immunogenic polysaccharide-protein conjugates
EP0109942A2 (en) 1982-10-18 1984-05-30 Bror Morein Immunogenic protein or peptide complex, method of producing said complex and the use thereof as an immune stimulant and as a vaccine
EP0372501A2 (en) 1988-12-07 1990-06-13 BEHRINGWERKE Aktiengesellschaft Synthetic antigens, method for their preparation and their use
EP0378881A1 (en) 1989-01-17 1990-07-25 ENIRICERCHE S.p.A. Synthetic peptides and their use as universal carriers for the preparation of immunogenic conjugates suitable for the development of synthetic vaccines
WO1990014837A1 (en) 1989-05-25 1990-12-13 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
WO1991001146A1 (en) 1989-07-14 1991-02-07 Praxis Biologics, Inc. Cytokine and hormone carriers for conjugate vaccines
EP0427347A1 (en) 1989-11-10 1991-05-15 ENIRICERCHE S.p.A. Synthetic peptides useful as universal carriers for the preparation of immunogenic conjugates and their use in the development of synthetic vaccines
US5057540A (en) 1987-05-29 1991-10-15 Cambridge Biotech Corporation Saponin adjuvant
EP0471177A2 (en) 1990-08-13 1992-02-19 American Cyanamid Company Filamentous hemagglutinin of bordetella pertussis as a carrier molecule for conjugate vaccines
EP0477508A1 (en) 1990-09-28 1992-04-01 American Cyanamid Company Improved oligosaccharide conjugate vaccines
WO1993017712A2 (en) 1992-03-06 1993-09-16 Biocine Spa Conjugates formed from heat shock proteins and oligo- or polysaccharides
WO1994000153A1 (en) 1992-06-25 1994-01-06 Smithkline Beecham Biologicals (S.A.) Vaccine composition containing adjuvants
WO1994003208A1 (en) 1992-07-30 1994-02-17 Yeda Research And Development Company Ltd. Conjugates of poorly immunogenic antigens and synthetic peptide carriers and vaccines comprising them
WO1994006467A1 (en) * 1992-09-24 1994-03-31 Brigham And Women's Hospital, Inc. Group b streptococcus type ii and type v polysaccharide-protein conjugate vaccines
EP0594610A1 (en) 1990-05-31 1994-05-04 Arne Forsgren PROTEIN D - AN IgD-BINDING PROTEIN OF HAEMOPHILUS INFLUENZAE
EP0626169A2 (en) 1988-08-25 1994-11-30 The Liposome Company, Inc. A dosage form comprising an antigen and a salt form of an organic acid derivative of a sterol
WO1995017211A1 (en) 1993-12-22 1995-06-29 Biocine S.P.A. Non-toxic mucosal adjuvant
EP0689454A1 (en) 1993-03-23 1996-01-03 Smithkline Beecham Biolog Vaccine compositions containing 3-o deacylated monophosphoryl lipid a
WO1996011711A1 (en) 1994-10-12 1996-04-25 Iscotec Ab Saponin preparations and use thereof in iscoms
WO1996029412A1 (en) 1995-03-17 1996-09-26 Biochem Vaccines Inc. Proteinase k resistant surface protein of neisseria meningitidis
EP0735898A1 (en) 1993-12-23 1996-10-09 SMITHKLINE BEECHAM BIOLOGICALS s.a. Vaccines
WO1996033739A1 (en) 1995-04-25 1996-10-31 Smithkline Beecham Biologicals S.A. Vaccines containing a saponin and a sterol
WO1996040795A1 (en) 1995-06-07 1996-12-19 North American Vaccine, Inc. Antigenic group b streptococcus type ii and type iii polysaccharide fragments having a 2, 5-anhydro-d-mannose terminal structure and conjugate vaccine thereof
WO1996040242A1 (en) 1995-06-07 1996-12-19 Smithkline Beecham Biologicals S.A. Vaccine comprising a polysaccharide antigen-carrier protein conjugate and free carrier protein
EP0835318A2 (en) 1995-06-29 1998-04-15 SMITHKLINE BEECHAM BIOLOGICALS s.a. Vaccines against hepatitis c
WO1998040100A1 (en) 1997-03-10 1998-09-17 Ottawa Civic Loeb Research Institute USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT
WO1998042721A1 (en) 1997-03-24 1998-10-01 Andrew Lees Uronium salt conjugate vaccines
WO1998042375A1 (en) 1997-03-21 1998-10-01 Chiron Corporation Detoxified mutants of bacterial adp-ribosylating toxins as parenteral adjuvants
WO1998057659A1 (en) 1997-06-14 1998-12-23 Smithkline Beecham Biologicals S.A. Adjuvant compositions for vaccines
WO1998058668A2 (en) 1997-06-20 1998-12-30 Microbiological Research Authority Bordetella pertussis antigens as carriers in vaccinating conjugates and oral vaccines comprising bordetella pertussis fimbriae
WO1999011241A1 (en) 1997-09-05 1999-03-11 Smithkline Beecham Biologicals S.A. Oil in water emulsions containing saponins
WO1999024578A2 (en) 1997-11-06 1999-05-20 Chiron S.P.A. Neisserial antigens
WO1999027105A2 (en) 1997-11-21 1999-06-03 Genset Chlamydia pneumoniae genomic sequence and polypeptides, fragments thereof and uses thereof, in particular for the diagnosis, prevention and treatment of infection
WO1999028475A2 (en) 1997-11-28 1999-06-10 Genset Chlamydia trachomatis genomic sequence and polypeptides, fragments thereof and uses thereof, in particular for the diagnosis, prevention and treatment of infection
WO1999027960A1 (en) 1997-11-28 1999-06-10 West Pharmaceutical Services Vaccine compositions for mucosal administration comprising chitosan
US5916588A (en) 1984-04-12 1999-06-29 The Liposome Company, Inc. Peptide-containing liposomes, immunogenic liposomes and methods of preparation and use
WO1999036544A2 (en) 1998-01-14 1999-07-22 Chiron S.P.A. Neisseria meningitidis antigens
WO1999040936A2 (en) 1998-02-12 1999-08-19 American Cyanamid Company Pneumococcal and meningococcal vaccines formulated with interleukin-12
WO1999042130A1 (en) 1998-02-23 1999-08-26 Connaught Laboratories Limited Multi-oligosaccharide glycoconjugate bacterial meningitis vaccines
WO1999044636A2 (en) 1998-03-05 1999-09-10 The Medical College Of Ohio Il-12 enhancement of immune responses to t-independent antigens
WO1999052549A1 (en) 1998-04-09 1999-10-21 Smithkline Beecham Biologicals S.A. Adjuvant compositions
WO1999057280A2 (en) 1998-05-01 1999-11-11 Chiron Corporation Neisseria meningitidis antigens and compositions
WO1999062923A2 (en) 1998-06-05 1999-12-09 Dynavax Technologies Corporation Immunostimulatory oligonucleotides with modified bases and methods of use thereof
WO2000007621A2 (en) 1998-08-05 2000-02-17 Smithkline Beecham Biologicals S.A. Vaccine comprising an iscom consisting of sterol and saponin which is free of additional detergent
US6027733A (en) 1997-03-26 2000-02-22 The Brigham And Women's Hospital, Inc. Method for generating saccharide fragments
WO2000022430A2 (en) 1998-10-09 2000-04-20 Chiron Corporation Neisseria genomic sequences and methods of their use
WO2000023105A2 (en) 1998-10-16 2000-04-27 Smithkline Beecham Biologicals S.A. Adjuvant systems and vaccines
WO2000027994A2 (en) 1998-11-12 2000-05-18 The Regents Of The University Of California Chlamydia pneumoniae genome sequence
WO2000033882A1 (en) 1998-12-04 2000-06-15 The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services A vi-repa conjugate vaccine for immunization against salmonella typhi
WO2000037494A2 (en) 1998-12-18 2000-06-29 Chiron S.P.A. Chlamydia trachomatis antigens
WO2000038711A2 (en) 1998-12-29 2000-07-06 Connaught Laboratories Purification of polysaccharide-protein conjugate vaccines by ultrafiltration with ammonium sulfate solutions
US6090406A (en) 1984-04-12 2000-07-18 The Liposome Company, Inc. Potentiation of immune responses with liposomal adjuvants
WO2000053221A1 (en) 1999-03-11 2000-09-14 Aventis Pasteur Intranasal delivery of pneumococcal polysaccharide vaccines
WO2000056365A1 (en) 1999-03-23 2000-09-28 Aventis Pasteur Use of trehalose for stabilising a liquid vaccine
WO2000056360A2 (en) 1999-03-19 2000-09-28 Smithkline Beecham Biologicals S.A. Vaccine against antigens from bacteriae
WO2000061761A2 (en) 1999-04-09 2000-10-19 Techlab, Inc. Recombinant clostridium toxin a protein carrier for polysaccharide conjugate vaccines
US6207646B1 (en) 1994-07-15 2001-03-27 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
WO2001021152A1 (en) 1999-09-24 2001-03-29 Smithkline Beecham Biologicals S.A. Adjuvant comprising a polyxyethylene alkyl ether or ester and at least one nonionic surfactant
WO2001021207A2 (en) 1999-09-24 2001-03-29 Smithkline Beecham Biologicals S.A. Use of combination of polyoxyethylene sorbitan ester and octoxynol as adjuvant and its use in vaccines
US6239116B1 (en) 1994-07-15 2001-05-29 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
WO2001052885A1 (en) 2000-01-17 2001-07-26 Chiron Spa Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins
WO2001072337A1 (en) 2000-03-27 2001-10-04 Microbiological Research Authority Proteins for use as carriers in conjugate vaccines
WO2001095935A1 (en) 2000-01-20 2001-12-20 Ottawa Health Research Institute Immunostimulatory nucleic acids for inducing a th2 immune response
WO2002002606A2 (en) 2000-07-03 2002-01-10 Chiron S.P.A. Immunisation against chlamydia pneumoniae
US6355271B1 (en) 1999-02-03 2002-03-12 Biosante Pharmaceuticals, Inc. Therapeutic calcium phosphate particles and methods of manufacture and use
WO2002026757A2 (en) 2000-09-26 2002-04-04 Hybridon, Inc. Modulation of immunostimulatory activity of immunostimulatory oligonucleotide analogs by positional chemical changes
WO2002034771A2 (en) 2000-10-27 2002-05-02 Chiron Srl Nucleic acids and proteins from streptococcus groups a & b
AU748716B2 (en) 1997-05-14 2002-06-13 Sanofi Pasteur Multivalent vaccine composition with mixed carrier
US6429199B1 (en) 1994-07-15 2002-08-06 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules for activating dendritic cells
WO2002091998A2 (en) 2001-05-11 2002-11-21 Aventis Pasteur, Inc. Novel meningitis conjugate vaccine
WO2003007985A2 (en) 2001-06-20 2003-01-30 Chiron Srl. Capsular polysaccharide solubilisation and combination vaccines
WO2003009869A1 (en) 2001-07-26 2003-02-06 Chiron Srl. Vaccines comprising aluminium adjuvants and histidine
WO2003024480A2 (en) 2001-09-14 2003-03-27 Cytos Biotechnology Ag In vivo activation of antigen presenting cells for enhancement of immune responses induced by virus like particles
WO2003024481A2 (en) 2001-09-14 2003-03-27 Cytos Biotechnology Ag Packaging of immunostimulatory substances into virus-like particles: method of preparation and use
WO2003035836A2 (en) 2001-10-24 2003-05-01 Hybridon Inc. Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5' ends
WO2003093306A2 (en) 2002-05-02 2003-11-13 Chir0N Srl Nucleic acids and proteins from streptococcus groups a & b
WO2004011027A1 (en) 2002-07-30 2004-02-05 Baxter International Inc. Chimeric multivalent polysaccharide conjugate vaccines
WO2004018646A2 (en) 2002-08-26 2004-03-04 Chiron Corporation Conserved and specific streptococcal genomes
WO2004041157A2 (en) 2002-09-13 2004-05-21 Chiron Corporation Group b streptococcus vaccine
WO2004060308A2 (en) 2002-12-27 2004-07-22 Chiron Corporation Thiosemicarbazones as anti-virals and immunopotentiators
WO2004064759A2 (en) 2003-01-21 2004-08-05 Chiron Corporation Use of tryptanthrin compounds for immune potentiation
WO2005000346A1 (en) 2003-06-23 2005-01-06 Baxter International Inc. Carrier proteins for vaccines
WO2006050341A2 (en) 2004-11-01 2006-05-11 The Brigham And Women's Hospital, Inc. Modified streptococcal polysaccharides and uses thereof
WO2006069200A2 (en) 2004-12-22 2006-06-29 Novartis Vaccines And Diagnostics Inc. Group b streptococcus
WO2006082530A2 (en) 2005-02-01 2006-08-10 Novartis Vaccines And Diagnostics Srl Conjugation of streptococcal capsular saccharides to carrier proteins
WO2006082527A2 (en) 2005-02-01 2006-08-10 Novartis Vaccines And Diagnostics Srl Purification of streptococcal capsular polysaccharide
WO2009010877A2 (en) 2007-07-17 2009-01-22 Novartis Ag Conjugate purification
WO2009081276A2 (en) 2007-12-20 2009-07-02 Novartis Ag Fermentation processes for cultivating streptococci and purification processes for obtaining cps therefrom
WO2009101403A1 (en) 2008-02-11 2009-08-20 Novartis Ag Hybrid polypeptides comprising gbs-80 and spb1 proteins of streptococcus

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
PT667787E (en) * 1992-09-24 2001-10-31 Brigham & Womens Hospital VACCINES OF POLYSTATE-PROTEIN CONJUGATE OF GROUP B TYPE II B TYPE AND TYPE V
CN101213205A (en) * 2004-12-22 2008-07-02 希龙公司 Group B streptococcus
EP2063911A2 (en) * 2006-07-26 2009-06-03 Novartis Ag Immunogenic compositions for gram positive bacteria

Patent Citations (95)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4356170A (en) 1981-05-27 1982-10-26 Canadian Patents & Development Ltd. Immunogenic polysaccharide-protein conjugates
EP0109942A2 (en) 1982-10-18 1984-05-30 Bror Morein Immunogenic protein or peptide complex, method of producing said complex and the use thereof as an immune stimulant and as a vaccine
US6090406A (en) 1984-04-12 2000-07-18 The Liposome Company, Inc. Potentiation of immune responses with liposomal adjuvants
US5916588A (en) 1984-04-12 1999-06-29 The Liposome Company, Inc. Peptide-containing liposomes, immunogenic liposomes and methods of preparation and use
US5057540A (en) 1987-05-29 1991-10-15 Cambridge Biotech Corporation Saponin adjuvant
EP0626169A2 (en) 1988-08-25 1994-11-30 The Liposome Company, Inc. A dosage form comprising an antigen and a salt form of an organic acid derivative of a sterol
EP0372501A2 (en) 1988-12-07 1990-06-13 BEHRINGWERKE Aktiengesellschaft Synthetic antigens, method for their preparation and their use
EP0378881A1 (en) 1989-01-17 1990-07-25 ENIRICERCHE S.p.A. Synthetic peptides and their use as universal carriers for the preparation of immunogenic conjugates suitable for the development of synthetic vaccines
US6451325B1 (en) 1989-05-25 2002-09-17 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
US6299884B1 (en) 1989-05-25 2001-10-09 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
WO1990014837A1 (en) 1989-05-25 1990-12-13 Chiron Corporation Adjuvant formulation comprising a submicron oil droplet emulsion
WO1991001146A1 (en) 1989-07-14 1991-02-07 Praxis Biologics, Inc. Cytokine and hormone carriers for conjugate vaccines
EP0427347A1 (en) 1989-11-10 1991-05-15 ENIRICERCHE S.p.A. Synthetic peptides useful as universal carriers for the preparation of immunogenic conjugates and their use in the development of synthetic vaccines
EP0594610A1 (en) 1990-05-31 1994-05-04 Arne Forsgren PROTEIN D - AN IgD-BINDING PROTEIN OF HAEMOPHILUS INFLUENZAE
EP0471177A2 (en) 1990-08-13 1992-02-19 American Cyanamid Company Filamentous hemagglutinin of bordetella pertussis as a carrier molecule for conjugate vaccines
US5306492A (en) 1990-09-28 1994-04-26 American Cyanamid Company Oligosaccharide conjugate vaccines
EP0477508A1 (en) 1990-09-28 1992-04-01 American Cyanamid Company Improved oligosaccharide conjugate vaccines
WO1993017712A2 (en) 1992-03-06 1993-09-16 Biocine Spa Conjugates formed from heat shock proteins and oligo- or polysaccharides
EP0761231A1 (en) 1992-06-25 1997-03-12 SMITHKLINE BEECHAM BIOLOGICALS s.a. Vaccine composition containing adjuvants
WO1994000153A1 (en) 1992-06-25 1994-01-06 Smithkline Beecham Biologicals (S.A.) Vaccine composition containing adjuvants
WO1994003208A1 (en) 1992-07-30 1994-02-17 Yeda Research And Development Company Ltd. Conjugates of poorly immunogenic antigens and synthetic peptide carriers and vaccines comprising them
WO1994006467A1 (en) * 1992-09-24 1994-03-31 Brigham And Women's Hospital, Inc. Group b streptococcus type ii and type v polysaccharide-protein conjugate vaccines
EP0689454A1 (en) 1993-03-23 1996-01-03 Smithkline Beecham Biolog Vaccine compositions containing 3-o deacylated monophosphoryl lipid a
WO1995017211A1 (en) 1993-12-22 1995-06-29 Biocine S.P.A. Non-toxic mucosal adjuvant
EP0735898A1 (en) 1993-12-23 1996-10-09 SMITHKLINE BEECHAM BIOLOGICALS s.a. Vaccines
US6429199B1 (en) 1994-07-15 2002-08-06 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules for activating dendritic cells
US6239116B1 (en) 1994-07-15 2001-05-29 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
US6207646B1 (en) 1994-07-15 2001-03-27 University Of Iowa Research Foundation Immunostimulatory nucleic acid molecules
WO1996011711A1 (en) 1994-10-12 1996-04-25 Iscotec Ab Saponin preparations and use thereof in iscoms
WO1996029412A1 (en) 1995-03-17 1996-09-26 Biochem Vaccines Inc. Proteinase k resistant surface protein of neisseria meningitidis
WO1996033739A1 (en) 1995-04-25 1996-10-31 Smithkline Beecham Biologicals S.A. Vaccines containing a saponin and a sterol
WO1996040242A1 (en) 1995-06-07 1996-12-19 Smithkline Beecham Biologicals S.A. Vaccine comprising a polysaccharide antigen-carrier protein conjugate and free carrier protein
WO1996040795A1 (en) 1995-06-07 1996-12-19 North American Vaccine, Inc. Antigenic group b streptococcus type ii and type iii polysaccharide fragments having a 2, 5-anhydro-d-mannose terminal structure and conjugate vaccine thereof
EP0835318A2 (en) 1995-06-29 1998-04-15 SMITHKLINE BEECHAM BIOLOGICALS s.a. Vaccines against hepatitis c
WO1998040100A1 (en) 1997-03-10 1998-09-17 Ottawa Civic Loeb Research Institute USE OF NUCLEIC ACIDS CONTAINING UNMETHYLATED CpG DINUCLEOTIDE AS AN ADJUVANT
WO1998042375A1 (en) 1997-03-21 1998-10-01 Chiron Corporation Detoxified mutants of bacterial adp-ribosylating toxins as parenteral adjuvants
WO1998042721A1 (en) 1997-03-24 1998-10-01 Andrew Lees Uronium salt conjugate vaccines
US6274144B1 (en) 1997-03-26 2001-08-14 The Brigham And Women's Hospital, Inc. Method for generating antibodies to saccharide fragments
US6027733A (en) 1997-03-26 2000-02-22 The Brigham And Women's Hospital, Inc. Method for generating saccharide fragments
AU748716B2 (en) 1997-05-14 2002-06-13 Sanofi Pasteur Multivalent vaccine composition with mixed carrier
WO1998057659A1 (en) 1997-06-14 1998-12-23 Smithkline Beecham Biologicals S.A. Adjuvant compositions for vaccines
WO1998058668A2 (en) 1997-06-20 1998-12-30 Microbiological Research Authority Bordetella pertussis antigens as carriers in vaccinating conjugates and oral vaccines comprising bordetella pertussis fimbriae
WO1999011241A1 (en) 1997-09-05 1999-03-11 Smithkline Beecham Biologicals S.A. Oil in water emulsions containing saponins
WO1999024578A2 (en) 1997-11-06 1999-05-20 Chiron S.P.A. Neisserial antigens
WO1999027105A2 (en) 1997-11-21 1999-06-03 Genset Chlamydia pneumoniae genomic sequence and polypeptides, fragments thereof and uses thereof, in particular for the diagnosis, prevention and treatment of infection
WO1999027960A1 (en) 1997-11-28 1999-06-10 West Pharmaceutical Services Vaccine compositions for mucosal administration comprising chitosan
WO1999028475A2 (en) 1997-11-28 1999-06-10 Genset Chlamydia trachomatis genomic sequence and polypeptides, fragments thereof and uses thereof, in particular for the diagnosis, prevention and treatment of infection
WO1999036544A2 (en) 1998-01-14 1999-07-22 Chiron S.P.A. Neisseria meningitidis antigens
WO1999040936A2 (en) 1998-02-12 1999-08-19 American Cyanamid Company Pneumococcal and meningococcal vaccines formulated with interleukin-12
WO1999042130A1 (en) 1998-02-23 1999-08-26 Connaught Laboratories Limited Multi-oligosaccharide glycoconjugate bacterial meningitis vaccines
WO1999044636A2 (en) 1998-03-05 1999-09-10 The Medical College Of Ohio Il-12 enhancement of immune responses to t-independent antigens
WO1999052549A1 (en) 1998-04-09 1999-10-21 Smithkline Beecham Biologicals S.A. Adjuvant compositions
WO1999057280A2 (en) 1998-05-01 1999-11-11 Chiron Corporation Neisseria meningitidis antigens and compositions
WO1999062923A2 (en) 1998-06-05 1999-12-09 Dynavax Technologies Corporation Immunostimulatory oligonucleotides with modified bases and methods of use thereof
WO2000007621A2 (en) 1998-08-05 2000-02-17 Smithkline Beecham Biologicals S.A. Vaccine comprising an iscom consisting of sterol and saponin which is free of additional detergent
WO2000022430A2 (en) 1998-10-09 2000-04-20 Chiron Corporation Neisseria genomic sequences and methods of their use
WO2000023105A2 (en) 1998-10-16 2000-04-27 Smithkline Beecham Biologicals S.A. Adjuvant systems and vaccines
WO2000027994A2 (en) 1998-11-12 2000-05-18 The Regents Of The University Of California Chlamydia pneumoniae genome sequence
WO2000033882A1 (en) 1998-12-04 2000-06-15 The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services A vi-repa conjugate vaccine for immunization against salmonella typhi
WO2000037494A2 (en) 1998-12-18 2000-06-29 Chiron S.P.A. Chlamydia trachomatis antigens
US6146902A (en) 1998-12-29 2000-11-14 Aventis Pasteur, Inc. Purification of polysaccharide-protein conjugate vaccines by ultrafiltration with ammonium sulfate solutions
WO2000038711A2 (en) 1998-12-29 2000-07-06 Connaught Laboratories Purification of polysaccharide-protein conjugate vaccines by ultrafiltration with ammonium sulfate solutions
US6355271B1 (en) 1999-02-03 2002-03-12 Biosante Pharmaceuticals, Inc. Therapeutic calcium phosphate particles and methods of manufacture and use
WO2000053221A1 (en) 1999-03-11 2000-09-14 Aventis Pasteur Intranasal delivery of pneumococcal polysaccharide vaccines
WO2000056360A2 (en) 1999-03-19 2000-09-28 Smithkline Beecham Biologicals S.A. Vaccine against antigens from bacteriae
WO2000056365A1 (en) 1999-03-23 2000-09-28 Aventis Pasteur Use of trehalose for stabilising a liquid vaccine
WO2000061761A2 (en) 1999-04-09 2000-10-19 Techlab, Inc. Recombinant clostridium toxin a protein carrier for polysaccharide conjugate vaccines
WO2001021207A2 (en) 1999-09-24 2001-03-29 Smithkline Beecham Biologicals S.A. Use of combination of polyoxyethylene sorbitan ester and octoxynol as adjuvant and its use in vaccines
WO2001021152A1 (en) 1999-09-24 2001-03-29 Smithkline Beecham Biologicals S.A. Adjuvant comprising a polyxyethylene alkyl ether or ester and at least one nonionic surfactant
WO2001052885A1 (en) 2000-01-17 2001-07-26 Chiron Spa Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins
WO2001095935A1 (en) 2000-01-20 2001-12-20 Ottawa Health Research Institute Immunostimulatory nucleic acids for inducing a th2 immune response
WO2001072337A1 (en) 2000-03-27 2001-10-04 Microbiological Research Authority Proteins for use as carriers in conjugate vaccines
WO2002002606A2 (en) 2000-07-03 2002-01-10 Chiron S.P.A. Immunisation against chlamydia pneumoniae
WO2002026757A2 (en) 2000-09-26 2002-04-04 Hybridon, Inc. Modulation of immunostimulatory activity of immunostimulatory oligonucleotide analogs by positional chemical changes
WO2002034771A2 (en) 2000-10-27 2002-05-02 Chiron Srl Nucleic acids and proteins from streptococcus groups a & b
WO2002091998A2 (en) 2001-05-11 2002-11-21 Aventis Pasteur, Inc. Novel meningitis conjugate vaccine
WO2003007985A2 (en) 2001-06-20 2003-01-30 Chiron Srl. Capsular polysaccharide solubilisation and combination vaccines
WO2003009869A1 (en) 2001-07-26 2003-02-06 Chiron Srl. Vaccines comprising aluminium adjuvants and histidine
WO2003024480A2 (en) 2001-09-14 2003-03-27 Cytos Biotechnology Ag In vivo activation of antigen presenting cells for enhancement of immune responses induced by virus like particles
WO2003024481A2 (en) 2001-09-14 2003-03-27 Cytos Biotechnology Ag Packaging of immunostimulatory substances into virus-like particles: method of preparation and use
WO2003035836A2 (en) 2001-10-24 2003-05-01 Hybridon Inc. Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5' ends
WO2003093306A2 (en) 2002-05-02 2003-11-13 Chir0N Srl Nucleic acids and proteins from streptococcus groups a & b
WO2004011027A1 (en) 2002-07-30 2004-02-05 Baxter International Inc. Chimeric multivalent polysaccharide conjugate vaccines
WO2004018646A2 (en) 2002-08-26 2004-03-04 Chiron Corporation Conserved and specific streptococcal genomes
WO2004041157A2 (en) 2002-09-13 2004-05-21 Chiron Corporation Group b streptococcus vaccine
WO2004060308A2 (en) 2002-12-27 2004-07-22 Chiron Corporation Thiosemicarbazones as anti-virals and immunopotentiators
WO2004064759A2 (en) 2003-01-21 2004-08-05 Chiron Corporation Use of tryptanthrin compounds for immune potentiation
WO2005000346A1 (en) 2003-06-23 2005-01-06 Baxter International Inc. Carrier proteins for vaccines
WO2006050341A2 (en) 2004-11-01 2006-05-11 The Brigham And Women's Hospital, Inc. Modified streptococcal polysaccharides and uses thereof
WO2006069200A2 (en) 2004-12-22 2006-06-29 Novartis Vaccines And Diagnostics Inc. Group b streptococcus
WO2006082530A2 (en) 2005-02-01 2006-08-10 Novartis Vaccines And Diagnostics Srl Conjugation of streptococcal capsular saccharides to carrier proteins
WO2006082527A2 (en) 2005-02-01 2006-08-10 Novartis Vaccines And Diagnostics Srl Purification of streptococcal capsular polysaccharide
WO2009010877A2 (en) 2007-07-17 2009-01-22 Novartis Ag Conjugate purification
WO2009081276A2 (en) 2007-12-20 2009-07-02 Novartis Ag Fermentation processes for cultivating streptococci and purification processes for obtaining cps therefrom
WO2009101403A1 (en) 2008-02-11 2009-08-20 Novartis Ag Hybrid polypeptides comprising gbs-80 and spb1 proteins of streptococcus

Non-Patent Citations (163)

* Cited by examiner, † Cited by third party
Title
ADDERSON ET AL., INFECTION AND IMMUNITY, vol. 71, no. 12, 2003, pages 6857 - 6863
AGARWAL, MISHRA, J EXP BIOL, vol. 37, 1999, pages 6 - 16
AHMAD, CHAPNICK, INFECT DIS CLIN NORTH AM, vol. 13, 1999, pages 113 - 33
ALMEIDA, ALPAR, J DRUG TARGETING, vol. 3, 1996, pages 455 - 467
ANDERSON ET AL., J CLIN INVEST, vol. 76, no. 1, 1985, pages 52 - 59
ANDERSON, INFECT IMMUN, vol. 39, no. 1, 1983, pages 233 - 238
ANDRIANOV ET AL., BIOMATERIALS, vol. 19, 1998, pages 109 - 115
ANONYMOUS, RESEARCH DISCLOSURE, January 2002 (2002-01-01), pages 453077
APOSTOLOPOULOS, PLEBANSKI, CURR OPIN MOL THER, vol. 2, 2000, pages 441 - 447
BAKER C J ET AL: "Immunization of pregnant women with group B streptococcal type III capsular polysaccharide-tetanus toxoid conjugate vaccine", VACCINE, ELSEVIER LTD, GB, vol. 21, no. 24, 28 July 2003 (2003-07-28), pages 3468 - 3472, XP004436458, ISSN: 0264-410X, DOI: 10.1016/S0264-410X(03)00353-0 *
BAKER CAROL J ET AL: "Safety and immunogenicity of a bivalent group B streptococcal conjugate vaccine for serotypes II and III.", JOURNAL OF INFECTIOUS DISEASES, vol. 188, no. 1, 1 July 2003 (2003-07-01), pages 66 - 73, XP002666912, ISSN: 0022-1899 *
BAKER ET AL., J INFECT DIS, vol. 189, 2004, pages 1103 - 12
BAKER ET AL: "Dose-response to type V group B streptococcal polysaccharide-tetanus toxoid conjugate vaccine in healthy adults", VACCINE, ELSEVIER LTD, GB, vol. 25, no. 1, 8 December 2006 (2006-12-08), pages 55 - 63, XP005797684, ISSN: 0264-410X, DOI: 10.1016/J.VACCINE.2006.07.018 *
BALTIMORE ET AL., J IMMUNOL., vol. 118, no. 2, 1977, pages 673 - 8
BARALDO ET AL., INFECT IMMUN, vol. 72, 2004, pages 4884 - 87
BARINGTON ET AL., INFECT IMMUN, vol. 61, 1993, pages 432 - 438
BARINGTON ET AL., INFECT IMMUN, vol. 62, 1994, pages 9 - 14
BARR ET AL., ADVANCED DRUG DELIVERY REVIEWS, vol. 32, 1998, pages 247 - 271
BAUDNER ET AL., INFECT IMMUN, vol. 70, 2002, pages 4785 - 4790
BEIGNON ET AL., INFECT IMMUN, vol. 70, 2002, pages 3012 - 3019
BELL, PEDIATR INFECT DIS J, vol. 19, 2000, pages 1187 - 1188
BERGQUIST ET AL., APMIS, vol. 106, 1998, pages 800 - 806
BHAGAT ET AL., BBRC, vol. 300, 2003, pages 853 - 861
BJUNE ET AL., LANCET, vol. 338, no. 8775, 1991, pages 1093 - 1096
BLACK STEVEN ET AL: "Efficacy, safety and immunogenicity of heptavalent pneumococcal conjugate vaccine in children", THE PEDIATRIC INFECTIOUS DISEASE JOURNAL, LIPPINCOTT WILLIAMS & WILKINS, US, vol. 19, no. 3, 1 March 2000 (2000-03-01), pages 187 - 195, XP009105189, ISSN: 0891-3668, DOI: 10.1097/00006454-200003000-00003 *
BLACKWELL ET AL., J IMMUNOL, vol. 170, 2003, pages 4061 - 4068
BODANSZKY, PRINCIPLES OFPEPTIDE SYNTHESIS, 1993
BRIGTSEN ET AL., JID, vol. 185, 2002, pages 1277 - 84
BRUSIC ET AL., BIOINFORMATICS, vol. 14, no. 2, 1998, pages 121 - 30
BURRAGE ET AL., INFECT IMMUN, vol. 70, 2002, pages 4946 - 4954
BUTTERY, MOXON, JR COLL PHYSICIANS LOND, vol. 34, 2000, pages 163 - 68
CARTER, METHODS MOL BIOL, vol. 36, 1994, pages 207 - 23
CHAN, WHITE, FMOC SOLID PHASE PEPTIDE SYNTHESIS, 2000
COSTANTINO ET AL., VACCINE, vol. 10, 1992, pages 691 - 698
DAGAN ET AL., INFECT IMMUN, vol. 66, 1998, pages 2093 - 2098
DALE, INFECT DIS CLIN NORTH AM, vol. 13, 1999, pages 227 - 43
DARKES, PLOSKER, PAEDIATR DRUGS, vol. 4, 2002, pages 609 - 630
DAVENPORT ET AL., IMMUNOGENETICS, vol. 42, 1995, pages 392 - 297
DAVIS, MT. SINAI J. MED., vol. 66, 1999, pages 84 - 90
DE LALLA ET AL., J. IMMUNOL., vol. 163, 1999, pages 1725 - 29
DEL GUIDICE ET AL., MOLECULAR ASPECTS OF MEDICINE, vol. 19, 1998, pages 1 - 70
DI JOHN ET AL., LANCET, vol. 2, no. 8677, 1989, pages 1415 - 8
DICK ET AL.: "Conjugate Vaccines", vol. 10, 1989, pages: 48 - 114
DOMENIGHINI ET AL., MOL MICROBIOL, vol. 15, 1995, pages 1165 - 1167
DONNELLY ET AL., AM JRESPIR CRIT CARE MED, vol. 162, 2000, pages 190 - 193
DONNELLY ET AL., ANNU REV IMMUNOL, vol. 15, 1997, pages 617 - 648
DREESEN, VACCINE, vol. 15, 1997, pages 2 - 6
DUBENSKY ET AL., MOL MED, vol. 6, 2000, pages 723 - 732
EVANS ET AL., EXPERT REV VACCINES, vol. 2, 2003, pages 219 - 229
FALUGI ET AL., EUR J ININIUNOL, vol. 31, 2001, pages 3816 - 24
FELLER, DE LA CRUZ, NATURE, vol. 349, no. 6311, 1991, pages 720 - 1
FERRETTI ET AL., PNAS USA, vol. 98, 2001, pages 4658 - 4663
FIELDS ET AL., METH ENZYMOL 289: SOLID-PHASE PEPTIDE SYNTHESIS, vol. 289, 1997
FREY ET AL., VACCINE, vol. 21, 2003, pages 4234 - 7
FUKASAWA ET AL., VACCINE, vol. 17, 1999, pages 2951 - 2958
GENNARO: "Remington: The Science and Practice of Pharmacy. 20th edition,", 2000
GERBER ET AL., VIROL, vol. 75, 2001, pages 4752 - 4760
GERLICH ET AL., VACCINE, vol. 8, 1990, pages 63 - 68,79-80
GEYSEN ET AL., PNAS USA, vol. 81, 1984, pages 3998 - 4002
GLEZEN, ALPERS, CLIN. INFECT. DIS., vol. 28, 1999, pages 219 - 224
GLUCK ET AL., VACCINE, vol. 20, 2002, pages B10 - B16
GOLDBLATT, J. MED. MICROBIOL., vol. 47, 1998, pages 563 - 7
GRANOFF ET AL., JAMA, vol. 272, 1994, pages 1116 - 1121
GRANOFF ET AL., VACCINE SUPPLL, 1993, pages 46 - 51
GUSTAFSSON ET AL., N. ENGL. ./ MED., vol. 334, 1996, pages 349 - 355
GUTTORMSEN ET AL., PROC NATL ACAD SCI U S A., vol. 105, no. 15, 2008, pages 5903 - 8
HENNINGS ET AL., J INFECT DIS, vol. 183, no. 7, 1 March 2001 (2001-03-01), pages 1138 - 42
HERMANSON: "Bioconjugae Techniques", 1996, ACADEMIC PRESS
HERZENBERG ET AL., NATURE, vol. 285, 1980, pages 664 - 667
HOPP, PEPTIDE RESEARCH, vol. 6, 1993, pages 183 - 190
HOPPENBROUWERS ET AL., VACCINE, vol. 17, 1999, pages 2588 - 98
HSU ET AL., CLIN LIVER DIS, vol. 3, 1999, pages 901 - 915
IBBA, BIOTECHNOL GENET ENG REV, vol. 13, 1996, pages 197 - 216
ILAN, CURR OPIN MOL THER, vol. 1, 1999, pages 116 - 120
IWARSON, APMIS, vol. 103, 1995, pages 321 - 326
JAKOBSEN ET AL., INFECT IMMUN, vol. 70, 2002, pages 1443 - 1452
JAMESON, BA ET AL., CABIOS, vol. 4, no. 1, 1988, pages 181 - 186
JEDRZEJAS, MICROBIOL MOL BIOL REV, vol. 65, 2001, pages 187 - 207
JOHNSON ET AL., BIOORG MED CHEM LETT, vol. 9, 1999, pages 2273 - 2278
JOHRI ATUL KUMAR ET AL: "Group B Streptococcus: global incidence and vaccine development", NATURE REVIEWS. MICROBIOLOGY, NATURE PUBLISHING GROUP, GB, vol. 4, no. 12, 1 December 2006 (2006-12-01), pages 932 - 942, XP008095186, ISSN: 1740-1526, DOI: 10.1038/NRMICRO1552 *
JONES, CURR OPIN INVESTIG DRUGS, vol. 2, 2001, pages 47 - 49
JONES, CURR OPIN INVESTIG DRUGS, vol. 4, 2003, pages 214 - 218
KALMAN ET AL., NATURE GENETICS, vol. 21, 1999, pages 385 - 389
KANDIMALLA ET AL., BBRC, vol. 306, 2003, pages 948 - 953
KANDIMALLA ET AL., BIOCHEMICAL SOCIETY TRANSACTIONS, vol. 31, 2003, pages 654 - 658
KANDIMALLA ET AL., NUCLEIC ACIDS RESEARCH, vol. 31, 2003, pages 2393 - 2400
KRIEG, NATURE MEDICINE, vol. 9, 2003, pages 831 - 835
KRIEG, TRENDS IMMUNOL, vol. 23, 2002, pages 64 - 65
KULLMANN, ENZYMATIC PEPTIDE SYNTHESIS, 1987
KUO, INFECT IMMUN, vol. 63, 1995, pages 2706 - 13
KURODA ET AL., LANCET, vol. 357, no. 9264, 2001, pages 1225 - 1240
LEI ET AL., DEV BIOL, vol. 103, 2000, pages 259 - 264
LENZ ET AL., J IMMUNOL, vol. 166, 2001, pages 5346 - 5355
LEWIS ET AL., PNAS USA, vol. 101, 2004, pages 11123 - 8
LIN ET AL., J INFECT DIS., vol. 184, no. 8, 2001, pages 1022 - 8
LIN ET AL., J INFECT DIS., vol. 190, no. 5, 2004, pages 928 - 34
LINDBERG, VACCINE, vol. 17, no. 2, 1999, pages 528 - 36
MADOFF ET AL., J CLIN INVEST, vol. 94, 1994, pages 286 - 92
MAKSYUTOV, ZAGREBELNAYA, COMPUT APPL BIOSCI, vol. 9, no. 3, 1993, pages 291 - 7
MCCLUSKIE ET AL., FEMS IMMUNOLOGY AND MEDICAL MICROBIOLOGY, vol. 32, 2002, pages 179 - 185
MCMICHAEL, VACCINE, vol. 19, no. 1, 2000, pages 101 - 107
MEISTER ET AL., VACCINE, vol. 13, no. 6, 1995, pages 581 - 91
MERALDI ET AL., VACCINE, vol. 21, 2003, pages 2485 - 2491
MICHON ET AL., CLIN VACCINE IMMUNOL., vol. 13, no. 8, August 2006 (2006-08-01), pages 936 - 43
MMWR MORB MORTAL WKLY REP, vol. 47, no. 1, 16 January 1998 (1998-01-16), pages 12,19
NEEDLEMAN, WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 - 453
NIIKURA ET AL., VIROLOGY, vol. 293, 2002, pages 273 - 280
OLANDER ET AL., VACCINE, vol. 20, 2001, pages 336 - 341
PAJAK ET AL., VACCINE, vol. 21, 2003, pages 836 - 842
PALAZZI D L ET AL: "Use of type V group B streptococcal conjugate vaccine in adults 65-85 years old", JOURNAL OF INFECTIOUS DISEASES, UNIVERSITY OF CHICAGO PRESS, CHICAGO, IL, vol. 190, 1 August 2004 (2004-08-01), pages 558 - 564, XP002997497, ISSN: 0022-1899, DOI: 10.1086/422010 *
PAOLETTI ET AL., INFECT IMMUN, vol. 62, 1994, pages 3236 - 43
PAOLETTI ET AL., INFECT INTMUN, vol. 60, 1992, pages 4009 - 14
PAOLETTI ET AL., INFECTION AND IMMUNITY, vol. 69, 2001, pages 6696 - 6701
PAOLETTI ET AL., J BIOL CHEM, vol. 265, 1990, pages 18278 - 83
PAOLETTI ET AL., J CLIN INVEST, vol. 89, 1992, pages 203 - 9
PAOLETTI ET AL., VACCINE, vol. 19, 2001, pages 2118 - 2126
PAOLETTI L C ET AL: "NEONATAL MOUSE PROTECTION AGAINST INFECTION WITH MULTIPLE GROUP B STREPTOCOCCAL (GBS) SEROTYPES BY MATERNAL IMMUNIZATION WITH A TETRAVALENT GBS POLYSACCHARIDE-TETANUS TOXOID CONJUGATE VACCINE", INFECTION AND IMMUNITY, AMERICAN SOCIETY FOR MICROBIOLOGY, WASHINGTON, US, vol. 62, no. 8, 1 August 1994 (1994-08-01), pages 3236 - 3243, XP001148813, ISSN: 0019-9567 *
PAOLETTI, KASPER, EXPERT OPIN BIOL THER, vol. 3, 2003, pages 975 - 84
PAOLETTI, VACCINE, vol. 19, no. 15-16, 2001, pages 2118 - 26
PARTIDOS ET AL., IMMUNOL LETT, vol. 67, 1999, pages 209 - 216
PAYNE ET AL., ADV DRUG DELIVERY REVIEW, vol. 31, 1998, pages 185 - 196
PEPPOLONI ET AL., EXPERT REV. VACCINES, vol. 2, 2003, pages 285 - 293
PINE ET AL., J CONTROL RELEASE, vol. 85, 2002, pages 263 - 270
PINTO ET AL., JINFECT DIS, vol. 188, 2003, pages 327 - 338
PIZZA ET AL., INT J MED MICROBIOL, vol. 290, 2000, pages 455 - 461
PIZZA ET AL., SCIENCE, vol. 287, 2000, pages 1816 - 1820
PIZZA ET AL., VACCINE, vol. 19, 2001, pages 2534 - 2541
PLOTKIN & ORENSTEIN: "Vaccines", 2004
PODDA ET AL., VACCINE, vol. 9, 1991, pages 741 - 745
PODDA, VACCINE, vol. 19, 2001, pages 2673 - 80
POWELL & NEWMAN: "Vaccine Design.", 1995, PLENUM
RADDRIZZANI, HAMMER, BRIEF BIOINFORM, vol. 1, no. 2, 2000, pages 179 - 89
RAMSAY ET AL., LANCET, vol. 357, no. 9251, 2001, pages 195 - 196
RAPPUOLI ET AL., TIBTECH, vol. 9, 1991, pages 232 - 238
READ ET AL., NUCLEIC ACIDS RES, vol. 28, 2000, pages 1397 - 406
RICE ET AL., TRENDS GENET, vol. 16, 2000, pages 276 - 277
ROBERTS ET AL., AIDS RES HUM RETROVIRUSES, vol. 12, no. 7, 1996, pages 593 - 610
ROBINSON, PERTMER, ADV VIRUS RES, vol. 55, 2000, pages 1 - 74
ROBINSON, TORRES, SEMINARS IN IMMUNOLOGY, vol. 9, 1997, pages 271 - 283
RODEWALD ET AL., JINFECT DIS., vol. 166, no. 3, 1992, pages 635 - 9
ROSENQVIST ET AL., DEV. BIOL. STAND., vol. 92, 1998, pages 323 - 333
ROSS ET AL., VACCINE, vol. 19, 2001, pages 4135 - 4142
RUBIN, PEDIATR CLIN NORTH AM, vol. 47, 2000, pages 269 - 285
RYAN ET AL., INFECT IMMUN, vol. 67, 1999, pages 6270 - 6280
SCHARTON-KERSTEN ET AL., INFECT IMMUN, vol. 68, 2000, pages 5306 - 5313
SCHUTZE ET AL., J IMMUNOL, vol. 135, 1985, pages 2319 - 2322
SCOTT-TAYLOR, DALGLEISH, EXPERT OPIN INVESTIG DRUGS, vol. 9, 2000, pages 471 - 480
SHIRAI ET AL., J. INFECT. DIS., vol. 181, no. 3, 2000, pages S524 - S527
SINGH ET AL., J CONT RELEASE, vol. 70, 2001, pages 267 - 276
SJOLANDERET ET AL., ADVANCED DRUG DELIVERY REVIEWS, vol. 32, 1998, pages 321 - 338
STANLEY, CLIN EXP DERMATOL, vol. 27, 2002, pages 571 - 577
SUTTER ET AL., PEDIATR CLIN NORTH AM, vol. 47, 2000, pages 287 - 308
TETTELIN ET AL., SCIENCE, vol. 287, 2000, pages 1809 - 1815
UGOZZOLI ET AL., J INFECT DIS, vol. 186, 2002, pages 1358 - 1361
WANG ET AL., VACCINE, vol. 21, 2003, pages 1112 - 7
WATSON, PEDIATR INFECT DIS J, vol. 19, 2000, pages 331 - 332
WELLING ET AL., FEBS LETT., vol. 188, 1985, pages 215 - 218
WESSELS ET AL., INFECT IMMUN, vol. 57, 1989, pages 1089 - 94
WESSELS ET AL., INFECT IMMUN, vol. 61, 1993, pages 4760 - 6
WESSELS ET AL., J CLIN INVEST, vol. 86, 1990, pages 1428 - 33
WESSELS ET AL., J INFECT DIS, vol. 171, 1995, pages 879 - 84
WESSELS ET AL., PROC NATL ACAD SCI USA, vol. 84, 1987, pages 9170 - 4
ZIMMERMAN, SPANN, AM FAM PHYSICIAN, vol. 59, 1999, pages 113 - 118,125-126

Cited By (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11116829B2 (en) 2001-10-11 2021-09-14 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US10300122B2 (en) 2001-10-11 2019-05-28 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US9623101B2 (en) 2001-10-11 2017-04-18 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US9757444B2 (en) 2001-10-11 2017-09-12 Wyeth Holdings Llc Immunogenic compositions for the prevention and treatment of meningococcal disease
US9556240B2 (en) 2010-08-23 2017-01-31 Wyeth Llc Stable formulations of Neisseria meningitidis rLP2086 antigens
US11077180B2 (en) 2010-09-10 2021-08-03 Wyeth Llc Non-lipidated variants of Neisseria meningitidis ORF2086 antigens
US10512681B2 (en) 2010-09-10 2019-12-24 Wyeth Llc Non-lipidated variants of Neisseria meningitidis ORF2086 antigens
US9757443B2 (en) 2010-09-10 2017-09-12 Wyeth Llc Non-lipidated variants of Neisseria meningitidis ORF2086 antigens
US9562894B2 (en) 2011-12-12 2017-02-07 Glaxosmithkline Biologicals Sa Method of detecting the presence of an antibody in a sample
WO2013088378A3 (en) * 2011-12-12 2014-05-01 Novartis Ag Method of detecting the presence of an antibody in a sample
US10196429B2 (en) 2012-03-09 2019-02-05 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US10829521B2 (en) 2012-03-09 2020-11-10 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US8986710B2 (en) 2012-03-09 2015-03-24 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US9724402B2 (en) 2012-03-09 2017-08-08 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US10550159B2 (en) 2012-03-09 2020-02-04 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US11472850B2 (en) 2012-03-09 2022-10-18 Pfizer Inc. Neisseria meningitidis composition and methods thereof
US9561269B2 (en) 2012-03-09 2017-02-07 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
JP2015512441A (en) * 2012-04-04 2015-04-27 ヴァックスフォーム エルエルシーVaxform Llc Improved adjuvant system for oral vaccine administration
JP2015531390A (en) * 2012-10-03 2015-11-02 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム Immunogenic composition
EP3482770B1 (en) 2012-10-03 2020-11-25 GlaxoSmithKline Biologicals S.A. Immunogenic compositions
EP2903638B1 (en) 2012-10-03 2019-12-18 GlaxoSmithKline Biologicals SA Immunogenic composition
WO2014053612A1 (en) 2012-10-03 2014-04-10 Novartis Ag Immunogenic composition
EP3482770A1 (en) 2012-10-03 2019-05-15 GlaxoSmithKline Biologicals S.A. Immunogenic compositions
US10286055B2 (en) 2012-10-03 2019-05-14 Glaxosmithkline Biologicals Sa Immunogenic composition
CN104582718A (en) * 2012-10-03 2015-04-29 诺华股份有限公司 Immunogenic compositions
CN104717977A (en) * 2012-10-03 2015-06-17 诺华股份有限公司 Immunogenic composition
US9855324B2 (en) 2012-10-03 2018-01-02 Glaxosmithkline Biologicals Sa Immunogenic compositions
US9855325B2 (en) * 2012-10-03 2018-01-02 Glaxosmithkline Biologicals Sa Immunogenic composition
JP2015531389A (en) * 2012-10-03 2015-11-02 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム Immunogenic composition
US20150224185A1 (en) * 2012-10-03 2015-08-13 Novartis Ag Immunogenic compositions
AU2013326503B2 (en) * 2012-10-03 2018-04-19 Glaxosmithkline Biologicals Sa Immunogenic composition
EP2903636B1 (en) 2012-10-03 2018-07-18 GlaxoSmithKline Biologicals S.A. Immunogenic compositions
WO2014053607A1 (en) 2012-10-03 2014-04-10 Novartis Ag Immunogenic compositions
US11135300B2 (en) 2013-01-15 2021-10-05 Glaxosmithkline Biologicals Sa Cycloalkyne derivatized saccharides
WO2014111344A1 (en) * 2013-01-15 2014-07-24 Novartis Ag Cycloalkyne derivatized saccharides
CN105377282A (en) * 2013-01-15 2016-03-02 葛兰素史密丝克莱恩生物有限公司 Cycloalkyne derivatized saccharides
US9802987B2 (en) 2013-03-08 2017-10-31 Pfizer Inc. Immunogenic fusion polypeptides
US10899802B2 (en) 2013-09-08 2021-01-26 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US9822150B2 (en) 2013-09-08 2017-11-21 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US11680087B2 (en) 2013-09-08 2023-06-20 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
EP3034516A1 (en) 2014-12-19 2016-06-22 Novartis AG Purification of streptococcal capsular polysaccharide
WO2016097147A1 (en) 2014-12-19 2016-06-23 Glaxosmithkline Biologicals Sa Purification of streptococcal capsular polysaccharide
US10888611B2 (en) 2015-02-19 2021-01-12 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US10946086B2 (en) 2015-05-04 2021-03-16 Pfizer Inc. Group B Streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof
US10226525B2 (en) 2015-05-04 2019-03-12 Pfizer Inc. Group B Streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof
WO2016178123A1 (en) 2015-05-04 2016-11-10 Pfizer Inc. Group b streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof
WO2017001586A1 (en) * 2015-07-01 2017-01-05 Glaxosmithkline Biologicals S.A. Immunogenic compositions
BE1024282B1 (en) * 2015-07-01 2018-01-15 Glaxosmithkline Biologicals Sa IMMUNOGENIC COMPOSITIONS
CN107847578A (en) * 2015-07-01 2018-03-27 葛兰素史密丝克莱恩生物有限公司 Immunogenic composition
CN108289944A (en) * 2015-10-07 2018-07-17 勃林格殷格翰动物保健公司 Multivalence Streptococcus suis polysaccharide-protein conjugate composition
WO2017062558A1 (en) * 2015-10-07 2017-04-13 Boehringer Ingelheim Vetmedica, Inc. Streptococcus suis polysaccharide-protein conjugate composition
WO2018087635A1 (en) 2016-11-09 2018-05-17 Pfizer Inc. Immunogenic polysaccharide protein conjugated comprising a polysaccharide derived from b streptococcus gbs
US10751402B2 (en) 2016-11-09 2020-08-25 Pfizer Inc. Immunogenic compositions and uses thereof
RU2791468C2 (en) * 2016-11-09 2023-03-09 Пфайзер Инк. Immunogenic polysaccharide-protein conjugates containing a polysaccharide derived from group b streptococcus
US12016913B2 (en) 2016-11-09 2024-06-25 Pfizer Inc. Immunogenic compositions and uses thereof
US11147865B2 (en) 2016-11-09 2021-10-19 Pfizer Inc. Immunogenic compositions and uses thereof
US10813989B2 (en) 2017-01-31 2020-10-27 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US10183070B2 (en) 2017-01-31 2019-01-22 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US10543267B2 (en) 2017-01-31 2020-01-28 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
US11730800B2 (en) 2017-01-31 2023-08-22 Pfizer Inc. Neisseria meningitidis compositions and methods thereof
WO2018229708A1 (en) 2017-06-16 2018-12-20 Glaxosmithkline Biologicals Sa Method of treatment
US11759510B2 (en) 2017-09-07 2023-09-19 Merck, Sharp & Dohme LLC Pneumococcal polysaccharides and their use in immunogenic polysaccharide-carrier protein conjugates
US11759511B2 (en) 2017-09-07 2023-09-19 Merck Sharp & Dohme Llc Pneumococcal polysaccharides and their use in immunogenic polysaccharide-carrier protein conjugates
RU2801288C2 (en) * 2017-09-07 2023-08-07 МЕРК ШАРП И ДОУМ ЭлЭлСи Pneumococcal polysaccharides and their use in polysaccharide-protein-carrier immunogenic conjugates
WO2020229964A1 (en) 2019-05-10 2020-11-19 Glaxosmithkline Biologicals Sa Conjugate production
WO2021099982A1 (en) 2019-11-22 2021-05-27 Glaxosmithkline Biologicals Sa Dosage and administration of a bacterial saccharide glycoconjugate vaccine
WO2021250625A2 (en) 2020-06-12 2021-12-16 Glaxosmithkline Biologicals Sa Gbs ferritin nanoparticles
WO2021250628A1 (en) 2020-06-12 2021-12-16 Glaxosmithkline Biologicals Sa Bacterial immunization using nanoparticle vaccine
WO2021250626A2 (en) 2020-06-12 2021-12-16 Glaxosmithkline Biologicals Sa Dock tag system
WO2022043855A1 (en) 2020-08-26 2022-03-03 Pfizer Inc. Group b streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof
WO2023111826A1 (en) 2021-12-14 2023-06-22 Glaxosmithkline Biologicals Sa Bacterial immunization using qbeta hairpin nanoparticle constructs

Also Published As

Publication number Publication date
CA2811305C (en) 2019-02-26
US20180036402A1 (en) 2018-02-08
CA2811305A1 (en) 2012-03-22
ES2677358T3 (en) 2018-08-01
EP2616099B1 (en) 2018-05-30
GB201101665D0 (en) 2011-03-16
EP2616099A1 (en) 2013-07-24
SG188499A1 (en) 2013-04-30
JP2013538228A (en) 2013-10-10
KR20130098362A (en) 2013-09-04
CN103209708B (en) 2017-08-22
TR201811681T4 (en) 2018-09-21
AU2011303478A1 (en) 2013-04-04
BR112013006396A2 (en) 2017-07-25
CN103209708A (en) 2013-07-17
RU2608905C2 (en) 2017-01-26
US20130273091A1 (en) 2013-10-17
US20150283232A1 (en) 2015-10-08
RU2013117082A (en) 2014-10-27
AU2011303478B2 (en) 2014-07-24
JP6093302B2 (en) 2017-03-08

Similar Documents

Publication Publication Date Title
AU2011303478B2 (en) Immunogenic compositions
US10188719B2 (en) Conjugation of Streptococcal capsular saccharides
US10286055B2 (en) Immunogenic composition
US20180153983A1 (en) Conjugation of staphylococcus aureus type 5 and type 8 capsular polysaccharides
AU2013202983A1 (en) Immunogenic compositions
JP2016029103A (en) Immunogenic composition

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11768149

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 225097

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2811305

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2013/002841

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2013528820

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2011303478

Country of ref document: AU

Date of ref document: 20110916

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20137009242

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2011768149

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2013117082

Country of ref document: RU

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 13824041

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013006396

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112013006396

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20130318