WO2010138740A1 - Inhibition 0f inflammation using antagonists of muc1 - Google Patents
Inhibition 0f inflammation using antagonists of muc1 Download PDFInfo
- Publication number
- WO2010138740A1 WO2010138740A1 PCT/US2010/036436 US2010036436W WO2010138740A1 WO 2010138740 A1 WO2010138740 A1 WO 2010138740A1 US 2010036436 W US2010036436 W US 2010036436W WO 2010138740 A1 WO2010138740 A1 WO 2010138740A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- mucl
- peptide
- residues
- consecutive
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- A61K38/1735—Mucins, e.g. human intestinal mucin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4727—Mucins, e.g. human intestinal mucin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/23—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a GST-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
Definitions
- This invention relates to regulation of inflammatory signaling.
- MUCl peptides derived from a particular region of the MUCl cytoplasmic domain have been shown to inhibit MUCl interaction with NF- ⁇ B, and thus inhibit NF- ⁇ B-mediated inflammatory signaling.
- similar effects against STAT3 -mediated inflammatory signaling have been demonstrated.
- NF- ⁇ B proteins (RelA/p65, ReIB, c-Rel, NF- ⁇ Bl/p50 and NF- ⁇ B2/p52) are ubiquitously expressed transcription factors.
- NF- ⁇ B proteins localize to the cytoplasm in complexes with I ⁇ B ⁇ and other members of the IKB family of inhibitor proteins (Hayden & Ghosh, 2008).
- Phosphorylation of I ⁇ B ⁇ by the high molecular weight IKB kinase (IKK ⁇ , IKK ⁇ , IKK ⁇ ) complex induces ubiquitination and degradation of I ⁇ B ⁇ and thereby release of NF -KB for nuclear translocation.
- NF- ⁇ B p65 contains an N-terminal ReI homology domain (RHD) that is responsible for dimerization and DNA binding.
- RHD N-terminal ReI homology domain
- the RHD also functions as a binding site for ankyrin repeats in the I ⁇ B ⁇ protein, which blocks the NF- ⁇ B p65 nuclear localization signal (NLS).
- NLS nuclear localization signal
- NF- ⁇ B pathway for example in the cellular response to tumor necrosis ⁇ (TNF ⁇ ), induces IKK ⁇ -mediated phosphorylation of I ⁇ B ⁇ and its degradation, with a shift in the balance of NF- ⁇ B p65 to the nucleus.
- the nuclear NF- ⁇ B dimers engage KB consensus sequences, as well as degenerate variants, in promoter and enhancer regions (Hoffman et al., 2006; Gilmore, 2008).
- Activation of NF- ⁇ B target genes is then further regulated by posttranslational modification of NF- ⁇ B p65 and its interaction with transcriptional coactivators (Hayden & Ghosh, 2008).
- One of the many NF- ⁇ B target genes is IKB a, the activation of which results in de novo synthesis of I ⁇ B ⁇ and termination of the NF -KB transcriptional response.
- Mucins are extensively O-glycosylated proteins that are predominantly expressed by epithelial cells.
- the secreted and membrane -bound mucins form a physical barrier that protects the apical borders of epithelial cells from damage induced by toxins, microorganisms and other forms of stress that occur at the interface with the external environment.
- the transmembrane mucin 1 (MUCl) can also signal to the interior of the cell through its cytoplasmic domain.
- MUCl has no sequence similarity with other membrane-bound mucins, except for the presence of a sea urchin sperm protein-enterokinase-agrin (SEA) domain (Duraisamy et al, 2006). In that regard, MUCl is translated as a single polypeptide and then undergoes autocleavage at the SEA domain JBC, 1992; Macao, 2006).
- SEA sea urchin sperm protein-enterokinase-agrin
- the transmembrane MUCl C-terminal subunit functions as a receptor (Ramasamy et al, 2007) and contains a 72-amino acid cytoplasmic domain (MUCl-CD) that is sufficient for inducing transformation (Huang et al., 2005).
- MUCl-C subunit is also targeted to the nucleus by a process dependent on its oligomerization (Leng et al., 2007).
- MUCl-CD functions as a substrate for phosphorylation by the epidermal growth factor receptor (Li et al.
- MUCl-CD also stabilizes the Wnt effector, ⁇ - catenin, through a direct interaction and thereby contributes to transformation (Huang et al. , 2005). Other studies have demonstrated that MUCl-CD interacts directly with IKK ⁇ and IKK ⁇ , and contributes to activation of the IKK complex (Ahmad et al., 2007).
- STAT3 transcription factor was identified as an effector of the interleukin-6 (IL-6) inflammatory response (Wegenka, 1994).
- STAT3 is activated by Janus-activated kinase (JAK)-I phosphorylation of the IL-6 receptor, recuitment of STAT3 and then phosphorylation of STAT3 on a conserved tyrosine at position 705 (Yu and Jove, 2004).
- Activation of the epidermal growth factor receptor is also associated with direct phosphorylation of STAT3 on Tyr-705.
- phosphorylated STAT3 undergoes dimerization, translocates to the nucleus and induces activation of STAT3 target genes, which encode regulators of cell cycle progression (cyclin Dl and c-Myc) and inhibitors of apoptosis (survivin and Bcl-xL) (Alvarez, 2005; Alvarez, 2006).
- STAT3 target genes encode regulators of cell cycle progression (cyclin Dl and c-Myc) and inhibitors of apoptosis (survivin and Bcl-xL) (Alvarez, 2005; Alvarez, 2006).
- Activated STAT3 induces transformation (Bromberg, 1999).
- STAT3 activation has been detected in diverse carcinomas and hematologic malignancies (Aaronson and Horvath, 2002; Bowman, 2000; Yu and Jove, 2004), consistent with involvement of STAT3 in the transcription of genes that control growth and survival.
- small molecule inhibitors of the JAK-I ⁇ ST AT3 pathway have anti-cancer activity in vitro and in animal models (Song, 2005; Siddiquee, 2007; Ahmad, 2008; Germain and Frank, 2007).
- aptamers that block EGFR signaling to STAT3 inhibit growth of malignant epithelial and hematologic cells (Buerger, 2003).
- a method of inhibiting inflammatory signaling in a MUCl -expressing cell comprising contacting the cell with a MUCl peptide of at least 4 consecutive MUCl residues and no more than 20 consecutive MUCl residues and comprising the sequence CQC, wherein the amino-terminal cysteine of CQC is covered on its NH 2 -terminus by at least one amino acid residue that need not correspond to the native MUC-I transmembrane sequence.
- the peptide may comprise at least 5, 6 or 7 consecutive MUCl residues, and the sequence may more specifically comprise CQCR (SEQ ID NO:54), CQCRR (SEQ ID NO:50), CQCRRR (SEQ ID NO:51), CQCRRRR (SEQ ID NO:52), CQCRRK (SEQ ID NO:4), or CQCRRKN (SEQ ID NO:53).
- the peptide may contain no more than 10 consecutive residues, 11 consecutive residues, 12 consecutive residues, 13 consecutive residues, 14 consecutive residues, 15 consecutive residues, 16 consecutive residues, 17 consecutive residues, 18 consecutive residues or 19 consecutive residues of MUCl.
- the MUCl -positive cell may be a tumor cell, an endothelial cell or an inflammatory cell, such as a macrophage, a B cell, at T cell, a dendritic cell, a myeloid-derived suppressor cell, an NK cell or a neutrophil.
- the peptide may be fused to a cell delivery domain, such as poly-D-R, poly-D-P or poly-D-K.
- the method may further comprise contacting the cell with a second anti-inflammatory agent, such as a steroid or a COX-2 inhibitor.
- the second antiinflammatory agent may be contacted prior to, after, or at the same time as the peptide.
- the peptide may comprise all L amino acids, all D amino acids or a mix of L and D amino acids.
- the inflammatory signaling may comprise NF- ⁇ B-mediated signaling or STAT-mediated signaling, such as STAT3 -mediated signaling.
- the NF- ⁇ B-mediated signaling inflammatory signaling may comprise NF -KB activation of a target gene selected from the group consisting of Bcl-xL and MUCl .
- the ST AT3 -mediated inflammatory signaling may comprise STAT3 activation of a target gene selected from the group consisting of Cy din Dl, survivin, Idpl, Idp2, CdknlC, Lefty 1, Mest, Aesl, Zfp57, Zfp3611, Sh3bpl, Ccnd3 and MUCl.
- a target gene selected from the group consisting of Cy din Dl, survivin, Idpl, Idp2, CdknlC, Lefty 1, Mest, Aesl, Zfp57, Zfp3611, Sh3bpl, Ccnd3 and MUCl.
- a method of inhibiting MUC 1 binding to NF -KB or a STAT comprising in a MUCl -expressing cell comprising contacting the cell with a MUCl peptide of at least 4 consecutive MUCl residues and no more than 20 consecutive MUCl residues and comprising the sequence CQC, wherein the amino-terminal cysteine of CQC is covered on its NH2-terminus by at least one amino acid residue that need not correspond to the native MUCl transmembrane sequence.
- a method of inhibiting MUCl competition with I ⁇ B ⁇ for binding to NF- ⁇ B in a MUCl -expressing cell comprising contacting the cell with a MUC 1 peptide of at least 4 consecutive MUC 1 residues and no more than 20 consecutive MUCl residues and comprising the sequence CQC, wherein the amino-terminal cysteine of CQC is covered on its NH2-terminus by at least one amino acid residue that need not correspond to the native MUCl transmembrane sequence.
- a method of inhibiting MUCl- induced nuclear translocation of NF- ⁇ B in a MUCl -expressing cell comprising contacting the cell with a MUCl peptide of at least 4 consecutive MUCl residues and no more than 20 consecutive MUCl residues and comprising the sequence CQC, wherein the amino-terminal cysteine of CQC is covered on its NH 2 -terminus by at least one amino acid residue that need not correspond to the native MUCl transmembrane sequence.
- a method of inhibiting an inflammatory response in a subject comprising administering to the subject a MUCl peptide of at least 4 consecutive MUCl residues and no more than 20 consecutive MUCl residues and comprising the sequence CQC (SEQ ID NO:4), wherein the amino-terminal cysteine of CQC is covered on its NH2-terminus by at least one amino acid residue that need not correspond to the native MUC-I transmembrane sequence.
- the peptide may comprise at least 5, 6 or 7 consecutive MUCl residues, and the sequence may more particularly comprise CQCR, CQCRR, CQCRRR, CQCRRRR, CQCRRK, or CQCRRKN.
- the peptide may contain no more than 10 consecutive residues, 11 consecutive residues, 12 consecutive residues, 13 consecutive residues, 14 consecutive residues, 15 consecutive residues, 16 consecutive residues, 17 consecutive residues, 18 consecutive residues or 19 consecutive residues of MUCl.
- the inflammatory response may be caused by NF- ⁇ B-mediated signaling or STAT- mediated signaling, such as STAT3 -mediate signaling.
- the peptide may be fused to a cell delivery domain, such as poly-D-R, poly-D-P or poly-D-K.
- Administering may comprise intravenous, intra-arterial, oral, intratumoral, subcutaneous, topical or intraperitoneal administration, or local, regional, systemic, or continual administration.
- Inhibiting may comprise inhibition or resolution of the inflammatory response.
- the method may further comprise administering to the subject a second anti-inflammatory therapy, such as a steroid or a COX2 inhibitor.
- the second anti-inflammatory therapy may be administered prior to, after or at the same time as the peptide.
- the subject may be a human.
- the peptide may be administered at 0.1-500 mg/kg/d, or more specifically, at 10-100 mg/kg/d.
- the peptide my be administered daily, such as for 7 days, 2 weeks, 3 weeks, 4 weeks, one month, 6 weeks, 8 weeks, two months, 12 weeks, or 3 months.
- the peptide may be administered weekly, such as for 2 weeks, 3 weeks, 4 weeks, 6 weeks, 8 weeks, 10 weeks, or 12 weeks.
- the peptide may comprise all L amino acids, all D amino acids or a mix of L and D amino acids.
- a pharmaceutical composition comprising (i) a MUCl peptide of at least 4 consecutive MUCl residues and no more than 20 consecutive MUCl residues and comprising the sequence CQC, wherein the amino-terminal cysteine of CQC is covered on its NH 2 -terminus by at least one amino acid residue that need not correspond to the native MUC-I transmembrane sequence; and (ii) a second anti- inflammatory agent other than (i).
- the second anti-inflammatory agent a steroid or COX-2 inhibitor.
- FIGS. IA-D MUCl-C associates with NF- ⁇ B p65.
- FIGS. IA-C Lysates from the indicated cells were immunoprecipitated with anti-p65 or a control IgG. The precipitates were immunoblotted with anti-MUCl-C and anti-p65.
- FIG. ID Lysates from ZR-75-1 cells were incubated with GST or GST-MUCl-CD bound to glutathione beads. The adsorbates were immunoblotted with anti-p65. Input of the GST proteins was assessed by Coomassie blue staining.
- FIGS. 2A-D MUCl attenuates binding of I ⁇ B ⁇ and NF- ⁇ B p65.
- FIGS. 2A-C Cytosolic lysates from the indicated ZR-75- I/vector, ZR-75-1 /MUC lsiRNA (FIG. 2A), HeLa/vector, HeLa/MUCl (FIG. 2B), 3Yl/vector and 3Y1/MUC1-CD (FIG. 2C) cells were immunoprecipitates with anti-p65 or a control IgG. The precipitates were immunoblotted with antibodies against I ⁇ B ⁇ and p65. (FIG.
- FIGS. 3A-D MUCl-C promotes occupancy of NF- ⁇ B p65 on the Bcl-xL gene promoter.
- FIG. 3A ZR-75-1 /vector and ZR-75-l/MUClsiRNA cells were fixed and double stained with anti-MUCl-C (green) and anti-NF- ⁇ B p65 (red). Nuclei were stained with TO-PRO-3.
- FIGS. 3B and 3C Soluble chromatin from ZR-75-1 /vector, ZR-75- 1/MUCl siRNA (FIG. 3B), HeLa/vector and HeLa/MUCl (FIG.
- FIGS. 4A-D MUCl-C interacts with NF- ⁇ B p65 in the response of MCF-IOA cells to TNF ⁇ .
- FIG. 4A MCF-IOA cells were stimulated with 20 ng/ml TNF ⁇ for the indicated times. Lysates were immunoblotted with anti-MUCl-C and anti- ⁇ -actin.
- FIG. 4B Lysates from MCF-IOA cells left untreated or stimulated with 20 ng/ml TNF ⁇ for 24 h were subjected to immunoprecipitation with anti-p65 or a control IgG. The precipitates were immunoblotted with the indicated antibodies.
- FIG. 4A MCF-IOA cells were stimulated with 20 ng/ml TNF ⁇ for the indicated times. Lysates were immunoblotted with anti-MUCl-C and anti- ⁇ -actin.
- FIG. 4B Lysates from MCF-IOA cells left untreated or stimulated with 20 ng/ml TNF ⁇ for 24 h
- FIGS. 5A-D MUCl-C promotes NF- ⁇ B p65-mediated activation of the MUCl promoters.
- FIGS. 5 A and 5B MCF-IOA cells were transfected with control or p65 siRNA pools for 72 h. The transfected cells were left untreated or stimulated with TNF ⁇ for 24 h. Lysates were immunoblotted with the indicated antibodies (FIG. 5A). The cells were then transfected to express a NF- ⁇ B-Luc reporter or a MUCl promoter-Luc reporter (pMUCl-Luc) and, as a control, the SV-40-Renilla-Luc plasmid (FIG. 5B). (FIG.
- MCF-IOA cells were transfected with control or MUCl siRNA pools for 72 h.
- the transfected cells were left untreated or stimulated with TNF ⁇ for 24 h. Lysates were immunoblotted with the indicated antibodies (FIG. 5C).
- the cells were then transfected to express a NF- ⁇ B-Luc reporter or a MUCl promoter-Luc reporter (pMUCl-Luc) and, as a control, the SV-40-Renilla-Luc plasmid (FIG. 5D). Luciferase activity was measured at 48 h after transfection. The results are expressed as the fold-activation (mean + SD from three separate experiments) compared to that obtained with cells transfected with the control siRNA and left untreated (assigned a value of 1).
- FIGS. 6A-D MUC1/CQC peptide blocks the interaction between MUCl and NF-KB p65.
- FIG. 6A Sequence of the MUC1/CQC (GO-201) and MUC1/AQA (CP-I) peptides with the poly-dArg transduction domain.
- GST-MUCl-CD was incubated with purified NF- ⁇ B p65 in the presence of MUC1/CQC or MUC1/AQA for 1 h at room temperature. Adsorbates to glutathione beads were immunoblotted with anti-p65 (left).
- MCF-IOA cells were left untreated or stimulated with TNF ⁇ in the presence of 5 ⁇ M MUC1/CQC or MUC1/AQA peptide added each 24 h for 72 h. Anti-p65 precipitates were immunoblotted with the indicated antibodies (right).
- FIGS. 6B and 6C MCF-IOA cells were left untreated or stimulated with TNF ⁇ in the presence of 5 ⁇ M MUC1/CQC or MUCl /AQA peptide added each 24 h for 72 h. Soluble chromatin was precipitated with anti-MUCl-C (left) or anti-p65 (right) and then analyzed for MUCl NF -KB binding motif promoter sequences (FIG. 6B).
- FIG. 6C Lysates were immunoblotted with the indicated antibodies.
- FIG. 6D Model for the proposed effects of MUCl-C on activation of the NF- KB pathway through interactions with IKKs and p65 in an auto-inductive regulatory loop.
- FIGS. 7A-E MUCl-C cytoplasmic domain binds to NF- ⁇ B p65 and to the p65 RHD.
- FIGS. 7A-B Lysates from the indicated cells were immunoprecipitated with anti- p65 or a control IgG. The precipitates were immunoblotted with anti-MUCl-C and anti- p65.
- FIG. 7C Lysates from ZR-75-1 cells were incubated with GST or GST-MUCl-CD bound to glutathione beads. The adsorbates were immunoblotted with anti-p65. Input of the GST proteins was assessed by Coomassie blue staining.
- FIG. 8 Silencing of MUCl in ZR-75-1 breast cancer cells.
- the BLOCK-iT Target Screening System (Invitrogen) was used to generate small interfering RNAs (siRNA) that target the MUCl sequence (AAGTTC AGTGCCC AGCTCT AC (SEQ ID NO:55)) and a control sequence (CGCTTACCGATTCAGAATGG (SEQ ID NO:56)).
- the siRNA cassettes were used for the generation of lentiviruses as described (Kawano et al, 2007).
- the ZR-75-1 cells were infected with the lentiviruses at a multiplicity of infection of 5 in the presence of polybrene (Sigma). Cell clones were selected for expression of EGFP. Lysates were subjected to immunob lotting with the indicated antibodies.
- FIGS. 9A-D MUCl-C binds directly to the STAT3 DBD.
- FIG. 9A Lysates from ZR-75-1 (left) and MCF-7 (right) cells were subjected to immunoprecipitation with anti- STAT3 or a control IgG. The precipitates were immunob lotted with the indicated antibodies.
- FIG. 9B Lysates from ZR-75-1 cells were incubated with GST and GST- MUCl-CD bound to glutathione beads. The adsorbates were immunob lotted with anti- STAT3 Input of the GST and GST-MUCl-CD proteins was assessed by Coomassie blue staining.
- GST, GST-STAT3 (full length; amino acids 1- 770), GST-MUCl-CD (N-terminal: amino acids 1-257), GST-MUCl-CD (DBD; amino acids 257-514) and GST-MUCl-CD (C-terminal; amino acids 514-770) bound to glutathione beads were incubated with purified MUCl-CD. Adsorbates were immunoblotted with anti-MUCl-C. Input of the GST and GST-STAT3 fusion proteins was assessed by Coomassie blue staining.
- FIGS. 10A-D MUCl-C associates with the STAT3 transcription complex.
- FIGS. 10A-B Schema of the MUCl promoter region with positioning of the STAT binding site (SBS). Soluble chromatin from ZR-75-1 (FIG. 10A) and MCF-7 (FIG. 10B) cells was immunoprecipitated with anti-STAT3 (left) and anti-MUCl-C (right). The final DNA extractions were amplified by PCR with pairs of primers that cover the STAT binding site (SBS; -689 to -414) and the control region (CR; +4524 to +4745 in the MUCl promoter. (FIGS.
- Soluble chromatin from the indicated cells was precipitated with anti- STAT3 and analyzed for MUCl promoter SBS and CR sequences.
- anti-STAT3 precipitates were released, reimmunoprecipitated with anti- MUCl-C and then analyzed for MUCl promoter sequences.
- FIGS. HA-D MUCl-C interacts with STAT3 in the response of MCF-IOA cells to IL-6.
- FIG. HA MCF-IOA cells were stimulated with IL-6 for the indicated times. Whole cell lysates (left) and nuclear lysates (right) were immunoblotted with the indicated antibodies.
- FIG. HB MCF-IOA cells were stimulated with IL-6 for 24 h. Lysates were immunoprecipitated with anti-STAT3 and a control IgG. The precipitates were immunoblotted with the indicated antibodies.
- FIGS. HA-D MUCl-C interacts with STAT3 in the response of MCF-IOA cells to IL-6.
- FIGS. HA-D MCF-IOA cells were stimulated with IL-6 for the indicated times. Whole cell lysates (left) and nuclear lysates (right) were immunoblotted with the indicated antibodies.
- FIG. HB MCF-IOA cells were stimulated with IL-6
- FIGS. 12A-D Activation of the MUCl promoter by IL-6 is mediated by STAT3.
- MCF-IOA cells were transfected with control or STAT3 siRNA pools for 72 h. The transfected cells were then left untreated or stimulated with IL-6 for 24 h. Lysates were immunoblotted with the indicated antibodies (FIG. 12A). The cells were then transfected to express a MUCl promoter-Luc reporter (pMUCl-Luc) and the Renilla-Luc plasmid. Luciferase activity was measured at 48 h after transfection (FIG. 12B).
- results are expressed as the fold-activation (mean+SD from three separate experiments) compared to that obtained with cells transfected with control siRNA and left untreated (assigned a value of 1).
- MCF-IOA were transfected to express pMUCl-Luc, which was wild-type or mutated at the STAT binding site (mSBS), and Renilla-Luc. After 24h, the cells were left untreated or stimulated with IL-6 for 24 h and then assayed for luciferase activity The results are expressed as the fold-activation (mean + SD from three separate experiments) compared to that obtained with cells transfected with wild-type pMUCl-Luc and left untreated (assigned a value of 1).
- FIG. 12D MCF- 1OA were treated with control or STAT3 siRNA. After 24h, the cells were left untreated or stimulated with IL-6 for 24 h and then assayed for luciferase activity The results are expressed as the fold-activation (mean + SD from three separate experiments) compared to that obtained with cells transfected with control siRNA and left untreated (assigned a value of 1).
- FIGS. 13A-D MUCl-C promotes STAT3 occupancy of the MUCl promoter.
- FIGS. 13A and B MCF-IOA cells were transfected with control or MUCl siRNA pools for 72 h. The transfected cells were then left untreated or stimulated with IL-6 for 24 h. Soluble chromatin was precipitated with anti-STAT3 and analyzed for MUCl promoter SBS and CR sequences (FIG. 13A). The cells were then transfected to express a MUCl promoter-Luc reporter (pMUCl-Luc) and the Renilla-Luc plasmid. Luciferase activity was measured at 48 h after transfection (FIG. 13B).
- FIG. 13C Soluble chromatin from ZR-75-1 /vector and ZR-75-l/MUClsiRNA cells was precipitated with anti-STAT3 and analyzed for MUCl promoter SBS and CR sequences.
- FIG. 13D ZR-75-1 /vector and ZR-75-l/MUClsiRNA cells were transfected to express pMUCl-Luc and Renilla-Luc. Luciferase activity was measured at 48 h after transfection. The results are expressed as the fold-activation (mean + SD from three separate experiments) compared to that obtained with ZR-75-l/MUClsiRNA cells (assigned a value of 1).
- FIGS. 14A-D GO-201 blocks the interaction between MUCl-C and STAT3 in IL-6-stimulated MCF-IOA cells.
- GST-STAT3 was incubated with purified MUCl-CD in the presence of GO-201 or CP-I for 1 h at room temperature. Adsorbates to glutathione beads were immunoblotted with anti-MUCl-C.
- FIGGS. 14B-C MCF-IOA cells were stimulated with IL-6 in the presence of 5 mM GO-201 or CP-I added each 24 h for 72 h.
- Anti-STAT3 precipitates were immunoblotted with the indicated antibodies (FIG. 14B). Soluble chromatin was precipitated with anti-STAT3 or anti-MUCl-C and analyzed for MUCl promoter SBS and CR sequences (FIG. 14C).
- FIG. 14D pMUCl- Luc.
- FIG. 15 Sequences of MUCl-CD Stapled Peptides.
- FIG. 16A Effects of MUCl-CD-stapled peptide on the growth of H1650 non- small cell lung carcinoma cells.
- H1650 NSCLC cells were treated with 1 and 5 ⁇ M MUCl CQC stapled peptide (GO-200- IB) for 7 days.
- Treatment of H1650 cells with 5 ⁇ M GO-200-1B was associated with significant inhibition of growth and then a decrease in cell number.
- FIG. 16B Effect of GO-200-2B on cell proliferation.
- H-1975 non-small cell lung carcinoma cell line was grown in DMEM with 10% heat-inactivated fetal bovine serum with 100 units/mL penicillin, 100 ⁇ g/ml streptomycin and 2 mmol/L L-glutamine. Cells were re-seeded one day before treatments. Cells were treated with 5 ⁇ M GO-200-2B for 3 days and cell viability was determined by trypan blue exclusion.
- FIG. 17 Effect of different MUCl-CD CQC-region peptides on the growth of hormone-dependent breast carcinoma cells.
- ZR-75-1 breast carcinoma cells were treated with 5 ⁇ M of different peptides for 4 days and monitored for cell proliferation. Significantly, there was a substantial growth inhibition compared with that in cells left untreated.
- FIG. 18 Effect of different MUCl-CD CQC-region peptides on the growth of non small cell carcinoma cells.
- A549 non-small cell lung carcinoma cells were treated with 5 ⁇ M GO-203, GO-203-2 or GO-203cyc for 7 days. Viable cell number on day 7 was determined by trypan blue exclusion and percent growth inhibition was calculated by comparing the cell growth of untreated cells.
- FIG. 19 Effect of different MUCl-CD CQC-region peptides on the growth of H1975 non-small cell carcinoma cells.
- H 1975 non-small cell lung carcinoma cells were treated with 5 ⁇ M of different MUCl-CD CQC-region peptides for 6 days. Viable cell number on day 6 was determined by trypan blue exclusion. The results demonstrate that treatment of H 1975 cells with 5 ⁇ M of different peptides was associated with significant inhibition of growth.
- FIG. 20 Effect of different MUCl-CD CQC-region peptides on the growth of triple-negative breast carcinoma cells.
- MDA-MB-231 triple-negative breast carcinoma cells were treated with 5 ⁇ M of different MUCl-CD CQC-region peptides for 6 days. Viable cell number on day 6 was determined by trypan blue exclusion. The results demonstrate that treatment of MDA-MB-231 cells with different peptides was associated with significant inhibition of growth.
- FIG. 21 Effect of Shorter GO-203 peptides on proliferation of ZR-75-1 Breast Cancer Cells.
- Human ZR-75-1 breast cancer cells were grown in RPMI1640 supplemented with 10% heat-inactivated fetal bovine serum, 100 units/ml penicillin, 100 ⁇ g/ml streptomycin. Cells were treated with different peptides at 5 ⁇ M every day for four days and cell viability was determined by trypan blue exclusion.
- MUCl has been studied extensively by the inventors and others for its role in cancer. As discussed above, human MUCl is heterodimeric glycoprotein, translated as a single polypeptide and cleaved into N- and C-terminal subunits in the endoplasmic reticulum (Lipponberg et al, 1992; Macao et al, 2006; Levitin et al, 2005). Aberrant overexpression of MUCl, as found in most human carcinomas (Kufe et al, 1984), confers anchorage- independent growth and tumorigenicity (Li et al, 2003a; Huang et al, 2003; Schroeder et al, 2004; Huang et al, 2005).
- MUCl confers resistance to apoptosis induced by oxidative stress and genotoxic anti-cancer agents (Yin and Kufe, 2003; Ren et al, 2004; Raina et al, 2004; Yin et al, 2004; Raina et al, 2006; Yin et al, 2007).
- the family of tethered and secreted mucins functions in providing a protective barrier of the epithelial cell surface. With damage to the epithelial layer, the tight junctions between neighboring cells are disrupted, and polarity is lost as the cells initiate a heregulin-induced repair program (Vermeer et al, 2003). MUCl-N is shed from the cell surface (Abe and Kufe, 1989), leaving MUCl-C to function as a transducer of environmental stress signals to the interior of the cell.
- MUCl-C forms cell surface complexes with members of the ErbB receptor family, and MUCl-C is targeted to the nucleus in the response to heregulin stimulation (Li et al, 2001; Li et al, 2003c).
- MUCl-C also functions in integrating the ErbB receptor and Wnt signaling pathways through direct interactions between the MUCl cytoplasmic domain (CD) and members of the catenin family (Huang et al, 2005; Li et al, 2003c; Yamamoto et al, 1997; Li et al, 1998; Li et al, 2001; Li and Kufe, 2001).
- MUCl-CD is phosphorylated by glycogen synthase kinase 3 ⁇ , c-Src, protein kinase C ⁇ , and c-Abl (Raina et al, 2006; Li et al, 1998; Li et al, 2001; Ren et al, 2002).
- NLS nuclear localization signal
- MUCl-CD contains a RRK motif that does not conform to a prototypical monopartite NLS (Hodel et al., 2002). However, certain proteins containing non-classical NLSs are transported through the nuclear pore by binding directly to importin ⁇ (Kau et al., 2004). Importin ⁇ associates with several nucleoporins (Ryan and Wente, 2000), including Nup62, which is located on both the cytoplasmic and nucleoplasmic faces of nuclear pore complexes (Percipalle et al., 1997). Other studies have indicated that ⁇ - catenin is imported into the nucleus by an importin- and nucleoporin-independent mechanism (Suh and Gumbiner, 2003).
- MUCl is imported into the nucleus by a mechanism involving binding to Nup62 (Leng et al., 2007). They also demonstrate that MUCl forms oligomers through a CQC motif in the MUCl cytoplasmic domain and that MUCl oligomerization is necessary for nuclear import. In 2007, they also demonstrated that overexpression of MUC 1 in human carcinoma cells is associated with constitutive activation of NF-kappaB p65 (Ahmad et al. 2007). MUCl was shown to interact with the high- molecular- weight IKB kinase (IKK) complex in vivo, and that the MUCl cytoplasmic domain binds directly to IKK ⁇ and IKK ⁇ .
- IKK IKB kinase
- the inventors have extended their research to encompass a further elucidation of the role that the CQC motif plays in oligomer formation. They also have demonstrated that short peptides corresponding to this region are able to disrupt MUCl oligomer formation, preventing transport into the nucleus of tumor cells. These peptides are able to inhibit tumor cell growth, as well as induce apoptosis in such cells and even necrosis of tumor tissue.
- MUCl-CD binds directly to NF -KB p65 and blocks the interaction between NF- ⁇ B p65 and I ⁇ B ⁇ .
- the inventors now show that the MUCl-C subunit associates with NF -KB p65 on the promoters of NF- ⁇ B target genes and promotes NF- ⁇ B-mediated transcription.
- the results also demonstrate that an inhibitor of MUCl-C oligomerization blocks the MUCl interaction with NF -KB p65 and constitutive activation of the inflammatory NF- ⁇ B pathway.
- STAT3 another inflammatory signaling factor
- MUCl is a mucin-type glycoprotein that is expressed on the apical borders of normal secretory epithelial cells (Kufe et al., 1984). MUCl forms a heterodimer following synthesis as a single polypeptide and cleavage of the precursor into two subunits in the endoplasmic reticulum (Lipponberg et al., 1992). The cleavage may be mediated by an autocatalytic process (Levitan et al., 2005).
- MUCl N-ter, MUCl-N The >250 kDa MUCl N-terminal (MUCl N-ter, MUCl-N) subunit contains variable numbers of 20 amino acid tandem repeats that are imperfect with highly conserved variations and are modified by O-linked glycans (Gendler et al., 1988; Siddiqui et al., 1988).
- MUCl-N is tethered to the cell surface by dimerization with the ⁇ 23 kDa C-terminal subunit (MUCl C-ter, MUCl-C), which includes a 58 amino acid extracellular region, a 28 amino acid transmembrane domain and a 72 amino acid cytoplasmic domain (CD; SEQ ID NO:1) (Merlo et al., 1989).
- CD set al., SEQ ID NO:1
- GSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFS AQSGAGVPGWGIALL VLVCVLVALAIVYLIALAVCOCRRKNYGOLDIFPAR DTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAA
- MUCl is aberrantly overexpressed in the cytosol and over the entire cell membrane (Kufe et al., 1984; Perey et al., 1992).
- Cell membrane-associated MUCl is targeted to endosomes by clathrin- mediated endocytosis (Kinlough et al., 2004).
- MUCl-C is targeted to the nucleus (Baldus et al., 2004; Huang et al., 2003; Li et al., 2003a; Li et al., 2003b; Li et al., 2003c; Wei et al., 2005; Wen et al., 2003) and mitochondria (Ren et al., 2004).
- MUCl interacts with members of the ErbB receptor family (Li et al, 2001b; Li et al, 2003c; Schroeder et al, 2001) and with the Wnt effector, ⁇ -catenin (Yamamoto et al, 1997).
- the epidermal growth factor receptor and c-Src phosphorylate the MUCl cytoplasmic domain (MUCl-CD) on Y-46 and thereby increase binding of MUCl and ⁇ -catenin (Li et al, 2001a; Li et al, 2001b).
- MUCl and ⁇ -catenin are also regulated by glycogen synthase kinase 3 ⁇ and protein kinase C ⁇ (Li et al, 1998; Ren et al, 2002).
- MUCl colocalizes with ⁇ -catenin in the nucleus (Baldus et al, 2004; Li et al, 2003a; Li et al, 2003c; Wen et al, 2003) and coactivates transcription of Wnt target genes (Huang et al, 2003).
- Other studies have shown that MUCl also binds directly to p53 and regulates transcription of p53 target genes (Wei et al, 2005).
- overexpression of MUCl is sufficient to induce anchorage-independent growth and tumorigenicity (Huang et al, 2003; Li et al, 2003b; Ren et al, 2002; Schroeder et al, 2004).
- mitochondrial proteins are encoded in the nucleus and are imported into mitochondria by translocation complexes in the outer and inner mitochondrial membranes. Certain mitochondrial proteins contain N-terminal mitochondrial targeting sequences and interact with Tom20 in the outer mitochondrial membrane (Truscott et al, 2003). Other mitochondrial proteins contain internal targeting sequences and interact with the Tom70 receptor (Truscott et al, 2003). Recent work showed that mitochondrial proteins without internal targeting sequences are delivered to Tom70 by a complex of HSP70 and HSP90 (Young et al, 2003).
- the present invention contemplates the design, production and use of various MUCl peptides.
- the structural features of these peptides are as follows. First, the peptides have no more than 20 consecutive residues of MUCl. Thus, the term "a peptide having no more than 20 consecutive residues,” even when including the term “comprising,” cannot be understood to comprise a greater number of consecutive MUCl residues. Second, the peptides will contain the CQC motif, and may further comprise the CQCR, CQCRR, or CQCRRK motifs. Thus, the peptides will have, at a minimum, these four, five or six consecutive residues of the MUCl-C domain.
- the peptides will have at least one amino acid residue attached to the NH 2 -terminal side of the first C residue in the CQCRRK motif, such that the first C residue is "covered” by that at least one amino acid attached thereto.
- This residue may be native to MUCl (i.e., from the transmembrane domain), may be selected at random (any of the twenty naturally-occuring amino acids or analogs thereof), or may be part of another peptide sequence (e.g., a tag sequence for purification, a stabilizing sequence, or a cell delivery domain).
- the peptides will be 50 residues or less, again, comprising no more than 20 consecutive residues of MUCl.
- the overall length may be 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 residues.
- Ranges of peptide length of 4-50 residues, 7-50 residues, 4-25 residues 7-25, residues, 4-20 residues, 7-20 residues, and 3-15 residues, and 7-15 residues are contemplated.
- the number of consecutive MUCl residues may be 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20. Ranges of consecutive residues of 4-20 residues, 5-20 residues, 6-20 residues, 7-20 residues, 4-15 residues, 5-15 residues, 6-15 residues and 7-15 residues are contemplated.
- the present invention may utilize L-configuration amino acids, D-configuration amino acids, or a mixture thereof. While L-amino acids represent the vast majority of amino acids found in proteins, D-amino acids are found in some proteins produced by exotic sea- dwelling organisms, such as cone snails. They are also abundant components of the peptidoglycan cell walls of bacteria. D-serine may act as a neurotransmitter in the brain.
- L and D convention for amino acid configuration refers not to the optical activity of the amino acid itself, but rather to the optical activity of the isomer of glyceraldehyde from which that amino acid can theoretically be synthesized (D-glyceraldehyde is dextrorotary; L- glyceraldehyde is levorotary).
- Retro-inverso modification of naturally occurring polypeptides involves the synthetic assemblage of amino acids with ⁇ - carbon stereochemistry opposite to that of the corresponding L-amino acids, i.e., D-amino acids in reverse order with respect to the native peptide sequence.
- a retro-inverso analogue thus has reversed termini and reversed direction of peptide bonds (NH-CO rather than CO- NH) while approximately maintaining the topology of the side chains as in the native peptide sequence. See U.S. Patent 6,261,569, incorporated herein by reference.
- the present invention contemplates fusing or conjugating a cell delivery domain (also called a cell delivery vector, or cell transduction domain).
- a cell delivery domain also called a cell delivery vector, or cell transduction domain.
- Such domains are well known in the art and are generally characterized as short amphipathic or cationic peptides and peptide derivatives, often containing multiple lysine and arginine resides (Fischer, 2007).
- poly-D-Arg and poly-D-Lys sequences e.g., dextrorotary residues, eight residues in length).
- peptides modified for in vivo use by the addition, at the amino- and/or carboxyl-terminal ends, of a blocking agent to facilitate survival of the peptide in vivo are contemplated. This can be useful in those situations in which the peptide termini tend to be degraded by proteases prior to cellular uptake.
- blocking agents can include, without limitation, additional related or unrelated peptide sequences that can be attached to the amino and/or carboxyl terminal residues of the peptide to be administered. These agents can be added either chemically during the synthesis of the peptide, or by recombinant DNA technology by methods familiar in the art. Alternatively, blocking agents such as pyroglutamic acid or other molecules known in the art can be attached to the amino and/or carboxyl terminal residues.
- a different, selectively removable protecting group is utilized for amino acids containing a reactive side group, such as lysine.
- a reactive side group such as lysine.
- the protected or derivatized amino acid is attached to an inert solid support through its unprotected carboxyl or amino group.
- the protecting group of the amino or carboxyl group is then selectively removed and the next amino acid in the sequence having the complementary (amino or carboxyl) group suitably protected is admixed and reacted with the residue already attached to the solid support.
- the protecting group of the amino or carboxyl group is then removed from this newly added amino acid residue, and the next amino acid (suitably protected) is then added, and so forth.
- any remaining terminal and side group protecting groups are removed sequentially or concurrently, to provide the final peptide.
- the peptides of the invention are preferably devoid of benzylated or methylbenzylated amino acids.
- Such protecting group moieties may be used in the course of synthesis, but they are removed before the peptides are used. Additional reactions may be necessary, as described elsewhere, to form intramolecular linkages to restrain conformation.
- non-standard amino acids Aside from the twenty standard amino acids can be used, there are a vast number of "non-standard” amino acids. Two of these can be specified by the genetic code, but are rather rare in proteins. Selenocysteine is incorporated into some proteins at a UGA codon, which is normally a stop codon. Pyrrolysine is used by some methanogenic archaea in enzymes that they use to produce methane. It is coded for with the codon UAG. Examples of non-standard amino acids that are not found in proteins include lanthionine, 2- aminoisobutyric acid, dehydroalanine and the neurotransmitter gamma-aminobutyric acid.
- Non-standard amino acids often occur as intermediates in the metabolic pathways for standard amino acids - for example ornithine and citrulline occur in the urea cycle, part of amino acid catabolism.
- Non-standard amino acids are usually formed through modifications to standard amino acids. For example, homocysteine is formed through the transsulfuration pathway or by the demethylation of methionine via the intermediate metabolite S-adenosyl methionine, while hydro xypro line is made by a posttranslational modification of proline.
- Linkers or cross-linking agents may be used to fuse MUCl peptides to other proteinaceous sequences.
- Bifunctional cross-linking reagents have been extensively used for a variety of purposes including preparation of affinity matrices, modification and stabilization of diverse structures, identification of ligand and receptor binding sites, and structural studies.
- Homobifunctional reagents that carry two identical functional groups proved to be highly efficient in inducing cross-linking between identical and different macromolecules or subunits of a macromolecule, and linking of polypeptide ligands to their specific binding sites.
- Heterobifunctional reagents contain two different functional groups. By taking advantage of the differential reactivities of the two different functional groups, cross-linking can be controlled both selectively and sequentially.
- the bifunctional cross-linking reagents can be divided according to the specificity of their functional groups, e.g., amino-, sulfhydryl- , guanidino-, indole-, or carboxyl-specific groups. Of these, reagents directed to free amino groups have become especially popular because of their commercial availability, ease of synthesis and the mild reaction conditions under which they can be applied.
- a majority of heterobifunctional cross-linking reagents contains a primary amine -reactive group and a thiol-reactive group.
- heterobifunctional cross-linking reagents and methods of using the cross-linking reagents are described in U.S. Patent 5,889,155, specifically incorporated herein by reference in its entirety.
- the cross-linking reagents combine a nucleophilic hydrazide residue with an electrophilic maleimide residue, allowing coupling in one example, of aldehydes to free thiols.
- the cross-linking reagent can be modified to cross-link various functional groups and is thus useful for cross-linking polypeptides. In instances where a particular peptide does not contain a residue amenable for a given cross-linking reagent in its native sequence, conservative genetic or synthetic amino acid changes in the primary sequence can be utilized.
- the present invention focuses on peptides comprising the sequence CQCRRK. Having identified this key structure in MUCl oligomer formation, the inventors also contemplate that variants of the CQCRRK sequence may be employed. For example, certain non-natural amino acids that satisfy the structural constraints of the CQCRRK sequence may be substituted without a loss, and perhaps with an improvement in, biological function.
- the present inventors also contemplate that structurally similar compounds may be formulated to mimic the key portions of peptide or polypeptides of the present invention. Such compounds, which may be termed peptidomimetics, may be used in the same manner as the peptides of the invention and, hence, also are functional equivalents.
- peptide mimetics that mimic elements of protein secondary and tertiary structure are described in Johnson et al. (1993).
- the underlying rationale behind the use of peptide mimetics is that the peptide backbone of proteins exists chiefly to orient amino acid side chains in such a way as to facilitate molecular interactions, such as those of antibody and/or antigen.
- a peptide mimetic is thus designed to permit molecular interactions similar to the natural molecule.
- ⁇ -helix mimetics are disclosed in U.S. Patents 5,446,128; 5,710,245; 5,840,833; and 5,859,184.
- Methods for generating conformationally restricted ⁇ -turns and ⁇ -bulges are described, for example, in U.S. Patents 5,440,013; 5,618,914; and 5,670,155.
- Other types of mimetic turns include reverse and ⁇ -turns.
- Reverse turn mimetics are disclosed in U.S. Patents 5,475,085 and 5,929,237, and ⁇ -turn mimetics are described in U.S. Patents 5,672,681 and 5,674,976.
- molecular modeling is meant quantitative and/or qualitative analysis of the structure and function of protein- protein physical interaction based on three-dimensional structural information and protein-protein interaction models. This includes conventional numeric-based molecular dynamic and energy minimization models, interactive computer graphic models, modified molecular mechanics models, distance geometry and other structure-based constraint models. Molecular modeling typically is performed using a computer and may be further optimized using known methods. Computer programs that use X-ray crystallography data are particularly useful for designing such compounds. Programs such as RasMol, for example, can be used to generate three dimensional models.
- INSIGHT Error Light
- GRASP Alignment-Proty Nicholls
- Dock Molecular Design Institute, University of California at San Francisco
- Auto-Dock Unmanned Equipment Deformation
- the methods can involve the additional step of outputting to an output device a model of the 3-D structure of the compound.
- the 3-D data of candidate compounds can be compared to a computer database of, for example, 3-D structures.
- Compounds of the invention also may be interactively designed from structural information of the compounds described herein using other structure -based design/modeling techniques (see, e.g., Jackson, 1997; Jones et al, 1996). Candidate compounds can then be tested in standard assays familiar to those skilled in the art. Exemplary assays are described herein.
- the 3-D structure of biological macromolecules can be determined from data obtained by a variety of methodologies. These methodologies, which have been applied most effectively to the assessment of the 3-D structure of proteins, include: (a) x-ray crystallography; (b) nuclear magnetic resonance (NMR) spectroscopy; (c) analysis of physical distance constraints formed between defined sites on a macromolecule, e.g., intramolecular chemical crosslinks between residues on a protein (e.g., PCT/USOO/14667, the disclosure of which is incorporated herein by reference in its entirety), and (d) molecular modeling methods based on a knowledge of the primary structure of a protein of interest, e.g., homology modeling techniques, threading algorithms, or ab initio structure modeling using computer programs such as MONSSTER (Modeling Of New Structures from Secondary and Tertiary Restraints) (see, e.g., International Application No.
- MONSSTER Modeling Of New Structures from Secondary and Tertiary Restraints
- X-ray Crystallography is based on the diffraction of x- radiation of a characteristic wavelength by electron clouds surrounding the atomic nuclei in a crystal of a molecule or molecular complex of interest.
- the technique uses crystals of purified biological macromolecules or molecular complexes (but these frequently include solvent components, co-factors, substrates, or other ligands) to determine near atomic resolution of the atoms making up the particular biological macromolecule.
- a prerequisite for solving 3-D structure by x-ray crystallography is a well-ordered crystal that will diffract x- rays strongly.
- the method directs a beam of x-rays onto a regular, repeating array of many identical molecules so that the x-rays are diffracted from the array in a pattern from which the structure of an individual molecule can be retrieved.
- Well-ordered crystals of, for example, globular protein molecules are large, spherical or ellipsoidal objects with irregular surfaces.
- the crystals contain large channels between the individual molecules. These channels, which normally occupy more than one half the volume of the crystal, are filled with disordered solvent molecules, and the protein molecules are in contact with each other at only a few small regions. This is one reason why structures of proteins in crystals are generally the same as those of proteins in solution.
- Crystallization robots can automate and speed up work of reproducibly setting up a large number of crystallization experiments (see, e.g., U.S. Patent 5,790,421, the disclosure of which is incorporated herein by reference in its entirety).
- Polypeptide crystallization occurs in solutions in which the polypeptide concentration exceeds its solubility maximum (i.e., the polypeptide solution is supersaturated). Such solutions may be restored to equilibrium by reducing the polypeptide concentration, preferably through precipitation of the polypeptide crystals. Often polypeptides may be induced to crystallize from supersaturated solutions by adding agents that alter the polypeptide surface charges or perturb the interaction between the polypeptide and bulk water to promote associations that lead to crystallization.
- Crystallizations are generally carried out between 4°C and 20 0 C.
- Substances known as "precipitants” are often used to decrease the solubility of the polypeptide in a concentrated solution by forming an energetically unfavorable precipitating depleted layer around the polypeptide molecules (Weber, 1991).
- other materials are sometimes added to the polypeptide crystallization solution. These include buffers to adjust the pH of the solution and salts to reduce the solubility of the polypeptide.
- Various precipitants are known in the art and include the following: ethanol, 3-ethyl-2-4 pentanediol, and many of the polyglycols, such as polyethylene glycol (PEG).
- the precipitating solutions can include, for example, 13-24% PEG 4000, 5-41% ammonium sulfate, and 1.0-1.5 M sodium chloride, and a pH ranging from 5.0-7.5.
- Other additives can include 0.1 M Hepes, 2- 4% butanol, 20-100 mM sodium acetate, 50-70 mM citric acid, 120-130 mM sodium phosphate, 1 mM ethylene diamine tetraacetic acid (EDTA), and 1 mM dithiothreitol (DTT). These agents are prepared in buffers and are added dropwise in various combinations to the crystallization buffer. Proteins to be crystallized can be modified, e.g.
- polypeptide crystallization methods include the following techniques: batch, hanging drop, seed initiation, and dialysis. In each of these methods, it is important to promote continued crystallization after nucleation by maintaining a supersaturated solution.
- batch method polypeptide is mixed with precipitants to achieve supersaturation, and the vessel is sealed and set aside until crystals appear.
- dialysis method polypeptide is retained in a sealed dialysis membrane that is placed into a solution containing precipitant. Equilibration across the membrane increases the polypeptide and precipitant concentrations, thereby causing the polypeptide to reach supersaturation levels.
- an initial polypeptide mixture is created by adding a precipitant to a concentrated polypeptide solution.
- concentrations of the polypeptide and precipitants are such that in this initial form, the polypeptide does not crystallize.
- a small drop of this mixture is placed on a glass slide that is inverted and suspended over a reservoir of a second solution.
- the system is then sealed.
- the second solution contains a higher concentration of precipitant or other dehydrating agent.
- the difference in the precipitant concentrations causes the protein solution to have a higher vapor pressure than the second solution. Since the system containing the two solutions is sealed, an equilibrium is established, and water from the polypeptide mixture transfers to the second solution. This equilibrium increases the polypeptide and precipitant concentration in the polypeptide solution. At the critical concentration of polypeptide and precipitant, a crystal of the polypeptide may form.
- Another method of crystallization introduces a nucleation site into a concentrated polypeptide solution.
- a concentrated polypeptide solution is prepared and a seed crystal of the polypeptide is introduced into this solution. If the concentrations of the polypeptide and any precipitants are correct, the seed crystal will provide a nucleation site around which a larger crystal forms.
- Yet another method of crystallization is an electrocrystallization method in which use is made of the dipole moments of protein macromolecules that self-align in the Helmholtz layer adjacent to an electrode (see, e.g., U.S. Patent 5,597,457, the disclosure of which is incorporated herein by reference in its entirety).
- Some proteins may be recalcitrant to crystallization. However, several techniques are available to the skilled artisan to induce crystallization. For example, the removal of flexible polypeptide segments at the amino or carboxyl terminal end of the protein may facilitate production of crystalline protein samples. Removal of such segments can be done using molecular biology techniques or treatment of the protein with proteases such as trypsin, chymotrypsin, or subtilisin.
- proteases such as trypsin, chymotrypsin, or subtilisin.
- a narrow and parallel beam of x-rays is taken from the x- ray source and directed onto the crystal to produce diffracted beams.
- the incident primary beams cause damage to both the macromolecule and solvent molecules.
- the crystal is, therefore, cooled (e.g., to between -220 0 C and -50 0 C) to prolong its lifetime.
- the primary beam must strike the crystal from many directions to produce all possible diffraction spots, so the crystal is rotated in the beam during the experiment.
- the diffracted spots are recorded on a film or by an electronic detector. Exposed film has to be digitized and quantified in a scanning device, whereas the electronic detectors feed the signals they detect directly into a computer.
- MIR Multiple Isomorphous Replacement
- Atomic coordinates refer to Cartesian coordinates (x, y, and z positions) derived from mathematical equations involving Fourier synthesis of data derived from patterns obtained via diffraction of a monochromatic beam of x-rays by the atoms (scattering centers) of biological macromolecule of interest in crystal form. Diffraction data are used to calculate electron density maps of repeating units in the crystal (unit cell). Electron density maps are used to establish the positions (atomic coordinates) of individual atoms within a crystal's unit cell.
- the absolute values of atomic coordinates convey spatial relationships between atoms because the absolute values ascribed to atomic coordinates can be changed by rotational and/or translational movement along x, y, and/or z axes, together or separately, while maintaining the same relative spatial relationships among atoms.
- a biological macromolecule e.g., a protein
- whose set of absolute atomic coordinate values can be rotationally or translationally adjusted to coincide with a set of prior determined values from an analysis of another sample is considered to have the same atomic coordinates as those obtained from the other sample.
- Further details on x-ray crystallography can be obtained from co-pending U.S. Application No. 2005/0015232, U.S. Patent 6,093,573 and International Application Nos. PCT/US99/18441, PCT/US99/11913, and PCT/USOO/03745. The disclosures of all these patent documents are incorporated herein by reference in their entirety.
- NMR Spectroscopy NMR Spectroscopy . Whereas x-ray crystallography requires single crystals of a macromolecule of interest, NMR measurements are carried out in solution under near physiological conditions. However, NMR-derived structures are not as detailed as crystal- derived structures.
- NMR spectroscopy was until relatively recently limited to the elucidation of the 3-D structure of relatively small molecules (e.g., proteins of 100-150 amino acid residues)
- relatively small molecules e.g., proteins of 100-150 amino acid residues
- isotopic labeling of the molecule of interest and transverse relaxation-optimized spectroscopy (TROSY) have allowed the methodology to be extended to the analysis of much larger molecules, e.g., proteins with a molecular weight of HO kDa (Wider, 2000).
- NMR uses radio-frequency radiation to examine the environment of magnetic atomic nuclei in a homogeneous magnetic field pulsed with a specific radio frequency.
- the pulses perturb the nuclear magnetization of those atoms with nuclei of nonzero spin.
- Transient time domain signals are detected as the system returns to equilibrium.
- Fourier transformation of the transient signal into a frequency domain yields a one-dimensional NMR spectrum. Peaks in these spectra represent chemical shifts of the various active nuclei.
- the chemical shift of an atom is determined by its local electronic environment.
- Two-dimensional NMR experiments can provide information about the proximity of various atoms in the structure and in three dimensional space. Protein structures can be determined by performing a number of two- (and sometimes 3- or 4-) dimensional NMR experiments and using the resulting information as constraints in a series of protein folding simulations.
- peptidomimetic compounds that are designed based upon the amino acid sequences of compounds of the invention that are peptides.
- Peptidomimetic compounds are synthetic compounds having a three-dimensional conformation "motif that is substantially the same as the three-dimensional conformation of a selected peptide.
- the peptide motif provides the peptidomimetic compound with the ability to inhibit the oligomerization of MUCl.
- Peptidomimetic compounds can have additional characteristics that enhance their in vivo utility, such as increased cell permeability and prolonged biological half-life.
- the peptidomimetics typically have a backbone that is partially or completely non- peptide, but with side groups that are identical to the side groups of the amino acid residues that occur in the peptide on which the peptidomimetic is based.
- Several types of chemical bonds e.g., ester, thioester, thioamide, retroamide, reduced carbonyl, dimethylene and ketomethylene bonds, are known in the art to be generally useful substitutes for peptide bonds in the construction of protease-resistant peptidomimetics.
- Stapled/Stitched Peptides A particular modification is in the context of peptides as therapeutics is the so-called “Stapled Peptide” technology of Aileron Therapeutics.
- the general approach for "stapling" a peptide is that two key residues within the peptide are modified by attachment of linkers through the amino acid side chains. Once synthesized, the linkers are connected through a catalyst, thereby creating a bridge that physically constrains the peptide into its native ⁇ -helical shape. In addition to helping retain the native structure needed to interact with a target molecule, this conformation also provides stability against peptidases as well as promotes cell-permeating properties.
- peptide stapling may encompasses the joining of two double bond-containing sidechains, two triple bond-containing sidechains, or one double bond-containing and one triple bond-containing side chain, which may be present in a polypeptide chain, using any number of reaction conditions and/or catalysts to facilitate such a reaction, to provide a singly "stapled” polypeptide.
- introduction of a staple entails a modification of standard peptide synthesis, with ⁇ -methy, ⁇ - alkenyl amino acids being introduced at two positions along the peptide chain, separated by either three or six intervening residues (i + 4 or i + 7).
- peptide stitching refers to multiple and tandem “stapling” events in a single peptide chain to provide a "stitched” (multiply stapled) polypeptide, each of which is incorporated herein by reference. See WO 2008/121767 for a specific example of stitched peptide technology.
- compositions in a form appropriate for the intended application. Generally, this will entail preparing compositions that are essentially free of pyrogens, as well as other impurities that could be harmful to humans or animals.
- compositions of the present invention comprise an effective amount of the vector to cells, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium. Such compositions also are referred to as inocula.
- pharmaceutically or pharmacologically acceptable refer to molecular entities and compositions that do not produce adverse, allergic, or other untoward reactions when administered to an animal or a human.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like.
- the use of such media and agents for pharmaceutically active substances is well know in the art. Except insofar as any conventional media or agent is incompatible with the vectors or cells of the present invention, its use in therapeutic compositions is contemplated. Supplementary active ingredients also can be incorporated into the compositions.
- compositions of the present invention may include classic pharmaceutical preparations. Administration of these compositions according to the present invention will be via any common route so long as the target tissue is available via that route. Such routes include oral, nasal, buccal, rectal, vaginal or topical route. Alternatively, administration may be by orthotopic, intradermal, subcutaneous, intramuscular, intratumoral, intraperitoneal, or intravenous injection. Such compositions would normally be administered as pharmaceutically acceptable compositions, described supra.
- the active compounds may also be administered parenterally or intraperitoneally.
- Solutions of the active compounds as free base or pharmacologically acceptable salts can be prepared in water suitably mixed with a surfactant, such as hydroxypropylcellulose.
- Dispersions can also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- the form must be sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- a coating such as lecithin
- surfactants for example, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sulfate, sodium sorbic acid, thimerosal, and the like.
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like.
- the use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
- the polypeptides of the present invention may be incorporated with excipients and used in the form of non-ingestible mouthwashes and dentifrices.
- a mouthwash may be prepared incorporating the active ingredient in the required amount in an appropriate solvent, such as a sodium borate solution (Dobell's Solution).
- the active ingredient may be incorporated into an antiseptic wash containing sodium borate, glycerin and potassium bicarbonate.
- the active ingredient may also be dispersed in dentifrices, including: gels, pastes, powders and slurries.
- the active ingredient may be added in a therapeutically effective amount to a paste dentifrice that may include water, binders, abrasives, flavoring agents, foaming agents, and humectants.
- compositions of the present invention may be formulated in a neutral or salt form.
- Pharmaceutically-acceptable salts include the acid addition salts (formed with the free amino groups of the protein) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, histidine, procaine and the like.
- solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective.
- the formulations are easily administered in a variety of dosage forms such as injectable solutions, drug release capsules and the like.
- the solution For parenteral administration in an aqueous solution, for example, the solution should be suitably buffered if necessary and the liquid diluent first rendered isotonic with sufficient saline or glucose.
- aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal administration.
- sterile aqueous media which can be employed will be known to those of skill in the art in light of the present disclosure.
- one dosage could be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, "Remington's Pharmaceutical Sciences," 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage will necessarily occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biologies standards. B. Inflammatory Disease States and Conditions i. Sepsis
- Sepsis is a serious medical condition characterized by a whole-body inflammatory state caused by infection.
- sepsis has been used interchangeably with septicaemia and septicemia ("blood poisoning").
- septicemia is considered a subset of sepsis.
- SIRS systemic inflammatory response syndrome
- the immunological response that causes sepsis is a systemic inflammatory response causing widespread activation of inflammation and coagulation pathways. This may progress to dysfunction of the circulatory system and, even under optimal treatment, may result in the multiple organ dysfunction syndrome and eventually death.
- Sepsis is considered present if infection is highly suspected or proven and two or more of the following systemic inflammatory response syndrome (SIRS) criteria are met: heart rate > 90 beats per minute body temperature ⁇ 36 (96.8°F) or > 38°C (100.4 0 F) hyperventilation (high respiratory rate) > 20 breaths per minute or, on blood gas, a P a CO 2 less than 32 mm Hg white blood cell count ⁇ 4000 cells/mm 3 or > 12000 cells/mm 3 ( ⁇ 4 x 10 9 or > 12 x 10 9 cells/L), or greater than 10% band forms (immature white blood cells).
- SIRS systemic inflammatory response syndrome
- sepsis severe sepsis (sepsis with acute organ dysfunction) and septic shock (sepsis with refractory arterial hypotension).
- SIRS systemic inflammatory response syndrome criteria
- patients with SIRS and acute organ dysfunction may be termed "severe SIRS.”
- Patients are defined as having "severe sepsis” if they have sepsis plus signs of systemic hypoperfusion; either end organ dysfunction or a serum lactate greater than 4 mmol/dL.
- Patient are defined as having septic shock if they have sepsis plus hypotension after an appropriate fluid bolus (typically 20 ml/kg of crystaloid).
- the criteria for diagnosing an adult with sepsis do not apply to infants under one month of age. In infants, only the presence of infection plus a "constellation" of signs and symptoms consistent with the systemic response to infection are required for diagnosis.
- the therapy of sepsis rests on antibiotics, surgical drainage of infected fluid collections, fluid replacement and appropriate support for organ dysfunction. This may include hemodialysis in kidney failure, mechanical ventilation in pulmonary dysfunction, transfusion of blood products, and drug and fluid therapy for circulatory failure. Ensuring adequate nutrition, if necessary by parenteral nutrition, is important during prolonged illness.
- drotrecogin alfa activate protein C, one of the coagulation factors
- a patient must have severe sepsis or septic shock with an APACHE II score of 25 or greater and a low risk of bleeding.
- Low dose hydrocortisone treatment has shown promise for septic shock patients with relative adrenal insufficiency as defined by ACTH stimulation testing.
- Standard treatment of infants with suspected sepsis consists of supportive care, maintaining fluid status with intravenous fluids, and the combination of a ⁇ -lactam antibiotic (such as ampicillin) with an aminoglycoside such as gentamicin.
- a ⁇ -lactam antibiotic such as ampicillin
- an aminoglycoside such as gentamicin
- Trauma can also be described as both unplanned, such as an accident, or planned, in the case of surgery. Both can be characterized by mild to severe tissue damage, blood loss and/or shock, and both may lead to subsequent infection, including sepsis.
- the present invention provides to treatment of trauma, including both pre- treatment (in the case of a medical procedure) and treatment after trauma injury as occurred.
- Surgery uses operative manual and instrumental techniques on a patient to investigate and/or treat a pathological condition such as disease or injury, to help improve bodily function or appearance, or sometimes for some other reason.
- a pathological condition such as disease or injury
- the present invention can address trauma resulting from surgeries, as defined further below.
- a procedure is considered surgical when it involves cutting of a patient's tissues or closure of a previously sustained wound.
- Other procedures that do not necessarily fall under this rubric such as angioplasty or endoscopy, may be considered surgery if they involve common surgical procedure or settings, such as use of a sterile environment, anesthesia, antiseptic conditions, typical surgical instruments, and suturing or stapling. All forms of surgery are considered invasive procedures; so-called noninvasive surgery usually refers to an excision that does not penetrate the structure being addressed (e.g., laser ablation of the cornea) or to a radiosurgical procedure (e.g., irradiation of a tumor). Surgery can last from minutes to hours.
- Surgical procedures are commonly categorized by urgency, type of procedure, body system involved, degree of invasiveness, and special instrumentation.
- Elective surgery is done to correct a non-life-threatening condition, and is carried out at the patient's request, subject to the surgeon's and the surgical facility's availability.
- Emergency surgery is surgery which must be done quickly to save life, limb, or functional capacity. Exploratory surgery is performed to aid or confirm a diagnosis.
- Therapeutic surgery treats a previously diagnosed condition.
- Amputation involves cutting off a body part, usually a limb or digit.
- Replantation involves reattaching a severed body part.
- Reconstructive surgery involves reconstruction of an injured, mutilated, or deformed part of the body.
- Cosmetic surgery is done to improve the appearance of an otherwise normal structure.
- Excision is the cutting out of an organ, tissue, or other body part from the patient.
- Transplant surgery is the replacement of an organ or body part by insertion of another from different human (or animal) into the patient. Removing an organ or body part from a live human or animal for use in transplant is also a type of surgery.
- organ system or structure When surgery is performed on one organ system or structure, it may be classed by the organ, organ system or tissue involved. Examples include cardiac surgery (performed on the heart), gastrointestinal surgery (performed within the digestive tract and its accessory organs), and orthopedic surgery (performed on bones and/or muscles).
- Minimally invasive surgery involves smaller outer incision(s) to insert miniaturized instruments within a body cavity or structure, as in laparoscopic surgery or angioplasty.
- an open surgical procedure requires a large incision to access the area of interest.
- Laser surgery involves use of a laser for cutting tissue instead of a scalpel or similar surgical instruments.
- Microsurgery involves the use of an operating microscope for the surgeon to see small structures.
- Robotic surgery makes use of a surgical robot, such as Da Vinci or Zeus surgical systems, to control the instrumentation under the direction of the surgeon.
- Traumatic Hemorrhage Traumatic Hemorrhage accounts for much of the wide ranging international impact of injury, causing a large proportion of deaths and creating great morbidity in the injured. Despite differences in pre-hospital care, the acute management of traumatic hemorrhage is similar around the world and follows well accepted published guidelines. A critically injured patient's care occurs as four, often overlapping segments: the resuscitative, operative, and critical care phases. The diagnosis and control of bleeding should be a high priority during all of the phases of trauma care and is especially important in the patient who is in hemorrhagic shock.
- Acute pancreatitis is rapidly-onset inflammation of the pancreas. Depending on its severity, it can have severe complications and high mortality despite treatment. While mild cases are often successfully treated with conservative measures or laparoscopy, severe cases require invasive surgery (often more than one intervention) to contain the disease process.
- ARDS Acute respiratory distress syndrome
- RDS respiratory distress syndrome
- IRDS adult respiratory distress syndrome
- ARDS is a severe lung disease caused by a variety of direct and indirect insults. It is characterized by inflammation of the lung parenchyma leading to impaired gas exchange with concomitant systemic release of inflammatory mediators causing inflammation, hypoxemia and frequently resulting in multiple organ failure. This condition is life threatening and often lethal, usually requiring mechanical ventilation and admission to an intensive care unit. A less severe form is called acute lung injury (ALI).
- ALI acute lung injury
- ARDS can occur within 24 to 48 hours of an injury or attack of acute illness. In such a case the patient usually presents with shortness of breath, tachypnea, and symptoms related to the underlying cause, i.e., shock. Long term illnesses can also trigger it, such as malaria. The ARDS may then occur sometime after the onset of a particularly acute case of the infection.
- An arterial blood gas analysis and chest X-ray allow formal diagnosis by inference using the aforementioned criteria. Although severe hypoxemia is generally included, the appropriate threshold defining abnormal PaO 2 has never been systematically studied. Any cardiogenic cause of pulmonary edema should be excluded. This can be done by placing a pulmonary artery catheter for measuring the pulmonary artery wedge pressure. However, this is not necessary and is now rarely done as abundant evidence has emerged demonstrating that the use of pulmonary artery catheters does not lead to improved patient outcomes in critical illness including ARDS. Plain chest X-rays are sufficient to document bilateral alveolar infiltrates in the majority of cases. While CT scanning leads to more accurate images of the pulmonary parenchyma in ARDS, its has little utility in the clinical management of patients with ARDS, and remains largely a research tool.
- Acute respiratory distress syndrome is usually treated with mechanical ventilation in the Intensive Care Unit. Ventilation is usually delivered through oro-tracheal intubation, or tracheostomy whenever prolonged ventilation (> 2 weeks) is deemed inevitable.
- the possibilities of non-invasive ventilation are limited to the very early period of the disease or, better, to prevention in individuals at risk for the development of the disease (atypical pneumonias, pulmonary contusion, major surgery patients). Treatment of the underlying cause is imperative, as it tends to maintain the ARDS picture.
- Appropriate antibiotic therapy must be administered as soon as microbiological culture results are available. Empirical therapy may be appropriate if local microbiological surveillance is efficient.
- Reperfusion injury refers to damage to tissue caused when blood supply returns to the tissue after a period of ischemia.
- the absence of oxygen and nutrients from blood creates a condition in which the restoration of circulation results in inflammation and oxidative damage through the induction of oxidative stress rather than restoration of normal function.
- the damage of reperfusion injury is due in part to the inflammatory response of damaged tissues.
- White blood cells carried to the area by the newly returning blood release a host of inflammatory factors such as interleukins as well as free radicals in response to tissue damage.
- the restored blood flow reintroduces oxygen within cells that damages cellular proteins, DNA, and the plasma membrane. Damage to the cell's membrane may in turn cause the release of more free radicals.
- Such reactive species may also act indirectly in redox signaling to turn on apoptosis.
- Leukocytes may also build up in small capillaries, obstructing them and leading to more ischemia.
- Reperfusion injury plays a part in the brain's ischemic cascade, which is involved in stroke and brain trauma. Repeated bouts of ischemia and reperfusion injury also are thought to be a factor leading to the formation and failure to heal of chronic wounds such as pressure sores and diabetic foot ulcers. Continuous pressure limits blood supply and causes ischemia, and the inflammation occurs during reperfusion. As this process is repeated, it eventually damages tissue enough to cause a wound.
- hypoxanthine In prolonged ischemia (60 min or more), hypoxanthine is formed as breakdown product of ATP metabolism.
- the enzyme xanthine dehydrogenase is converted to xanthine oxidase as a result of the higher availability of oxygen. This oxidation results in molecular oxygen being converted into highly reactive superoxide and hydroxyl radicals.
- Xanthine oxidase also produces uric acid, which may act as both a prooxidant and as a scavenger of reactive species such as peroxinitrite.
- Excessive nitric oxide produced during reperfusion reacts with superoxide to produce the potent reactive species peroxynitrite.
- Such radicals and reactive oxygen species attack cell membrane lipids, proteins, and glycosaminoglycans, causing further damage. They may also initiate specific biological processes by redox signaling.
- Cardiovascular disease refers to the class of diseases that involve the heart or blood vessels (arteries and veins). While the term technically refers to any disease that affects the cardiovascular system, it is usually used to refer to those related to atherosclerosis (arterial disease). These conditions have similar causes, mechanisms, and treatments. Treatment of cardiovascular disease depends on the specific form of the disease in each patient, but effective treatment always includes preventive lifestyle changes discussed above. Medications, such as blood pressure reducing medications, aspirin and the statin cholesterol- lowering drugs may be helpful. In some circumstances, surgery or angioplasty may be warranted to reopen, repair, or replace damaged blood vessels
- biomarkers are thought to offer a more detailed risk of cardiovascular disease. However, the clinical value of these biomarkers is questionable.
- biomarkers which may reflect a higher risk of cardiovascular disease include: higher fibrinogen and PAI-I blood concentrations hlevated homocysteine, or even upper half of normal elevated blood levels of asymmetric dimethylarginine high inflammation as measured by C-reactive protein levated blood levels of B-type natriuretic peptide (BNP)
- cardiovascular disease include aneurysms, angina, arrhythmia, atherosclerosis, cardiomyopathy, cerebrovascular disease, congenital heart disease, congestive heart failure, myocarditis, valve disease, coronary artery disease, dilated cardiomyopathy, diastolic dysfunction, endocarditis, high blood pressure (hypertension), hypertrophic cardiomyopathy, nitral valve prolapse, myocardial infarction, and venous thromboembolism.
- autoimmune/Inflammtory Disease include aneurysms, angina, arrhythmia, atherosclerosis, cardiomyopathy, cerebrovascular disease, congenital heart disease, congestive heart failure, myocarditis, valve disease, coronary artery disease, dilated cardiomyopathy, diastolic dysfunction, endocarditis, high blood pressure (hypertension), hypertrophic cardiomyopathy, nitral valve prolapse, myocardial infarction, and venous thromboembolism.
- the present invention contemplates the treatment of a variety of autoimmune and/or inflammatory disease states such as spondyloarthropathy, ankylosing spondylitis, psoriatic arthritis, reactive arthritis, enteropathic arthritis, ulcerative colitis, Crohn's disease, irritable bowel disease, inflammatory bowel disease, rheumatoid arthritis, juvenile rheumatoid arthritis, familial Mediterranean fever, amyotrophic lateral sclerosis, Sjogren's syndrome, early arthritis, viral arthritis, multiple sclerosis, or psoriasis.
- spondyloarthropathy ankylosing spondylitis
- psoriatic arthritis reactive arthritis
- enteropathic arthritis ulcerative colitis
- Crohn's disease irritable bowel disease
- inflammatory bowel disease rheumatoid arthritis
- juvenile rheumatoid arthritis juvenile rheumatoid arthritis
- familial Mediterranean fever amyotrophic lateral sclerosis
- cancer therapy including chemotherapy, radiation, and cytokines
- chemotherapy are associated with toxicity, sometimes severe, in the cancer patient.
- the present invention seeks to reduce this toxicity using the pharmaceutical compositions of the present invention, thereby reducing or alleviating discomfort on the part of the patient, as well as permitting higher doses of the therapy.
- a burn may be an injury caused by heat, cold, electricity, chemicals, friction or radiation.
- First-degree burns are usually limited to redness (erythema), a white plaque, and minor pain at the site of injury. These burns usually extend only into the epidermis.
- Second-degree burns additionally fill with clear fluid, have superficial blistering of the skin, and can involve more or less pain depending on the level of nerve involvement. Second-degree burns involve the superficial (papillary) dermis and may also involve the deep (reticular) dermis layer.
- Third-degree burns additionally have charring of the skin, and produce hard, leather-like eschars.
- An eschar is a scab that has separated from the unaffected part of the body.
- Chemical burns are usually caused by chemical compounds, such as sodium hydroxide (lye), silver nitrate, and more serious compounds (such as sulfuric acid). Most chemicals (but not all) that can cause moderate to severe chemical burns are strong acids or bases. Nitric acid, as an oxidizer, is possibly one of the worst burn-causing chemicals. Hydrofluoric acid can eat down to the bone and its burns are often not immediately evident. Most chemicals that can cause moderate to severe chemical burns are called caustic.
- Burns are assessed in terms of total body surface area (TBSA), which is the percentage affected by partial thickness or full thickness burns (superficial thickness burns are not counted). The rule of nines is used as a quick and useful way to estimate the affected TBSA.
- the first step in managing a person with a burn is to stop the burning process. With dry powder burns, the powder should be brushed off first. With other burns, the affected area should be rinsed with a large amount of clean water to remove foreign bodies and help stop the burning process. Cold water should never be applied to any person with extensive burns, as it may severely compromise the burn victim's temperature status. At this stage of management, it is also critical to assess the airway status. If the patient was involved in a fire, then it must be assumed that he or she has sustained inhalation injury until proven otherwise, and treatment should be managed accordingly.
- the development of cancer referred to as carcinogenesis
- carcinogenesis can be modeled and characterized in a number of ways.
- An association between the development of cancer and inflammation has long-been appreciated.
- the inflammatory response is involved in the host defense against microbial infection, and also drives tissue repair and regeneration.
- Considerable evidence points to a connection between inflammation and a risk of developing cancer, i.e., chronic inflammation can lead to dysplasia.
- Organisms such as human papilloma virus (HPV), hepatitis B and C virus, HIV, and Helicobacter pylori all have been linked to cancer.
- environmental conditions causing chronic irritation and subsequent inflammation can also predispose to cancer, including cigarette smoke, asbestos and silica.
- virally-encoded genes can contribute to cellular transformation.
- An example is the HPV oncoproteins E6 and E7.
- other microbes associated with cancer do not operate in this fashion as they are not transforming.
- certain strains of H. pylori contain factors that affect host cell signaling but do not contain oncogenes.
- H. pylori induces MUCl .
- Yet another path to cellular dysregulation may result from the cell death that occurs in infection or other inflammatory insult. Lost cells must be repopulated by the expansion of other cells, sometimes undifferentiated precursor cells such as tissue stem cells. Not surprisingly, many inflammatory pathways function to mediate survival and proliferation. Thus, in attempting to mediating tissue repair, the inflammatory response may unwittingly provide excessive survival and proliferative signals to cells, thus leading to tumorigenesis.
- Peptides or analogs that inhibit MUCl oligomer formation are generally useful as antiinflammatories. They can be administered to mammalian subjects (e.g., human patients) alone or in conjunction with other drugs that modulate inflammation. The compounds can also be administered to subjects that are genetically and/or due to, for example, physiological and/or environmental factors, susceptible to inflammation, e.g., subjects with a family history of inflammatory disease, or subjects with chronic inflammation or subject to chronic stress.
- the dosage required depends on the choice of the route of administration; the nature of the formulation; the nature of the patient's illness; the subject's size, weight, surface area, age, and sex; other drugs being administered; and the judgment of the attending physician. Suitable dosages are in the range of 0.0001-100 mg/kg. Wide variations in the needed dosage are to be expected in view of the variety of compounds available and the differing efficiencies of various routes of administration. For example, oral administration would be expected to require higher dosages than administration by intravenous injection. Variations in these dosage levels can be adjusted using standard empirical routines for optimization as is well understood in the art.
- Administrations can be single or multiple (e.g., 2-, 3-, 4-, 6-, 8-, 10-, 20-, 50-,100-, 150-, or more times).
- Encapsulation of the polypeptide in a suitable delivery vehicle e.g., polymeric microparticles or implantable devices
- a target cell or subject with a MUCl antagonist and at least one other therapy.
- These therapies would be provided in a combined amount effective to achieve a reduction in one or more disease parameter.
- This process may involve contacting the cells/subjects with the both agents/therapies at the same time, e.g., using a single composition or pharmacological formulation that includes both agents, or by contacting the cell/subject with two distinct compositions or formulations, at the same time, wherein one composition includes the MUCl antagonist and the other includes the other agent.
- the MUCl antagonist may precede or follow the other treatment by intervals ranging from minutes to weeks.
- Agents or factors suitable for use in a combined therapy against an inflammatory disorder include steroids, glucocorticoids, non-steriodal anti-inflammatory drugs (NSAIDS; including COX-I and COX-2 inhibitors), aspirin, ibuprofen, and naproxen.
- NSAIDS non-steriodal anti-inflammatory drugs
- Analgesics are commonly associated with anti-inflammatory drugs but which have no anti-inflammatory effects.
- An example is paracetamol, called acetaminophen in the U.S. and sold under the brand name of Tylenol.
- paracetamol As opposed to NSAIDS, which reduce pain and inflammation by inhibiting COX enzymes, paracetamol has recently been shown to block the reuptake of endocannabinoids, which only reduces pain, likely explaining why it has minimal effect on inflammation.
- Human ZR-75-1 breast cancer and U-937 leukemia cells were grown in RPMI 1640 medium containing 10% heat-inactivated fetal bovine serum (FBS), 100 units/ml penicillin, 100 ⁇ g/ml streptomycin and 2 mM L-glutamine.
- FBS heat-inactivated fetal bovine serum
- Human HeLa cervical and MCF- 7 breast carcinoma cells were grown in Dulbecco's modified Eagle's medium with 10% FBS, antibiotics and L-glutamine.
- Human MCF-IOA breast epithelial cells were grown in mammary epithelial cell growth medium (MEGM; Lonza, Walkersville, MD) and treated with 20 ng/ml TNF ⁇ (BD Biosciences, San Jose, CA).
- Immunoprecipitation and immunoblotting Lysates from sub-confluent cells were prepared as described (Ren et al, 2004). Soluble proteins were precipitated with anti-NF- ⁇ B p65 (Santa Cruz Biotechnology, Santa Cruz, CA). The immunoprecipitates and cell lysates were subjected to immunoblotting with anti-p65, anti-p65 (180-306) (Millipore, Billerica, MA) anti-MUCl-C (Ab5; Lab Vision, Fremont, CA), anti-I ⁇ B ⁇ (Santa Cruz Biotechnology), anti-Bcl-xL (Santa Cruz Biotechnology) and anti- ⁇ -actin (Sigma, St. Louis, MO). Immune complexes were detected with horseradish peroxidase-conjugated secondary antibodies (GE Healthcare Biosciences, Piscataway, NJ) and enhanced chemiluminescence (GE Healthcare).
- GST, GST-MUCl-CD, GST-MUC 1-CD(I -45) and GST- MUCl-CD(46-72) were prepared as described (Ahmad et al, 2007) and incubated with p65 and certain p65 deletion mutants.
- Purified GST-MUCl-CD was cleaved with thrombin to remove the GST moiety.
- GST-IKBO, (Millipore, Billerica, MA) was incubated with p65(186- 306) for 2 h at 25°C in the absence and presence of purified MUCl-CD.
- Adsorbates to glutathione-conjugated beads were analyzed by immunoblotting.
- Immunofluorescence confocal microscopy Cells were fixed and permeabilized as described (Raina et al., 2006). Incubation with anti-MUCl-C and anti-NF- ⁇ B p65 in blocking buffer was performed overnight at 4°C. The cells were blocked with 10% goat serum and stained with anti-MUCl-C, followed by FITC-conjugated secondary anti-hamster antibody. The cells were then incubated with anti-NF- ⁇ B p65 followed by Texas Red- conjugated anti-mouse Ig conjugate (Jackson Immuno-Research Laboratories, West Grove, PA). Nuclei were stained with 2 ⁇ M TO-PRO-3. Images were captured with a Zeiss LSM510 confocal microscope at 1024 x 1024 resolution.
- ChIP assays Soluble chromatin was prepared as described (Wei et al., 2006) and precipitated with anti-p65, anti-MUCl-C or a control non-immune IgG.
- Re-ChIP assays complexes from the primary ChIP were eluted with 10 mM DTT, diluted in Re-ChIP buffer and reimmunoprecipitated with anti-p65.
- PCR 2 ⁇ l from a 50 ⁇ l DNA extraction was used with 25-35 cycles of amplification.
- Luciferase assays Cells were transfected with NFKB-LUC (Ahmad et al., 2007) or pMUCl-Luc (Yin et al., 2003) and SV-40-Renilla-Luc (Promega, Madison, WI) in the presence of Lipofectamine. After 48 h, the cells were lysed in passive lysis buffer. Lysates were analyzed for firefly and Renilla luciferase activities using the dual luciferase assay kit (Promega).
- MUCl-C associates with NF- ⁇ B p65.
- anti-NF- ⁇ B p65 precipitates from ZR-75-1 breast cancer cells were immunob lotted with an antibody against the MUCl-C subunit cytoplasmic domain.
- the results demonstrate that MUCl-C coprecipitates with NF- ⁇ B p65 (FIG. IA).
- Similar findings were obtained with lysates from MCF-7 breast cancer cells, which also overexpress endogenous MUCl (FIG. IB).
- MUCl-CD binds directly to NF- ⁇ B p65.
- the inventors incubated GST, GST-MUCl-CD or GST-MUCl-CD deletion mutants (FIG. 7 A, upper panel) with purified recombinant NF- ⁇ B p65. Analysis of the adsorbates demonstrated that GST-MUCl-CD, and not GST, binds to NF- ⁇ B p65 (FIG. 7A, lower panels). Incubation of MUCl-CD deletion mutants further demonstrated that this interaction is mediated by MUCl-CD(46-72), and not MUC 1-CD(I -45) (FIG. 7A, lower panels).
- NF- ⁇ B p65 is a 551 -amino acid protein that includes an N-terminal ReI homology domain (RHD) and a C-terminal transactivation domain (TAD) (FIG. 7B, upper panel).
- RHD N-terminal ReI homology domain
- TAD C-terminal transactivation domain
- Incubation of GST-MUCl-CD with purified NF -KB deletion mutants demonstrated binding to p65(l-306) and not p65(354-551) (FIG. 7B, lower panels).
- the inventors incubated GST-MUCl-CD with p65(l- 180) and p65(186-306). The results show that MUCl-CD binds to p65(l-180) (FIG. 7C).
- MUCl-CD competes with I ⁇ B ⁇ for binding to NF- ⁇ B p65.
- the conserved RHD is responsible for DNA binding, dimerization and association with the IKB inhibitory proteins (Ghosh et al, 1998; Chen and Greene, 2004).
- the inventors first studied ZR-75-1 cells that are stably silenced for MUCl with a MUCl siRNA (FIG. 8). Silencing of MUCl was associated with increased binding of NF- ⁇ B p65 and I ⁇ B ⁇ (FIG. 2A).
- MUCl-C associates with NF- ⁇ B p65 in the nucleus. Confocal analysis of ZR-75-1 cells showed nuclear colocalization of MUCl-C and NF -KB p65 (FIG. 3A). In addition, and consistent with MUCl-CD competing for binding to NF- ⁇ B p65, silencing MUCl in the ZR- 75-1 cells was associated with localization of nuclear NF -KB p65 to the cytoplasm (FIG. 3A). Previous studies demonstrated that MUCl contributes to the upregulation of Bcl-xL expression (Ahmad et al, 2007).
- the anti-MUCl-C complexes were released, reimmunoprecipitated with anti-p65 and then analyzed by PCR.
- Anti-p65 precipitated the NF- ⁇ B-RE region after release from anti-MUCl-C (FIG. 3D, right), indicating that MUCl-C is constitutively present in the Bcl-xL promoter region occupied by the NF- ⁇ B transcription complex.
- MCF-IOA breast epithelial cells Inducible interaction of NF- ⁇ B p65 and MUCl-C in MCF-IOA breast epithelial cells.
- the non-malignant MCF-IOA breast epithelial cells (Soule et al, 1990; Muthuswamy et al, 2001) express endogenous MUCl, but at levels lower than that found in breast carcinoma cells (Ahmad et al, 2007).
- the inventors found, however, that stimulation of the MCF-IOA cells with TNF ⁇ is associated with a substantial upregulation of MUCl expression (FIG. 4A).
- the MCF-IOA cells In contrast to breast cancer cells, the MCF-IOA cells exhibited little if any constitutive interaction between NF- ⁇ B p65 and MUCl-C (FIG. 4B).
- NF- ⁇ B engages consensus and degenerate KB binding sequences (5'- GGGRNWYYCC-3' (SEQ ID NO:57), where R is a purine, N is any base, W is an adenine or thymine and Y is a pyrimidine).
- the MUCl promoter contains such a potential sequence for NF-KB binding (5'-GGAAAGTCC-3'; -589 to -580) (Lagow et al, 2002) (FIG. 4C).
- TNF ⁇ -induced activation of the MUCl promoter-Luc was also attenuated by silencing NF -KB p65 (FIG. 5B, right).
- MUCl- C the inventors silenced MUCl expression in the MCF-IOA cells with a MUClsiRNA (FIG. 5C). Consistent with the effects of MUCl on NF- ⁇ B p65 occupancy of the NF- ⁇ B-RE, silencing MUCl attenuated TNF -induced activation of the NF- ⁇ B-Luc reporter (FIG. 5D, left).
- Targeting MUCl-CD blocks NF- ⁇ B p65 function.
- the inventors synthesized a peptide corresponding to MUCl- CD(I -15) which blocks oligomerization and thereby function of the MUCl-C cytoplasmic domain (Leng et al., 2007).
- a control peptide was synthesized in which the CQC motif was mutated to AQA (FIG. 6A).
- a poly D-arginine transduction domain was included in the synthesis to facilitate entry of the peptides into cells (Fischer, 2007) (FIG. 6A).
- the MUC1/CQC peptide blocked the interaction between MUCl-CD and NF- ⁇ B p65 in vitro (FIG. 6A, left). By contrast, the MUC1/AQA peptide had little if any effect on this interaction (FIG. 6A, left).
- Treatment of MCF-IOA cells with the MUC1/CQC, but not the MUC1/AQA, peptide also blocked the TNF ⁇ -induced interaction between MUCl-C and NF- KB p65 (FIG. 6A, right).
- ChIP analysis of the MUCl promoter further showed that treatment with the MUC1/CQC peptide decreased TNF ⁇ -induced MUCl-C and NF- ⁇ B p65 occupancy of the NF- ⁇ B binding motif (FIG. 6B).
- MUCl-C directly interacts with STAT3.
- the MUCl-C subunit interacts with certain transcription factors that include p53 (Wei, 2005; Wei, 2006; Wei, 2007).
- anti-STAT3 precipitates from ZR-75-1 breast cancer cells were immunob lotted with an antibody against MUCl-C.
- the results demonstrate that MUCl-C constitutively associates with STAT3 (FIG. 9A, left). Similar results were obtained when coprecipitation studies were performed on MCF-7 breast cancer cells, which also express endogenous MUCl (FIG. 9A, right).
- the structure of STAT3 includes a dimerization domain at the N-terminus, a central DNA binding domain (DBD) and C-terminal transactivation domain (Yu and Jove, 2004) (FIG. 9D).
- DBD central DNA binding domain
- C-terminal transactivation domain Yu and Jove, 2004
- MUCl-C localizes to the nucleus of breast cancer cells (Wei, 2006).
- ChIP chromatin immunoprecipitation
- Precipitation of chromatin from ZR-75-1 cells with anti-STAT3 demonstrated the presence of STAT3 on the STAT binding motif, and not on a control region (CR; +4524 to +4745) (FIG. 1OA, left). ChIP analysis also demonstrated that MUCl-C constitutively occupies the STAT binding site (FIG. 1OA, right). ChIP analysis of the MUCl promoter in MCF-7 cells further demonstrated that both STAT3 and MUCl-C constitutively occupy the STAT binding site and not the control region (FIG. 10B). Moreover, Re-ChIP assays demonstrated that MUCl-C occupies the MUCl promoter with STAT3 in both ZR-75-1 and MCF-7 cells (FIG. 10C).
- IL-6 induces MUCl expression in MCF-IOA breast epithelial cells.
- the non- malignant MCF-IOA breast epithelial cells express endogenous MUCl, but at levels lower than that in ZR-75-1 and MCF-7 breast cancer cells (Ahmad, 2007).
- stimulation of MCF-IOA cells with IL-6 an activator of the STAT3 pathway (Yu and Jove, 2004), was associated with upregulation of MUCl-C expression (FIG. 1 IA, left) and targeting of MUCl- C to the nucleus (FIG. HB, right).
- FIG. HB shows that there was little constitutive association of MUCl-C with STAT3 in the MCF-IOA cells (FIG. HB).
- IL-6 activates the MUCl promoter by a STAT3-dependent mechanism.
- STAT3 is responsible for the IL-6-induced upregulation of MUCl
- the inventors silenced STAT3 in the MCF-IOA cells (FIG. 12A).
- the results demonstrate that IL-6 induces MUCl expression by an IL-6-dependent mechanism (FIG. 12A).
- IL-6 stimulation of MCF- 1OA cells is associated with upregulation of MUCl mRNA levels as determined by RT-PCR (FIG. 12B).
- the MCF-IOA cells were trans fected to express a MUCl promoter- luciferase construct (pMUCl-Luc).
- IL-6 stimulation was associated with activation of pMUCl-Luc expression (FIG. 12C).
- mutation of the STAT binding site in pMUCl-Luc attenuated IL-6-induced activation of the reporter, consistent with activation by STAT3 (FIG. 12C).
- silencing STAT3 blocked activation of pMUCl-Luc in the response to IL-6 (FIG. 12D).
- MUCl-C promotes targeting of STAT3 to the MUCl promoter.
- the inventors silenced MUCl in the MCF-IOA cells (FIG. 13 A, left) and then performed ChIP assays of the MUCl promoter. The results demonstrate that IL-6-induced targeting of STAT3 to the MUCl promoter is attenuated by silencing MUCl (FIG. 13 A, right). In concert with these results, silencing MUCl also attenuated IL-6-induced activation of the pMUCl-Luc reporter (FIG. 13B). In ZR-75-1 cells, silencing MUCl (FIG.
- MUCl-C function blocks IL-6-induced targeting of STAT3 to the MUCl promoter in MCF-IOA cells.
- the inventors synthesized GO-201, a peptide inhibitor of MUCl-C oligomerization and function of the cytoplasmic domain (Raina, 2009).
- a control CP-I peptide was also synthesized that had no effect on MUCl-C function (Raina, 2009).
- GO-201, and not CP-I blocked the interaction between MUCl-CD and STAT3 in vitro (FIG. 14A).
- MUCl-C-terminal CQC Stapled Peptides The intracellular protein-protein interactions that govern many biological pathways are frequently mediated by ⁇ -helix structures of proteins. Helical peptides can also interfere with or stabilize protein-protein interactions. Native helical peptides have major shortcomings as therapeutic agents because of low potency, instability and inefficient delivery to cells. Recent studies have shown that these problems could be overcome by a chemical modification of ⁇ -helical peptides termed as hydrocarbon stapling.
- the inventors used MUCl-C terminal endogenous peptide sequence (AIVYLIALAVCQCRRKNYG) and generated two ⁇ -helical peptides, GO-200-1B and GO- 200-2B using hydrocarbon stapling:
- H-1650 cells were treated with 1 and 5 ⁇ M GO-200-1B for 7 days and monitored for growth.
- the results demonstrate that treatment of cells with 5 ⁇ M GO-200- IB was associated with significant inhibition of growth (FIG. 16A).
- another non- small cell lung carcinoma cell line, H- 1975 was treated with 5 ⁇ M GO-200-2B for 3 days and monitored for cell growth as well as cell death.
- the results demonstrate that treatment of H- 1975 cells with GO-200-2B for 3 days was associated with more than 80% inhibition of cell proliferation.
- GO-200-2B was also associated with significant induction of cell death (FIG. 16B).
- MUCl C-terminal peptide CQCRRKNYGQLDIFP
- CQCRRKN a shorter MUCl -C-terminal peptide
- these MUCl -C-terminal peptides consists of L- amino acids.
- peptides with L-amino acids have susceptible to degradation by proteolytic enzymes, whereas those containing D-amino acids have been shown to be more stable.
- Multiple tumor cell lines (ZR-75-1 Hormone-dependent Breast Carcinoma; MDA- MB-231 Triple-Negative Breast Carcinoma; A549 Non-small Cell Lung Carcinoma; H- 1975 Non-small Cell Lung Carcinoma) were grown in RPMI- 1640 supplemented with 10% heat- inactivated fetal bovine serum, 100 units/mL penicillin and 100 ⁇ g/mL streptomycin and 2 mmol/L L-glutamine. Cells were treated separately with 5 ⁇ M of different analogs of GO- 203 (FIG. 15) for 3 to 7 days and viability was determined by trypan blue exclusion. The proliferation of different cell lines was compared with cells treated with vehicle only. The results demonstrate that treatement of multiple tumor cell lines with 5 ⁇ M of different analogs of GO-203 was associated with significant inhibition of growth (FIGS. 17-21).
- MUCl is sufficient for the induction of anchorage-independent growth and tumorigenicity (Li et al., 2003a; Huang et al, 2003; Huang et al, 2005).
- the MUCl transforming function is abrogated by mutation of the CQC motif in the cytoplasmic domain to AQA (Leng et al, 2007).
- MUCl forms oligomers and the CQC motif is necessary for this oligomerization (Leng et al, 2007).
- oligomer formation is necessary for targeting of the MUCl-C subunit to the nucleus (Leng et al, 2007).
- the inventors synthesized a MUCl -derived peptide that contains the CQC motif and a poly-Arg cell delivery domain for entry into cells.
- Initial studies with this MUC1/CQC peptide showed that it inhibits oligomerization of MUCl-CD in vitro, whereas MUCl /AQA did not.
- uptake of the MUC1/CQC peptide was associated with down-regulation of MUCl-C levels in the nucleus.
- exposure of cells to MUC1/CQC, and not MUC1/AQA was associated with growth arrest and the induction of necrosis.
- MUC1/CQC peptide sensitivity to the MUC1/CQC peptide is dependent on overexpression of MUCl and a function of MUCl associated with the malignant phenotype.
- the MUC1/CQC peptide thus appears to have a dominant-negative activity that is selective for carcinoma cells overexpressing MUCl.
- the inventors found that administration of the MUCl /CQC peptide to tumor bearing mice at 10 and 30 mg/kg/d for 21 d was well-tolerated without apparent acute toxicities, and that treatment at these doses was effective in abrogating tumor growth.
- Administration of the MUCl /CQC peptide at 50 mg/kg/d for 7 d also demonstrated that tumor growth remains arrested for extended periods following treatment.
- MUCl binds to NF- ⁇ B p65 and blocks the I ⁇ B ⁇ interaction.
- the NF KB proteins contain the conserved 300 amino acid RHD that confers DNA binding, dimerization and binding to IKB proteins (Hayden & Ghosh, 2008).
- the present work demonstrates that the MUCl-C subunit associates with NF- ⁇ B p65 in cells and that the MUCl-C cytoplasmic domain binds directly to p65. More detailed binding studies showed that MUCl-CD forms complexes with p65(l-306), but not p65(354-551), indicating that MUCl-CD interacts with the RHD.
- MUCl-CD binds to p65(l 86-306) invoked the possibility that the MUCl-C subunit may interfere with the interaction between I ⁇ B ⁇ and NF -KB p65.
- silencing endogenous MUCl in ZR-75-1 cells is associated with targeting of nuclear NF -KB p65 to the cytoplasm.
- direct binding studies with purified proteins confirmed that MUCl-CD blocks the interaction between NF- ⁇ B p65 and I ⁇ B ⁇ .
- NF- ⁇ B p65 interacts with multiple proteins that affect DNA binding and transcription (Natoli et ah, 2005). However, to the inventors' knowledge, there are no reports of proteins that interact with the NF -KB p65 RHD and interfere with binding of I ⁇ B ⁇ . Thus, based on these findings, the overexpression of MUCl-C in human malignancies could subvert the cytoplasmic retention of NF- ⁇ B p65 by competitively blocking the NF- ⁇ B p65-I ⁇ B ⁇ interaction.
- MUCl increases occupancy of NF- ⁇ B p65 on NF- ⁇ B target genes.
- Nuclear NF -KB activates I ⁇ B ⁇ expression in a negative feed back loop that promotes the formation of new NF- ⁇ B-I ⁇ B ⁇ complexes and shuttling of NF- ⁇ B back to the cytoplasm (Hayden & Ghosh, 2008).
- the association of MUCl-C with NF- ⁇ B p65 could attenuate downregulation of NF- ⁇ B signaling by blocking the interaction with I ⁇ B ⁇ .
- the present results provide support for a model in which binding of MUCl-C to NF -KB p65 results in targeting of NF- ⁇ B p65 to the promoters of NF- ⁇ B target genes (FIG. 6D).
- Stimulation of MCF-IOA epithelial cells with TNF ⁇ was associated with binding of MUCl-C to NF -KB p65 and occupancy of these complexes on the NF- ⁇ B-RE in the Bcl-xL gene promoter.
- NF- ⁇ B p65 occupancy of the Bcl-xL NF- ⁇ B-RE was detectable constitutively and decreased by silencing MUC 1.
- MUCl-C subunit forms oligomers by a mechanism dependent on a CQC motif in the cytoplasmic domain (Leng et al, 2007). MUCl-C oligomerization is necessary for its interaction with importin ⁇ and targeting to the nucleus (Leng et al, 2007). As mentioned above, a 15-mer peptide corresponding to the MUCl cytoplasmic domain that includes the CQC motif blocks oligomerization of MUCl-CD in vitro and of MUCl-C in cells.
- the present results show that the same MUCl /CQC peptide blocks the direct binding of MUCl- CD and NF- ⁇ B p65 in vitro, indicating that MUCl-CD oligomerization is, at least in part, necessary for the interaction.
- the TNF ⁇ -induced association of NF- ⁇ B p65 and MUCl-C in MCF-IOA cells was also blocked by treatment with the MUC1/CQC peptide.
- the specificity of the MUCl /CQC peptide is further supported by the lack of an effect of the mutated MUCl /AQA peptide on the interaction between MUCl-CD and NF- ⁇ B p65 in vitro and in cells.
- Blocking the NF- ⁇ B p65-MUCl-C interaction with the MUC1/CQC peptide was associated with a decrease in occupancy of NF- ⁇ B p65 on the NF -KB binding motif in the MUCl promoter and a decrease in MUCl expression.
- the MUC1/CQC peptide also decreased Bcl-xL expression.
- TNF ⁇ stimulation of TNF receptor 1 induces the formation of cell membrane complexes that lead to the activation of (i) NF- ⁇ B and survival or, alternatively, (ii) caspase-8 and apoptosis (Micheau & Tschopp, 2003; Schneider-Brachert et al, 2004).
- the overexpression of MUCl as found in human breast carcinomas (Kufe et al, 1984), blocks activation of caspase-8 and apoptosis in the response to TNF ⁇ and other death receptor ligands (Agata et al, 2008).
- MUCl-C interacts with caspase-8 and FADD as an induced response to death receptor stimulation and blocks recruitment of caspase-8 to the death receptor complex (Agata et al, 2008).
- Other work has demonstrated that MUCl-C associates with and activates the IKK complex (Ahmad et al, 2007) (FIG. 6D).
- TNF ⁇ -induced upregulation of MUCl-C expression in MCF-IOA cells directly contributes to the activation of NF- ⁇ B p65.
- MUCl-C can activate the NF -KB pathway through interactions with both IKKs and p65, and thereby promote a survival response (FIG. 6D).
- MUCl-C protects against the induction of apoptosis by blocking caspase-8 activation.
- the present findings also indicate that through binding to NF -KB p65, MUCl-C can contribute to activation of the MUCl gene in an auto-inductive loop and, as a result, prolong survival, albeit in a reversible manner.
- MUCl may play a physiologic role in transiently dictating cell fate in the inducible response to death receptor stimulation.
- MUCl-C-NF- ⁇ B p65 regulatory loop could confer a phenotype that is stably resistant to cell death through persistent activation of NF- ⁇ B p65 and inhibition of caspase-8.
- Irreversible activation of a MUCI-C-NF-KB p65 loop and the upregulation of prosurvival NF -KB target genes could also contribute to the MUCl -induced block in the apoptotic response of human carcinoma cells to genotoxic, oxidative and hypoxic stress (Ren et al, 2004; Yin et al, 2003; Raina et al, 2004; Yin et al, 2004; 2007).
- a physiologic mechanism designed to protect epithelial cells during death receptor stimulation may have been exploited by human carcinomas for survival under adverse conditions.
- MUCl-C interacts directly with STAT3.
- Constitutive activation of STAT3 has been identified in a wide variety of human carcinomas, including breast cancer, and certain hematologic malignancies (Aaronson, 2002; Bowman, 2000; Yu, 2004).
- the finding that MUC 1 is constitutively overexpressed in breast and other carcinomas invoked the possibility for interaction between the MUCl and STAT3 pathways.
- the present results demonstrate that the MUCl-C subunit associates with STAT3 in ZR-75-1 and MCF-7 breast cancer cells.
- the interaction between MUCl-C and STAT3 is induced in the response of non- malignant MCF-IOA breast epithelial cells to IL-6 stimulation.
- MUCl-C associates with STAT3 in soluble chromatin and is detectable with STAT3 on the STAT binding site in the MUCl promoter.
- This occupancy of the MUCl promoter STAT binding site by MUCl-C and STAT3 was found to be constitutive in breast cancer cells and inducible by IL-6 in the MCF-IOA breast epithelial cells.
- STAT3 had been previously shown to interact with the MUCl promoter and activate MUCl gene transcription (Gaemers, 2001). However, to the inventors' knowledge, there have been no reports that MUCl-C constitutes part of the STAT3 transcription complex.
- MUCl-C promotes STAT3-mediated transcription.
- the inventors first showed that activation of the MUCl promoter in the response of MCF-IOA cells to IL-6 is indeed mediated by STAT3 and occupancy of STAT3 on the STAT binding site in the MUCl promoter.
- silencing MUCl in the MCF-IOA cells attenuated IL-6-induced targeting of STAT3 to the STAT binding site, indicating that MUCl-C may play a role in initiating STAT3 occupancy of that site or in delaying STAT3 latency.
- MUCl-C also promotes STAT3 -mediated activation of the MUCl promoter
- silencing MUCl in breast cancer cells was associated with decreases in (i) constitutive STAT3 occupancy on the STAT binding site, and (ii) constitutive activation of the MUCl promoter.
- studies were performed with GO-201, an inhibitor of MUCl-C oligomerization (Raina, 2009).
- GO-201 blocked the interaction between the MUCl-C cytoplasmic domain and STAT3 in vitro and in IL-6-stimulated MCF-IOA cells.
- GO-201 also blocked IL-6-induced targeting of MUCl-C and STAT3 to the MUCl promoter, again indicating that MUCl-C promotes STAT3 occupancy of the STAT binding site.
- GO-201 blocked IL-6 induced activation of the MUCl promoter.
- the epithelial cell barrier is exposed to diverse forms of stress, including inflammatory settings associated with production of cytokines, such as tumor necrosis factor ⁇ , interferon- ⁇ and IL-6. Epithelial cells thus need a robust defense mechanism to survive in the presence of such insults.
- the MUCl-C subunit and specifically its cytoplasmic domain is sufficient to confer resistance to death in response to multiple insults, including genotoxic, oxidative and hypoxic stress (Ren, 2004; Raina, 2004; Yin, 2003; Yin, 2004; Yin, 2007).
- IL-6-mediated activation of the STAT3 pathway induces MUCl expression as a potential mechanism to protect against epithelial damage during an inflammatory response.
- MUCl could play a physiologic role in transiently dictating cell fate.
- irreversible activation of MUCl expression through a MUC1-C-STAT3 auto-inductive loop could confer a phenotype that is stably resistant to cell death. Therefore, a physiologic mechanism that protects epithelial cells during an inflammatory response may have been exploited by human breast carcinomas to survive under adverse conditions.
- targeting MUCl-C function could affect constitutive activation of the STAT3 pathway in breast cancer cells.
- compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Cell Biology (AREA)
- Marine Sciences & Fisheries (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2012513262A JP5702371B2 (ja) | 2009-05-27 | 2010-05-27 | Muc1のアンタゴニストを使用した、炎症の阻害 |
| MX2011012625A MX2011012625A (es) | 2009-05-27 | 2010-05-27 | Inhibicion de la inflamacion usando los antagonistas de mucina 1 (muc1). |
| EP20100781227 EP2435062A4 (en) | 2009-05-27 | 2010-05-27 | INHIBITION OF INFLAMMATION USING MUC1 ANTAGONISTS |
| AU2010253834A AU2010253834B2 (en) | 2009-05-27 | 2010-05-27 | Inhibition 0f inflammation using antagonists of MUC1 |
| CN2010800330961A CN102665748A (zh) | 2009-05-27 | 2010-05-27 | 使用muc1拮抗剂抑制炎症 |
| CA2763327A CA2763327C (en) | 2009-05-27 | 2010-05-27 | Inhibition 0f inflammation using antagonists of muc1 |
| IL216612A IL216612A0 (en) | 2009-05-27 | 2011-11-24 | Inhhibition of inflammation using antagonists of muc1 |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US18153009P | 2009-05-27 | 2009-05-27 | |
| US61/181,530 | 2009-05-27 | ||
| US25373009P | 2009-10-21 | 2009-10-21 | |
| US61/253,730 | 2009-10-21 | ||
| US30399710P | 2010-02-12 | 2010-02-12 | |
| US61/303,997 | 2010-02-12 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010138740A1 true WO2010138740A1 (en) | 2010-12-02 |
Family
ID=43223089
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2010/036436 Ceased WO2010138740A1 (en) | 2009-05-27 | 2010-05-27 | Inhibition 0f inflammation using antagonists of muc1 |
Country Status (9)
| Country | Link |
|---|---|
| US (2) | US8614186B2 (enExample) |
| EP (1) | EP2435062A4 (enExample) |
| JP (1) | JP5702371B2 (enExample) |
| CN (1) | CN102665748A (enExample) |
| AU (1) | AU2010253834B2 (enExample) |
| CA (1) | CA2763327C (enExample) |
| IL (1) | IL216612A0 (enExample) |
| MX (1) | MX2011012625A (enExample) |
| WO (1) | WO2010138740A1 (enExample) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103848890A (zh) * | 2012-11-30 | 2014-06-11 | 北京市结核病胸部肿瘤研究所 | Muc1自身抗体识别的抗原多肽 |
| WO2020243787A1 (en) * | 2019-06-06 | 2020-12-10 | The University Of Sydney | Anti-inflammatory agents |
| WO2025217515A3 (en) * | 2024-04-12 | 2025-11-06 | Dana-Farber Cancer Institute, Inc. | Identification of muc1-c as a target for the treatment of squamous cell carcinomas |
Families Citing this family (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8524669B2 (en) | 2008-10-17 | 2013-09-03 | Dana-Farber Cancer Institute, Inc. | MUC-1 cytoplasmic domain peptides as inhibitors of cancer |
| WO2011100688A1 (en) * | 2010-02-12 | 2011-08-18 | Dana-Farber Cancer Institute, Inc. | Improved antagonists of muc1 |
| WO2013026015A1 (en) | 2011-08-18 | 2013-02-21 | Dana-Farber Cancer Institute, Inc. | Muc1 ligand traps for use in treating cancers |
| US9044421B2 (en) | 2012-03-28 | 2015-06-02 | Genus Oncology, Llc | Treating MUC1-expressing cancers with combination therapies |
| WO2013170257A1 (en) * | 2012-05-11 | 2013-11-14 | Dana-Farber Cancer Institute, Inc. | Treating muc1-expressing cancers with helicase inhibitors |
| WO2014164395A1 (en) | 2013-03-11 | 2014-10-09 | Dana-Farber Cancer Institute, Inc. | Combination anti-estrogen receptor cancer therapy using muc1 peptides and chemotherapeutics |
| US10507227B2 (en) | 2014-04-15 | 2019-12-17 | The Hospital For Sick Children | Cationic antimicrobial peptides |
| RU2712452C2 (ru) * | 2014-07-02 | 2020-01-29 | Инфлектис Байосайенс | Новое терапевтическое применение производных бензилиденгуанидина для лечения протеинопатий |
| EP3197474B1 (en) | 2014-09-26 | 2023-06-07 | Rajendra Sahai Bhatnagar | Inhibitors of nf kappa-b activity for treatment of diseases and disorders |
| CA3075440A1 (en) * | 2017-09-13 | 2019-03-21 | B.R.A.H.M.S Gmbh | Pro-adm as a therapy monitoring marker for critcally ill patients |
| CN107952069A (zh) * | 2017-11-24 | 2018-04-24 | 长春百克生物科技股份公司 | 重组疫苗及其应用 |
| CN117929754B (zh) * | 2024-01-25 | 2025-02-11 | 广州医科大学附属第一医院(广州呼吸中心) | Muc1-c段在肺动脉高压预防或治疗药物制备中的应用 |
| WO2025231266A1 (en) * | 2024-05-01 | 2025-11-06 | Emory University | Use of muc1 mimetic peptide inhibitors for inhibition of mucus secretion |
| CN119236051B (zh) * | 2024-09-29 | 2025-12-19 | 北京大学 | Muc1抑制剂在制备预防、治疗细菌感染药物中的应用 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20020086829A1 (en) * | 2000-09-13 | 2002-07-04 | Praecis Pharmaceuticals Inc. | Pharmaceutical compositions for sustained drug delivery |
| US6548643B1 (en) * | 1994-11-16 | 2003-04-15 | Austin Research Institute | Antigen carbohydrate compounds and their use in immunotherapy |
| US20070071675A1 (en) * | 2005-08-19 | 2007-03-29 | Chengbin Wu | Dual variable domain immunoglobulin and uses thereof |
| WO2008121767A2 (en) * | 2007-03-28 | 2008-10-09 | President And Fellows Of Harvard College | Stitched polypeptides |
| US20080286264A1 (en) * | 2005-02-15 | 2008-11-20 | Dana-Farber Cancer Institute, Inc. | Modulation of Muc1 Activity |
Family Cites Families (28)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5595756A (en) | 1993-12-22 | 1997-01-21 | Inex Pharmaceuticals Corporation | Liposomal compositions for enhanced retention of bioactive agents |
| US5912232A (en) * | 1994-09-23 | 1999-06-15 | Board Of Regents Of The University Of Nebraska | Anti-inflammatory polypeptide antagonists of human I1-8 |
| NO961031D0 (no) | 1996-03-13 | 1996-03-13 | Det Norske Radiumshospital Tum | Fremgangsmåte til å drepe uönskede målceller |
| US20020044943A1 (en) * | 1997-09-10 | 2002-04-18 | Longenecker B. Michael | MUC-1 as an immunosuppressive therapeutic agent for the treatment of inflammatory and autoimmune conditions |
| WO2000034468A2 (en) | 1998-12-11 | 2000-06-15 | Biomira Inc. | Muc-1 antagonists and methods of treating immune disorders |
| CA2383737C (en) * | 1999-09-08 | 2011-01-18 | Transgene S.A. | Muc-1 derived peptides |
| JP2003533181A (ja) | 2000-02-01 | 2003-11-11 | ジ・オースティン・リサーチ・インスティテュート | ムチン−1誘導抗原および免疫療法におけるその使用 |
| JP5165175B2 (ja) * | 2000-09-11 | 2013-03-21 | デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド | Muc1細胞外ドメインおよびそれから得られた癌治療組成物 |
| EP1531842A4 (en) | 2000-12-22 | 2007-03-07 | Dana Farber Cancer Inst Inc | REGULATION OF CELL GROWTH BY MUC1 |
| US7118862B2 (en) * | 2001-04-18 | 2006-10-10 | Dana-Farber Cancer Institute, Inc. | Induction of apoptosis by cellular stress |
| US7247297B2 (en) * | 2001-09-14 | 2007-07-24 | The University Of Chicago | Use of DF3/MUC1 regulated expression in gene therapy |
| WO2003034984A2 (en) * | 2001-10-19 | 2003-05-01 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of inflammatory bowel disorders |
| US7696306B2 (en) * | 2003-07-11 | 2010-04-13 | Board of Agents of the University of Nebraska | Compositions and methods for preventing or treating cancer |
| WO2005042573A1 (en) * | 2003-10-24 | 2005-05-12 | Dana-Farber Cancer Institute, Inc. | Modulation of the interaction of muc1 with muc1 ligands |
| EP1538164A1 (en) * | 2003-12-04 | 2005-06-08 | Vectron Therapeutics AG | RGD targeting moiety its production and use |
| WO2005079508A2 (en) | 2004-02-17 | 2005-09-01 | Cancervax Corporation | Method and composition for angiogenesis inhibition |
| JP2007523214A (ja) * | 2004-02-23 | 2007-08-16 | ジェンザイム コーポレイション | デスレセプターリガンド誘導アポトーシスのmuc1アンタゴニスト増強方法 |
| WO2005101021A1 (en) | 2004-04-13 | 2005-10-27 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with g protein-coupled adrenergic alpha-1d-receptor (adra1d) |
| US20070207209A1 (en) | 2004-08-27 | 2007-09-06 | Murphy Christopher J | Trophic factor combinations for nervous system treatment |
| US7767642B2 (en) * | 2005-04-15 | 2010-08-03 | Arizona Biomedical Research Commission | Therapeutic peptides for the treatment of metastatic cancer |
| WO2007024940A2 (en) * | 2005-08-22 | 2007-03-01 | Dana-Farber Cancer Institute, Inc. | Mitochondrial localization of muc1 |
| GB0519303D0 (en) | 2005-09-21 | 2005-11-02 | Oxford Biomedica Ltd | Chemo-immunotherapy method |
| US7972870B2 (en) * | 2007-02-02 | 2011-07-05 | Dana-Farber Cancer Institute, Inc. | Methods and compositions relating to the regulation of MUC1 by HSF1 and STAT3 |
| WO2008097844A2 (en) * | 2007-02-02 | 2008-08-14 | Dana -Farber Cancer Institute, Inc. | Methods and compositions relating to the regulation of apoptosis by muc1 and bh3- containing proapoptotic proteins |
| WO2008101121A2 (en) * | 2007-02-14 | 2008-08-21 | Dana-Farber Cancer Institute, Inc. | Methods and compositions relating to promoter regulation by muc1 and klf proteins |
| US8524669B2 (en) * | 2008-10-17 | 2013-09-03 | Dana-Farber Cancer Institute, Inc. | MUC-1 cytoplasmic domain peptides as inhibitors of cancer |
| WO2011100688A1 (en) * | 2010-02-12 | 2011-08-18 | Dana-Farber Cancer Institute, Inc. | Improved antagonists of muc1 |
| US8952054B2 (en) * | 2010-03-15 | 2015-02-10 | Dana-Farber Cancer Institute, Inc. | Small molecule inhibitors of MUC1 and methods of identifying the same |
-
2010
- 2010-05-27 AU AU2010253834A patent/AU2010253834B2/en not_active Ceased
- 2010-05-27 WO PCT/US2010/036436 patent/WO2010138740A1/en not_active Ceased
- 2010-05-27 CN CN2010800330961A patent/CN102665748A/zh active Pending
- 2010-05-27 EP EP20100781227 patent/EP2435062A4/en not_active Withdrawn
- 2010-05-27 CA CA2763327A patent/CA2763327C/en not_active Expired - Fee Related
- 2010-05-27 US US12/789,127 patent/US8614186B2/en not_active Expired - Fee Related
- 2010-05-27 JP JP2012513262A patent/JP5702371B2/ja not_active Expired - Fee Related
- 2010-05-27 MX MX2011012625A patent/MX2011012625A/es not_active Application Discontinuation
-
2011
- 2011-11-24 IL IL216612A patent/IL216612A0/en unknown
-
2013
- 2013-12-23 US US14/138,521 patent/US9096687B2/en not_active Expired - Fee Related
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6548643B1 (en) * | 1994-11-16 | 2003-04-15 | Austin Research Institute | Antigen carbohydrate compounds and their use in immunotherapy |
| US20020086829A1 (en) * | 2000-09-13 | 2002-07-04 | Praecis Pharmaceuticals Inc. | Pharmaceutical compositions for sustained drug delivery |
| US20080286264A1 (en) * | 2005-02-15 | 2008-11-20 | Dana-Farber Cancer Institute, Inc. | Modulation of Muc1 Activity |
| US20070071675A1 (en) * | 2005-08-19 | 2007-03-29 | Chengbin Wu | Dual variable domain immunoglobulin and uses thereof |
| WO2008121767A2 (en) * | 2007-03-28 | 2008-10-09 | President And Fellows Of Harvard College | Stitched polypeptides |
Non-Patent Citations (9)
| Title |
|---|
| ANDERSON ET AL.: "Multiple Myeloma: New Insights and Therapeutic Approaches Hematology", HEMATOLOGY, 2000, pages 147 - 165, XP008148796 * |
| ARKIN ET AL.: "Structural aspects of oligomerization taking place between the transmembrane a- helices of bitopic membrane proteins.", BIOCHIMICA ET BIOPHYSICA ACTA, vol. 1565, 2002, pages 347 - 363, XP004390077 * |
| BEATTY ET AL.: "Cutting Edge: Transgenic Expression of Human MUC1 in IL-10 -/- Mice Accelerates Inflammatory Bowel Disease and Progression to Colon Cancer.", J. IMMUNOL., vol. 179, 2007, pages 735 - 739, XP008148773 * |
| BEGUM ET AL.: "Muc1 Based Breast Cancer Vaccines: Role of Post Translational Modifications..", J AYUB MED COLL ABBOTTABAD, vol. 20, no. 4, 2008, pages 130 - 133, XP008148768 * |
| KAWANO ET AL.: "MUC1 oncoprotein promotes growth and survival of human multiple myeloma cells.", INTERNATIONAL JOURNAL OF ONCOLOGY., vol. 33, 2008, pages 153 - 159, XP008148780 * |
| KINLOUGH ET AL.: "Recycling of MUC1 Is Dependent on Its Palmitoylation.", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 281, no. 17, 28 April 2006 (2006-04-28), pages 12112 - 12122, XP008148774 * |
| LENG ET AL.: "Nuclear Import of the MUC1-C Oncoprotein Is Mediated by Nucleoporin Nup62.", THE JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 282, no. 27, July 2007 (2007-07-01), pages 19321 - 19330, XP002604941 * |
| PECZUH ET AL.: "Peptide and Protein Recognition by Designed Molecules.", CHEM. REV., vol. 100, 2000, pages 2479 - 2494, XP008148767 * |
| See also references of EP2435062A4 * |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN103848890A (zh) * | 2012-11-30 | 2014-06-11 | 北京市结核病胸部肿瘤研究所 | Muc1自身抗体识别的抗原多肽 |
| CN103848890B (zh) * | 2012-11-30 | 2015-09-09 | 北京市结核病胸部肿瘤研究所 | Muc1自身抗体识别的抗原多肽 |
| WO2020243787A1 (en) * | 2019-06-06 | 2020-12-10 | The University Of Sydney | Anti-inflammatory agents |
| CN114555624A (zh) * | 2019-06-06 | 2022-05-27 | 悉尼大学 | 抗炎剂 |
| EP3980440A4 (en) * | 2019-06-06 | 2023-07-05 | The University Of Sydney | Anti-inflammatory agents |
| WO2025217515A3 (en) * | 2024-04-12 | 2025-11-06 | Dana-Farber Cancer Institute, Inc. | Identification of muc1-c as a target for the treatment of squamous cell carcinomas |
Also Published As
| Publication number | Publication date |
|---|---|
| US9096687B2 (en) | 2015-08-04 |
| JP2012528191A (ja) | 2012-11-12 |
| JP5702371B2 (ja) | 2015-04-15 |
| CA2763327A1 (en) | 2010-12-02 |
| CN102665748A (zh) | 2012-09-12 |
| IL216612A0 (en) | 2012-02-29 |
| MX2011012625A (es) | 2012-04-20 |
| AU2010253834B2 (en) | 2013-12-19 |
| CA2763327C (en) | 2019-04-02 |
| AU2010253834A1 (en) | 2011-12-08 |
| US20140187494A1 (en) | 2014-07-03 |
| EP2435062A4 (en) | 2013-01-02 |
| US8614186B2 (en) | 2013-12-24 |
| EP2435062A1 (en) | 2012-04-04 |
| US20110015138A1 (en) | 2011-01-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9096687B2 (en) | Inhibition of inflammation using antagonists of MUC1 | |
| US9546201B2 (en) | MUC-1 cytoplasmic domain peptides as inhibitors of cancer | |
| US20140322332A1 (en) | Antagonists of muc1 | |
| US8952054B2 (en) | Small molecule inhibitors of MUC1 and methods of identifying the same | |
| CN115960249A (zh) | 用于组织修复的双特异性治疗性蛋白质 | |
| CN114026114B (zh) | 用于治疗再灌注损伤的bnip3肽 | |
| TW201200151A (en) | Methods and compositions related to reduced MET phosphorylation by leukocyte cell-derived chemotaxin 2 in tumor cells | |
| HK1160795B (en) | Muc-1 cytoplasmic domain peptides as inhibitors of cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080033096.1 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10781227 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010253834 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2763327 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012513262 Country of ref document: JP Ref document number: MX/A/2011/012625 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2010253834 Country of ref document: AU Date of ref document: 20100527 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010781227 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |