WO2010080909A1 - Compositions and methods of use of an oncolytic vesicular stomatitis virus - Google Patents

Compositions and methods of use of an oncolytic vesicular stomatitis virus Download PDF

Info

Publication number
WO2010080909A1
WO2010080909A1 PCT/US2010/020370 US2010020370W WO2010080909A1 WO 2010080909 A1 WO2010080909 A1 WO 2010080909A1 US 2010020370 W US2010020370 W US 2010020370W WO 2010080909 A1 WO2010080909 A1 WO 2010080909A1
Authority
WO
WIPO (PCT)
Prior art keywords
vsv
virus
seq
tumor
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/020370
Other languages
French (fr)
Other versions
WO2010080909A9 (en
Inventor
Anthony N. Van Den Pol
Guido Wollmann
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Yale University
Original Assignee
Yale University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Yale University filed Critical Yale University
Publication of WO2010080909A1 publication Critical patent/WO2010080909A1/en
Priority to PCT/US2010/055480 priority Critical patent/WO2011056993A1/en
Publication of WO2010080909A9 publication Critical patent/WO2010080909A9/en
Anticipated expiration legal-status Critical
Priority to US13/464,692 priority patent/US20120315248A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/20011Rhabdoviridae
    • C12N2760/20211Vesiculovirus, e.g. vesicular stomatitis Indiana virus
    • C12N2760/20222New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/20011Rhabdoviridae
    • C12N2760/20211Vesiculovirus, e.g. vesicular stomatitis Indiana virus
    • C12N2760/20232Use of virus as therapeutic agent, other than vaccine, e.g. as cytolytic agent

Definitions

  • the present application is generally related to oncolytic vesicular stomatitis viruses and compositions and methods of use for treatment of cancer.
  • chemotherapeutic agents that selectively target the more rapidly proliferating tumor cells relative to the host cells. These have serious side effects, including death of normal cells, mucositis, nausea, and may give rise to drug resistant tumor cells.
  • Antibodies and antibody targeted therapeutics are a desirable alternative to chemotherapeutics since they are more selective, but are limited to the few tumors expressing antigens that can be effectively targeted.
  • Drugs that inhibit angiogenesis are another approach having fewer side effects, but have been found to only limit tumor growth, not kill existing tumors.
  • Viruses are an alternative approach for combating cancer.
  • One approach to treating tumors is to use replication-incompetent viral vectors to deliver genes to the tumor.
  • Replication-incompetent viruses have value in delivering genes to the area of the tumor that might then alter the general environment near the tumor, making it less hospitable to the tumor.
  • viral vectors including delivery of suicide genes such as HSV-tk or ricin, genes that reduce vascular proliferation, restore cell cycle control and encourage apoptosis such as p53, or stimulate an immune response (IL- 12, interferon, tumor necrosis factor).
  • conditional replication competent viruses are that they infect and kill tumor cells, and then their new viral progeny are released to kill additional tumor cells.
  • a small injection of replication competent VSV or Sindbis virus can lead to a rapid and complete intratumoral spread of the virus.
  • replication competent viruses may be effective with one single application, whereas repetitive injections have to be applied for the less effective replication incompetent agents.
  • a number of viruses have been shown to have oncolytic potential, including recombinant herpes, adeno, polio and alpha viruses.
  • Myxoma virus was effective in killing medulloblastoma, and infection was increased in combination with Rapamycin (Lun, et al, Cancer Res., 67(18):8818-8827 (2007).
  • Herpes simplex virus has been rendered conditionally replication-competent for tumors by inserting mutations in several HSV genes.
  • Oncolytic adenovirus agents specifically restrict their replication to p53 deficient tumor cells, and retrovirus to tumors with activated Ras-signaling pathways (Chiocca, Nat. Rev. Cancer, 2: 938-950 (2002); Rainov and Ren, Acta Neurochir Suppl, 88:113-123 (2003)). These strategies are restricted to defined mutations of the tumor.
  • Oncolytic viruses that are not strictly dependent on a single gene mutation are therefore desirable to treat cancers that exhibit a heterogenous array of genetic aberrations.
  • One replication competent virus with oncolytic potential is vesicular stomatitis virus (VSV) (Lun, et al. J. Nat. Can. Instil, 98(21): 1546-1557 (2006), Wu, et al., Clin. Cancer Res., 14(4):1218-1227 (2008), Ozduman, et al., J. Virol. , 83(22): 11540-11549 (2009), Wollmarra, et al., J Virol, (2009 Epub; 2010 J.
  • VSV vesicular stomatitis virus
  • Virology 84(3).VSV is an RNA virus that uses a negative strand RNA to encode its genome. Although some viruses may express over a hundred different genes, VSV with its 11-12 kilobase genome encodes five structural genes, N, P, M, G, and L, encoding proteins that each may have multiple functions.
  • the virus envelope consists of a host cell-derived lipid bilayer that contains several hundred copies of viral glycoprotein spikes (G- protein) and forms a characteristic bullet shape.
  • G- protein viral glycoprotein spikes
  • the nucleocapsid protein N forms a tight complex with the helical coiled non-segmented RNA genome and the viral matrix protein M bridges the gap between nucleocapsid and viral envelope.
  • a complex formed by the phosphoprotein P and the large polymerase L facilitates viral polymerase activity.
  • Phosphorylation is thought to play a role in the function of the of P protein, for example, unphosphorylated P is much less active in supporting viral transcription at low concentrations (Spadafora et al., J. Virol, 70(7): 45-38-4548 (1996)).
  • VSV binds to the cell membrane, becomes internalized, and then replicates in the cell cytoplasm. VSV replicates fairly quickly, about 6 hours for progeny virus to bud from the plasma membrane of the infected cell. A single infected cell can release many VSV progeny, although some of the progeny are defective particles.
  • VSV blocks the ability of infected cells to transport mRNA out of the nucleus (VSV M-protein blocks nuclear pores), and usurps the host cell translational mechanisms to synthesize primarily viral gene products.
  • VSV is found around the world. Many mammals, including humans, can be infected by the vims which is probably spread by biting flies (de Mattos et al. In Fields of Virology, pp. 1245-1277, (Knipe, et al., Eds) (2001)). Humans show only modest symptoms, or none, with infection which clears as the immune system eliminates the virus.
  • Replication competent VSVs are in human clinical trials as a carrier virus to generate immune responses against more dangerous viruses, including HIV, influenza, and papilloma viruses cloned into the VSV genome (Roberts, et al., J Virol, 73:3723-32 (1999); Roberts, et al., J Virol, 78: 3196-3199 (2004); Okuma et al., J. Virol. 346(1 ):86-97 (2006); Rose et al., Cell, 106:539-549 (2001)).
  • VSV has demonstrated potential as an oncolytic virus, hi a battery of in vitro and in vivo tests, VSV showed the greatest promise among nine replication competent viruses including Sindbis, human and mouse cytomegalovirus, pseudorabies virus, the parvoviruses MVMi and MVMp, and others that have been described as having oncolytic potential (Wollmann et al, J Virol, 79(10): 6005-6022 (2005)). Normal cells possess innate mechanisms to reduce or block viral infections. VSV replication can be attenuated or blocked by cellular interferon (IFN). Defects in this system are thought to contribute to the oncolytic activity of VSV (Wollmann, et al. s J Virol, 81(3):1479-1491 (2007)).
  • IFN cellular interferon
  • VSV has also shown promise outside the brain as an anti-cancer agent in recent experimental studies on various solid tumors, for example carcinoma of colon (Stojdl et al., Cancer Cell, 4:263-275 (2003)), breast (Ebert et al., Cancer Gene Ther, 12:350-358 (2005)), prostate (Ahmed et al., Virology, 330:34-49 (2004)) and liver (Shinozaki et al, 2005) or hematological malignancies such as leukemia (Lichty et al., 2004b).
  • VSV-rp30 a recombinant wildtype-based VSV expressing a gene coding for green fluorescent protein (GFP), VSV-G/GFP (7,30) was grown for many generations on human glioblastoma cancer cells using a protocol that enhanced viral fitness based on viral internalization, replication, and cell selectivity.
  • GFP green fluorescent protein
  • VSV-rp30 Wang et al, J Virol, 79(10): 6005-6022 (2005), Ozduman, et al., J ofNeurosci.
  • VSV-rp30 and less effective VSV viruses, such as the parent strain, would provide an avenue for development of a range of oncolytic viruses with improved oncolytic potential for anti-cancer therapeutics.
  • Oncolytic VSV viruses have been developed as a strategy for combating cancer, where the virus selectively infect, and kill, tumor cells.
  • Mutant VSV that have one or more mutations in the nucleic acid sequence encoding the viral genome, specifically, mutations in the P and/or L proteins enhance the oncolytic potential, of the virus.
  • Some viruses have more than one mutation.
  • a virus can have mutations of both the L and P proteins.
  • An exemplary virus is VSV-rp30.
  • viruses are modified to include one or more targeting or therapeutic proteins.
  • viral genes are substituted or rearranged to modulate infectivity and replication frequency of the virus.
  • compositions containing virus and one or more excipients may be systemically or locally administered.
  • compositions are administered for the treatment of benign or malignant tumors.
  • administration of the virus reduces one or more symptoms of a tumor.
  • routes of administration include intratumoral, intravenous, and intraarterial injection, and intranasal delivery.
  • compositions containing oncolytic viruses may be coupled with surgical, radiologic, other therapeutic approaches to treatment of cancer.
  • co-administration of virus with an immunosuppressant will preferentially reduce or inhibit the subject's immune response, extending the infective half-life of the virus.
  • Compositions containing virus can also be co-administered with traditional cancer treatments such as chemotherapy.
  • Additional mutant VSV viruses exhibiting desired properties can be developed by applying selective pressure, or through directed or random mutagenesis.
  • IA 5 IB, 1C, ID 5 and IE are graphs illustrating VSV-rp30 oncolysis of five tumor cell lines: (IA) Mcf-7 human breast cancer cells, (IB) T47-D human breast cancer cells, (1C) BT-474 human breast cancer cells, (1 D) A-549 human lung cancer cells, and (1 E) CaIu- 1 human lung cancer cells.
  • Each graph illustrates the % infected cells (line rising from bottom left to top right), and cells with intact morphology (line falling from top left to bottom right), as a function of time (hours).
  • FIG. 2 is a schematic comparing VSV genomes, as indicated.
  • the five viral genes are labeled, N, P, M, G and L. Additional genes including Green Fluorescent Protein (GFP) arid G/GFP fusion are also indicated. Mutations are identified with an arrow head.
  • S126L indicates a serine to leucine substitution as codon 126 of the P protein
  • D223Y indicates an aspartic acid to tyrosine substitution at codon 223 of the L protein of VSV- rp30.
  • M51 indicates a deletion of the methionine at position 51 of the M protein
  • CT9 indicates deletion of all but 9 of the 27 amino acids of the C-terminal cytoplasmic tail in VSV-M51/CT9.
  • Figure 3 is a chart illustrating the plaque size (diameter) that developed in the monolayer of 11 cancer cell lines (as labeled from top to bottom above the dotted line) and 3 non-cancer cell lines (as labeled from top to bottom below the dotted line) following infection with 4 different VSV viruses (as labeled from left to right).
  • Each circle represents the mean of 30 randomly selected plaques measured across their diameter, then normalized with respect to the corresponding VSV-G/GFP mean plaque diameter. Small marks at the top of each circle represent standard error of the mean. "NS" indicates the only plaques that were not statistically different (p ⁇ 0.05).
  • Figure 4 is a chart illustrating the plaque size (black circles) compared to EthD-1 labeled cytotoxic areas (white circles) that developed in the monolayer of four cancer cell lines (as labeled from top to bottom) following infection with 4 different VSV viruses (as labeled from left to right). Measurements were collected and normalized as in Figure 3.
  • Figure 5 A is a diagram depicting the series of six overlapping PCR products derived from the amplification of the VSV genomic cDNA and used for sequencing. Sequencing primers are illustrated with arrows.
  • Figure 5B is a schematic of the parent VSV-G/GFP genome, and illustrates the positions of the four mutations (C1772T, G7693T, A11712G, C11736) identified in the variant VSV-rp30.
  • Figure 5C is a section of the sequencing chromatographs of both the parent, VSV-G/GFP (top) and mutated VSV- rp30 (bottom) codons.
  • Figures 6A, 6B, and 6C are bar graphs illustrating the average plaque diameters (%) of VSV-rp30 plaques (black bars) relative to VSV-G/GFP plaques (white bars) on U-373MG cell monolayers after treatment of increasing concentrations (left to right), of different kinase inhibitors: (6A) Staurosporine (nM), (6B) Genistein ( ⁇ M), and (6C) Tyrphostin 51 ( ⁇ M).
  • Figures 7 A, 7B and 7C are a schematized general outline of VSV oncolysis in the SCID mouse brain tumor model. After intravenous injection (7A), VSV-rp30 infection starts at few scattered foci (7B) around the brain tumor vasculature and spreads to infect the entire tumor (7C).
  • Figure 8 is a bar graph illustrating tumor area (%) as a function of time post-infection.
  • Tumor infectivity (% of tumor GFP-positive) is represented by vertical bars from the bottom up: left hand bar represents the parent virus VSV-G/GFP and the right hand bar represents the mutant virus VSV-rp30 for each time point (24, 48, 72 hours, left to right).
  • Intact tumor (%) infected with each virus is represented by vertical bars from the top down.
  • the black space between each top and bottom bar represents tumor debris (%)
  • Figure 9A is a bar graph illustrating the number of tumor cells with intact morphology as a function of hours post infection (HPI) with VSV- rp30.
  • Figure 9B is a bar graph illustrating the number tumor cell nuclei with intact morphology as a function of hours post infection (HPI) with VSV- rp30.
  • Figure 9C is a bar graph illustrating the number of apoptotic tumor cells as a function of hours post infection (HPI) with VSV-rp30.
  • Figure 10 is a bar graph illustrating the percent of apoptotic cells in various tumor xenograft models infected with VSV-rp30 by intravenous injection. From left to right bars represent Ul 18 (glioma) tumor in T- and B- deficient SCID mouse, 4Tl (mouse mammary carcinoma) tumor in SCID mouse, and rU87 (glioma) tumor in nude mouse.
  • Figure 11 is a graph showing the percent surface area infected of glioma tumor in a mouse brain as a function of time (hours) following infection with VSV-rp30.
  • Figurel2A is a bar graph illustrating the relative VSV quantity (%) cell surface bound to normal human astrocytes (Astro) or rU87 glioma cells 20 min after infection.
  • Figure 12B is a bar graph illustrating the relative VSV quantity (%) cell surface bound and intracellular to/in normal human astrocytes (Astro) or rU87 glioma cells 30 min after infection.
  • Figure 12C is a bar graph illustrating the relative VSV quantity (%) in endosomes in normal human astrocytes (Astro) or rU87 glioma cells 90 min after infection.
  • Figure 12D is a bar graph illustrating the relative VSV quantity (%) in intracellular in normal human astrocytes (Astro) or rU87 glioma cells 90 min after infection.
  • isolated is meant to describe a compound of interest (e.g., either a polynucleotide or a polypeptide) that is in an environment different from that in which the compound naturally occurs e.g. separated from its natural milieu such as by concentrating a peptide to a concentration at which it is not found in nature. "Isolated” is meant to include compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified.
  • nucleic acid(s) refers to any nucleic acid containing molecule, including, but not limited to, DNA or RNA.
  • the term encompasses sequences that include any of the known base analogs of DNA and RNA including, but not limited to, 4-acetylcytosine, 8-hydroxy-N6- methyladenosine, aziridinylcytosine, pseudoisocytosine, 5-
  • uracil (carboxyhydroxylmethyl) uracil, 5-fluorouracil, 5-bromouracil, 5- carboxyme ⁇ ylaminomethyl-2-thiouracil, 5- carboxymethylaminomethyluracil, dihydrouracil, inosine, N6- isopentenyladenine, 1-methyladenine, 1-methylpseudouracil, 1- methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2- methylguanine, 3-methylcytosine, 5-methylcytosine, N6-methyladenine, 7- methylguanine, 5-methylaminomethyluracil, 5-methoxy-aminomethyl-2- thiouracil, beta-D-marmosylqueosine, 5'-methoxycarbonylmethyluracil, 5- methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil- 5 -oxyacetic acid methylester
  • nucleic acid sequences are denominated by either a three letter, or single letter code as indicated as follows: adenine (Ade, A), thymine (Thy, T), guanine (Gua, G) cytosine (Cyt, C), uracil (Ura, U).
  • polynucleotide refers to a chain of nucleotides of any length, regardless of modification (e.g., methylation).
  • gene refers to a nucleic acid (e.g., DNA or RNA) sequence that comprises coding sequences necessary for the production of a polypeptide, RNA (e.g., including but not limited to, mRNA, tRNA and rRNA) or precursor.
  • RNA e.g., including but not limited to, mRNA, tRNA and rRNA
  • the polypeptide, RNA, or precursor can be encoded by a full length coding sequence or by any portion thereof.
  • the term also encompasses the coding region of a structural gene and the sequences located adjacent to the coding region on both the 5' and 3' ends for a distance of about 1 kb on either end such that the gene corresponds to the length of the full-length mRNA.
  • the term "gene” encompasses both cDNA and genomic forms of a gene, which may be made of DNA, or RNA.
  • a genomic form or clone of a gene may contain the coding region interrupted with non-coding sequences termed "nitrons" or "intervening regions” or “intervening sequences.”
  • Introns are segments of a gene that are transcribed into nuclear RNA (hnRNA); introns may contain regulatory elements such as enhancers.
  • Introns are removed or "spliced out” from the nuclear or primary transcript; introns therefore are absent in the messenger RNA (mRNA) transcript.
  • the mRNA functions during translation to specify the sequence or order of amino acids in a nascent polypeptide.
  • nucleic acid molecule encoding refers to the order or sequence of nucleotides along a strand of nucleotides. The order of these nucleotides determines the order of amino acids along the polypeptide (protein) chain.
  • amino acid sequence thus codes for the amino acid sequence
  • polypeptide refers to a chain of amino acids of any length, regardless of modification (e.g., phosphorylation or glycosylation).
  • amino acid residue sequences are denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg 5 R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (GIn, Q), Glutamic Acid (GIu, E), Glycine (GIy, G), Histidine (His, H), Isoleucine (He, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S) 5 Threonine (Thr,
  • a "variant,” “mutant,” or “mutated” polynucleotide contains at least one polynucleotide sequence alteration as compared to the polynucleotide sequence of the corresponding wild-type or parent polynucleotide.
  • a “variant,” “mutant,” or “mutated” polypeptide contains at least one amino acid sequence alteration as compared to the amino acid sequence of the corresponding wild-type, or parent polypeptide. Mutations may be natural, deliberate, or accidental.
  • nucleic acid sequence alteration can be, for example, a substitution, a deletion, or an insertion of one or more nucleotides.
  • amino acid sequence alteration can be, for example, a substitution, a deletion, or an insertion of one or more amino acids.
  • a "vector” is a replicon, such as a plasmid, phage, or cosraid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment.
  • the vectors described herein can be expression vectors.
  • the term "effective amount” or “therapeutically effective amount” means a dosage sufficient to treat, inhibit, or alleviate one or more symptoms of a disease state being treated or to otherwise provide a desired pharmacologic and/or physiologic effect.
  • the precise dosage will vary according to a variety of factors such as subject-dependent variables (e.g., age, immune system health, etc.), the disease, and the treatment being effected.
  • Neoplastic cells As used herein, the terms “neoplastic cells,” “neoplasia,” “tumor,” “tumor cells,” “cancer” and “cancer cells, “ (used interchangeably) refer to cells which exhibit relatively autonomous growth, so that they exhibit an aberrant growth phenotype characterized by a significant loss of control of cell proliferation (i.e., de-regulated cell division). Neoplastic cells can be malignant or benign.
  • VSV-rp30 and “VSV-rp30a” are used interchangeably, and refer to a mutant VSV with improved oncolytic potential compared to the parent strain VSV-G/GFP.
  • viruses disclosed herein may be "native" or naturally-occuring viruses, or engineered viruses, such as recombinant viruses. Mutations are introduced into the viral genome to provide viruses with enhanced selectivity and cytolytic activity for cells of interest, such as cancer cells.
  • Oncolytic Viruses The present invention includes mutant VSV that have one or more mutations in the nucleic acid sequence encoding the viral genome.
  • the mutations may reduce or inhibit post translational phosphorylation of viral proteins, or may work well due to other independent mechanisms. Changes in post translational phosphorylation of viral proteins, such as the P and/or L proteins, may increase the specificity or infectivity of oncolytic viruses. Increasing the specificity or infectivity of a virus for one or more types of cancers compared to normal cells increases the oncolytic potential of the virus.
  • a protein kinase is an enzyme that modifies proteins by covalently adding phosphate groups to them in a chemical reaction known as phosphorylation. Phosphorylation can cause a functional change of the phosphorylated protein, such changing enzyme activity, cellular location, or association with other proteins.
  • the amino acids serine, threonine, and tyrosine, and sometimes others such as bJstidine, can be phosphorylated in the presence of a kinase.
  • Cells contain a number of kinases, and each kinase may be capable of phosphorylating one or more amino acids.
  • kinases phosphorylate serine and theronine, while others phosphorylate serine, theronine, and tyrosine.
  • Changes in the nucleic acid sequence of viral genes have the potential to increase or decrease the post translational phosphorylation of viral proteins, by increasing or decreasing the number of amino acids that can be phosphorylated. Mutations altering the phophorylation of viral proteins will become apparent when viral genes are translated in the presence of kinases, such as cellular kinases.
  • the mutant virus has one or more mutations in at least one codon in the viral genome encoding a phosphorylation site.
  • the mutation is designed to inhibit phosphorylation of at least one phosphorylation site.
  • the mutation can result in amino acid insertions, deletions, and/or substitutions, introduced at the phosphorylation sites in order to block phosphorylation.
  • the mutation can result in substitution of at least one serine, threonine, and/or tyrosine, amino acid by an amino acid, such as alanine.
  • the mutation can result in amino acid insertions, deletions, and/or substitutions that reduce or inhibit phosphorylation of a serine, threonine, or tyrosine by sterically blocking kinase activity.
  • Mutations may promote or increase post translational phosphorylation of viral proteins in the presence of a kinase.
  • the mutant virus has one or more mutations in at least one codon in the viral genome encoding an amino acid that is not phosphorylated, such that the substituted amino acid can be phosphorylated in the presence of a kinase. Substitutions may be made at any amino acid such that phosphorylation of the viral protein is increased.
  • the mutation can be a substitution from any amino acid that can not be phosphorylated, to an amino acid that can be phosphorylated, such as an alanine to a serine, threonine, or tyrosine.
  • the mutation can result in amino acid insertions, deletions, and/or substitutions introduced adjacent to phosphorylation sites in order to increase or promote phosphorylation in the presence of kinase. For example, removal of amino acids that sterically block phosphorylation of another amino acid may be replaced or deleted. Mutations in one or more codons in the viral genome resulting in the substitution of one phosphorylation site or another phosphorylation site are are also considered. For example a serine can be replaced by threonine. Substitution of the amino acid at phosphorylation sites may increase, decrease, or otherwise alter the phosphorylation of viral proteins by presenting an alternative substrate for the available cellular kinases.
  • one or more mutations in at least one codon in the viral genome of a self-replicating VSV genome alters the phosphorylation of the P protein, the L protein, or a combination thereof.
  • Non-limiting illustrations of mutations that alter the phosphorylation of the P protein, and the L protein are described in the examples below.
  • VSV-G/GFP is an oncolytic VSV virus with a genome encoded by nucleic acid SEQ ID 1 which is a cDNA sense strand.
  • the P protein of VSV-G/GFP (SEQ ID NO: 3) is encoded by the nucleic acids between 1396-2193 of SEQ ID NO: 1 (SEQ ID NO: 2).
  • the L protein of VSV-G/GFP (SEQ ID NO: 5) is encoded by the nucleic acids between 7027-13356 of SEQ ID NO:1 (SEQ ID NO: 4).
  • the L protein has an amino acid SEQ ID NO: 5.
  • the virus has a mutation in codon 126 of
  • SEQ ID NO: 3 encoding the P protein.
  • the mutation in codon 126 of SEQ ID NO: 3 results in replacement of the serine (S), with another amino acid such alanine (A), arginine (R), asparagine (N) 5 aspartic acid (D) 5 cysteine (C), glutamine (Q), glutamic acid (E), glycine (G), histidine (H), isoleucine (I), leucine (L), lysine (K), methionine (M), phenylalanine (F), proline (P), tryptophan (W), or valine (V).
  • the mutation in codon 126 of SEQ ID 3 results in replacement of the serine (S) with a leucine (L) (S126L substitution).
  • the mutation is a C1772T mutation in nucleic acid SEQ ID NO: 1.
  • the virus has a mutation in codon 223 of SEQ ID NO: 5 encoding the L protein.
  • the mutation in codon 223 results in a replacement of the asparagine (D) with a serine (S), threonine (T), or tyrosine (Y).
  • the mutation in codon 223 results in a replacement of the asparagine (D) in VSV-G/GFP with a tyrosine (Y) (D223Y substitution).
  • the mutation is a G7693T mutation that appears in nucleic acid SEQ ID NO: L
  • This mutation may or may not alter phosphorylation state.
  • a virus can have mutations that result in a decrease in the phosphorylation of both the P and L proteins. Mutations of more than one nucleic acid are also possible, and may result in altered phosphorylation of both the P and L proteins at the same time. For example, a virus can have mutations that result in an increase in phosphorylation of the P protein and a decrease in the phosphorylation of the L protein.
  • the composition includes a virus with a decrease in phosphorylation of the P protein and an increase in the phosphorylation of the L protein-
  • the composition includes a VSV with both a S126L substitution in the P protein encoded by SEQ ID NO: 3 and a D223Y substitution in the L protein encoded by SEQ ID NO 5.
  • the virus is VSV-rp30 encoded by SEQ ID NO: 6 which is a cDNA sense strand
  • VSV-rp30 was generated by growing VSV for many generations on glioblastoma cells, and the resultant virus displayed enhanced infection of the U87 glioblastoma line on which the virus had been cell-adapted, and on other glioblastoma lines (Wollmann et al, J Virol., 79(10): 6005-6022 (2005)). The resulting change in phenotype was achieved by combining VSVs inherent potential to adapt to different hosts with the application of selective pressure during viral propagation. Sequencing VSV-rp30 identified two amino acid-altering mutations.
  • VSV is highly immunogenic, and a substantial B and T cell response from the adaptive immune system will ultimately limit VSV infection, which is good from the perspective that it will halt runaway long-lasting viral infections.
  • a virus that shows enhanced selectivity, and a faster rate of infection, will have a greater likelihood of eliminating cancer cells before the virus is eliminated by the immune system.
  • the use of VSV against cancer cells does not have to be restricted to a single application.
  • VSVrp30 may be desirable to rearrange the VSVrp30 genome. For example, shifting the L-gene to the sixth position, by rearrangement or insertion of an additional gene upstream, can result in attenuated L-protein synthesis and a slight reduction in replication (Dalton and Rose, Virology, 279(2):414-21 (2001 )), an advantage when considering treatment of the brain. Additional examples of attenuating VSV viruses by gene shifting, gene truncations, gene deletions, and combinations thereof, are described in Wollmann, et al., J. Virol., (2009) Epub; J. Virol. 84(3): (2010))
  • Viruses may be modified to express one or more targeting or therapeutic proteins, separately or as a part of other expressed proteins.
  • the viral genome of VSV has the capacity to accommodate additional genetic material. At least two additional transcription units, totaling 4.5 kb, can be added to the genome, and methods for doing so are known in the art.
  • the added genes are stably maintained in the genome upon repeated passage (Schnell, et al., EMBO Journal, 17:1289-1296 (1998); Schnell, et al., PNAS, 93: 11359-11365 (1996); Schnell, et al., Journal of Virology, 70:2318-2323 (1996); Kahn, et al., Virology, 254, 81-91 (1999)).
  • Viruses can be engineered to include one or more additional genes that target the virus to cells of interest, see for example U.S. Patent No. 7,429,481.
  • expression of the gene results in expression of a ligand on the surface of the virus containing one or more domains that bind to antigens, ligands or receptors that are specific to tumor cells, or are upregulated in tumor cells compared to normal tissue.
  • virus can be engineered to bind to antigens, Hgands or receptors that are specific to tumor cells or tumor-associated neovasculature, or are upregulated in tumor cells or tumor-associated neovasculature compared to normal tissue.
  • Antigens, ligands and receptors to target can be engineered to bind to antigens, Hgands or receptors that are specific to tumor cells or tumor-associated neovasculature, or are upregulated in tumor cells or tumor-associated neovasculature compared to normal tissue.
  • the viral surface contains a domain that specifically binds to an antigen that is expressed by tumor cells.
  • the antigen expressed by the tumor may be specific to the tumor, or may be expressed at a higher level on the tumor cells as compared to non-tumor cells.
  • Antigenic markers such as serologically defined markers known as tumor associated antigens, which are either uniquely expressed by cancer cells or are present at markedly higher levels (e.g., elevated in a statistically significant manner) in subjects having a malignant condition relative to appropriate controls, are known.
  • Tumor-associated antigens may include, for example, cellular oncogene-encoded products or aberrantly expressed proto-oncogene-encoded products (e.g., products encoded by the neu, ras, trk, and kit genes), or mutated forms of growth factor receptor or receptor-Hke cell surface molecules (e.g., surface receptor encoded by the c-erb B gene).
  • Other tumor- associated antigens include molecules that may be directly involved in transformation events, or molecules that may not be directly involved in oncogenic transformation events but are expressed by tumor cells (e.g., carcinoernbryonic antigen, CA-125, melonoma associated antigens, etc.)
  • Genes that encode cellular tumor associated antigens include cellular oncogenes and proto-oncogenes that are aberrantly expressed.
  • cellular oncogenes encode products that are directly relevant to the transformation of the cell, so these antigens are particularly preferred targets for immunotherapy.
  • An example is the tumorigenic neu gene that encodes a cell surface molecule involved in oncogenic transformation.
  • Other examples include the ras, kit, and trk genes.
  • the products of proto-oncogenes may be aberrantly expressed (e.g., overexpressed), and this aberrant expression can be related to cellular transformation.
  • the product encoded by proto-oncogenes can be targeted.
  • Some oncogenes encode growth factor receptor molecules or growth factor receptor-like molecules that are expressed on the tumor cell surface.
  • An example is the cell surface receptor encoded by the c-erbB gene.
  • Other tumor-associated antigens may or may not be directly involved in malignant transformation. These antigens, however, are expressed by certain tumor cells and may therefore provide effective targets.
  • Some examples are carcinoembryonic antigen (CEA), CA 125 (associated with ovarian carcinoma), and melanoma specific antigens.
  • tumor associated antigens are detectable in samples of readily obtained biological fluids such as serum or mucosal secretions.
  • One such marker is CA125, a carcinoma associated antigen that is also shed into the bloodstream, where it is detectable in serum (e.g., Bast, et al., N. Eng. J. Med, 309:883 (1983); Lloyd, et al., Int. J. Cane, 71:842 (1997).
  • CA125 levels in serum and other biological fluids have been measured along with levels of other markers, for example, carcinoembryonic antigen (CEA), squamous cell carcinoma antigen (SCC), tissue polypeptide specific antigen (TPS), sialyl TN mucin (STN), and placental alkaline phosphatase (PLAP), in efforts to provide diagnostic and/or prognostic profiles of ovarian and other carcinomas (e.g., Sarandakou, et al., Acta Oncol, 36:755 (1997); Sarandakou, et al., Eur. J, Gynaecol.
  • CEA carcinoembryonic antigen
  • SCC squamous cell carcinoma antigen
  • TPS tissue polypeptide specific antigen
  • STN sialyl TN mucin
  • PLAP placental alkaline phosphatase
  • Elevated serum CA125 may also accompany neuroblastoma (e.g., Hirokawa, et al., Surg. Today, 28:349 (1998), while elevated CEA and SCC, among others, may accompany colorectal cancer (Gebauer, et al., Anticancer Res., 17(4B):2939 (1997)).
  • the tumor associated antigen mesothelin defined by reactivity with monoclonal antibody K-I, is present on a majority of squamous cell carcinomas including epithelial ovarian, cervical, and esophageal tumors, and on mesotheliomas (Chang, et al., Cancer Res., 52:181 (1992); Chang, et al, Int. J. Cancer, 50:373 (1992); Chang, et al., Int. J. Cancer, 51 :548 (1992); Chang, et al., Proc. Natl Acad. Sci. USA, 93:136 (1996); Chowdhury, et al., Proc. Natl. Acad. Sci.
  • mesothelin is detectable only as a cell-associated tumor marker and has not been found in soluble form in serum from ovarian cancer patients, or in medium conditioned by OVCAR-3 cells (Chang, et al., Int. J. Cancer, 50:373 (1992)).
  • Structurally related human mesothelin polypeptides also include tumor-associated antigen polypeptides such as the distinct mesothelin related antigen (MRA) polypeptide, which is detectable as a naturally occurring soluble antigen in biological fluids from patients having malignancies (see WO 00/50900).
  • MRA mesothelin related antigen
  • a tumor antigen may include a cell surface molecule.
  • Tumor antigens of known structure and having a known or described function include the following cell surface receptors: HERl (GenBank Accession NO: U48722), HER2 (Yoshino, et al., J Immunol, 152:2393 (1994); Disis, et al., Cane. Res., 54:16 (1994); GenBank Ace. Nos. X03363 and Ml 7730), HER3 (GenBank Ace. Nos. U29339 and M34309), HER4 (Plowman, et al., Nature, 366:473 (1993); GenBank Ace. Nos.
  • EGFR epidermal growth factor receptor
  • vascular endothelial cell growth factor GenBank NO: M32977
  • vascular endothelial cell growth factor receptor GenBank Ace. Nos. AF022375, 1680143, U48801 and X62568
  • insulin-like growth factor-I GenBank Ace. Nos. XOO 173, X56774, X56773, X06043, European Patent No. GB 2241703
  • insulin-like growth factor-II GeneBank Ace. Nos.
  • X03562, X00910, Ml 7863 and M 17862), transferrin receptor Trowbridge and Omary, Proc. Nat. Acad. USA, 78:3039 (1981); GenBank Ace. Nos. X01060 and Ml 1507), estrogen receptor (GenBank Ace. Nos. M38651, X03635, X99101, U47678 and M12674), progesterone receptor (GenBank Ace. Nos. X51730, X69068 and M15716), follicle stimulating hormone receptor (FSH- R) (GenBank Ace. Nos. Z34260 and M65085), retinoic acid receptor (GenBank Ace. Nos.
  • any of the CTA class of receptors including in particular HOM- MEL-40 antigen encoded by the SSX2 gene (GenBank Ace. Nos. X86175, U90842, U90841 and X86174), carcinoembryonic antigen (CEA, Gold and Freedman, J. Exp. Med, 121 :439 (1985); GenBank Ace. Nos. M59710, M59255 and M29540), and PyLT (GenBank Ace. Nos.
  • PSA prostate surface antigen
  • ⁇ -human chorionic gonadotropin ⁇ -HCG ⁇ -human chorionic gonadotropin ⁇ -HCG
  • Tumor antigens of interest include antigens regarded in the art as
  • CT antigens that are immunogenic in subjects having a malignant condition
  • Scanlan, et al., Cancer Immun., 4:1 (2004) CT antigens include at least 19 different families of antigens that contain one or more members and that are capable of inducing an immune response, including, but not limited to, MAGEA (CTl); BAGE (CT2); MAGEB (CT3); GAGE (CT4); SSX (CT5); NY-ESO-I (CT6); MAGEC (CT7); SYCPl (C8); SPANXBl (CTl 1.2); NA88 (CT18); CTAGE (CT21); SPA17 (CT22); OY-TES-I (CT23); CAGE (CT26); HOM-TES-85 (CT28); HCA661 (CT30); NY-SAR-35 (CT38); FATE (CT43); and TPTE (CT44).
  • MAGEA CTl
  • BAGE CT2
  • MAGEB CT3
  • GAGE CT4
  • SSX CT5
  • Additional tumor antigens that can be targeted include, but are not limited to, alpha- actinin-4, Bcr-Abl fusion protein, Casp-8, beta-catenin, cdc27, cdk4, cdkn2a, coa-1, dek-can fusion protein, EF2, ET V6- AMLl fusion protein, LDLR- fucosyltransferaseAS fusion protein, HLA-A2, HLA-AI l, hsp70-2, KIAAO205, Mart2, Mum-1 , 2, and 3, neo-PAP, myosin class I, OS-9, pml- RAR ⁇ fusion protein, PTPRK, K-ras, N-ras, Triosephosphate isomeras, Bage-1, Gage 3,4,5,6,7, GnTV, Herv-K-mel, Lü-1, Mage- Al,2,3 ,4,6,10,12, Mage
  • Oncolytic viral therapeutics can be more effective in treating tumors by targeting to blood vessels of the tumor.
  • Tumor-associated neovasculature provides a readily accessible route through which protein therapeutics can access the tumor.
  • the viral proteins contain a domain that specifically binds to an antigen that is expressed by neovasculature associated with a tumor.
  • the antigen may be specific to tumor neovasculature or may be expressed at a higher level in tumor neovasculature when compared to normal vasculature.
  • antigens that are over-expressed by tumor- associated neovasculature as compared to normal vasculature include, but are not limited to, VEGF/KDR, Tie2, vascular cell adhesion molecule (VCAM), endoglin and ⁇ s ⁇ 3 integrin/vitronectin.
  • Other antigens that are over- expressed by tumor-associated neovasculature as compared to normal vasculature are known to those of skill in the art and are suitable for targeting by the disclosed fusion proteins.
  • the fusion proteins contain a domain that specifically binds to a chemokine or a chemokine receptor.
  • Chemokines are soluble, small molecular weight (8-14 kDa) proteins that bind to their cognate G-protein coupled receptors (GPCRs) to elicit a cellular response, usually directional migration or chemotaxis.
  • GPCRs G-protein coupled receptors
  • Tumor cells secrete and respond to chemokines, which facilitate growth that is achieved by increased endothelial cell recruitment and angiogenesis, subversion of immunological surveillance and maneuvering of the tumoral leukocyte profile to skew it such that the chemokine release enables the tumor growth and metastasis to distant sites.
  • chemokines are vital for tumor progression.
  • CXC conserved two N-terminal cysteine residues of the chemokines
  • CXC chemokines Based on the positioning of the conserved two N-terminal cysteine residues of the chemokines, they are classified into four groups: CXC, CC, CX3C and C chemokines.
  • the CXC chemokines can be further classified into ELR+ and ELR- chemokines based on the presence or absence of the motif 4 glu-leu-arg (ELR motif)' preceding the CXC sequence.
  • ELR motif glu-leu-arg
  • the CC chemokines act on several subsets of dendritic cells, lymphocytes, macrophages, eosinophils, natural killer cells but do not stimulate neutrophils as they lack CC chemokine receptors except murine neutrophils. There are approximately 50 chemokines and only 20 chemokine receptors, thus there is considerable redundancy in this system of Hgand/receptor interaction.
  • Chemokines elaborated from the tumor and the stromal cells bind to the chemokine receptors present on the tumor and the stromal cells.
  • the autocrine loop of the tumor cells and the paracrine stimulatory loop between the tumor and the stromal cells facilitate the progression of the tumor.
  • CXCR2, CXCR4, CCR2 and CCR7 play major roles in tumorigenesis and metastasis.
  • CXCR2 plays a vital role in angiogenesis and CCR2 plays a role in the recruitment of macrophages into the tumor microenvironment.
  • CCR7 is involved in metastasis of the tumor cells into the sentinel lymph nodes as the lymph nodes have the ligand for CCR7, CCL21.
  • CXCR4 is mainly involved in the metastatic spread of a wide variety of tumors. b. Molecular classes of targeting domains
  • tumor or tumor-associated neovasculature targeting domains are ligands that bind to cell surface antigens or receptors that are specifically expressed on tumor cells or tumor-associated neovasculature or are overexpressed on tumor cells or tumor-associated neovasculature as compared to normal tissue.
  • Tumors also secrete a large number of Hgands into the tumor microenvironment that affect tumor growth and development.
  • Receptors that bind to ligands secreted by tumors including, but not limited to, growth factors, cytokines and chemokines, including the chemokines discussed above, are suitable for use in the disclosed fusion proteins.
  • Ligands secreted by tumors can be targeted using soluble fragments of receptors that bind to the secreted ligands.
  • Soluble receptor fragments are fragments of polypeptides that may be shed, secreted or otherwise extracted from the producing cells and include the entire extracellular domain, or fragments thereof.
  • tumor or tumor-associated neovasculature targeting domains are single polypeptide antibodies that bind to cell surface antigens or receptors that are specifically expressed on tumor cells or tumor- associated neovasculature or are overexpressed on tumor cells or tumor- associated neovasculature as compared to normal tissue.
  • Single domain antibodies are described above with respect to coinhibitory receptor antagonist domains.
  • tumor or tumor-associated neovasculature targeting domains are Fc domains of immunoglobulin heavy chains that bind to Fc receptors expressed on tumor cells or on tumor-associated neovasculature.
  • the Fc region includes polypeptides containing the constant region of an antibody excluding the first constant region immunoglobulin domain.
  • Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM.
  • the Fc domain is derived from a human or murine immunoglobulin.
  • the Fc domain is derived from human IgGl or murine IgG2a including the CH2 and C H 3 regions. 4.
  • Viruses can also be engineered to include one or more additional genes that encode a therapeutic protein.
  • Suitable therapeutic proteins such as cytokines or chemokines, are known in the art.
  • Preferred cytokines include, but are not limited to, granulocyte macrophage colony stimulating factor (GM-CSF), tumor necrosis factor alpha (TNF ⁇ ), tumor necrosis factor beta (TNF ⁇ ), macrophage colony stimulating factor (M-CSF), interleukin-l (IL-I), interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-6 (IL-6), interleukin- 10 (IL- 10), interleukin- 12 (IL- 12), interleukin-l 5 (IL-15), interleukin-21 (IL-21), interferon alpha (IFN ⁇ ), interferon beta (IFN ⁇ ), interferon gamma (IFN ⁇ ), and IGIF, and variants and fragments thereof.
  • Suitable chemokines include, but are not limited to, an alpha- chemokine or a beta-chemokine, including, but not limited to, a CSa, interleukin- 8 (IL- 8), monocyte chemotactic protein 1 alpha (MIP l ⁇ ), monocyte chemotactic protein 1 beta (MIPl ⁇ ), monocyte chemoattractant protein 1 (MCP-I), monocyte chemoattractant protein 3 (MCP-3), platelet activating factor (PAFR), N-formyl-methionyl-leucyl-[ 3 H]phenylalanine (FMLPR), leukotriene B 4 , gastrin releasing peptide (GRP), RANTES, eotaxin, lymphotactin, IPlO, 1-309, ENA78, GCP-2, NAP-2 and MGSA/gro, and variants and fragments thereof.
  • IL- 8 interleukin- 8
  • MIP l ⁇ monocyte
  • compositions containing virus may be for systemic or local administration, such as intratumoral.
  • Dosage forms for administration by parenteral (intramuscular (IM), intraperitoneal (IP), intravenous (IV) or subcutaneous injection (SC)), or transmucosal (nasal, vaginal, pulmonary, or rectal) routes of administration can be formulated.
  • the compositions disclosed herein are administered to a subject in a therapeutically effective amount.
  • the term "effective amount” or “therapeutically effective amount” means a dosage sufficient to treat, inhibit, or alleviate one or more symptoms of the disorder being treated or to otherwise provide a desired pharmacologic and/or physiologic effect. The precise dosage will vary according to a variety of factors such as subject-dependent variables (e.g., age, immune system health, etc.), the disease, and the treatment being effected.
  • Therapeutically effective amounts of the viruses disclosed herein cause a reduction in tumor progression of reduction of tumor burden.
  • compositions disclosed herein and nucleic acids encoding the same appropriate dosage levels for treatment of various conditions in various patients, can be determined by a person skilled in the art, considering the therapeutic context, age, and general health of the recipient.
  • the selected dosage depends upon the desired therapeutic effect, on the route of administration, and on the duration of the treatment desired.
  • Active virus can also be measured in terms of plaque-forming units (PFU).
  • a plaque- forming unit can be defined as areas of cell lysis (CPE) in monolayer cell culture, under overlay conditions, initiated by infection with a single virus particle.
  • CPE cell lysis
  • dosage levels of virus between 10 2 and 10 12 PFU are administered to humans.
  • Virus is typically administered in a liquid suspension, in a volume ranging between 10 ⁇ l and 100 ml depending on the route of administration.
  • dosage and volume may be lower for intratumoral injection, than systemic administration or infusion.
  • the dose may be administered once or multiple times.
  • the dose will be 100 ⁇ l administered intratumorly in multiple doses, while systemic or regional administration via subcutaneous, intramuscular, intra-organ, or intravenous administration will be from 10 to 100 ml.
  • pharmaceutically acceptable means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredients.
  • pharmaceutically-acceptable carrier means one or more compatible solid or liquid fillers, diluents or encapsulating substances which are suitable for administration to a human or other vertebrate animal.
  • carrier refers to an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application.
  • compositions may be formulated in a conventional manner using one or more physiologically acceptable carriers including excipients and auxiliaries which facilitate processing of the active compounds into preparations which can be used pharmaceutically.
  • the compositions may be administered in combination with one or more physiologically or pharmaceutically acceptable carriers, thickening agents, co-solvents, adhesives, antioxidants, buffers, viscosity and absorption enhancing agents and agents capable of adjusting osmolality of the formulation.
  • Proper formulation is dependent upon the route of administration chosen.
  • the compositions may also contain minor amount of nontoxic auxiliary substances such as wetting or emulsifying agents, dyes, pH buffering agents, or preservatives.
  • the formulations should not include membrane disrupting agents which could kill or inactivate the virus. 1.
  • compositions including oncolytic virus disclosed herein are administered in an aqueous solution, by parenteral injection.
  • Injection includes, but it not limited to, local, intratumoral, intravenous, intraperitoneal, intramuscular, or subcutaneous.
  • the formulation may also be in the form of a suspension or emulsion.
  • pharmaceutical compositions are provided including effective amounts of virus, and optionally include pharmaceutically acceptable diluents, preservatives, solubilizers, emulsii ⁇ ers, adjuvants and/or carriers.
  • compositions include diluents sterile water, buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength; and optionally, additives such as anti-ox ⁇ dants (e.g., ascorbic acid, sodium metabisulf ⁇ te), and preservatives and bulking substances (e.g., lactose, mannitol).
  • buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength; and optionally, additives such as anti-ox ⁇ dants (e.g., ascorbic acid, sodium metabisulf ⁇ te), and preservatives and bulking substances (e.g., lactose, mannitol).
  • non-aqueous solvents or vehicles are propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable
  • compositions are formulated for mucosal administration, such as through nasal, pulmonary, or buccal delivery.
  • Mucosal formulations may include one or more agents for enhancing delivery through the nasal mucosa.
  • Agents for enhancing mucosal delivery are known in the art, see for example U.S. Patent Application No. 20090252672 to Eddington, and U.S. Patent Application No. 20090047234 to Touitou.
  • Acceptable agents include, but are not limited to, chelators of calcium (EDTA), inhibitors of nasal enzymes (boro-leucin, aprotinin), inhibitors of muco-ciliar clearance (preservatives), solubilizers of nasal membrane (cyclodextrin, fatty acids, surfactants) and formation of micelles (surfactants such as bile acids, Laureth 9 and taurodehydrofusidate (STDHF)).
  • Compositions may include one or more absorption enhancers, including surfactants, fatty acids, and chitosan derivatives, which can enhance delivery by modulation of the tight junctions (TJ) (B. J. Aungst, et al., J. Pharm.
  • the optimal absorption enhancer should possess the following qualities: its effect should be reversible, it should provide a rapid permeation enhancing effect on the cellular membrane of the mucosa, and it should be non-cytotoxic at the effective concentration level and without deleterious arid/or irreversible effects on the cellular membrane, virus membrane, or cytoskeleton of the TJ.
  • its effect should be reversible, it should provide a rapid permeation enhancing effect on the cellular membrane of the mucosa, and it should be non-cytotoxic at the effective concentration level and without deleterious arid/or irreversible effects on the cellular membrane, virus membrane, or cytoskeleton of the TJ.
  • Dosage units include virus in a pharmaceutically acceptable carrier for shipping and storage and/or administration. Active virus should be shipped and stored using a method consistent with viability such as in cooler containing dry ice so that cells are maintained below 4°C, and preferably below -2O 0 C. VSV virus should not be lyophilized. Components of the kit may be packaged individually and can be sterile. In one embodiment, a pharmaceutically acceptable carrier containing an effective amount of virus is shipped and stored in a sterile vial. The sterile vial may contain enough virus for one or more doses. Virus may be shipped and stored in a volume suitable for administration, or may be provided in a concentrated titer that is diluted prior to administration.
  • a pharmaceutically acceptable carrier containing an effective amount of virus can be shipped and stored in a syringe.
  • Typical concentrations of viral particles in the sterile saline, phosphate buffered saline or other suitable media for the virus is in the range of 10 8 to 10 9 with a maximu of 10 i2 .
  • Dosage units should not contain membrane disruptive agents nor should the viral solution be frozen and dried (i.e., lyophilized), which could kill the virus.
  • Kits containing syringes of various capacities or vessels with deformable sides e.g., plastic vessels or plastic-sided vessels
  • the size and design of the syringe will depend on the route of administration.
  • a syringe for administering virus intratumorally is capable of accurately delivering a smaller volume (such as 1 to 100 ⁇ l).
  • a larger syringe, pump or catheter will be used to administer virus systemically.
  • kits optionally include one or more of the following: bioactive agents, media, excipients and one or more of: a syringe, a bandage, a disinfectant, a local anesthetic, an analgesic agent, surgical thread, scissors, a sterile fluid, and a sterile vessel.
  • Kits for intranasal administration may optionally contain a delivery device for facilitating intranasal delivery, such as a nasal sprayer.
  • the kits are generally provided in a container, e.g., a plastic, cardboard, or metal container suitable for commercial sale. Any of the kits can include instructions for use. III. Methods of use A. Subjects to be treated
  • compositions are useful for targeting and destroying a cell or cells of interest.
  • the cells of interest are cancer cells.
  • compositions are useful as therapeutic compositions, which can be used to treat benign or malignant tumors.
  • a balance usually is maintained between cell renewal and cell death in most organs and tissues.
  • the various types of mature cells in the body have a given life span; as these cells die, new cells are generated by the proliferation and differentiation of various types of stem cells. Under normal circumstances, the production of new cells is so regulated that the numbers of any particular type of cell remain constant. Occasionally, though, cells arise that are no longer responsive to normal growth-control mechanisms.
  • cancer refers specifically to a malignant tumor.
  • malignant tumors exhibit metastasis.
  • small clusters of cancerous cells dislodge from a tumor, invade the blood or lymphatic vessels, and are carried to other tissues, where they continue to proliferate. In this way a primary tumor at one site can give rise to a secondary tumor at another site.
  • compositions and method described herein are useful for treating subjects having benign or malignant tumors by delaying or inhibiting the growth of a tumor in a subject, reducing the growth or size of the tumor, inhibiting or reducing metastasis of the tumor, and/or inhibiting or reducing symptoms associated with tumor development or growth.
  • the examples below demonstrate that the VSV virus disclosed herein are oncolytic to tumors in vivo.
  • Malignant tumors which may be treated are classified herein according to the embryonic origin of the tissue from which the tumor is derived.
  • Carcinomas are tumors arising from endodermal or ectodermal tissues such as skin or the epithelial lining of internal organs and glands.
  • the disclosed compositions are particularly effective in treating carcinomas.
  • Sarcomas which arise less frequently, are derived from mesodermal connective tissues such as bone, fat, and cartilage.
  • the leukemias and lymphomas are malignant tumors of hematopoietic cells of the bone marrow. Leukemias proliferate as single cells, whereas lymphomas tend to grow as tumor masses. Malignant tumors may show up at numerous organs or tissues of the body to establish a cancer.
  • the types of cancer that can be treated with the provided compositions and methods include, but are not limited to, cancers such as vascular cancer such as multiple myeloma, adenocarcinomas and sarcomas, of bone, bladder, brain, breast, cervical, colo-rectal, esophageal, kidney, liver, lung, nasopharangeal, pancreatic, prostate, skin, stomach, and uterine.
  • cancers such as vascular cancer such as multiple myeloma, adenocarcinomas and sarcomas, of bone, bladder, brain, breast, cervical, colo-rectal, esophageal, kidney, liver, lung, nasopharangeal, pancreatic, prostate, skin, stomach, and uterine.
  • the disclosed compositions are used to treat multiple cancer types concurrently.
  • the compositions can also be used to treat metastases or tumors at multiple locations.
  • the oncolytic virus VSV-rp30 is particularly effective in treating gliomas (including astrocytomas) in the brain, as well as bone, breast, prostate, colon, and lung cancers. It can also infect and kill pancreatic and stem cells from brain cancer.
  • the composition is used to treat lung or breast cancer carcinomas, which are the source of many brain cancers.
  • a composition containing an oncolytic VSV such as VSV-rp30 is used for treating glioblastoma.
  • VSV has a good oncolytic profile in part by taking advantage of defects in the innate cellular anti-viral defense system, which is a common feature in malignancies, including colon, breast, prostate, liver, and leukemia.
  • compositions and methods are used to treat a population of cells with defects in the interferon system.
  • the cells with a defective interferon system or defective antiviral defense system are tumor cells that are susceptible to VSV infection and destruction in the presence of exogenous interferons such as IFN- ⁇ , or IFN- ⁇ / ⁇ pathway inducer polyriboinosinic polyribocytidylic acid [poly(I:C)].
  • exogenous interferons such as IFN- ⁇ , or IFN- ⁇ / ⁇ pathway inducer polyriboinosinic polyribocytidylic acid [poly(I:C)].
  • an effective amount of the composition reduces or stops tumor progression or at least reduces one or more symptoms of the tumor.
  • Symptoms of cancer may be physical, such as tumor burden, or biological such as proliferation of cancer cells.
  • the actual effective amounts of virus can vary according to factors including the specific virus administered, the particular composition formulated, the mode of administration, and the age, weight, condition of the subject being treated, as well as the route of administration and the disease or disorder.
  • the particular mode of administration selected will depend upon factors such as the particular formulation, the severity of the state of the subject being treated, and the dosage required to induce an effective response.
  • the administration may be localized (i.e., to a particular region, physiological system, tissue, organ, or cell type) or systemic.
  • the compositions can be administered by a number of routes including, but not limited to, injection: intravenous, intraarterial, intraperitoneal, intramuscular, or subcutaneous, or to a mucosal surface (oral, sublingual or buccal, nasal, rectal, vaginal, pulmonary) and special means such as convection enhanced delivery.
  • the oncolytic virus is administered in an aqueous solution, by parenteral injection.
  • the composition is injected locally at the site of treatment, such as a tumor.
  • the composition is delivered systemically, by injection into the circulatory system (i.e. intravenous) or an appropriate lymphoid tissue, such as the spleen, lymph nodes or mucosal-associated lymphoid tissue.
  • the injections can be given at one, or multiple locations. In a preferred embodiment, one treatment is sufficient. In some embodiments, multiple treatments are required.
  • the composition can also be administered mucosally.
  • mucosal administration is intranasal delivery. Intranasal administration can result in systemic or local delivery of oncolytic virus.
  • compositions containing oncolytic viruses may be coupled with surgical, radiologic, other therapeutic approaches to treatment of cancer.
  • compositions and methods can be used as an adjunct to surgery.
  • Surgery is a common treatment for many types of benign and malignant tumors.
  • the disclosed compositions containing oncolytic virus are particularly useful subsequent to resection of the primary tumor mass, and would be able to infect and destroy even dispersed tumor cells.
  • compositions and methods are used as an adjunct or alternative to neurosurgery.
  • the compositions are particularly well suited to treat areas of the brain that is difficult to treat surgically, for instance high grade tumors of the brain stem, motor cortex, basal ganglia, or internal capsule. High grade gliomas in these locations are generally considered inoperable.
  • the viral compositions can be administered to a subject in need thereof alone or in combination with one or more additional therapeutic agents selected based on the condition, disorder or disease to be treated.
  • additional therapeutic agents include conventional cancer therapeutics such as chemotherapeutic agents, cytokines, chemokines, and radiation therapy.
  • chemotherapeutic drags can be divided into: alkylating agents, antimetabolites, anthracyclines, plant alkaloids, topoisomerase inhibitors, and other antitumour agents. All of these drugs affect cell division or DNA synthesis and function in some way.
  • Additional therapeutics include monoclonal antibodies and the tyrosine kinase inhibitors e.g. imatinib mesylate (GLEEVEC® or GLIVEC®), which directly targets a molecular abnormality in certain types of cancer (chronic myelogenous leukemia, gastrointestinal stromal tumors).
  • GLEEVEC® or GLIVEC® tyrosine kinase inhibitors
  • GLIVEC® GLIVEC®
  • chemotherapeutic agents include, but are not limited to, cisplatin, carboplatin, oxaliplatin, mechlorethamine, cyclophosphamide, chlorambucil, vincristine, vinblastine, vinorelbine, vindesine, taxol and derivatives thereof, irinotecan, topotecan, amsacrine, etoposide, etoposide phosphate, teniposide, epipodophyllotoxins, trastuzumab (HERCEPTIN®), cetuximab, and rituxiniab (RITUXAN® or MABTHERA®), bevacizumab (AVASTIN®), and combinations thereof.
  • chemotherapeutics will affect tumors or cancer cells, without diminishing the activity of the virus.
  • the additional therapeutic agent inhibits proliferation of cancer cells without affecting targeting, infectivity, or replication of the virus.
  • Oncolytic viruses such as VSV are highly immunogenic, and a substantial B and T cell response from the adaptive immune system would ultimately limit viral infection.
  • An immunosuppressant attenuates the host immune response and prolongs viral infection.
  • Immunosuppressants include glucocorticoids, cytostatics (such as alkylating agents, antimetabolites, and cytotoxic antibodies), antibodies (such as those directed against T-cell recepotors or 11-2 receptors), drugs acting on immunophilins (such as cyclosporine, tacrolimus, and sirolimus) and other drugs (such as interferons, opioids, TNF binding proteins, mycophenolate, and other small molecules such as fingolimod).
  • cytostatics such as alkylating agents, antimetabolites, and cytotoxic antibodies
  • antibodies such as those directed against T-cell recepotors or 11-2 receptors
  • drugs acting on immunophilins such as cyclosporine, tacrolimus, and sirolimus
  • other drugs such as interferons, opioids, TNF binding proteins, mycophenolate, and other small molecules such as fingolimod.
  • the dosage ranges for immunosuppressant agents are known in the art. The specific dosage will depend upon the desired therapeutic
  • a cytostatic when used as an immunosuppressant, a cytostatic maybe administered at a lower dosage than when used in chemotherapy.
  • Suitable immunosuppressants include, but are not limited to, FK506, prednisone, methylprednisolone, cyclophosphamide, thalidomide, azathioprine, and dacHzumab, physalin B, physalin F, physalin G, seco- steroids purified from Physalis angulata L, lS-deoxyspergualin, MMF, rapamycin and its derivatives, CCI-779, FR 900520, FR 900523, NK86- 1086, depsidomycin, kanglemycin-C, spergualin, ⁇ rodigiosin25-c, cammunomicin, demethomycin, tetranactin, tranilast, stevastelins, myrioc
  • Preferred immunosuppressants will preferentially reduce or inhibit the subject's immune response, without reducing or inhibiting the activity of the virus.
  • the additional therapeutic agent inhibits activation and/or proliferation without affecting targeting, infectivity, or replication of the virus.
  • compositions can be administered with an antibody or antigen binding fragment thereof specific for growth factor receptors or tumor specific antigens.
  • growth factors receptors include, but are not limited to, epidermal growth factor receptor (EGFR; HERl); c-erbB2 (HER2); c-erbB3 (HER3); c-erbB4 (HER4); insulin receptor; insulin-like growth factor receptor 1 (IGF-IR); insulin-like growth factor receptor 2/Mannose ⁇ 6- ⁇ hosphate receptor (IGF-II R/M-6-P receptor); insulin receptor related kinase (IRRK); platelet-derived growth factor receptor (PDGFR); colony-stimulating factor-1 receptor (CSF-IR) (c-Fms); steel receptor (c- Kit); Flk2/Flt3; fibroblast growth factor receptor 1 (Flg/Cekl); fibroblast growth factor receptor 2 (Bek/Cek3/K-Sam); Fibroblast growth factor receptor 3; Fibroblast growth factor eceptor 4
  • VSV is an effective oncolytic virus, in-part, by taking advantage of defects in the interferon system.
  • Administration of therapeutic proteins such as IFN- ⁇ , or IFN- ⁇ / ⁇ pathway inducer polyriboinosinic polyribocytidylic acid [poly(I:C)] are effective in protecting normal cells from the oncolytic activity, while leaving the tumor cells susceptible to infection and death (Wollmann, et al. J. Virol., 81(3): 1479-1491 (2007), (WoUmann, et al., J Virol, (2009)). Therefore, in some embodiments, the disclosed compositions are administered in combination with a therapeutic protein to reduce infectivity and death of normal cells. Suitable therapeutic proteins are described above. d. Peripheral immunization
  • VSV genome is a single negative-sense, non-segmented stand of RNA that contains five genes (N, L, P, M, and G) and has a total size of 11.161 kb.
  • Methods of engineering recombinant viruses by reconstituting VSV from DNA encoding a positive-sense stand of RNA are known in the art (Lawson, et al., PNAS, 92:4477-4481 (1995), Dalton and Rose, Virology, 279:414-421 (2001)).
  • recombinant DNA can be transcribed by T7 RNA polymerase to generate a full-length positive-strand RNA complimentary to the viral genome.
  • VSV viruses can be engineered to express variant proteins, additional proteins, foreign antigens, targeting proteins, or therapeutic proteins using known cloning methods.
  • RNA viruses are prone to spontaneous genetic variation.
  • the mutation rate of VSV is about 10 "4 per nucleotide replicated, which is approximately one nucleotide change per genome (Drake, et al, Proc. Natl. Acad ScL USA, 96:13910-13913). Therefore, mutant VSV viruses exhibiting desired properties can be developed by applying selective pressure. Methods for adaption of VSV viruses through repeated passaging is described in the art. See, for example, Wollmann, et al., J Virol., 79(10): 6005-6022 (2005). Selective pressure can be applied by repeated passaging and enhanced selection to create mutant virus with desirable traits such as increased infectivity and oncolytic potential for a cell type of interest.
  • the cell type of interest could be general, such as cancer cells, or specific such as glioblastoma cells.
  • Mutant virus can also be selected based on reduced toxicity to normal cells. Methods of enhanced selection include, but are not limited to, short time for viral attachment to cells, collection of early viral progeny, and preabsorption of viral particles with high affinity of undesirable cells (such as normal cells). Mutations can be identified by sequencing the viral genome, for instance as described in Example 4 below. DNA encoding the VSV genome can also be used as a substrate for random or site directed mutagenesis to develop VSV mutant viruses. Mutagenesis can be accomplished by a variety of standard, mutagenic procedures.
  • Changes in single genes may be the consequence of point mutations that involve the removal, addition or substitution of a single nucleotide base within a DNA sequence, or they may be the consequence of changes involving the insertion or deletion of large numbers of nucleotides. Mutations can arise spontaneously as a result of events such as errors in the fidelity of nucleic acid replication or the movement of transposable genetic elements (transposons) within the genome. They also are induced following exposure to chemical or physical mutagens. Such mutation- inducing agents include ionizing radiations, ultraviolet light and a diverse array of chemicals such as alkylating agents and polycyclic aromatic hydrocarbons all of which are capable of interacting either directly or indirectly (generally following some metabolic biotransformations) with nucleic acids.
  • the nucleic acid lesions induced by such environmental agents may lead to modifications of base sequence when the affected DNA is replicated or repaired and thus to a mutation.
  • Mutation also can be site- directed through the use of particular targeting methods.
  • Various types of mutagenesis such as random mutagenesis, e.g., insertional mutagenesis, chemical mutagenesis, radiation mutagenesis, in vitro scanning mutagenesis, random mutagenesis by fragmentation and reassembly, and site specific mutagenesis, e.g., directed evolution, are described in U.S. Patent Application No. 2007/0026012.
  • Mutant viruses can be prepared by site specific mutagenesis of nucleotides in the DNA encoding the protein, thereby producing DNA encoding the mutant.
  • substitution mutations at predetermined sites in DNA having a known sequence are well known, for example M 13 primer mutagenesis and PCR mutagenesis.
  • Amino acid substitutions are typically of single residues, but can occur at a number of different locations at once. Insertions usually will be on the order of about from 1 to 10 amino acid residues; and deletions will range about from 1 to 30 residues. Substitutions, deletions, insertions or any combination thereof can be combined to arrive at a final construct
  • the mutations must not place the sequence out of reading frame and preferably will not create complementary regions that could produce secondary mRNA structure.
  • Substitutional variants are those in which at least one residue has been removed and a different residue inserted in its place. Examples
  • Example 1 VSV-rp30 kills human cancer cells that can cause brain tumors
  • VSVrp30a was tested on five human carcinoma lines, selected by the fact that lung and breast cancers are the most common sources for brain metastasis.
  • AU human cancer lines tested including A549, CaIu-I lung carcinoma, and T-47D, MCF7, and BT-474 breast carcinoma, were infected and killed by VSVr ⁇ 30a at an MOI of 1. All cells exhibited viral green fluorescence by 60 h after infection, and all cells, dividing and nondividing, in the culture dish were killed by 48-72 h after infection ( Figure 1). In addition, multiple cultures were established from tissue derived from resected glioblastoma surgery.
  • VSV-rp30 has improved oncolytic potential
  • VSV-G/GFP additional G protein with GFP reporter fusion inserted at 5th gene position
  • VSV-M51/CT9 M protein M51 mutation + G protein with cytoplasmic tail truncated to 9 amino acids
  • VSV-1'GFP GFP reporter inserted in 1 st gene position
  • VSV- G/GFP The four VSVs used in the present study (VSV- G/GFP, VSV-rp30, VSV-M5I/CT9 and VSV-I 1 GFP) were all derived from a recombinant version of the San Juan strain of Indiana serotype VSV, the genome of which consists of a single negative strand of RNA that encodes five genes, N, P, M, G and L, depicted on the top (VSV). (see Figure 2). All four express enhanced GFP, a fluorescent reporter protein that enables the visualization of infected cells.
  • VSV-G/GFP incorporates a GFP reporter gene (shown in grey) encoding an additional copy of the G-protein with a C-teraiinal fusion of GFP.
  • VSV-rp30 (RP30) is a glioblastoma cell- adapted variant of VSV-G/GFP that has been previously described to display increased oncolytic activity in glioblastoma cells.
  • the P and L genes (shown in white) are the genes found to contain the mutations S126L and D223Y identified in the present study.
  • VS V-M51/CT9 (M51 /CT9) contains a GFP reporter gene (in grey) inserted between the G and L genes.
  • the M gene (in white) has been modified to delete the methionine at position 51 of the M protein and the G gene (white) encodes a truncated version of the G protein that removes all but 9 of the 27 amino acids of the C-terminal cytoplasmic tail. Both of these mutations have previously been reported to result in attenuated viral propagation (Clarke et al., J Virol., 81: 2056-2064 (2007); Publicover et al., J. Virol, 78: 9317-9324 (2004); Publicover et at, J. Virol., 80: 7028-7036 (2006)).
  • VSV-I 1 GFP contains a GFP reporter gene (grey) inserted into the first position in the gene order, thus decreasing the level of transcription from the remaining five downstream genes and leading to attenuated viral propagation (Clarke et al., J Virol., 81: 2056-2064 (2007); Flanagan et al., J. Virol, 75: 6107-6114 (2001); Ramsburg et al., J Virol, 79: 15043-15053 (2005)).
  • GFP reporter gene grey
  • the human glioblastoma tumor cell line U-87MG, the baby hamster kidney cell line BHK-21, and the embryonic mouse cell line NIFV3T3 were obtained from the American Type Culture Collection (ATCC) (Manassas, VA).
  • the human glioblastoma tumor cell lines U-118MG and U-373MG were provided by R. Matthews, Yale University.
  • the human prostate tumor cell line DU- 145 was provided by B. Gullen, Yale University.
  • the human cell lines SJSA-I, BT-549, T-47D, HCTU6, LS180, SfV480 and A549 and established from tumors of bone, breast, breast, colon, colon, colon and lung, respectively, were provided by S.
  • Mella Yale University Cancer Center.
  • the primary human astrocyte culture was established from human brain tissue obtained in the course of epilepsy surgery, as described by Wollmann, et al., J Virol, 81:1479-1491 (2007), with patient welfare being the sole basis for resection of brain tissue. All cell lines were propagated using MEM growth media consisting of minimum essential medium (Gibco, Carlsbad, CA) supplemented with 10% fetal bovine serum (Gibco) and 1% penicillin/streptomycin solution (Gibco) and housed in a humidified incubator at 37°C supplied with 57% CO 2 . Plaque size assay In order to compare VSV propagation among various cell types, a plaque size assay was devised.
  • confluent cell monolayers were grown in six-well plates and triplicate wells were infected with each of the VSVs to be tested. Immediately prior to viral inoculation, media in all wells was aspirated and replaced with 0.9 ml of MEM growth medium followed by inoculation using 0.1 ml of serially diluted VSV generated previously and stored in MEM growth medium at -8O 0 C. After inoculation, plates were placed back in the incubator for 1 hr to allow time for the virus to adsorb into the cell monolayer.
  • the inoculation media was then aspirated and cell monolayers were overlaid with 2 ml of 0.5% (w/vol) agarose (Ultrapure GPG/LE; American Bioanalytical, Natick, MA) in MEM growth medium. After solidification of the agarose, plates were incubated at 37°C in 5Vo CO 2 for 18 - 36 hr to allow time for plaque development. Since each of the VSVs expressed enhanced GFP as a reporter protein, fluorescent microscopic imaging was employed to visualize and measure individual GFP fluorescent plaques.
  • the fluorescent imaging system consisted of an Olympus 1X71 inverted microscope (Tokyo, Japan) fitted with an Olympus UPlanFl 4X objective and EGFP filter set.
  • VSV-rp30 In order to more fully assess the relative differences in the growth characteristics of VSV-rp30 with respect to the parent VSV-G/GFP from which it was derived, a panel of eleven widely used cancer cell lines was assembled for use in a plaque size assay. These lines were established from tumors of a number of different types of common human adult cancers including bone, brain, breast, colon, lung and prostate. Additionally, two other GFP-expressing VSVs were included for comparison in the assay (VSVM5I/CT9 and VSV-I'GFP) that have been reported to display attenuated growth characteristics in vitro (Clarke et al., J. Virol., 81: 2056- 2064 (2007); Publicover et al., J.
  • a similar analysis was performed for each of the 11 cancer cell lines
  • Each circle represents the mean of 30 randomly selected plaques measured across their diameter, then normalized with respect to the corresponding VSV-G/GFP mean plaque diameter.
  • the small marks at the top of each circle represent the standard error of the mean.
  • VSV ⁇ rp30 plaques were significantly larger (p ⁇ 0.001) than VSV-G/GFP plaques in all cancer cell lines tested.
  • VSV-I 1 GFP plaques were also significantly smaller, ranging in diameter from a low of 39% ⁇ 4
  • VSV-rp30 plaques develop to become significantly larger than VSV-G/GFP plaques when grown on cancer-derived cells, in contrast to the little or no difference in size observed when grown on non-cancerous cells.
  • VSV-M51/CT9 and VSV-I 'GFP plaques tend to be significantly smaller than VSV-G/GFP plaques in the majority of cell lines tested, independent of whether the cells are of a cancerous or non-cancerous origin.
  • the larger plaques associated with VSV-rp30 were indicative of a faster rate of infection and replication of this virus than the other VSVs tested here. This enhanced rate of infection may prove beneficial in treating cancer, as it would give VSV ⁇ rp30 a headstart in the race against the immune system.
  • VSV-rp30 was more aggressive in infecting tumors, the relative efficacy of VSV-rp30 in infecting normal human astrocytes was reduced compared with the tumors; this is an attribute of VSV-rp30, as it suggests that the virus has a greater replication potential in tumor than in non-tumor tissue.
  • VSV-rp30 displayed a mean 50% greater infection of all human cancer lines than the parent VSV-G/GFP, and showed a three-fold greater infection than VS V-CT9/M51 or VS V- 1 'GFP. In contrast, VSV-rp30 showed only a modest 9% greater infection on human non-cancer control cells.
  • VSV-rp30 exhibits increased oncolytic activity Materials and Methods Plaque cytotoxicity labeling with ethid ⁇ um homodimer
  • EthD-1 ethidiurn homodimer
  • plaques were visualized with the fluorescent microscopic imaging system described above using either EGFP or Texas red filters. Under red fluorescent visualization, plaques were easily identifiable due to the greatly increased density of dead cells labeled by EthD-1. After confirming the location of the plaque using GFP fluorescence, the diameter of the red fluorescent EthD-1 labeled area of cell death associated with the plaque was measured. The diameters of these cytotoxic areas were normalized with respect to the corresponding mean VSV-G/GFP cytotoxic area diameter of each cell line tested. Thirty plaques from each condition were randomly selected and analyzed in this manner and statistical comparisons were performed as described above. Results
  • Ethidium homodimer is an agent that yields a bright red fluorescence upon binding to the exposed nucleic acids of dead or damaged cells and is routinely used in assessments of cytotoxicity. Under red fluorescent illumination, VSV plaques were easily identifiable due to the greatly increased density of dead cells. Analysis of the cytotoxic areas associated with VSV plaques indicated that the relative size of the regions of enhanced cell death closely mirrored the GFP fluorescent plaque size in all four of the cancer cell lines tested ( Figure 4).
  • VSV-rp30 not only propagates more quickly than VSV-G/GFP, overall, it yields a greater oncolytic effect than VSV-G/GFP as well. Additionally, VSV-M51/CT9 and VSV-1'GFP both yielded less of an oncolytic effect than VSV-G/GFP, consistent with the smaller plaque size attendant to each of these viruses.
  • Example 4 Genotype of VSV-rp30 Materials and Methods
  • VSV genome sequencing Viral genomic RNA was extracted from VSV-G/GFP and VSV-rp30 using the QIAamp Viral RNA Mini Kit (Qiagen, Valencia, CA). Reverse transcription of isolated VSV genomic RNA was performed using Thermo-X Reverse Transcriptase (Invitrogen, Carlsbad, CA) at a reaction temperature of 53.9°C and an RT-oligo with the sequence, 5'- ACG AAG ACA AAC AAA CCA TTA TTA TC-3' (SEQ ID NO: 11) designed to anneal to the initial 26 bases of the 3'-end of the VSV genome.
  • PCR 1 IF - RT-oligo shown above (SEQ ID NO: 11), IR 5'-GAT ATG GTG AGA GGC TGA AGA C-3 1 : (SEQ ID NO: 12) 54.2°C; 2054 bp.
  • PCR 2 2F 5'-CCA GTG ATG AAC ACA CAT CC-3' (SEQ ID NO: B) 5 2R 5'-AGT CTC GAG CGT GAT ATC TGT TAG-3' (SEQ ID NO: 14); 54.3°C; 2726 bp.
  • PCR 3 3F 5'-CTC AAA TCC TGC TAG GTA TG-3' (SEQ ID NO: 15), 3R 5'-GAC TTC CAT GAT TGC TGT TAG-3' (SEQ ID NO: 16); 54.2°C; 2422 bp.
  • PCR 4 4F 5'-TTC AAG GAC GAC GAC GGC AAC
  • PCR 6 6F 5'-GAC TCA AGT ATG GAC TAC AC-3' (SEQ ID NO: 21) 6R 5'-ACG AAG ACC ACA AAA CCA G-3' (SEQ ID NO: 22); 50.4 0 C; 2496 bp. All PCR was performed using the Expand High Fidelity PCR Kit (Roche Diagnostics, Indianapolis, IN) and the reaction products were purified using the Qi Aquick PCR Purification Kit (Qiagen). Samples from all reactions were run on 0.8% agarose gels to confirm the presence of a single product of the appropriate molecular weight Purified products were spectrophotometrically quantified, mixed with the appropriate sequencing primers and submitted to the W. M.
  • PCR 1 IF (shown above, SEQ ID NO: 11) , 960F 5'-AAA ACC CTG CCT TCC ACT TC-3' (SEQ ID NO: 23), 1040R 5'-CAA ACC TGC TGT AGT AAG AG-3' (SEQ ID NO: 24), IR (shown above, SEQ ID NO: 12).
  • PCR 2 2F, (as shown above, SEQ ID NO: 13), 2962F 5'-CTA GTC TAA CTT CTA GCT TCT G- 3' (SEQ ID NO: 25), 3959F 5'-TTC AGG ACG TTG AGA GGA TC-3' (SEQ ID NO: 26), 3047R 5'-AAC AGA TCG ATC TCT GTT AG-3' (SEQ ID NO: 27), 4026R 5'-GGA GCA AGA TAG CTG AGA TC-3 1 (SEQ ID NO: 28), 2R (shown above, SEQ ID NO: 14) PCR 3: 3F (shown above, SEQ ID NO: 15), 497 IF 5'-TTC CAT CCG ATC CTT CAC TC-3' (SEQ ID NO: 29), 569IF 5'-ATT CAA GAC GCT GCT TCG CAA C-3' (SEQ ID NO: 30), 6035R 5'-GAG CTT TTC CAA CTA CTG AAC-3
  • PCR 6: 6F (shown above, SEQ ID NO: 21), 11959F 5'-GAA TCA GGT TGG GCC AAT TAC-3' (SEQ ID NO: 37) 12024R 5'-AGC CGT CTC CAC AAC TCA AG-3' (SEQ ID NO: 38), 13045R 5'-CAC TTC TGC TTG TAT CCT CC-3' (SEQ ID NO: 39), 6R, (shown above, SEQ ID NO: 22).
  • AU oligonucleotides were synthesized by the Department of Pathology
  • Genometics were purified and quantified as described above and 350 ng of each were included in restriction digestion reactions and control reactions (no enzyme) and incubated according to the manufacturer's instructions. Digestion products were run on 1.2% agarose gels stained with ethidium bromide. Results The genotypic alterations were identified by sequencing the genomes of the parent VSV-G/GFP and glioblastoma cell-adapted VSV-rp30 viruses using RT-PCR and automated nucleotide sequencing ( Figures 5 A-C). Sequencing of the parent virus as a control showed an identical nucleotide sequence to that used in generating the virus, showing that the parent VSV had population stability, at least over the estimated minimum of 50 generations of viral progeny from the stock previously generated.
  • the C1772T mutation of SEQ ID NO: 1 appears in the second position of codon 126 of the P protein and results in a replacement of the serine (S) in VSV-G/GFP (SEQ ID NO: 3) with a leucine (L) in VSV-rp30 (S 126L) (SEQ ID NO: 8).
  • SEQ ID NO: 3 The C1772T mutation of SEQ ID NO: 1 appears in the second position of codon 126 of the P protein and results in a replacement of the serine (S) in VSV-G/GFP (SEQ ID NO: 3) with a leucine (L) in VSV-rp30 (S 126L) (SEQ ID NO: 8).
  • a Genbank search indicated that a number of Indiana serotype VSV strains have been identified that, like VSV ⁇ rp30, possess a leucine (L) at position 126 of the P protein, (SEQ ID NO: 8).
  • strain 85CLB South America strain 94GUB Central America
  • strain 98COE North America strain Glasgow
  • strain Mudd-Summers strain Mudd-Summers
  • the only Indiana serotype VSV strain found to possess a serine (S) at position 126 of the P protein was the San Juan strain (Genbank accession P03520), the same strain from which VSV-G/GFP was originally recombinantly engineered (Lawson 1995).
  • the G7693T mutation of SEQ ID NO: 1 appears in the first position of codon 223 of the L protein and results in a replacement of the asparagine (D) in VSV-G/GFP (SEQ ID NO: 5) with a tyrosine (Y) in VSV-rp30 (D223Y) (SEQ ID NO: 10).
  • a Genbank search indicated that the asparagine (D) at position 223 of the L protein (SEQ ID NO: 5) appears to be a highly conserved residue and is present among all the Indiana serotype VSV strains for which sequence data are available.
  • VSV-r ⁇ 30 SEQ ID NO: 10
  • C1772T (S126L) and G7693T (D223Y) mutations are possible targets for cellular kinases
  • serine and tyrosine can act as potential phosphorylation sites for cellular kinases.
  • VSV-r ⁇ 30a amino acid alterations involved either a serine or a tyrosine.
  • Phosphorylation events that target these sites may be one basis for the novel phenotype observed in VSV-rp30, specifically the loss of the serine at 126, (SEQ ID NO: 8), and the gain of the tyrosine at 223, (SEQ ID NO: 10), could remove and create, respectively serine and tyrosine kinase phosphorylation sites.
  • the first server (NetPhos 2.0) is a database that predicts the likelihood that any particular serine, threonine or tyrosine in a protein sequence is a target of phosphorylation.
  • the second server (NetPhosK 1.0) makes predictions as to what specific kinases would be likely to recognize these sites. These servers indicated the following with respect to the mutant VSV-rp30 sites. S126L in the P protein
  • the serine that is lost at position 126 of the P protein in VSV-rp30 (SEQ ID NO: 8) is predicted to have a very high likelihood of acting as a substrate for phosphorylation and displayed a score of 0.997.
  • Two kinases were predicted to recognize this site, i.e. cdk5 and RSK.
  • Cdk5 is a cyclin- dependent kinase that is specific to neurons and has an axonal subcellular localization.
  • the serines at positions 60 and 64 were predicted to be phosphorylation sites and displayed scores of 0.985 and 0.989. respectively.
  • the sites at 60 and 64 were predicted to be recognized by casein kinase 2 (CK2), the kinase that has been empirically identified as the kinase responsible for phosphorylating these sites in VSV. D223Yin the L protein
  • the tyrosine that is gained at position 223 of the L protein in VSV- rp30 (SEQ ID NO: 10) is predicted to be phosphorylated with a score of
  • kinase inhibitor assay The kinase inhibitors staurosporine, genistein and tyrphostin 51 were obtained from Sigma-Aldrich, St. Louis, MO (catalog numbers: 54400, G6649 and T7665, respectively) and used to prepare 3 niM, 100 mM and 100 mM stock solutions, respectively, in 100% DMSO. Stock solutions were aliquotted and stored in a lightproof container at -20°C until use. Confluent U-373 cell monolayers in six-well plates were grown as described earlier.
  • the cell monolayers were aspirated and washed once with 2 mis of PBS before replacing the media with 0.9 ml of low-serum MEM media (1% FBS). Monolayers were then inoculated with either VSV-G/GFP or VSV- rp30 at a dilution selected to yield approximately 150 plaques per well and overlaid with 2 ml of agarose in low-serum MEM media as described earlier. After solidification of the agarose, a 0.5 ml volume of low-serum MEM media containing kinase inhibitor or vehicle (DMSO) at 5X the final concentration was overlaid onto the agarose.
  • VSV-G/GFP VSV- rp30
  • each kinase inhibitor was prepared by first serially diluting the kinase inhibitor stock solution in DMSO, then adding a constant volume of inhibitor/DMSO solution or DMSO alone (vehicle) to the 0.5 ml volume of low-serum MEM media. In this manner, all conditions were exposed to the same concentration of vehicle, i.e. 0.03% DMSO in the genistein experiments and 0.01% DMSO in the staurosporine and tyrphostin 51 experiments.
  • Staurosporine caused a significant attenuation of the difference in plaque size between VSV-rp30 and VSV- G/GFP at concentrations of 10 nM and 100 nM ( Figure 6 A).
  • Genistein is a protein kinase inhibitor selective for tyrosine kinases (Akiyama et aL, J. Biol. Chem., 262: 5592-5595 (1987).
  • Genistein also significantly attenuated the difference in plaque size between VSV ⁇ rp30 and VSV-G/GFP at a concentration of 10 ⁇ M (Figure 6 B).
  • tyrphostin 51 is a tyrosine kinase inhibitor selective for the epidermal growth factor receptor tyrosine kinase (EGFR). In contrast to the effects of both staurosporine and genistein, tyrphostin 51 had no significant effect on the difference in plaque size between VSV-rp30 and VSV-G/GFP at concentrations up to 10 ⁇ M, the highest dose tested ( Figure 6C).
  • RFP tetrameric phosphorylated Discosoma red (pDsRedl) ⁇ Nl and monomeric pDsRed-monomer- Cl] cyan fluorescent protein [phosphorylated cytomegalovirus (pCMV) ⁇ CFP], and blue fluorescent protein (pCMV-BFP) plasmids were used.
  • pCMV-CFP and pCMV— BFP were generated by exchanging the RFP expression cassette from pDsRed monomer-Cl with CFP or BFP cassettes from pRSET/CFP (Invitrogen). Cells were transfected using Lipofectamine 2000 reagent (Invitrogen), enriched, and maintained with G418 (Sigma, St. Louis, MO).
  • rU87 and rUl 18 cells were sorted for brightest fluorescence on a FACSvantage SE fluorescence-activated cell sorter (BD Biosciences, San Jose, CA). Growth characteristics were assessed using 3-(4,5- dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide (MTT) (Invitrogen) assay according to the instructions of the manufacturer. Optical density was read at 570 ran using a Dynatech (Alexandria, VA) MR500 ELISA plate reader and corrected from background control. Results
  • CMV-CFP cyan
  • pCMV-BFP blue
  • red tetrameric pDsRedl- Nl and monomeric pDsRedmonomer-Cl
  • Bilateral brain injections of either rU87 or rUl 18 cells in SCID or nude mice yielded tumors in 100% (90 of 90) of injections.
  • Ten days after injection, nomnfected rU87 xenografts in SCID mice had a mean calculated volume of 7.13+5.76 mm3 (n 4; calculated as ellipsoid volume: 4/3 x y z).
  • Horizontal and vertical radi x and y represent half of the horizontal and vertical diameters in the coronal section that harbored the largest tumor cross-section area.
  • the anteroposterior radius z represents half the tumor craniocaudal length, calculated by multiplying section thickness with the number of sections where the tumor is present.
  • Tumor xenografts grew predominantly by expansion, although in a number of cases tumor cells separated from the main tumor body and invading the surrounding parenchyma. Tumors grew with no spontaneous regression or hemorrhage until they reached a lethal size. For humane reasons, mice were killed at the onset of symptoms before tumor induced death.
  • a teardrop-shaped skin flap (with an anteroposterior axis along the parasagittal plane crossing the midpupiHary line) was removed, and a 5 -mm- wide round craniectomy was drilled under an operating microscope (Zeiss, Oberkochen, Germany).
  • rU87 glioma cells 5 x 10 4 , were injected along a trajectory parallel to the cortex immediately below the pia mater.
  • the craniotomy was covered with a round glass coverslip of 8 mm diameter and glued to the bone margins using cyanoacrylate. Animals were followed with daily measurements of weight, food and water consumption, and overall health and activity, and the cranial window animals were given parenteral antibiotics.
  • mice were lightly anesthetized to reduce movement, and the head was maintained in a horizontal position during image acquisition. Animals were killed with a pentobarbital overdose and perfused transcardially with 4% paraformaldehyde. For determination of blood- brain barrier integrity, 2% Evans Blue (Sigma) in 100 ⁇ l of sterile saline was injected intravenously 1 h before the animals were killed. Viruses
  • VSV-GFP and VSV- ⁇ G-GFP were generously provided by Dr. J. K. Rose (Yale University).
  • PRV-GFP strain 152 was kindly provided by Dr. L. W.
  • VSVrp30a replicates and spreads within the tumor mass Materials and Methods
  • VSV is a replication-competent virus and spreads within the tumor. Early in the course of infection in the non-infected areas, red tumor cells with intact cellular outlines were seen. Within the VSV-infected area, infected and dead tumor cells and debris were surrounded by VSV-infected cells with membranous GFP staining. The presence of newly infected cells at the boundary between killed and non-infected cells suggests that VSV spreads within the tumor. To document viral spread within the tumor mass, animals were killed 24, 48, and 72 h post-inoculation (HPI). Results
  • DAPI counterstain showed nuclear breakdown commonly found in dead cells, and areas of dead cells showed small granular debris in the place of intact cells.
  • the mean infected area in coronal brain sections with the largest tumor diameter increased from approximately 50 to 60% at 1 d post-inoculation (DPI) to what appeared to be infection of almost the entire tumor by 3 DPI ( Figure 8).
  • DPI d post-inoculation
  • Figure 8 the proportion of viable tumor cells showing normal cellular and nuclear morphology decreased simultaneously.
  • VSVrp30a infection causes tumor ce ⁇ l death Materials and Methods lmmunocytochemistry
  • DAPI 4,6-diamidino-2- phenylindole
  • 20 ⁇ m sections were incubated with a 1 : 150 dilution of polyclonal rabbit cleaved caspase 3 antiserum (Cell Signaling Technology, Danvers, MA) 5 followed by detection with a 1:200 dilution of biotinylated anti-rabbit antibody (Invitrogen) and ABC reagents detected with diaminobenzidine and hydrogen peroxide (Vector Laboratories, i Burlingame, CA).
  • DAPI 4,6-diamidino-2- phenylindole
  • VSV infection results in death of tumor cells in vitro.
  • VSVrp30a induced widespread tumor cell death in the brain in vivo.
  • Such a fast and efficient elimination of the tumor is important because remaining resistant cells have the potential of repopulating the tumor mass, which is commonly observed in gliomas after conventional treatment.
  • Widespread cell death was detected within the tumor mass.
  • Cell death was indicated by loss of cellular outlines on confocal and light microscopy. Differential interference contrast (DIC) microscopy showed loss of cellular outlines and diffusion of intracellular tumor cell DsRed with fluorescent imaging and nuclear fragmentation assessed with DAPI staining.
  • Example 11 Oncolytic potential of VSVrp30a generalizes to human glioma and mammary carcinoma
  • VSVrp30a was adapted to human gliomas by passaging it on U87MG cells for many generations. Therefore, to test the hypothesis that the in vivo oncolytic potential of VSVrp30a was not restricted to the cell line on which it was developed, two other types of tumor implanted into the mouse brain were also tested.
  • One of the cell types was Ul 18MG, a cell line derived from high-grade human glioma but with different genetic anomalies than found in U87MG.
  • the two glioma types have been shown to differ from each other in their p53 status, c-myc, and epidermal growth factor receptor and PDGF (platelet-derived growth factor) receptor overexpression; they share pi 4, pi 6 deletion, and low expression of multidrug resistance gene.
  • UI l 8 cells were stably transfected and sorted using the same protocol used for U87MG cells and will be called rU118 herein.
  • SCID mice bearing rUl 18 human glioblastoma xenografts (n - 12 tumors) were killed 48 and 72 h (six tumors each) after a single intravenous injection of VSVrp30a; widespread selective infection, and apoptotic cell death was noted.
  • VSVrp30a 0 J 855, Student's t test
  • 4Tl cells were transiently transfected with the monomeric DsRed gene and injected into the brain and periphery 48 h after transfection.
  • 4Tl mouse mammary carcinoma cells were used to create an animal model with simultaneous peripheral and multiple brain tumors to mimic the setting of a disseminated systemic cancer.
  • VSVrp30a infected all cranial and subcutaneous flank grafts in SCID mice (n - 2 mice) after a single intravenous injection.
  • Example 12 IV delivery of VSV efficiently targets and lyses brain xenografts in nude mice Materials and Methods
  • VSV VSV
  • an intravenous injection of VSV can be used to target simultaneously both brain and peripheral metastases of a systemic cancer.
  • Direct intratumoral injection may be useful for some tumors.
  • intratumoral injections of viruses have resulted in a very limited viral spread around the injection site (Pulkkanen and Yla-Herttuala, MoI Ther, 12:585-598 (2005)).
  • the ability of VSV to infect multiple independent central and peripheral sites and spread in them is substantive, making it possible to treat disseminated disease and even target minute tumor colonies that are otherwise difficult to detect.
  • Xenograft models are limited in that human gliomas often grow expansively rather than infiltratively in mice. Nonetheless, infiltrating cells were observed within the host brain, and these were targeted by VSV.
  • Example 13 Intranasal VSV targets olfactory bulb tumors Materials and Methods
  • VSV can enter the CNS.
  • Nasal mucosal infection results in infection of olfactory neurons, and VSV can gain access to the CNS through the olfactory nerve, which projects to the glomeruli in the olfactory bulb (van den Pol et al, J Virol, 76:1309-1327 (2002)).
  • the hypothesis that VSV could enter the brain along the olfactory nerve and target brain tumors in the olfactory bulb was tested.
  • rU87 cells were stereotactically grafted into one of the two olfactory bulbs in SCID mice. Four days after tumor implantation, animals were inoculated in each nostril with 25 ⁇ l containing 2.5xlO 7 PFU of VSVrp30a. Results
  • animals killed 3 DPI (four tumors) or 5 DPI (six tumors) VSV infection was located within the tumor but not in the surrounding parenchyma or in the intact contralateral olfactory bulb.
  • mice killed 7, 10, 15, 16, or 17 d after virus inoculation, cellular debris indicative of a viral infection was found, but surviving tumor cells were not found, suggesting that the virus was successful in eliminating the tumor.
  • infected olfactory nerve fibers that could serve as entry to the CNS, there is still the possibility that VSV entered the blood circulation through intranasal application and might reach the olfactory bulb via the circulatory system.
  • peripheral sentinel tumors were placed into the flank of three animals simultaneously with olfactory tumor grafting. Seven days later, mice received 2.5x10 7 PFU VSVrp30a into each nostril. At 3 d after inoculation, both olfactory bulb and peripheral tumors were analyzed.
  • VSV infection as early as 16 HPI after tail vein injection of 10 7 PFU of VSVrp30a could be detected ( Figure 11) and followed through viral infection over several days in the live brain. Tumor growth and infection were observed every 4 - 8 h over a course of 4 d. VSV infection spread through the whole tumor bulk within 96 h ( Figure 11); although multiple points of infection were seen, the majority of tumor cells appeared to be infected by a locally spreading VSV infection.
  • Laser confocal microscopy gave a cellular or even subcellular resolution, making visible not only single cells but also their processes.
  • VSV infected single infiltrating red tumor cells but not the surrounding normal brain tissue.
  • Vascular patency and circulation appeared normal in tumor vessels within the infected area even at advanced stages of tumor cell lysis; in live real-time imaging, erythrocytes could be seen moving through the uninfected walls of the blood vessels within the tumor even when all surrounding tumor cells were infected and dying.
  • the blood-brain barrier may be leaky in some types of tumors.
  • VSV does not enter the CNS through the hematogenous route. Therefore, to explore what makes tumor xenografts permeable to VSV, blood-brain barrier integrity was tested in the xenograft neovasculature. Results
  • VSVrp30a does not enter the brain because of the injury of cell transplantation, nor does it target normal human or mouse cells transplanted into the brain. Infection of glioma xenografts appears specific for replication-competent VSV.
  • VSV- ⁇ G-GFP recombinant replication deficient VSV
  • Intravenous injection of 10 7 PFUs of VSV- ⁇ G-GFP to animals with bilateral striatal tumors (n - 2) did not result in tumor infection,
  • GFP-expressing scattered cells were detected in the liver after intravenous injection of VSV- ⁇ G-GFP.
  • two other viruses that were previously shown to infect or Iy se glioma cells in vitro was used.
  • Example 16 VSV binding to the plasma membrane and virus internalization is greater in glioma than in normal astrocytes Materials and Methods
  • VSVrp30a Binding, entry, and uncoating of VSVrp30a were compared in rU87 glioma cells and normal human astrocytes using quantitative RT-PCR. To assess membrane-bound fraction, cells were incubated at 4°C with VSVrp30a for 20 min and washed five times before RNA extraction. To quantify intracellular virus, cells were trypsimzed for 10 min and washed five times in PBS. VSV was pooled in the endosomal compartment by incubating for 90 min in the presence of 5 niM ammonium chloride (Sigma). Ammonium chloride blocks acidification of the endosome and therefore blocks viral uncoating into the cytoplasm. These experiments were done in triplicate using an MOI of 10.
  • GFP glyceraldehyde-3 -phosphate dehydrogenase
  • VSV selectively targets glioma in the brain, suggesting that some mechanism underlies the relative selectivity of the virus to the tumor.
  • a correlation exists between VSV infection and various defects in the interferon system in tumor cells (Stojdl et al., Nat Med, 6:821-825 (2000); Balachandran et al, J Virol, 75:3474-3479 (2001)).
  • a series of five different brain tumor cell lines and normal human control astrocytes was compared previously, and demonstrated an interferon-dependent selectivity of VSV for glial tumor cells over their nontumor counterpart (Wollmann et al., J Virol, 81:1479-1491 (2007)).
  • antiviral defense may not exclusively account for the selectivity, and several additional mechanisms have been proposed (Wagner and Rose, Philadelphia Raven Press, (1996); Balachandran and Barber, Cancer Cell, 5:51-65 (2004); Barber, Oncogene, 24:7710-7719 (2005); Lyles and Rupprecht, Lippinscott Williams and Wilkins, 1363-1408 (2007).
  • No specific receptor has been identified for VSV; after binding, the virion undergoes clathrin-mediated endocytosis, and, after acidification in the endosome, the uncoated virus enters the cytoplasm.
  • VSVrp30a For this purpose, cells were incubated with VSVrp30a at an MOI of 10 for 30 min and next incubated for another 1 h after changing the medium three times to eliminate unbound virus. At 90 min after infection, cells were washed five times with PBS and trypsimzed, and intracellular VSV was quantified.
  • VSV-rp30 targets colon cancer in mouse Materials and Methods Mouse procedures
  • NCr-Foxnlnu were obtained from Taconic Farms (Germantown, NY). Six to eight-week-old mice were briefly anesthetized by i.p. injection using a combination of ketamine and xylazine (100 and 10 mg/kg, respectively) and injected in both flanks with 500,000 HCTl 16 cells suspended in 0.1 ml sterile saline. Sizeable subcutaneous tumors formed within 3 weeks. Tumor bearing mice received a single tail vein injection of 0.1 ml of virus solution containing 5x106 pfu VSV-rp3O. Body weight and mouse health were monitored daily.
  • mice Three days post VSV inoculation mice were sacrificed by an overdose of pentobarbital and perfused transcardially with physiological saline for 1 minute followed by freshly prepared 4% paraformaldehyde solution. Subcutaneous tumor masses and control tissues (liver, spleen, and lung) were excised, stored in 4% paraformaldehyde solution, and cut in 20- ⁇ m sections using a microtome. Cryosections were mounted using 4 t ,6-diamidino-2-phenylindole (DAPI (Invitrogen) and analyzed on a fluorescence microscope (Olympus Optical IXTl; Tokyo, Japan) coupled to a SPOT color camera (Diagnostic Instruments, Sterling Heights, MI). Results
  • DAPI 4 t ,6-diamidino-2-phenylindole
  • VSV-rp30 is oncolytic in vivo using U-87 brain tumor xenograft mouse models employing two different virus application strategies, direct intratumoral injection (34) as well as systemic injection (20).
  • a HCTl 16 human colon carcinoma xenograft model was used.
  • Four immunocompromised NCr nude mice bearing bilateral subcutaneous human HCTl 16 tumors received a single bolus of 100 ⁇ l of saline containing 5xlO 6 pfu VSV-rp30 via tail vein injection.
  • Mouse body weight showed a transient decrease after VSV injection, but recovered to pre-application values at 2 dpi.
  • VSV-rp30 can be applied systemically and target and infect tumor xenografts remote from the injection site with a striking preference for tumor tissue over normal control tissue.
  • VSV-rp30 As a proof of principle test that the in vitro data suggesting VSV-rp30 is oncolytic to many types of cancer may generalize to the whole animal, human colon cancer tumor cells were transplanted into mice. Intravenous injections of VSV-rp30 resulted in selective infection and cell death of the tumor, with relatively little detectable infection of normal cells. The in vivo experiment suggests that the tissue culture experiments may generalize to in vivo situations.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Virology (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Oncology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

Oncolytic VSV viruses have been developed as a strategy for combating cancer. The present invention includes mutant VSV that have one or more mutations in the nucleic acid sequence encoding the viral genome that increase the oncolytic potential of the virus. Pharmaceutical compositions including oncolytic virus disclosed herein are also provided. Pharmaceutical compositions containing virus and one or more excipients may be for systemic or local administration. Methods of administering an effective amount of the compositions for treating cancer are disclosed. Preferred routes of administration include intratumeral and intravenous injection, and intranasal delivery. Administration of the disclosed compositions containing oncolytic viruses may be coupled with surgical, radiologic, other therapeutic approaches to treatment of cancer. Methods of manufacturing mutant VSV viruses exhibiting desired properties include applying selective pressure, and through directed or random mutagenesis.

Description

COMPOSITIONS AND METHODS OF USE OF AN ONCOLYTIC
VESICULAR STOMATITIS VIRUS
CROSS REFERENCE TO RELATED APPLICATIONS This application claims priority to and benefit of U.S. Provisional
Patent Application No. 61/143,236 filed on January 8, 2009, and where permissible is incorporated by reference in its entirety.
GOVERNMENT SUPPORT
The United States government has certain rights in this invention by virtue of National Institutes of Health Grant Numbers 5RO1CA124737-03 and 5ROl AI048854-09 to Anthony N. van den Pol.
FIELD OF THE INVENTION
The present application is generally related to oncolytic vesicular stomatitis viruses and compositions and methods of use for treatment of cancer.
BACKGROUND OF THE INVENTION
There are many different types of cancers and means of treating the cancers. The most typical way of treating cancer is through the use of chemotherapeutic agents that selectively target the more rapidly proliferating tumor cells relative to the host cells. These have serious side effects, including death of normal cells, mucositis, nausea, and may give rise to drug resistant tumor cells. Antibodies and antibody targeted therapeutics are a desirable alternative to chemotherapeutics since they are more selective, but are limited to the few tumors expressing antigens that can be effectively targeted. Drugs that inhibit angiogenesis are another approach having fewer side effects, but have been found to only limit tumor growth, not kill existing tumors.
Viruses are an alternative approach for combating cancer. One approach to treating tumors is to use replication-incompetent viral vectors to deliver genes to the tumor. Replication-incompetent viruses have value in delivering genes to the area of the tumor that might then alter the general environment near the tumor, making it less hospitable to the tumor. There are a number of interesting strategies based on viral vectors, including delivery of suicide genes such as HSV-tk or ricin, genes that reduce vascular proliferation, restore cell cycle control and encourage apoptosis such as p53, or stimulate an immune response (IL- 12, interferon, tumor necrosis factor). One problem with replication incompetent viruses is that, even with direct injection into a tumor, the number of cells infected in a solid tumor is generally quite small, averaging about 7% of the total tumor cell population (Puumalainen ei at, Adv Exp Med Biol, 451 :505-509 (1998); Rainov and Ren, Acta Neurochir Suppl, 88:113-123 (2003)). Thus with viruses that do not replicate, it has not been possible to infect a substantial percentage of the tumor cells.
A primary advantage of conditional replication competent viruses is that they infect and kill tumor cells, and then their new viral progeny are released to kill additional tumor cells. In contrast to replication incompetent viral vectors that only infect a small number of tumor cells, a small injection of replication competent VSV or Sindbis virus can lead to a rapid and complete intratumoral spread of the virus. Beneficially, due to local self- amplification, replication competent viruses may be effective with one single application, whereas repetitive injections have to be applied for the less effective replication incompetent agents. A number of viruses have been shown to have oncolytic potential, including recombinant herpes, adeno, polio and alpha viruses. Myxoma virus was effective in killing medulloblastoma, and infection was increased in combination with Rapamycin (Lun, et al, Cancer Res., 67(18):8818-8827 (2007). Herpes simplex virus has been rendered conditionally replication-competent for tumors by inserting mutations in several HSV genes. Oncolytic adenovirus agents specifically restrict their replication to p53 deficient tumor cells, and retrovirus to tumors with activated Ras-signaling pathways (Chiocca, Nat. Rev. Cancer, 2: 938-950 (2002); Rainov and Ren, Acta Neurochir Suppl, 88:113-123 (2003)). These strategies are restricted to defined mutations of the tumor. Oncolytic viruses that are not strictly dependent on a single gene mutation are therefore desirable to treat cancers that exhibit a heterogenous array of genetic aberrations. One replication competent virus with oncolytic potential is vesicular stomatitis virus (VSV) (Lun, et al. J. Nat. Can. Instil, 98(21): 1546-1557 (2006), Wu, et al., Clin. Cancer Res., 14(4):1218-1227 (2008), Ozduman, et al., J. Virol. , 83(22): 11540-11549 (2009), Wollmarra, et al., J Virol, (2009 Epub; 2010 J. Virology 84(3).VSV is an RNA virus that uses a negative strand RNA to encode its genome. Although some viruses may express over a hundred different genes, VSV with its 11-12 kilobase genome encodes five structural genes, N, P, M, G, and L, encoding proteins that each may have multiple functions. The virus envelope consists of a host cell-derived lipid bilayer that contains several hundred copies of viral glycoprotein spikes (G- protein) and forms a characteristic bullet shape. The nucleocapsid protein N forms a tight complex with the helical coiled non-segmented RNA genome and the viral matrix protein M bridges the gap between nucleocapsid and viral envelope. A complex formed by the phosphoprotein P and the large polymerase L facilitates viral polymerase activity. Phosphorylation is thought to play a role in the function of the of P protein, for example, unphosphorylated P is much less active in supporting viral transcription at low concentrations (Spadafora et al., J. Virol, 70(7): 45-38-4548 (1996)). VSV binds to the cell membrane, becomes internalized, and then replicates in the cell cytoplasm. VSV replicates fairly quickly, about 6 hours for progeny virus to bud from the plasma membrane of the infected cell. A single infected cell can release many VSV progeny, although some of the progeny are defective particles. VSV blocks the ability of infected cells to transport mRNA out of the nucleus (VSV M-protein blocks nuclear pores), and usurps the host cell translational mechanisms to synthesize primarily viral gene products. VSV is found around the world. Many mammals, including humans, can be infected by the vims which is probably spread by biting flies (de Mattos et al. In Fields of Virology, pp. 1245-1277, (Knipe, et al., Eds) (2001)). Humans show only modest symptoms, or none, with infection which clears as the immune system eliminates the virus. In some rural regions of central America, the majority of adults show seropositivity with antisera against VSV with few symptoms detectable (Tesh, et at, Am. J. Epidemiol., 90:255-261, (1969)). Replication competent VSVs are in human clinical trials as a carrier virus to generate immune responses against more dangerous viruses, including HIV, influenza, and papilloma viruses cloned into the VSV genome (Roberts, et al., J Virol, 73:3723-32 (1999); Roberts, et al., J Virol, 78: 3196-3199 (2004); Okuma et al., J. Virol. 346(1 ):86-97 (2006); Rose et al., Cell, 106:539-549 (2001)).
VSV has demonstrated potential as an oncolytic virus, hi a battery of in vitro and in vivo tests, VSV showed the greatest promise among nine replication competent viruses including Sindbis, human and mouse cytomegalovirus, pseudorabies virus, the parvoviruses MVMi and MVMp, and others that have been described as having oncolytic potential (Wollmann et al, J Virol, 79(10): 6005-6022 (2005)). Normal cells possess innate mechanisms to reduce or block viral infections. VSV replication can be attenuated or blocked by cellular interferon (IFN). Defects in this system are thought to contribute to the oncolytic activity of VSV (Wollmann, et al.s J Virol, 81(3):1479-1491 (2007)). In addition to destroying glioblastoma cells, VSV has also shown promise outside the brain as an anti-cancer agent in recent experimental studies on various solid tumors, for example carcinoma of colon (Stojdl et al., Cancer Cell, 4:263-275 (2003)), breast (Ebert et al., Cancer Gene Ther, 12:350-358 (2005)), prostate (Ahmed et al., Virology, 330:34-49 (2004)) and liver (Shinozaki et al, 2005) or hematological malignancies such as leukemia (Lichty et al., 2004b).
To further enhance the potential selectivity of VSVs for brain cancer cells, a recombinant wildtype-based VSV expressing a gene coding for green fluorescent protein (GFP), VSV-G/GFP (7,30), was grown for many generations on human glioblastoma cancer cells using a protocol that enhanced viral fitness based on viral internalization, replication, and cell selectivity. This cell-adapted propagation resulted in a virus that displayed an enhanced rate of infection and replication on the U-87MG glioblastoma line used to grow the virus and was named VSV-rp30 (Wollmann et al, J Virol, 79(10): 6005-6022 (2005), Ozduman, et al., J ofNeurosci. , 28(8): 1882- 1893 (2008)). Identification of the differences between VSV-rp30 and less effective VSV viruses, such as the parent strain, would provide an avenue for development of a range of oncolytic viruses with improved oncolytic potential for anti-cancer therapeutics.
It is an object of the invention to provide isolated oncolytic VSV virus with enhanced oncolytic potential, compared to naturally occurring wild strains.
It is a further object of the invention to provide mutant VSVs with an increased replicative capacity in cancer cells relative to normal cells.
It is another object of the invention to provide a viral composition effective to reduce tumor burden. It is another object of the invention to provide methods for making and using the viral compositions for treating cancer.
SUMMARY OF THE INVENTION Oncolytic VSV viruses have been developed as a strategy for combating cancer, where the virus selectively infect, and kill, tumor cells. Mutant VSV that have one or more mutations in the nucleic acid sequence encoding the viral genome, specifically, mutations in the P and/or L proteins enhance the oncolytic potential, of the virus. Some viruses have more than one mutation. For example, a virus can have mutations of both the L and P proteins. An exemplary virus is VSV-rp30. In some embodiments, viruses are modified to include one or more targeting or therapeutic proteins. In other embodiments viral genes are substituted or rearranged to modulate infectivity and replication frequency of the virus.
Pharmaceutical compositions containing virus and one or more excipients may be systemically or locally administered. For example, compositions are administered for the treatment of benign or malignant tumors. In a preferred embodiment, administration of the virus reduces one or more symptoms of a tumor. Preferred routes of administration include intratumoral, intravenous, and intraarterial injection, and intranasal delivery.
Administration of the disclosed compositions containing oncolytic viruses may be coupled with surgical, radiologic, other therapeutic approaches to treatment of cancer. For example, co-administration of virus with an immunosuppressant will preferentially reduce or inhibit the subject's immune response, extending the infective half-life of the virus. Compositions containing virus can also be co-administered with traditional cancer treatments such as chemotherapy.
Methods of manufacturing virus are disclosed. Additional mutant VSV viruses exhibiting desired properties can be developed by applying selective pressure, or through directed or random mutagenesis.
BRIEF DESCRIPTION OF THE DRAWINGS Figures IA5 IB, 1C, ID5 and IE are graphs illustrating VSV-rp30 oncolysis of five tumor cell lines: (IA) Mcf-7 human breast cancer cells, (IB) T47-D human breast cancer cells, (1C) BT-474 human breast cancer cells, (1 D) A-549 human lung cancer cells, and (1 E) CaIu- 1 human lung cancer cells. Each graph illustrates the % infected cells (line rising from bottom left to top right), and cells with intact morphology (line falling from top left to bottom right), as a function of time (hours).
Figure 2 is a schematic comparing VSV genomes, as indicated. The five viral genes are labeled, N, P, M, G and L. Additional genes including Green Fluorescent Protein (GFP) arid G/GFP fusion are also indicated. Mutations are identified with an arrow head. S126L indicates a serine to leucine substitution as codon 126 of the P protein, and D223Y indicates an aspartic acid to tyrosine substitution at codon 223 of the L protein of VSV- rp30. M51 indicates a deletion of the methionine at position 51 of the M protein, and CT9 indicates deletion of all but 9 of the 27 amino acids of the C-terminal cytoplasmic tail in VSV-M51/CT9.
Figure 3 is a chart illustrating the plaque size (diameter) that developed in the monolayer of 11 cancer cell lines (as labeled from top to bottom above the dotted line) and 3 non-cancer cell lines (as labeled from top to bottom below the dotted line) following infection with 4 different VSV viruses (as labeled from left to right). Each circle represents the mean of 30 randomly selected plaques measured across their diameter, then normalized with respect to the corresponding VSV-G/GFP mean plaque diameter. Small marks at the top of each circle represent standard error of the mean. "NS" indicates the only plaques that were not statistically different (p < 0.05).
Figure 4 is a chart illustrating the plaque size (black circles) compared to EthD-1 labeled cytotoxic areas (white circles) that developed in the monolayer of four cancer cell lines (as labeled from top to bottom) following infection with 4 different VSV viruses (as labeled from left to right). Measurements were collected and normalized as in Figure 3.
Figure 5 A is a diagram depicting the series of six overlapping PCR products derived from the amplification of the VSV genomic cDNA and used for sequencing. Sequencing primers are illustrated with arrows. Figure 5B is a schematic of the parent VSV-G/GFP genome, and illustrates the positions of the four mutations (C1772T, G7693T, A11712G, C11736) identified in the variant VSV-rp30. Figure 5C is a section of the sequencing chromatographs of both the parent, VSV-G/GFP (top) and mutated VSV- rp30 (bottom) codons.
Figures 6A, 6B, and 6C are bar graphs illustrating the average plaque diameters (%) of VSV-rp30 plaques (black bars) relative to VSV-G/GFP plaques (white bars) on U-373MG cell monolayers after treatment of increasing concentrations (left to right), of different kinase inhibitors: (6A) Staurosporine (nM), (6B) Genistein (μM), and (6C) Tyrphostin 51 (μM). Figures 7 A, 7B and 7C are a schematized general outline of VSV oncolysis in the SCID mouse brain tumor model. After intravenous injection (7A), VSV-rp30 infection starts at few scattered foci (7B) around the brain tumor vasculature and spreads to infect the entire tumor (7C).
Figure 8 is a bar graph illustrating tumor area (%) as a function of time post-infection. Tumor infectivity (% of tumor GFP-positive) is represented by vertical bars from the bottom up: left hand bar represents the parent virus VSV-G/GFP and the right hand bar represents the mutant virus VSV-rp30 for each time point (24, 48, 72 hours, left to right). Intact tumor (%) infected with each virus is represented by vertical bars from the top down. The black space between each top and bottom bar represents tumor debris (%)
Figure 9A is a bar graph illustrating the number of tumor cells with intact morphology as a function of hours post infection (HPI) with VSV- rp30. Figure 9B is a bar graph illustrating the number tumor cell nuclei with intact morphology as a function of hours post infection (HPI) with VSV- rp30. Figure 9C is a bar graph illustrating the number of apoptotic tumor cells as a function of hours post infection (HPI) with VSV-rp30.
Figure 10 is a bar graph illustrating the percent of apoptotic cells in various tumor xenograft models infected with VSV-rp30 by intravenous injection. From left to right bars represent Ul 18 (glioma) tumor in T- and B- deficient SCID mouse, 4Tl (mouse mammary carcinoma) tumor in SCID mouse, and rU87 (glioma) tumor in nude mouse.
Figure 11 is a graph showing the percent surface area infected of glioma tumor in a mouse brain as a function of time (hours) following infection with VSV-rp30.
Figurel2A is a bar graph illustrating the relative VSV quantity (%) cell surface bound to normal human astrocytes (Astro) or rU87 glioma cells 20 min after infection. Figure 12B is a bar graph illustrating the relative VSV quantity (%) cell surface bound and intracellular to/in normal human astrocytes (Astro) or rU87 glioma cells 30 min after infection. Figure 12C is a bar graph illustrating the relative VSV quantity (%) in endosomes in normal human astrocytes (Astro) or rU87 glioma cells 90 min after infection. Figure 12D is a bar graph illustrating the relative VSV quantity (%) in intracellular in normal human astrocytes (Astro) or rU87 glioma cells 90 min after infection.
DETAILED DESCRIPTION OF THE INVENTION I. Definitions
As used herein the term "isolated" is meant to describe a compound of interest (e.g., either a polynucleotide or a polypeptide) that is in an environment different from that in which the compound naturally occurs e.g. separated from its natural milieu such as by concentrating a peptide to a concentration at which it is not found in nature. "Isolated" is meant to include compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified. With respect to nucleic acids5 the term "isolated" includes any non-naturally-occurring nucleic acid sequence, since such non-naturally-occurring sequences are not found in nature and do not have immediately contiguous sequences in a naturally-occurring genome. As used herein, the term "nucleic acid(s)" refers to any nucleic acid containing molecule, including, but not limited to, DNA or RNA. The term encompasses sequences that include any of the known base analogs of DNA and RNA including, but not limited to, 4-acetylcytosine, 8-hydroxy-N6- methyladenosine, aziridinylcytosine, pseudoisocytosine, 5-
(carboxyhydroxylmethyl) uracil, 5-fluorouracil, 5-bromouracil, 5- carboxymeώylaminomethyl-2-thiouracil, 5- carboxymethylaminomethyluracil, dihydrouracil, inosine, N6- isopentenyladenine, 1-methyladenine, 1-methylpseudouracil, 1- methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2- methylguanine, 3-methylcytosine, 5-methylcytosine, N6-methyladenine, 7- methylguanine, 5-methylaminomethyluracil, 5-methoxy-aminomethyl-2- thiouracil, beta-D-marmosylqueosine, 5'-methoxycarbonylmethyluracil, 5- methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil- 5 -oxyacetic acid methylester, uracil-5-oxyacetic acid, oxybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouraciϊ, 4-thiouracil, 5- methyluracil, N-uracil-5 -oxyacetic acid methylester, uracil-5-oxyacetic acid, pseudouracϊl, queosine, 2-thiocytosine, and 2,6-diaminopurine. In accordance with standard nomenclature, nucleic acid sequences are denominated by either a three letter, or single letter code as indicated as follows: adenine (Ade, A), thymine (Thy, T), guanine (Gua, G) cytosine (Cyt, C), uracil (Ura, U).
As used herein, the term "polynucleotide" refers to a chain of nucleotides of any length, regardless of modification (e.g., methylation). The term "gene" refers to a nucleic acid (e.g., DNA or RNA) sequence that comprises coding sequences necessary for the production of a polypeptide, RNA (e.g., including but not limited to, mRNA, tRNA and rRNA) or precursor. The polypeptide, RNA, or precursor can be encoded by a full length coding sequence or by any portion thereof. The term also encompasses the coding region of a structural gene and the sequences located adjacent to the coding region on both the 5' and 3' ends for a distance of about 1 kb on either end such that the gene corresponds to the length of the full-length mRNA. The term "gene" encompasses both cDNA and genomic forms of a gene, which may be made of DNA, or RNA. A genomic form or clone of a gene may contain the coding region interrupted with non-coding sequences termed "nitrons" or "intervening regions" or "intervening sequences." Introns are segments of a gene that are transcribed into nuclear RNA (hnRNA); introns may contain regulatory elements such as enhancers. Introns are removed or "spliced out" from the nuclear or primary transcript; introns therefore are absent in the messenger RNA (mRNA) transcript. The mRNA functions during translation to specify the sequence or order of amino acids in a nascent polypeptide. As used herein, the term "nucleic acid molecule encoding," refers to the order or sequence of nucleotides along a strand of nucleotides. The order of these nucleotides determines the order of amino acids along the polypeptide (protein) chain. The nucleotide sequence thus codes for the amino acid sequence As used herein, the term "polypeptide" refers to a chain of amino acids of any length, regardless of modification (e.g., phosphorylation or glycosylation). In accordance with standard nomenclature, amino acid residue sequences are denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg5 R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (GIn, Q), Glutamic Acid (GIu, E), Glycine (GIy, G), Histidine (His, H), Isoleucine (He, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S)5 Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (VaI, V). As used herein, a "variant," "mutant," or "mutated" polynucleotide contains at least one polynucleotide sequence alteration as compared to the polynucleotide sequence of the corresponding wild-type or parent polynucleotide. A "variant," "mutant," or "mutated" polypeptide contains at least one amino acid sequence alteration as compared to the amino acid sequence of the corresponding wild-type, or parent polypeptide. Mutations may be natural, deliberate, or accidental.
As used herein, a "nucleic acid sequence alteration" can be, for example, a substitution, a deletion, or an insertion of one or more nucleotides. An "amino acid sequence alteration" can be, for example, a substitution, a deletion, or an insertion of one or more amino acids.
As used herein, a "vector" is a replicon, such as a plasmid, phage, or cosraid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. The vectors described herein can be expression vectors.
As used herein, the term "effective amount" or "therapeutically effective amount" means a dosage sufficient to treat, inhibit, or alleviate one or more symptoms of a disease state being treated or to otherwise provide a desired pharmacologic and/or physiologic effect. The precise dosage will vary according to a variety of factors such as subject-dependent variables (e.g., age, immune system health, etc.), the disease, and the treatment being effected.
As used herein, the terms "neoplastic cells," "neoplasia," "tumor," "tumor cells," "cancer" and "cancer cells, " (used interchangeably) refer to cells which exhibit relatively autonomous growth, so that they exhibit an aberrant growth phenotype characterized by a significant loss of control of cell proliferation (i.e., de-regulated cell division). Neoplastic cells can be malignant or benign. As used herein, the terms "VSV-rp30" and "VSV-rp30a" are used interchangeably, and refer to a mutant VSV with improved oncolytic potential compared to the parent strain VSV-G/GFP. II. Compositions A. Viruses The viruses disclosed herein may be "native" or naturally-occuring viruses, or engineered viruses, such as recombinant viruses. Mutations are introduced into the viral genome to provide viruses with enhanced selectivity and cytolytic activity for cells of interest, such as cancer cells.
1. Oncolytic Viruses The present invention includes mutant VSV that have one or more mutations in the nucleic acid sequence encoding the viral genome. The mutations may reduce or inhibit post translational phosphorylation of viral proteins, or may work well due to other independent mechanisms. Changes in post translational phosphorylation of viral proteins, such as the P and/or L proteins, may increase the specificity or infectivity of oncolytic viruses. Increasing the specificity or infectivity of a virus for one or more types of cancers compared to normal cells increases the oncolytic potential of the virus.
A protein kinase is an enzyme that modifies proteins by covalently adding phosphate groups to them in a chemical reaction known as phosphorylation. Phosphorylation can cause a functional change of the phosphorylated protein, such changing enzyme activity, cellular location, or association with other proteins. The amino acids serine, threonine, and tyrosine, and sometimes others such as bJstidine, can be phosphorylated in the presence of a kinase. Cells contain a number of kinases, and each kinase may be capable of phosphorylating one or more amino acids. For example, some kinases phosphorylate serine and theronine, while others phosphorylate serine, theronine, and tyrosine. Changes in the nucleic acid sequence of viral genes, have the potential to increase or decrease the post translational phosphorylation of viral proteins, by increasing or decreasing the number of amino acids that can be phosphorylated. Mutations altering the phophorylation of viral proteins will become apparent when viral genes are translated in the presence of kinases, such as cellular kinases.
In some embodiments, the mutant virus has one or more mutations in at least one codon in the viral genome encoding a phosphorylation site. In some viruses, the mutation is designed to inhibit phosphorylation of at least one phosphorylation site. For example, the mutation can result in amino acid insertions, deletions, and/or substitutions, introduced at the phosphorylation sites in order to block phosphorylation. The mutation can result in substitution of at least one serine, threonine, and/or tyrosine, amino acid by an amino acid, such as alanine. The mutation can result in amino acid insertions, deletions, and/or substitutions that reduce or inhibit phosphorylation of a serine, threonine, or tyrosine by sterically blocking kinase activity.
Mutations may promote or increase post translational phosphorylation of viral proteins in the presence of a kinase. In one embodiment, the mutant virus has one or more mutations in at least one codon in the viral genome encoding an amino acid that is not phosphorylated, such that the substituted amino acid can be phosphorylated in the presence of a kinase. Substitutions may be made at any amino acid such that phosphorylation of the viral protein is increased. The mutation can be a substitution from any amino acid that can not be phosphorylated, to an amino acid that can be phosphorylated, such as an alanine to a serine, threonine, or tyrosine. The mutation can result in amino acid insertions, deletions, and/or substitutions introduced adjacent to phosphorylation sites in order to increase or promote phosphorylation in the presence of kinase. For example, removal of amino acids that sterically block phosphorylation of another amino acid may be replaced or deleted. Mutations in one or more codons in the viral genome resulting in the substitution of one phosphorylation site or another phosphorylation site are are also considered. For example a serine can be replaced by threonine. Substitution of the amino acid at phosphorylation sites may increase, decrease, or otherwise alter the phosphorylation of viral proteins by presenting an alternative substrate for the available cellular kinases.
In one embodiment, one or more mutations in at least one codon in the viral genome of a self-replicating VSV genome alters the phosphorylation of the P protein, the L protein, or a combination thereof.
Non-limiting illustrations of mutations that alter the phosphorylation of the P protein, and the L protein are described in the examples below.
VSV-G/GFP is an oncolytic VSV virus with a genome encoded by nucleic acid SEQ ID 1 which is a cDNA sense strand. The P protein of VSV-G/GFP (SEQ ID NO: 3) is encoded by the nucleic acids between 1396-2193 of SEQ ID NO: 1 (SEQ ID NO: 2). The L protein of VSV-G/GFP (SEQ ID NO: 5) is encoded by the nucleic acids between 7027-13356 of SEQ ID NO:1 (SEQ ID NO: 4). The L protein has an amino acid SEQ ID NO: 5. In the preferred embodiment the virus has a mutation in codon 126 of
SEQ ID NO: 3 encoding the P protein. In one embodiment the mutation in codon 126 of SEQ ID NO: 3 results in replacement of the serine (S), with another amino acid such alanine (A), arginine (R), asparagine (N)5 aspartic acid (D)5 cysteine (C), glutamine (Q), glutamic acid (E), glycine (G), histidine (H), isoleucine (I), leucine (L), lysine (K), methionine (M), phenylalanine (F), proline (P), tryptophan (W), or valine (V). In an alternative embodiment, the mutation in codon 126 of SEQ ID 3, results in replacement of the serine (S) with a leucine (L) (S126L substitution). In the most preferred embodiment, the mutation is a C1772T mutation in nucleic acid SEQ ID NO: 1.
In another embodiment the virus has a mutation in codon 223 of SEQ ID NO: 5 encoding the L protein. In one embodiment the mutation in codon 223 results in a replacement of the asparagine (D) with a serine (S), threonine (T), or tyrosine (Y). In a further embodiment the mutation in codon 223 results in a replacement of the asparagine (D) in VSV-G/GFP with a tyrosine (Y) (D223Y substitution). In a preferred embodiment, the mutation is a G7693T mutation that appears in nucleic acid SEQ ID NO: L Some viruses have more than one mutation. For example, a virus can have mutations that result in a change of both the L and P proteins. This mutation may or may not alter phosphorylation state. A virus can have mutations that result in a decrease in the phosphorylation of both the P and L proteins. Mutations of more than one nucleic acid are also possible, and may result in altered phosphorylation of both the P and L proteins at the same time. For example, a virus can have mutations that result in an increase in phosphorylation of the P protein and a decrease in the phosphorylation of the L protein. In a preferred embodiment, the composition includes a virus with a decrease in phosphorylation of the P protein and an increase in the phosphorylation of the L protein- In the most preferred embodiment, the composition includes a VSV with both a S126L substitution in the P protein encoded by SEQ ID NO: 3 and a D223Y substitution in the L protein encoded by SEQ ID NO 5.
In preferred embodiments, the virus is VSV-rp30 encoded by SEQ ID NO: 6 which is a cDNA sense strand
VSV-rp30 was generated by growing VSV for many generations on glioblastoma cells, and the resultant virus displayed enhanced infection of the U87 glioblastoma line on which the virus had been cell-adapted, and on other glioblastoma lines (Wollmann et al, J Virol., 79(10): 6005-6022 (2005)). The resulting change in phenotype was achieved by combining VSVs inherent potential to adapt to different hosts with the application of selective pressure during viral propagation. Sequencing VSV-rp30 identified two amino acid-altering mutations. One mutation is in the P protein encoded by nucleic acid SEQ ID NO: 7, atggataatctcacaaaagttcgtgagtatctcaagtcctattctcgtctggatcaggcggtaggagagatagat gagatcgaagcacaacgagctgaaaagtccaattatgagttgttccaagaggatggagtggaagagcatact aagccctcttattttcaggcagcagatgattctgacacagaatctgaaccagaaattgaagacaatcaaggctt gtatgcaccagatccagaagctgagcaagttgaaggctttatacaggggcctttagatgactatgcagatgag gaagtggatgttgtatttacttcggactggaaacagcctgagcttgaatctgacgagcatggaaagaccttacg gttgacattgccagagggtttaagtggagagcagaaatcccagtggctttcgacgattaaagcagtcgtgcaa agtgccaaatactggaatctggcagagtgcacatttgaagcatcgggagaaggggtcattatgaaggagcgc cagataactccggatgtatataaggtcactccagtgatgaacacacatccgtcccaatcagaagcagtatcag atgtttggtctctctcaaagacatccatgactttccaacccaagaaagcaagtcttcagcctctcaccatatcctt ggatgaattgttctcatctagaggagagttcatctctgtcggaggtgacggacgaatgtctcataaagaggcca tcctgctcggcctgagatacaaaaagttgtacaatcaggcgagagtcaaatattctctgtag, and amino acid sequence mdnltkvreylksysrldqavgeideieaqraeksnyelfqedgveehtkpsyfqaaddsdtesepeied nqglyapdpeaeqvegfiqgplddyadeevdwftsdwkqpelesdehgktlrltlpeglsgeqksqwls tikawqsakywnlaectfeasgegvimkerqitpdvykvtpvmnthpsqseavsdvwslsktsmtfq pkkaslqpltisldelfssrgefisvggdgrmshkeaillglrykklynqarvkysl (SEQ ID NO: 8). Another mutation is in the L protein encoded by nucleic acid SEQ ID NO: 9, and by amino acid SEQ ID NO: 10. 2. Gene switching and rearrangement
VSV is highly immunogenic, and a substantial B and T cell response from the adaptive immune system will ultimately limit VSV infection, which is good from the perspective that it will halt runaway long-lasting viral infections. A virus that shows enhanced selectivity, and a faster rate of infection, will have a greater likelihood of eliminating cancer cells before the virus is eliminated by the immune system. However, the use of VSV against cancer cells does not have to be restricted to a single application. By molecular substitution of the G-protein for enhancing immune responses against foreign genes expressed by VSV, one could switch the original Indiana G protein of the virus with the G protein from VSV New Jersey or Chandipura, allowing a slightly different antigen presentation, and reducing the initial response of the adaptive immune system to second or third oncolytic inoculations with VSV.
It also may be desirable to rearrange the VSVrp30 genome. For example, shifting the L-gene to the sixth position, by rearrangement or insertion of an additional gene upstream, can result in attenuated L-protein synthesis and a slight reduction in replication (Dalton and Rose, Virology, 279(2):414-21 (2001 )), an advantage when considering treatment of the brain. Additional examples of attenuating VSV viruses by gene shifting, gene truncations, gene deletions, and combinations thereof, are described in Wollmann, et al., J. Virol., (2009) Epub; J. Virol. 84(3): (2010))
3. Viruses engineered to express targeting or therapeutic proteins
Viruses may be modified to express one or more targeting or therapeutic proteins, separately or as a part of other expressed proteins. The viral genome of VSV has the capacity to accommodate additional genetic material. At least two additional transcription units, totaling 4.5 kb, can be added to the genome, and methods for doing so are known in the art. The added genes are stably maintained in the genome upon repeated passage (Schnell, et al., EMBO Journal, 17:1289-1296 (1998); Schnell, et al., PNAS, 93: 11359-11365 (1996); Schnell, et al., Journal of Virology, 70:2318-2323 (1996); Kahn, et al., Virology, 254, 81-91 (1999)). Viruses can be engineered to include one or more additional genes that target the virus to cells of interest, see for example U.S. Patent No. 7,429,481. In preferred embodiments, expression of the gene results in expression of a ligand on the surface of the virus containing one or more domains that bind to antigens, ligands or receptors that are specific to tumor cells, or are upregulated in tumor cells compared to normal tissue.
Appropriate targeting ligands will depend on the cell or cancer of interest and will be known to those skilled in the art. For example, virus can be engineered to bind to antigens, Hgands or receptors that are specific to tumor cells or tumor-associated neovasculature, or are upregulated in tumor cells or tumor-associated neovasculature compared to normal tissue. a. Antigens, ligands and receptors to target
1. Tumor-specific and tumor-associated antigens
In one embodiment the viral surface contains a domain that specifically binds to an antigen that is expressed by tumor cells. The antigen expressed by the tumor may be specific to the tumor, or may be expressed at a higher level on the tumor cells as compared to non-tumor cells. Antigenic markers such as serologically defined markers known as tumor associated antigens, which are either uniquely expressed by cancer cells or are present at markedly higher levels (e.g., elevated in a statistically significant manner) in subjects having a malignant condition relative to appropriate controls, are known.
Tumor-associated antigens may include, for example, cellular oncogene-encoded products or aberrantly expressed proto-oncogene-encoded products (e.g., products encoded by the neu, ras, trk, and kit genes), or mutated forms of growth factor receptor or receptor-Hke cell surface molecules (e.g., surface receptor encoded by the c-erb B gene). Other tumor- associated antigens include molecules that may be directly involved in transformation events, or molecules that may not be directly involved in oncogenic transformation events but are expressed by tumor cells (e.g., carcinoernbryonic antigen, CA-125, melonoma associated antigens, etc.)
(see, e.g., U.S. Patent No. 6,699,475; Jager, et al, Int. J. Cancer, 106:817-20 (2003); Kennedy, et al., Int. Rev. Immunol, 22:141-72 (2003); Scanlan, et al. Cancer Immun., 4:1 (2004)).
Genes that encode cellular tumor associated antigens include cellular oncogenes and proto-oncogenes that are aberrantly expressed. In general, cellular oncogenes encode products that are directly relevant to the transformation of the cell, so these antigens are particularly preferred targets for immunotherapy. An example is the tumorigenic neu gene that encodes a cell surface molecule involved in oncogenic transformation. Other examples include the ras, kit, and trk genes. The products of proto-oncogenes (the normal genes which are mutated to form oncogenes) may be aberrantly expressed (e.g., overexpressed), and this aberrant expression can be related to cellular transformation. Thus, the product encoded by proto-oncogenes can be targeted. Some oncogenes encode growth factor receptor molecules or growth factor receptor-like molecules that are expressed on the tumor cell surface. An example is the cell surface receptor encoded by the c-erbB gene. Other tumor-associated antigens may or may not be directly involved in malignant transformation. These antigens, however, are expressed by certain tumor cells and may therefore provide effective targets. Some examples are carcinoembryonic antigen (CEA), CA 125 (associated with ovarian carcinoma), and melanoma specific antigens.
In ovarian and other carcinomas, for example, tumor associated antigens are detectable in samples of readily obtained biological fluids such as serum or mucosal secretions. One such marker is CA125, a carcinoma associated antigen that is also shed into the bloodstream, where it is detectable in serum (e.g., Bast, et al., N. Eng. J. Med, 309:883 (1983); Lloyd, et al., Int. J. Cane, 71:842 (1997). CA125 levels in serum and other biological fluids have been measured along with levels of other markers, for example, carcinoembryonic antigen (CEA), squamous cell carcinoma antigen (SCC), tissue polypeptide specific antigen (TPS), sialyl TN mucin (STN), and placental alkaline phosphatase (PLAP), in efforts to provide diagnostic and/or prognostic profiles of ovarian and other carcinomas (e.g., Sarandakou, et al., Acta Oncol, 36:755 (1997); Sarandakou, et al., Eur. J, Gynaecol. Oncol., 19:73 (1998); Meier, et al, Anticancer Res., 17(4B):2945 (1997); Kudoh, et al., Gynecol. Obstet. Invest., 47:52 (1999)). Elevated serum CA125 may also accompany neuroblastoma (e.g., Hirokawa, et al., Surg. Today, 28:349 (1998), while elevated CEA and SCC, among others, may accompany colorectal cancer (Gebauer, et al., Anticancer Res., 17(4B):2939 (1997)).
The tumor associated antigen mesothelin, defined by reactivity with monoclonal antibody K-I, is present on a majority of squamous cell carcinomas including epithelial ovarian, cervical, and esophageal tumors, and on mesotheliomas (Chang, et al., Cancer Res., 52:181 (1992); Chang, et al, Int. J. Cancer, 50:373 (1992); Chang, et al., Int. J. Cancer, 51 :548 (1992); Chang, et al., Proc. Natl Acad. Sci. USA, 93:136 (1996); Chowdhury, et al., Proc. Natl. Acad. Sci. USA, 95:669 (1998)). Using MAb K-I, mesothelin is detectable only as a cell-associated tumor marker and has not been found in soluble form in serum from ovarian cancer patients, or in medium conditioned by OVCAR-3 cells (Chang, et al., Int. J. Cancer, 50:373 (1992)). Structurally related human mesothelin polypeptides, however, also include tumor-associated antigen polypeptides such as the distinct mesothelin related antigen (MRA) polypeptide, which is detectable as a naturally occurring soluble antigen in biological fluids from patients having malignancies (see WO 00/50900).
A tumor antigen may include a cell surface molecule. Tumor antigens of known structure and having a known or described function, include the following cell surface receptors: HERl (GenBank Accession NO: U48722), HER2 (Yoshino, et al., J Immunol, 152:2393 (1994); Disis, et al., Cane. Res., 54:16 (1994); GenBank Ace. Nos. X03363 and Ml 7730), HER3 (GenBank Ace. Nos. U29339 and M34309), HER4 (Plowman, et al., Nature, 366:473 (1993); GenBank Ace. Nos. L07868 and T64105), epidermal growth factor receptor (EGFR) (GenBank Ace. Nos. U48722, and KO3193), vascular endothelial cell growth factor (GenBank NO: M32977), vascular endothelial cell growth factor receptor (GenBank Ace. Nos. AF022375, 1680143, U48801 and X62568), insulin-like growth factor-I (GenBank Ace. Nos. XOO 173, X56774, X56773, X06043, European Patent No. GB 2241703), insulin-like growth factor-II (GenBank Ace. Nos. X03562, X00910, Ml 7863 and M 17862), transferrin receptor (Trowbridge and Omary, Proc. Nat. Acad. USA, 78:3039 (1981); GenBank Ace. Nos. X01060 and Ml 1507), estrogen receptor (GenBank Ace. Nos. M38651, X03635, X99101, U47678 and M12674), progesterone receptor (GenBank Ace. Nos. X51730, X69068 and M15716), follicle stimulating hormone receptor (FSH- R) (GenBank Ace. Nos. Z34260 and M65085), retinoic acid receptor (GenBank Ace. Nos. L 12060, M60909, X77664, X57280, X07282 and X06538), MUC-I (Barnes, et al., Proc. Nat. Acad. ScL USA, 86:7159 (1989); GenBank Ace. Nos. M65132 and M64928) NY-ESO-I (GenBank Ace. Nos. AJ003149 and U87459), NA 17-A (PCT Publication NO: WO 96/40039), Melan-A/MART-1 (Kawakami, et al, Proc. Nat. Acad ScL USA, 91 :3515 (1994); GenBank Ace. Nos. U06654 and U06452), tyrosinase (Topalian, et al., Proc, Nat. Acad. ScL USA9 91:9461 (1994); GenBank Ace. NO: M26729; Weber, et al., J. CHn. Invest, 102:1258 (1998)), Gp-100 (Kawakami, et al., Proc. Nat. Acad. ScL USA, 91:3515 (1994); GenBank Ace. NO: S73003, Adema, et al., J. Biol. Chem., 269:20126 (1994)), MAGE (van den Bruggen, et al., Science, 254:1643 (1991)); GenBank Ace. Nos. U93163, AF064589, U66083, D32077, D32076, D32075, U10694, U10693, U10691, U10690, UΪ0689, U10688, Ul 0687, U10686, U10685, Ll 8877, U10340, U10339, L18920, U03735 and M77481), BAGE (GenBank Ace. NO: U19180; U.S. Pat. Nos. 5,683,886 and 5,571,711), GAGE (GenBank Ace. Nos. AF055475, AF055474, AF055473, U19147, U19146, U19145, U19144, U19143 and U 19142), any of the CTA class of receptors including in particular HOM- MEL-40 antigen encoded by the SSX2 gene (GenBank Ace. Nos. X86175, U90842, U90841 and X86174), carcinoembryonic antigen (CEA, Gold and Freedman, J. Exp. Med, 121 :439 (1985); GenBank Ace. Nos. M59710, M59255 and M29540), and PyLT (GenBank Ace. Nos. J02289 and J02038); p97 (melanotransferrin) (Brown, et al., J. Immunol, 127:539-46 (1981); Rose, et al., Proc. Natl. Acad. ScL USA, 83:1261-61 (1986)).
Additional tumor associated antigens include prostate surface antigen (PSA) (U.S. Pat. Nos. 6,677,157; 6,673,545); β-human chorionic gonadotropin β-HCG) (McManus, et al., Cancer Res. , 36:3476-81 (1976); Yoshimura, et al., Cancer, 73:2745-52 (1994); Yamaguchi, et al., Br. J. Cancer, 60:382-84 (1989): Aϊfthan, et al., Cancer Res., 52:4628-33 (1992)); glycosyltransferase β- 1 ,4-N-acetylgalactosaminyltransferases (GaINAc) (Hoon, et al., Int. J. Cancer, 43:857-62 (1989); Ando, et al., Int. J. Cancer, 40:12-17 (1987); Tsuchϊda, et al., J. Natl. Cancer, 78:45-54 (1987);
Tsuchida, et al., J. Natl Cancer, 78:55-60 (1987)); NUCl 8 (Lehmarm, et al., Proc. Natl Acad. ScL USA, 86:9891-95 (1989); Lehmann, et al., Cancer
Res., 47:841-45 (1987)); melanoma antigen gp75 (Vijayasardahi, et al., J. Exp. Med., 171:1375-80 (1990); GenBank Accession NO: X51455); human cytokeratin 8; high molecular weight melanoma antigen (Natali, et al., Cancer, 59:55-63 (1987); keratin 19 (Datta, et al., J Clin. Oncol, 12:475-82 (1994)). Tumor antigens of interest include antigens regarded in the art as
"cancer/testis" (CT) antigens that are immunogenic in subjects having a malignant condition (Scanlan, et al., Cancer Immun., 4:1 (2004)). CT antigens include at least 19 different families of antigens that contain one or more members and that are capable of inducing an immune response, including, but not limited to, MAGEA (CTl); BAGE (CT2); MAGEB (CT3); GAGE (CT4); SSX (CT5); NY-ESO-I (CT6); MAGEC (CT7); SYCPl (C8); SPANXBl (CTl 1.2); NA88 (CT18); CTAGE (CT21); SPA17 (CT22); OY-TES-I (CT23); CAGE (CT26); HOM-TES-85 (CT28); HCA661 (CT30); NY-SAR-35 (CT38); FATE (CT43); and TPTE (CT44). Additional tumor antigens that can be targeted, including a tumor- associated or tumor-specific antigen, include, but are not limited to, alpha- actinin-4, Bcr-Abl fusion protein, Casp-8, beta-catenin, cdc27, cdk4, cdkn2a, coa-1, dek-can fusion protein, EF2, ET V6- AMLl fusion protein, LDLR- fucosyltransferaseAS fusion protein, HLA-A2, HLA-AI l, hsp70-2, KIAAO205, Mart2, Mum-1 , 2, and 3, neo-PAP, myosin class I, OS-9, pml- RARα fusion protein, PTPRK, K-ras, N-ras, Triosephosphate isomeras, Bage-1, Gage 3,4,5,6,7, GnTV, Herv-K-mel, Lage-1, Mage- Al,2,3 ,4,6,10,12, Mage-C2, NA-88, NY-Eso-l/Lage-2, SP17, SSX-2, and TRP2-Int2, MelanA (MART-I), gplOO (Pmel 17), tyrosinase, TRP-I, TRP-2, MAGE-I , MAGE-3, BAGE, GAGE-I, GAGE-2, pi 5(58), CEA, RAGE, NY-ESO (LAGE), SCP-I, Hom/Mel~40, PRAME, p53, H-Ras, HER-2/neu, BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, EBNA5 human papillomavirus (HPV) antigens E6 and E7, TSP- 180, MAGE-4, MAGE-5, MAGE-6, pl85erbB2, pl80erbB-3, c-met, nm- 23Hl, PSA, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, β- Catenin, CDK4, Mum-1, plό, TAGE, PSMA, PSCA, CT7, telomerase, 43- 9F, 5T4, 791Tgp72, α-fetoprotein, 13HCG, BCA225, BTAA, CA 125, CA
15-3 (CA 27.29\BCAA), CA 195, CA 242, CA-50, CAM43, CD68\KP1, CO-029, FGF-5, G250, Ga733 (EpCAM), HTgp-175, M344, MA-50, MG7- Ag, MOV 18, NB\70K, NY-CO-I, RCASl, SDCCAGl 6, TA-90 (Mac-2 binding prσtein\cycloρhilin C-associated protein), TAAL6, TAG72, TLP, and TPS. Other tumor-associated and tumor- specific antigens are known to those of skill in the art and are suitable for targeting by the disclosed fusion proteins.
2. Antigens associated with tumor neovasculature
Oncolytic viral therapeutics can be more effective in treating tumors by targeting to blood vessels of the tumor. Tumor-associated neovasculature provides a readily accessible route through which protein therapeutics can access the tumor. In one embodiment the viral proteins contain a domain that specifically binds to an antigen that is expressed by neovasculature associated with a tumor. The antigen may be specific to tumor neovasculature or may be expressed at a higher level in tumor neovasculature when compared to normal vasculature. Exemplary antigens that are over-expressed by tumor- associated neovasculature as compared to normal vasculature include, but are not limited to, VEGF/KDR, Tie2, vascular cell adhesion molecule (VCAM), endoglin and αsβ3 integrin/vitronectin. Other antigens that are over- expressed by tumor-associated neovasculature as compared to normal vasculature are known to those of skill in the art and are suitable for targeting by the disclosed fusion proteins.
3. Chemokines/chemokine receptors In another embodiment, the fusion proteins contain a domain that specifically binds to a chemokine or a chemokine receptor. Chemokines are soluble, small molecular weight (8-14 kDa) proteins that bind to their cognate G-protein coupled receptors (GPCRs) to elicit a cellular response, usually directional migration or chemotaxis. Tumor cells secrete and respond to chemokines, which facilitate growth that is achieved by increased endothelial cell recruitment and angiogenesis, subversion of immunological surveillance and maneuvering of the tumoral leukocyte profile to skew it such that the chemokine release enables the tumor growth and metastasis to distant sites. Thus, chemokines are vital for tumor progression.
Based on the positioning of the conserved two N-terminal cysteine residues of the chemokines, they are classified into four groups: CXC, CC, CX3C and C chemokines. The CXC chemokines can be further classified into ELR+ and ELR- chemokines based on the presence or absence of the motif 4glu-leu-arg (ELR motif)' preceding the CXC sequence. The CXC chemokines bind to and activate their cognate chemokine receptors on neutrophils, lymphocytes, endothelial and epithelial cells. The CC chemokines act on several subsets of dendritic cells, lymphocytes, macrophages, eosinophils, natural killer cells but do not stimulate neutrophils as they lack CC chemokine receptors except murine neutrophils. There are approximately 50 chemokines and only 20 chemokine receptors, thus there is considerable redundancy in this system of Hgand/receptor interaction.
Chemokines elaborated from the tumor and the stromal cells bind to the chemokine receptors present on the tumor and the stromal cells. The autocrine loop of the tumor cells and the paracrine stimulatory loop between the tumor and the stromal cells facilitate the progression of the tumor. Notably, CXCR2, CXCR4, CCR2 and CCR7 play major roles in tumorigenesis and metastasis. CXCR2 plays a vital role in angiogenesis and CCR2 plays a role in the recruitment of macrophages into the tumor microenvironment. CCR7 is involved in metastasis of the tumor cells into the sentinel lymph nodes as the lymph nodes have the ligand for CCR7, CCL21. CXCR4 is mainly involved in the metastatic spread of a wide variety of tumors. b. Molecular classes of targeting domains
1. Ligands and receptors
In one embodiment, tumor or tumor-associated neovasculature targeting domains are ligands that bind to cell surface antigens or receptors that are specifically expressed on tumor cells or tumor-associated neovasculature or are overexpressed on tumor cells or tumor-associated neovasculature as compared to normal tissue. Tumors also secrete a large number of Hgands into the tumor microenvironment that affect tumor growth and development. Receptors that bind to ligands secreted by tumors, including, but not limited to, growth factors, cytokines and chemokines, including the chemokines discussed above, are suitable for use in the disclosed fusion proteins. Ligands secreted by tumors can be targeted using soluble fragments of receptors that bind to the secreted ligands. Soluble receptor fragments are fragments of polypeptides that may be shed, secreted or otherwise extracted from the producing cells and include the entire extracellular domain, or fragments thereof. 2. Single polypeptide antibodies
In another embodiment, tumor or tumor-associated neovasculature targeting domains are single polypeptide antibodies that bind to cell surface antigens or receptors that are specifically expressed on tumor cells or tumor- associated neovasculature or are overexpressed on tumor cells or tumor- associated neovasculature as compared to normal tissue. Single domain antibodies are described above with respect to coinhibitory receptor antagonist domains.
3. Fc domains In another embodiment, tumor or tumor-associated neovasculature targeting domains are Fc domains of immunoglobulin heavy chains that bind to Fc receptors expressed on tumor cells or on tumor-associated neovasculature. As defined herein, the Fc region includes polypeptides containing the constant region of an antibody excluding the first constant region immunoglobulin domain. Thus Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM. In a preferred embodiment, the Fc domain is derived from a human or murine immunoglobulin. In a more preferred embodiment, the Fc domain is derived from human IgGl or murine IgG2a including the CH2 and CH3 regions. 4. Therapeutic Proteins
Viruses can also be engineered to include one or more additional genes that encode a therapeutic protein. Suitable therapeutic proteins, such as cytokines or chemokines, are known in the art. Preferred cytokines include, but are not limited to, granulocyte macrophage colony stimulating factor (GM-CSF), tumor necrosis factor alpha (TNFα), tumor necrosis factor beta (TNFβ), macrophage colony stimulating factor (M-CSF), interleukin-l (IL-I), interleukin-2 (IL-2), interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-6 (IL-6), interleukin- 10 (IL- 10), interleukin- 12 (IL- 12), interleukin-l 5 (IL-15), interleukin-21 (IL-21), interferon alpha (IFNα), interferon beta (IFNβ), interferon gamma (IFNγ), and IGIF, and variants and fragments thereof.
Suitable chemokines include, but are not limited to, an alpha- chemokine or a beta-chemokine, including, but not limited to, a CSa, interleukin- 8 (IL- 8), monocyte chemotactic protein 1 alpha (MIP lα), monocyte chemotactic protein 1 beta (MIPl β), monocyte chemoattractant protein 1 (MCP-I), monocyte chemoattractant protein 3 (MCP-3), platelet activating factor (PAFR), N-formyl-methionyl-leucyl-[3H]phenylalanine (FMLPR), leukotriene B4, gastrin releasing peptide (GRP), RANTES, eotaxin, lymphotactin, IPlO, 1-309, ENA78, GCP-2, NAP-2 and MGSA/gro, and variants and fragments thereof.
B. Pharmaceutical Carriers
Pharmaceutical compositions containing virus may be for systemic or local administration, such as intratumoral. Dosage forms for administration by parenteral (intramuscular (IM), intraperitoneal (IP), intravenous (IV) or subcutaneous injection (SC)), or transmucosal (nasal, vaginal, pulmonary, or rectal) routes of administration can be formulated.
In some in vivo approaches, the compositions disclosed herein are administered to a subject in a therapeutically effective amount. As used herein the term "effective amount" or "therapeutically effective amount" means a dosage sufficient to treat, inhibit, or alleviate one or more symptoms of the disorder being treated or to otherwise provide a desired pharmacologic and/or physiologic effect. The precise dosage will vary according to a variety of factors such as subject-dependent variables (e.g., age, immune system health, etc.), the disease, and the treatment being effected. Therapeutically effective amounts of the viruses disclosed herein cause a reduction in tumor progression of reduction of tumor burden.
For the compositions disclosed herein and nucleic acids encoding the same, appropriate dosage levels for treatment of various conditions in various patients, can be determined by a person skilled in the art, considering the therapeutic context, age, and general health of the recipient. The selected dosage depends upon the desired therapeutic effect, on the route of administration, and on the duration of the treatment desired. Active virus can also be measured in terms of plaque-forming units (PFU). A plaque- forming unit can be defined as areas of cell lysis (CPE) in monolayer cell culture, under overlay conditions, initiated by infection with a single virus particle. Generally dosage levels of virus between 102 and 1012PFU are administered to humans. Virus is typically administered in a liquid suspension, in a volume ranging between 10 μl and 100 ml depending on the route of administration. Generally, dosage and volume may be lower for intratumoral injection, than systemic administration or infusion. The dose may be administered once or multiple times. Typically the dose will be 100 μl administered intratumorly in multiple doses, while systemic or regional administration via subcutaneous, intramuscular, intra-organ, or intravenous administration will be from 10 to 100 ml.
The term "pharmaceutically acceptable" means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredients. The term "pharmaceutically-acceptable carrier" means one or more compatible solid or liquid fillers, diluents or encapsulating substances which are suitable for administration to a human or other vertebrate animal. The term "carrier" refers to an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application.
Pharmaceutical compositions may be formulated in a conventional manner using one or more physiologically acceptable carriers including excipients and auxiliaries which facilitate processing of the active compounds into preparations which can be used pharmaceutically. The compositions may be administered in combination with one or more physiologically or pharmaceutically acceptable carriers, thickening agents, co-solvents, adhesives, antioxidants, buffers, viscosity and absorption enhancing agents and agents capable of adjusting osmolality of the formulation. Proper formulation is dependent upon the route of administration chosen. If desired, the compositions may also contain minor amount of nontoxic auxiliary substances such as wetting or emulsifying agents, dyes, pH buffering agents, or preservatives. The formulations should not include membrane disrupting agents which could kill or inactivate the virus. 1. Formulations for local or parenteral administration
In a preferred embodiment, compositions including oncolytic virus disclosed herein, are administered in an aqueous solution, by parenteral injection. Injection includes, but it not limited to, local, intratumoral, intravenous, intraperitoneal, intramuscular, or subcutaneous. The formulation may also be in the form of a suspension or emulsion. In general, pharmaceutical compositions are provided including effective amounts of virus, and optionally include pharmaceutically acceptable diluents, preservatives, solubilizers, emulsiiϊers, adjuvants and/or carriers. Such compositions include diluents sterile water, buffered saline of various buffer content (e.g., Tris-HCl, acetate, phosphate), pH and ionic strength; and optionally, additives such as anti-oxϊdants (e.g., ascorbic acid, sodium metabisulfϊte), and preservatives and bulking substances (e.g., lactose, mannitol). Examples of non-aqueous solvents or vehicles are propylene glycol, polyethylene glycol, vegetable oils, such as olive oil and corn oil, gelatin, and injectable organic esters such as ethyl oleate. A preferred solution is phosphate buffered saline or sterile saline.
2. Formulations for mucosal administration In some embodiments, the compositions are formulated for mucosal administration, such as through nasal, pulmonary, or buccal delivery.
Mucosal formulations may include one or more agents for enhancing delivery through the nasal mucosa. Agents for enhancing mucosal delivery are known in the art, see for example U.S. Patent Application No. 20090252672 to Eddington, and U.S. Patent Application No. 20090047234 to Touitou. Acceptable agents include, but are not limited to, chelators of calcium (EDTA), inhibitors of nasal enzymes (boro-leucin, aprotinin), inhibitors of muco-ciliar clearance (preservatives), solubilizers of nasal membrane (cyclodextrin, fatty acids, surfactants) and formation of micelles (surfactants such as bile acids, Laureth 9 and taurodehydrofusidate (STDHF)). Compositions may include one or more absorption enhancers, including surfactants, fatty acids, and chitosan derivatives, which can enhance delivery by modulation of the tight junctions (TJ) (B. J. Aungst, et al., J. Pharm. ScL 89(4):429-442 (2000)). In general, the optimal absorption enhancer should possess the following qualities: its effect should be reversible, it should provide a rapid permeation enhancing effect on the cellular membrane of the mucosa, and it should be non-cytotoxic at the effective concentration level and without deleterious arid/or irreversible effects on the cellular membrane, virus membrane, or cytoskeleton of the TJ. C. Kits
Dosage units include virus in a pharmaceutically acceptable carrier for shipping and storage and/or administration. Active virus should be shipped and stored using a method consistent with viability such as in cooler containing dry ice so that cells are maintained below 4°C, and preferably below -2O0C. VSV virus should not be lyophilized. Components of the kit may be packaged individually and can be sterile. In one embodiment, a pharmaceutically acceptable carrier containing an effective amount of virus is shipped and stored in a sterile vial. The sterile vial may contain enough virus for one or more doses. Virus may be shipped and stored in a volume suitable for administration, or may be provided in a concentrated titer that is diluted prior to administration. In another embodiment, a pharmaceutically acceptable carrier containing an effective amount of virus can be shipped and stored in a syringe. Typical concentrations of viral particles in the sterile saline, phosphate buffered saline or other suitable media for the virus is in the range of 108 to 109 with a maximu of 10i2. Dosage units should not contain membrane disruptive agents nor should the viral solution be frozen and dried (i.e., lyophilized), which could kill the virus.
Kits containing syringes of various capacities or vessels with deformable sides (e.g., plastic vessels or plastic-sided vessels) that can be squeezed to force a liquid composition out of an orifice are provided. The size and design of the syringe will depend on the route of administration. For example, in one embodiment, a syringe for administering virus intratumorally, is capable of accurately delivering a smaller volume (such as 1 to 100 μl). Typically, a larger syringe, pump or catheter will be used to administer virus systemically.
The kits optionally include one or more of the following: bioactive agents, media, excipients and one or more of: a syringe, a bandage, a disinfectant, a local anesthetic, an analgesic agent, surgical thread, scissors, a sterile fluid, and a sterile vessel. Kits for intranasal administration may optionally contain a delivery device for facilitating intranasal delivery, such as a nasal sprayer. The kits are generally provided in a container, e.g., a plastic, cardboard, or metal container suitable for commercial sale. Any of the kits can include instructions for use. III. Methods of use A. Subjects to be treated
In general, the compositions are useful for targeting and destroying a cell or cells of interest. In a preferred embodiment, the cells of interest are cancer cells. For example, compositions are useful as therapeutic compositions, which can be used to treat benign or malignant tumors. In a mature animal, a balance usually is maintained between cell renewal and cell death in most organs and tissues. The various types of mature cells in the body have a given life span; as these cells die, new cells are generated by the proliferation and differentiation of various types of stem cells. Under normal circumstances, the production of new cells is so regulated that the numbers of any particular type of cell remain constant. Occasionally, though, cells arise that are no longer responsive to normal growth-control mechanisms. These cells give rise to clones of cells that can expand to a considerable size, producing a tumor or neoplasm. A tumor that is not capable of indefinite growth and does not invade the healthy surrounding tissue extensively is benign. A tumor that continues to grow and becomes progressively invasive is malignant. The term cancer refers specifically to a malignant tumor. In addition to uncontrolled growth, malignant tumors exhibit metastasis. In this process, small clusters of cancerous cells dislodge from a tumor, invade the blood or lymphatic vessels, and are carried to other tissues, where they continue to proliferate. In this way a primary tumor at one site can give rise to a secondary tumor at another site. The compositions and method described herein are useful for treating subjects having benign or malignant tumors by delaying or inhibiting the growth of a tumor in a subject, reducing the growth or size of the tumor, inhibiting or reducing metastasis of the tumor, and/or inhibiting or reducing symptoms associated with tumor development or growth. The examples below demonstrate that the VSV virus disclosed herein are oncolytic to tumors in vivo.
Malignant tumors which may be treated are classified herein according to the embryonic origin of the tissue from which the tumor is derived. Carcinomas are tumors arising from endodermal or ectodermal tissues such as skin or the epithelial lining of internal organs and glands. The disclosed compositions are particularly effective in treating carcinomas. Sarcomas, which arise less frequently, are derived from mesodermal connective tissues such as bone, fat, and cartilage. The leukemias and lymphomas are malignant tumors of hematopoietic cells of the bone marrow. Leukemias proliferate as single cells, whereas lymphomas tend to grow as tumor masses. Malignant tumors may show up at numerous organs or tissues of the body to establish a cancer.
The types of cancer that can be treated with the provided compositions and methods include, but are not limited to, cancers such as vascular cancer such as multiple myeloma, adenocarcinomas and sarcomas, of bone, bladder, brain, breast, cervical, colo-rectal, esophageal, kidney, liver, lung, nasopharangeal, pancreatic, prostate, skin, stomach, and uterine. In some embodiments, the disclosed compositions are used to treat multiple cancer types concurrently. The compositions can also be used to treat metastases or tumors at multiple locations. As shown in the examples below, the oncolytic virus VSV-rp30 is particularly effective in treating gliomas (including astrocytomas) in the brain, as well as bone, breast, prostate, colon, and lung cancers. It can also infect and kill pancreatic and stem cells from brain cancer. In some embodiments, the composition is used to treat lung or breast cancer carcinomas, which are the source of many brain cancers. In a preferred embodiment, a composition containing an oncolytic VSV such as VSV-rp30 is used for treating glioblastoma. VSV has a good oncolytic profile in part by taking advantage of defects in the innate cellular anti-viral defense system, which is a common feature in malignancies, including colon, breast, prostate, liver, and leukemia. Reduction in interferon-related antiviral defenses enhance infection of cancer cells by VSVrp30. Activation of the interferon pathway protects normal human brain cells from VSV infection while maintaining the vulnerability of human glioblastoma cells to viral destruction (Wollmann, et al. J. Virol., 81(3): 1479-1491 (2007)). In some embodiments, the disclosed compositions and methods are used to treat a population of cells with defects in the interferon system. In preferred embodiments, the cells with a defective interferon system or defective antiviral defense system are tumor cells that are susceptible to VSV infection and destruction in the presence of exogenous interferons such as IFN-α, or IFN-α/β pathway inducer polyriboinosinic polyribocytidylic acid [poly(I:C)]. B. Methods of administration Any acceptable method known to one of ordinary skill in the art may be used to administer a formulation to the subject. Preferably, administration of the formulations may be accomplished by any acceptable method which allows an effective amount of the oncolytic virus to reach their target. As generally used herein, an "effective amount" is that amount which is able to induce a desired result in a treated subject. The desired results will depend on the disease or condition to be treated. For example, in treating a subject with a tumor, in one embodiment, an effective amount of the composition reduces or stops tumor progression or at least reduces one or more symptoms of the tumor. Symptoms of cancer may be physical, such as tumor burden, or biological such as proliferation of cancer cells. The actual effective amounts of virus can vary according to factors including the specific virus administered, the particular composition formulated, the mode of administration, and the age, weight, condition of the subject being treated, as well as the route of administration and the disease or disorder.
The particular mode of administration selected will depend upon factors such as the particular formulation, the severity of the state of the subject being treated, and the dosage required to induce an effective response. The administration may be localized (i.e., to a particular region, physiological system, tissue, organ, or cell type) or systemic. The compositions can be administered by a number of routes including, but not limited to, injection: intravenous, intraarterial, intraperitoneal, intramuscular, or subcutaneous, or to a mucosal surface (oral, sublingual or buccal, nasal, rectal, vaginal, pulmonary) and special means such as convection enhanced delivery. In a preferred embodiment, the oncolytic virus is administered in an aqueous solution, by parenteral injection. In one embodiment, the composition is injected locally at the site of treatment, such as a tumor. In some embodiments, the composition is delivered systemically, by injection into the circulatory system (i.e. intravenous) or an appropriate lymphoid tissue, such as the spleen, lymph nodes or mucosal-associated lymphoid tissue. The injections can be given at one, or multiple locations. In a preferred embodiment, one treatment is sufficient. In some embodiments, multiple treatments are required. The composition can also be administered mucosally. One example of mucosal administration is intranasal delivery. Intranasal administration can result in systemic or local delivery of oncolytic virus. For example, following intranasal delivery, virus gain access to the CNS through the olfactory nerve, which projects to the glomeruli in the olfactory bulb of the brain (van den Pol et al., J Virol, 76 1309-27 (2002)). C Combination therapies
Administration of the disclosed compositions containing oncolytic viruses may be coupled with surgical, radiologic, other therapeutic approaches to treatment of cancer.
1. Surgery
The disclosed compositions and methods can be used as an adjunct to surgery. Surgery is a common treatment for many types of benign and malignant tumors. As it is often not possible to remove all the tumor cells from during surgery, the disclosed compositions containing oncolytic virus are particularly useful subsequent to resection of the primary tumor mass, and would be able to infect and destroy even dispersed tumor cells.
An additional situation where an oncolytic virus may be helpful is in regions where the tumor is either wrapped around critical vasculature, or in an area that is difficult to treat surgically. Widely disseminated metastatic carcinomas are also a potential target given the high efficiency of VSV against many systemic malignancies such as breast, prostate, liver or colon carcinomas or lymphomas (Stojdl et al,2003; Ahmet et aL.,2000; Bbert et al,2005; Shinozaki ei al,2005; Lichty et al., 2004b). In a preferred embodiment, the disclosed compositions and methods are used as an adjunct or alternative to neurosurgery. The compositions are particularly well suited to treat areas of the brain that is difficult to treat surgically, for instance high grade tumors of the brain stem, motor cortex, basal ganglia, or internal capsule. High grade gliomas in these locations are generally considered inoperable.
2. Therapeutic agents
The viral compositions can be administered to a subject in need thereof alone or in combination with one or more additional therapeutic agents selected based on the condition, disorder or disease to be treated. A description of the various classes of suitable pharmacological agents and drugs may be found in Goodman and Gilman, The Pharmacological Basis of Therapeutics, (11th Ed., McGraw-Hill Publishing Co.) (2005). Additional therapeutic agents include conventional cancer therapeutics such as chemotherapeutic agents, cytokines, chemokines, and radiation therapy. The majority of chemotherapeutic drags can be divided into: alkylating agents, antimetabolites, anthracyclines, plant alkaloids, topoisomerase inhibitors, and other antitumour agents. All of these drugs affect cell division or DNA synthesis and function in some way. Additional therapeutics include monoclonal antibodies and the tyrosine kinase inhibitors e.g. imatinib mesylate (GLEEVEC® or GLIVEC®), which directly targets a molecular abnormality in certain types of cancer (chronic myelogenous leukemia, gastrointestinal stromal tumors).
Representative chemotherapeutic agents include, but are not limited to, cisplatin, carboplatin, oxaliplatin, mechlorethamine, cyclophosphamide, chlorambucil, vincristine, vinblastine, vinorelbine, vindesine, taxol and derivatives thereof, irinotecan, topotecan, amsacrine, etoposide, etoposide phosphate, teniposide, epipodophyllotoxins, trastuzumab (HERCEPTIN®), cetuximab, and rituxiniab (RITUXAN® or MABTHERA®), bevacizumab (AVASTIN®), and combinations thereof.
Preferred chemotherapeutics will affect tumors or cancer cells, without diminishing the activity of the virus. For example, in a preferred embodiment, the additional therapeutic agent inhibits proliferation of cancer cells without affecting targeting, infectivity, or replication of the virus. a. Immunosuppressants
It may be desirable to administer viral compositions in combination with an immunosuppressant. Oncolytic viruses such as VSV are highly immunogenic, and a substantial B and T cell response from the adaptive immune system would ultimately limit viral infection. An immunosuppressant attenuates the host immune response and prolongs viral infection. Immunosuppressants are known in the art and include glucocorticoids, cytostatics (such as alkylating agents, antimetabolites, and cytotoxic antibodies), antibodies (such as those directed against T-cell recepotors or 11-2 receptors), drugs acting on immunophilins (such as cyclosporine, tacrolimus, and sirolimus) and other drugs (such as interferons, opioids, TNF binding proteins, mycophenolate, and other small molecules such as fingolimod). The dosage ranges for immunosuppressant agents are known in the art. The specific dosage will depend upon the desired therapeutic effect, the route of administration, and on the duration of the treatment desired. For example, when used as an immunosuppressant, a cytostatic maybe administered at a lower dosage than when used in chemotherapy. Suitable immunosuppressants include, but are not limited to, FK506, prednisone, methylprednisolone, cyclophosphamide, thalidomide, azathioprine, and dacHzumab, physalin B, physalin F, physalin G, seco- steroids purified from Physalis angulata L, lS-deoxyspergualin, MMF, rapamycin and its derivatives, CCI-779, FR 900520, FR 900523, NK86- 1086, depsidomycin, kanglemycin-C, spergualin, ρrodigiosin25-c, cammunomicin, demethomycin, tetranactin, tranilast, stevastelins, myriocin, gliotoxin, FR 651814, SDZ214-104, bredinin, WS9482, mycophenolic acid, mimoribine, misoprostol, OKT3, anti-IL-2 receptor antibodies, azasporine, leflunomide, mizoribine, azaspirane, paclitaxel, altretamine, busulfan, chlorambucil, ifosfamide, mechlorethamϊne, melphalan, thiotepa, cladribine, fluorouracil, floxuridine, gemcitabine, thioguaniήe, pentostatin, methotrexate, 6-mercaptopurine, cytarabine, carmustine, lomustine, streptozotocin, carboplatin, cisplatin, oxaliplatin, iproplatin, tetraplatin, lobaplatin, JM216, JM335, fludarabine, aminoglutethimide, fiutamide, goserelin, leuprolide, megestrol acetate, cyproterone acetate, tamoxifen, anastrozole, bicalutamide, dexamethasone, diethylstilbestrol, bleomycin, dactinomycin, daunorubicin, doxirubicin, idarubicin, mitoxantrone, losoxantrone, mitomycin-c, pHcamycin, paclitaxel, docetaxel, topotecan, irinotecan, 9-amino camptothecan, 9-rύtro camptothecan. GS-2115 etoposide, teniposide, vinblastine, vincristine, vinorelbine, procarbazine, asparaginase, pegaspargase, octreotide, estramustine, and hydroxyurea, and combinations thereof. Preferred immunosuppressants will preferentially reduce or inhibit the subject's immune response, without reducing or inhibiting the activity of the virus. For example, in a preferred embodiment, the additional therapeutic agent inhibits activation and/or proliferation without affecting targeting, infectivity, or replication of the virus. b. Anticancer agents
The compositions can be administered with an antibody or antigen binding fragment thereof specific for growth factor receptors or tumor specific antigens. Representative growth factors receptors include, but are not limited to, epidermal growth factor receptor (EGFR; HERl); c-erbB2 (HER2); c-erbB3 (HER3); c-erbB4 (HER4); insulin receptor; insulin-like growth factor receptor 1 (IGF-IR); insulin-like growth factor receptor 2/Mannose~~6-ρhosphate receptor (IGF-II R/M-6-P receptor); insulin receptor related kinase (IRRK); platelet-derived growth factor receptor (PDGFR); colony-stimulating factor-1 receptor (CSF-IR) (c-Fms); steel receptor (c- Kit); Flk2/Flt3; fibroblast growth factor receptor 1 (Flg/Cekl); fibroblast growth factor receptor 2 (Bek/Cek3/K-Sam); Fibroblast growth factor receptor 3; Fibroblast growth factor eceptor 4; nerve growth factor receptor (NGFR) (TrkA); BDNF receptor (TrkB); NT-3-receptor (TrkC); vascular endothelial growth factor receptor 1 (Fltl); vascular endothelial growth factor receptor 2/Flkl/KDR; hepatocyte growth factor receptor (HGF- R/Met); Eph; Eck; Eek; Cek4/Mek4/HEK; Cek5; Elk/Cek6; Cek7; Sek/Cek8; Cek9; CeklO; HEKl 1; 9 Rorl; Ror2; Ret; AxI; RYK; DDR; and Tie. c. Therapeutic proteins
It may be desirable to administer the disclosed compositions in combination with therapeutic proteins. VSV is an effective oncolytic virus, in-part, by taking advantage of defects in the interferon system. Administration of therapeutic proteins such as IFN-α, or IFN-α/β pathway inducer polyriboinosinic polyribocytidylic acid [poly(I:C)] are effective in protecting normal cells from the oncolytic activity, while leaving the tumor cells susceptible to infection and death (Wollmann, et al. J. Virol., 81(3): 1479-1491 (2007), (WoUmann, et al., J Virol, (2009)). Therefore, in some embodiments, the disclosed compositions are administered in combination with a therapeutic protein to reduce infectivity and death of normal cells. Suitable therapeutic proteins are described above. d. Peripheral immunization
It may be desirable to administer the disclosed compositions after peripheral immunization with the virus. Evidence suggests that peripheral activation of the systemic immune system can protect the brain from VSV damage (Ozduman, et al.s J Virol, 83(22): 11540-11549 (2009)). Immunization is carried out first, preferably by intranasal or intramuscular delivery, or combination thereof. Immunization is followed by administration of therapeutic compositions by intracranial injection. IV. Methods of Manufacture
A. Engineering recombinant VSV viruses The VSV genome is a single negative-sense, non-segmented stand of RNA that contains five genes (N, L, P, M, and G) and has a total size of 11.161 kb. Methods of engineering recombinant viruses by reconstituting VSV from DNA encoding a positive-sense stand of RNA are known in the art (Lawson, et al., PNAS, 92:4477-4481 (1995), Dalton and Rose, Virology, 279:414-421 (2001)). For example, recombinant DNA can be transcribed by T7 RNA polymerase to generate a full-length positive-strand RNA complimentary to the viral genome. Expression of this RNA in cells also expressing the VSV nucleocapsid protein and the two VSV polymerase subunits results in production of VSV virus (Lawson, et al., PNAS, 92:4477- 4481 (1995)). In this way, VSV viruses can be engineered to express variant proteins, additional proteins, foreign antigens, targeting proteins, or therapeutic proteins using known cloning methods. B. Creating mutant VSV virus
RNA viruses are prone to spontaneous genetic variation. The mutation rate of VSV is about 10"4 per nucleotide replicated, which is approximately one nucleotide change per genome (Drake, et al, Proc. Natl. Acad ScL USA, 96:13910-13913). Therefore, mutant VSV viruses exhibiting desired properties can be developed by applying selective pressure. Methods for adaption of VSV viruses through repeated passaging is described in the art. See, for example, Wollmann, et al., J Virol., 79(10): 6005-6022 (2005). Selective pressure can be applied by repeated passaging and enhanced selection to create mutant virus with desirable traits such as increased infectivity and oncolytic potential for a cell type of interest. The cell type of interest could be general, such as cancer cells, or specific such as glioblastoma cells. Mutant virus can also be selected based on reduced toxicity to normal cells. Methods of enhanced selection include, but are not limited to, short time for viral attachment to cells, collection of early viral progeny, and preabsorption of viral particles with high affinity of undesirable cells (such as normal cells). Mutations can be identified by sequencing the viral genome, for instance as described in Example 4 below. DNA encoding the VSV genome can also be used as a substrate for random or site directed mutagenesis to develop VSV mutant viruses. Mutagenesis can be accomplished by a variety of standard, mutagenic procedures. Changes in single genes may be the consequence of point mutations that involve the removal, addition or substitution of a single nucleotide base within a DNA sequence, or they may be the consequence of changes involving the insertion or deletion of large numbers of nucleotides. Mutations can arise spontaneously as a result of events such as errors in the fidelity of nucleic acid replication or the movement of transposable genetic elements (transposons) within the genome. They also are induced following exposure to chemical or physical mutagens. Such mutation- inducing agents include ionizing radiations, ultraviolet light and a diverse array of chemicals such as alkylating agents and polycyclic aromatic hydrocarbons all of which are capable of interacting either directly or indirectly (generally following some metabolic biotransformations) with nucleic acids. The nucleic acid lesions induced by such environmental agents may lead to modifications of base sequence when the affected DNA is replicated or repaired and thus to a mutation. Mutation also can be site- directed through the use of particular targeting methods. Various types of mutagenesis such as random mutagenesis, e.g., insertional mutagenesis, chemical mutagenesis, radiation mutagenesis, in vitro scanning mutagenesis, random mutagenesis by fragmentation and reassembly, and site specific mutagenesis, e.g., directed evolution, are described in U.S. Patent Application No. 2007/0026012. Mutant viruses can be prepared by site specific mutagenesis of nucleotides in the DNA encoding the protein, thereby producing DNA encoding the mutant. Techniques for making substitution mutations at predetermined sites in DNA having a known sequence are well known, for example M 13 primer mutagenesis and PCR mutagenesis. Amino acid substitutions are typically of single residues, but can occur at a number of different locations at once. Insertions usually will be on the order of about from 1 to 10 amino acid residues; and deletions will range about from 1 to 30 residues. Substitutions, deletions, insertions or any combination thereof can be combined to arrive at a final construct The mutations must not place the sequence out of reading frame and preferably will not create complementary regions that could produce secondary mRNA structure. Substitutional variants are those in which at least one residue has been removed and a different residue inserted in its place. Examples
Example 1: VSV-rp30 kills human cancer cells that can cause brain tumors
Materials and Methods Cell culture U87MG human high-grade glioma cells and 4Tl mouse mammary carcinoma cells were obtained from American Type Culture Collection (Rockville, MD). A549 and CaIu-I human lung carcinomas and T-47D, MCF-7, and BT474 human breast carcinoma cells were provided by the Yale Cancer Center (Yale University, New Haven, CT). Ul 18MG glioma cells were provided by Dr. R. Matthews, Yale University. Primary human glioblastoma cultures were established from tissue derived from two patients undergoing resective surgery. Nontumor primary human astrocytes were prepared as explant outgrowth cultures from human temporal lobectomy material, removed for intractable epilepsy, solely for the benefit of the patient, and the use was approved by the Yale University Human
Investigation Committee. Astrocyte identity was confirmed by positive immunofluorescence for human glial fibrillary acidic protein. Cells were maintained in Minimal Essential Medium (Invitrogen, Carlsbad, CA) supplemented with 10% fetal bovine serum, 1% sodium pyruvate, 100 μM nonessential amino acids, and 25 mM HEPES buffer. For VSV susceptibility experiments, 2x105 cells were cultured in six-well plates and infected with VSVrp30a at a multiplicity of infection (MOI) of 1. The total number of viable and infected cells was counted at 12 h intervals in 15 high- magnification microscopic fields. Results
To test the tumor cell tropism, VSVrp30a was tested on five human carcinoma lines, selected by the fact that lung and breast cancers are the most common sources for brain metastasis. AU human cancer lines tested, including A549, CaIu-I lung carcinoma, and T-47D, MCF7, and BT-474 breast carcinoma, were infected and killed by VSVrρ30a at an MOI of 1. All cells exhibited viral green fluorescence by 60 h after infection, and all cells, dividing and nondividing, in the culture dish were killed by 48-72 h after infection (Figure 1). In addition, multiple cultures were established from tissue derived from resected glioblastoma surgery. These primary high-grade gliomas were grown in culture and infected with VSVrp30a at an MOI of 1. Complete infection and presence of cytopathic effects were observed within 36 h after virus application indicating that the oncolytic capacity of VSV seen on established glioma and other cancer cell lines could translate to tumor cells directly derived from human cancer patients. Example 2: VSV-rp30 has improved oncolytic potential Materials and Methods Viruses VSV-G/GFP (additional G protein with GFP reporter fusion inserted at 5th gene position), VSV-M51/CT9 (M protein M51 mutation + G protein with cytoplasmic tail truncated to 9 amino acids) and VSV-1'GFP (GFP reporter inserted in 1st gene position) were obtained from J. Rose (Yale University) and propagated using BHK-21 cells (Figure 2). VSV-rp30 was generated from VSV-G/GFP through repeated passage and adaptation on U- 87MG glioblastoma cells. The four VSVs used in the present study (VSV- G/GFP, VSV-rp30, VSV-M5I/CT9 and VSV-I1GFP) were all derived from a recombinant version of the San Juan strain of Indiana serotype VSV, the genome of which consists of a single negative strand of RNA that encodes five genes, N, P, M, G and L, depicted on the top (VSV). (see Figure 2). All four express enhanced GFP, a fluorescent reporter protein that enables the visualization of infected cells. VSV-G/GFP (G/GFP) incorporates a GFP reporter gene (shown in grey) encoding an additional copy of the G-protein with a C-teraiinal fusion of GFP. VSV-rp30 (RP30) is a glioblastoma cell- adapted variant of VSV-G/GFP that has been previously described to display increased oncolytic activity in glioblastoma cells. The P and L genes (shown in white) are the genes found to contain the mutations S126L and D223Y identified in the present study. VS V-M51/CT9 (M51 /CT9) contains a GFP reporter gene (in grey) inserted between the G and L genes. The M gene (in white) has been modified to delete the methionine at position 51 of the M protein and the G gene (white) encodes a truncated version of the G protein that removes all but 9 of the 27 amino acids of the C-terminal cytoplasmic tail. Both of these mutations have previously been reported to result in attenuated viral propagation (Clarke et al., J Virol., 81: 2056-2064 (2007); Publicover et al., J. Virol, 78: 9317-9324 (2004); Publicover et at, J. Virol., 80: 7028-7036 (2006)). VSV-I1GFP (I1GFP) contains a GFP reporter gene (grey) inserted into the first position in the gene order, thus decreasing the level of transcription from the remaining five downstream genes and leading to attenuated viral propagation (Clarke et al., J Virol., 81: 2056-2064 (2007); Flanagan et al., J. Virol, 75: 6107-6114 (2001); Ramsburg et al., J Virol, 79: 15043-15053 (2005)). Celt lines The human glioblastoma tumor cell line U-87MG, the baby hamster kidney cell line BHK-21, and the embryonic mouse cell line NIFV3T3 were obtained from the American Type Culture Collection (ATCC) (Manassas, VA). The human glioblastoma tumor cell lines U-118MG and U-373MG were provided by R. Matthews, Yale University. The human prostate tumor cell line DU- 145 was provided by B. Gullen, Yale University. The human cell lines SJSA-I, BT-549, T-47D, HCTU6, LS180, SfV480 and A549 and established from tumors of bone, breast, breast, colon, colon, colon and lung, respectively, were provided by S. Mella, Yale University Cancer Center. The primary human astrocyte culture was established from human brain tissue obtained in the course of epilepsy surgery, as described by Wollmann, et al., J Virol, 81:1479-1491 (2007), with patient welfare being the sole basis for resection of brain tissue. All cell lines were propagated using MEM growth media consisting of minimum essential medium (Gibco, Carlsbad, CA) supplemented with 10% fetal bovine serum (Gibco) and 1% penicillin/streptomycin solution (Gibco) and housed in a humidified incubator at 37°C supplied with 57% CO2. Plaque size assay In order to compare VSV propagation among various cell types, a plaque size assay was devised. For each cell type, confluent cell monolayers were grown in six-well plates and triplicate wells were infected with each of the VSVs to be tested. Immediately prior to viral inoculation, media in all wells was aspirated and replaced with 0.9 ml of MEM growth medium followed by inoculation using 0.1 ml of serially diluted VSV generated previously and stored in MEM growth medium at -8O0C. After inoculation, plates were placed back in the incubator for 1 hr to allow time for the virus to adsorb into the cell monolayer. The inoculation media was then aspirated and cell monolayers were overlaid with 2 ml of 0.5% (w/vol) agarose (Ultrapure GPG/LE; American Bioanalytical, Natick, MA) in MEM growth medium. After solidification of the agarose, plates were incubated at 37°C in 5Vo CO2 for 18 - 36 hr to allow time for plaque development. Since each of the VSVs expressed enhanced GFP as a reporter protein, fluorescent microscopic imaging was employed to visualize and measure individual GFP fluorescent plaques. The fluorescent imaging system consisted of an Olympus 1X71 inverted microscope (Tokyo, Japan) fitted with an Olympus UPlanFl 4X objective and EGFP filter set. Images were captured using a SPOT-RT digital camera (Diagnostic Instruments, Sterling Heights, MI) and further processed using Adobe Photoshop 7.0 software (Adobe Systems, San Jose, CA). Fluorescent plaque diameter measurements were taken after VSV- G/GFP plaques had grown to between 0.5 - 1.5 mm in diameter. For each VSV tested, 30 plaques were randomly selected under fluorescent visualization and measured across their diameter to the nearest 0.05 mm. The mean VSV-G/GFP plaque diameter was used as the normalization factor for all plaque diameter measurements in each cell line (normalized mean VSV- G/GFP plaque diameter = 100%). All uncertainties represent the standard error of the mean (SE) of normalized values. Statistical calculations were performed using InStat 3.0 software (GraphPad Software, La Jolla, CA). One-way analysis of variance (ANOVA) with post hoc Bonferroni multiple comparison tests were used to determine statistical significance. Comparisons between groups yielding a p-value < 0.05 were considered significantly different. Results
In order to more fully assess the relative differences in the growth characteristics of VSV-rp30 with respect to the parent VSV-G/GFP from which it was derived, a panel of eleven widely used cancer cell lines was assembled for use in a plaque size assay. These lines were established from tumors of a number of different types of common human adult cancers including bone, brain, breast, colon, lung and prostate. Additionally, two other GFP-expressing VSVs were included for comparison in the assay (VSVM5I/CT9 and VSV-I'GFP) that have been reported to display attenuated growth characteristics in vitro (Clarke et al., J. Virol., 81: 2056- 2064 (2007); Publicover et al., J. Virol, 78: 9317-9324 (2004); Publicover et al., J Virol, 80: 7028-7036 (2006); Ramsburg et al, J Virol, 79: 15043- 15053 (2005)). A diagram illustrating the genomic composition of each of the four VSVs assayed is shown in Figure 2. Analysis of the average size of VSV-rp30 plaques relative to those produced by VSV-G/GFP indicated that VSV-rp30 plaques had a significantly larger diameter (165% ± 7 SE, p <
0.001, n =30) than VSV-G/GFP plaques (100% ± 5 SE, n = 30) and that both VSV- M51/CT9 and VSV-I 'GFP plaques had significantly smaller diameters (55% ± 3 SE, pO.001, n=30; 53% ± 4SE, p < 0.001, n=30) respectively, than VSV-G/GFP plaques (Figure 3). A similar analysis was performed for each of the 11 cancer cell lines
(Figure 3). Each circle represents the mean of 30 randomly selected plaques measured across their diameter, then normalized with respect to the corresponding VSV-G/GFP mean plaque diameter. The small marks at the top of each circle represent the standard error of the mean. VSV~rp30 plaques were significantly larger (p < 0.001) than VSV-G/GFP plaques in all cancer cell lines tested. The VSV-rp30 plaques ranged in average diameter from a low of 137% ± 6 SE (p < 0.001 , n = 30) in brain U-87MG cells to a high of 165% in the previously mentioned brain U-373MG cells. In 9 of 11 cancer lines, VSV-4 M5I/CT9 plaques were significantly smaller than VSV- G/GFP plaques and ranged in average diameter from a low of 10% + 1 SE (p < 0.001, n = 30) in breast T-47D ceils to a high of 83% ± 4 SE (n = 30) in brain U-87MG cells. In 10 of 11 cancer lines, VSV-I1GFP plaques were also significantly smaller, ranging in diameter from a low of 39% ± 4
SE (p < 0.001, n=30) in brain U-87MG cells to a high of 114% ± 5 SE (n = 30) in lung A549 cells.
Three additional non-cancer-derived cell lines (primary human astrocytes, mouse NIH3T3 and hamster BHK-21 cells) were also tested in the assay (Figure 3). The primary 12 human astrocyte cells displayed an average VSV-rp30 plaque diameter (118% ± 6 SE, n = 30) that was marginally larger than that of VSV-G/GFP plaques (100% + 5 SE , n - 30), however, this difference achieved significance only at the p < 0.05 level of confidence. Conversely, both VSV-MS 1/CT9 and VSV-I1GFP plaques had significantly smaller diameters (19% ± 3 SE, p < 0.001, n =30; 61% ± 5 SE, p < 0.001, n = 30, respectively). The mouse NIH/3T3 cells displayed an average VSV-rp30 plaque diameter (98% ± 6 SE, n = 30) that was not significantly different from that of VSV-G/GFP (100% + 7 SE, n - 30), however, both VSV-MS 1/CT9 and VSV-1'GFP plaques had significantly smaller diameters (41% ± 3 SE, pO.OOl, n=30; 74% + 6 SE, p < 0.05, n = 30, respectively). Finally, hamster BHK-21 cells displayed average VSV- rp30 (109% + 3 SE, n - 30), VSV-M51/CT9 (88% + 4 SE, n = 3O)5 and VSV- I1GFP (93% ± 4 SE, n = 30) plaque diameters that were not significantly different than that of VSV-G/GFP (100% + 4 SE, n - 30). Taken together, these data indicate that VSV-rp30 plaques develop to become significantly larger than VSV-G/GFP plaques when grown on cancer-derived cells, in contrast to the little or no difference in size observed when grown on non-cancerous cells. Additionally, VSV-M51/CT9 and VSV-I 'GFP plaques tend to be significantly smaller than VSV-G/GFP plaques in the majority of cell lines tested, independent of whether the cells are of a cancerous or non-cancerous origin. The larger plaques associated with VSV-rp30 were indicative of a faster rate of infection and replication of this virus than the other VSVs tested here. This enhanced rate of infection may prove beneficial in treating cancer, as it would give VSV~rp30 a headstart in the race against the immune system. Although VSV-rp30 was more aggressive in infecting tumors, the relative efficacy of VSV-rp30 in infecting normal human astrocytes was reduced compared with the tumors; this is an attribute of VSV-rp30, as it suggests that the virus has a greater replication potential in tumor than in non-tumor tissue. Based on plaque size, VSV-rp30 displayed a mean 50% greater infection of all human cancer lines than the parent VSV-G/GFP, and showed a three-fold greater infection than VS V-CT9/M51 or VS V- 1 'GFP. In contrast, VSV-rp30 showed only a modest 9% greater infection on human non-cancer control cells.
Example 3: VSV-rp30 exhibits increased oncolytic activity Materials and Methods Plaque cytotoxicity labeling with ethidϊum homodimer
Assessments of cell death were performed on plaques after treatment with ethidiurn homodimer (EthD-1), an agent that yields a bright red fluorescence upon binding to the exposed nucleic acids of dead or damaged cells. EthD-1 (Molecular Probes, Eugene, OR) was prepared in D-PBS at a 4 μM concentration according to the manufacturer's instructions and 1 ml was used to overlay the agar layer of infected cell monolayers on which plaques had been allowed to develop for 48 hrs. One well from each condition was overlaid with 1 ml of D-PBS alone as a negative EthD-1 control. After incubation for 30 minutes at 370C, plaques were visualized with the fluorescent microscopic imaging system described above using either EGFP or Texas red filters. Under red fluorescent visualization, plaques were easily identifiable due to the greatly increased density of dead cells labeled by EthD-1. After confirming the location of the plaque using GFP fluorescence, the diameter of the red fluorescent EthD-1 labeled area of cell death associated with the plaque was measured. The diameters of these cytotoxic areas were normalized with respect to the corresponding mean VSV-G/GFP cytotoxic area diameter of each cell line tested. Thirty plaques from each condition were randomly selected and analyzed in this manner and statistical comparisons were performed as described above. Results
To assess the oncolytic activity of VSV-rρ30 relative to VSV-G/GFP, VSVlO M51/CT9 and VSV-1'GFP, plaque assays treated with ethidium homodimer were used to visualize the cell death associated with plaques. Ethidium homodimer (EthD-1) is an agent that yields a bright red fluorescence upon binding to the exposed nucleic acids of dead or damaged cells and is routinely used in assessments of cytotoxicity. Under red fluorescent illumination, VSV plaques were easily identifiable due to the greatly increased density of dead cells. Analysis of the cytotoxic areas associated with VSV plaques indicated that the relative size of the regions of enhanced cell death closely mirrored the GFP fluorescent plaque size in all four of the cancer cell lines tested (Figure 4). Cytotoxic area measurements were collected and normalized as in Figure 3. Unless otherwise indicated, all cytoxic areas differed significantly (p < 0.05) in size from the corresponding VSV-G/GFP cytotoxic areas, with no statistically significant difference indicated by ns. Thus, VSV-rp30 not only propagates more quickly than VSV-G/GFP, overall, it yields a greater oncolytic effect than VSV-G/GFP as well. Additionally, VSV-M51/CT9 and VSV-1'GFP both yielded less of an oncolytic effect than VSV-G/GFP, consistent with the smaller plaque size attendant to each of these viruses. Example 4: Genotype of VSV-rp30 Materials and Methods
VSV genome sequencing Viral genomic RNA was extracted from VSV-G/GFP and VSV-rp30 using the QIAamp Viral RNA Mini Kit (Qiagen, Valencia, CA). Reverse transcription of isolated VSV genomic RNA was performed using Thermo-X Reverse Transcriptase (Invitrogen, Carlsbad, CA) at a reaction temperature of 53.9°C and an RT-oligo with the sequence, 5'- ACG AAG ACA AAC AAA CCA TTA TTA TC-3' (SEQ ID NO: 11) designed to anneal to the initial 26 bases of the 3'-end of the VSV genome. Full-length genomic VSV cDNA (13.5 kb) was then used as template in a series of 6 PCR reactions that generated overlapping products covering the entire genome and ranging in size from 2.0 - 2.7 kb. Primers were designed on the basis of the VSV- G/GFP sequence, SEQ ID NO: 1 (Genbank accession FJ478454). The primers, annealing temperatures and product sizes for these reactions were as follows. PCR 1: IF - RT-oligo shown above (SEQ ID NO: 11), IR 5'-GAT ATG GTG AGA GGC TGA AGA C-31: (SEQ ID NO: 12) 54.2°C; 2054 bp. PCR 2: 2F 5'-CCA GTG ATG AAC ACA CAT CC-3' (SEQ ID NO: B)5 2R 5'-AGT CTC GAG CGT GAT ATC TGT TAG-3' (SEQ ID NO: 14); 54.3°C; 2726 bp. PCR 3: 3F 5'-CTC AAA TCC TGC TAG GTA TG-3' (SEQ ID NO: 15), 3R 5'-GAC TTC CAT GAT TGC TGT TAG-3' (SEQ ID NO: 16); 54.2°C; 2422 bp. PCR 4: 4F 5'-TTC AAG GAC GAC GAC GGC AAC
TAC AAG AC-3' (SEQ ID NO: 17), 4R 5'-ACC CTC TTG TCC TTG CCA AC-3' (SEQ ID NO: 18); 54.3°C;2559 bp. PCR 5: 5F 5'-CTT AAT CGA GAG AAC TCA TG-3' (SEQ ID NO: 19), 5R 5'-GAT CTG TTT TAT CTC TTG TC-3' (SEQ ID NO: 20); 50.40C; 2131 bp. PCR 6: 6F 5'-GAC TCA AGT ATG GAC TAC AC-3' (SEQ ID NO: 21) 6R 5'-ACG AAG ACC ACA AAA CCA G-3' (SEQ ID NO: 22); 50.40C; 2496 bp. All PCR was performed using the Expand High Fidelity PCR Kit (Roche Diagnostics, Indianapolis, IN) and the reaction products were purified using the Qi Aquick PCR Purification Kit (Qiagen). Samples from all reactions were run on 0.8% agarose gels to confirm the presence of a single product of the appropriate molecular weight Purified products were spectrophotometrically quantified, mixed with the appropriate sequencing primers and submitted to the W. M. Keck DNA Sequencing Facility (Yale University) for automated DNA sequencing. Sequencing of each PCR product was performed on both the sense and antisense DNA strands using the following primers. PCR 1: IF (shown above, SEQ ID NO: 11) , 960F 5'-AAA ACC CTG CCT TCC ACT TC-3' (SEQ ID NO: 23), 1040R 5'-CAA ACC TGC TGT AGT AAG AG-3' (SEQ ID NO: 24), IR (shown above, SEQ ID NO: 12). PCR 2: 2F, (as shown above, SEQ ID NO: 13), 2962F 5'-CTA GTC TAA CTT CTA GCT TCT G- 3' (SEQ ID NO: 25), 3959F 5'-TTC AGG ACG TTG AGA GGA TC-3' (SEQ ID NO: 26), 3047R 5'-AAC AGA TCG ATC TCT GTT AG-3' (SEQ ID NO: 27), 4026R 5'-GGA GCA AGA TAG CTG AGA TC-31 (SEQ ID NO: 28), 2R (shown above, SEQ ID NO: 14) PCR 3: 3F (shown above, SEQ ID NO: 15), 497 IF 5'-TTC CAT CCG ATC CTT CAC TC-3' (SEQ ID NO: 29), 569IF 5'-ATT CAA GAC GCT GCT TCG CAA C-3' (SEQ ID NO: 30), 6035R 5'-GAG CTT TTC CAA CTA CTG AAC-3' (SEQ ID NO: 31), 3R, (SEQ IDNO: 16). PCR 4: 4F (shown above, SEQ ID NO: 17), 6974F 5'- GTG ATA CCA TGC TCA AAG AG-3' (SEQ ID NO: 32), 7960F 5'-CCT TTA GTC CCA CAA TTC C-3' (SEQ ID NO: 33) 8046R 5'-GAT CCA CTG TTT TCA CAC TC-3' (SEQ ID NO: 34), 4R (shown above, SEQ ID NO: 18). PCR 5: 5F (shown above, SEQ ID NO: 19), 9931F 5'-CGA ACT TGT TAA AGA CTG AGG-31 (SEQ ID NO: 35), 10038R 5'-GGA ACA GAG GAT TTA TTG AC-3' (SEQ ID NO: 36), 5R, (shown above, SEQ ID NO: 20). PCR 6: 6F (shown above, SEQ ID NO: 21), 11959F 5'-GAA TCA GGT TGG GCC AAT TAC-3' (SEQ ID NO: 37) 12024R 5'-AGC CGT CTC CAC AAC TCA AG-3' (SEQ ID NO: 38), 13045R 5'-CAC TTC TGC TTG TAT CCT CC-3' (SEQ ID NO: 39), 6R, (shown above, SEQ ID NO: 22). AU oligonucleotides were synthesized by the Department of Pathology
Oligonucleotide Synthesis Facility (Yale University School of Medicine). Inspection of sequence chromatographic data was performed using 4Peaks Version 1.6 software (Mek&Tosj.com) and base-call files were assembled and analyzed using DNA Strider Version 1.3fl4 software (Ch. Marck, Cedex, France). In general, any sequencing ambiguities that arose in one strand were easily resolved by inspection of sequence results from the complementary strand.
VSV-rp30 mutation analysis with BsrDl
Restriction digestions using BsrDl (New England Biolabs, Beverly, MA) were performed on a 2.1 kb PCR product encompassing the site of the C1772T mutation identified in the gene for the P protein of VSV-rp30. This mutation creates a unique BsrDl restriction site in the VSV-rp30 PCR product that is not present in the VSV-G/GFP product, and when cleaved, yields two smaller species of 1298 bp and 828 bp. The 2126 bp PCR product was amplified from VSV-G/GFP and VSV-rp30 cDNA using the same methods as described above and primers 960F and 3047R at an annealing temperature of 52°C for 30 cycles. Products were purified and quantified as described above and 350 ng of each were included in restriction digestion reactions and control reactions (no enzyme) and incubated according to the manufacturer's instructions. Digestion products were run on 1.2% agarose gels stained with ethidium bromide. Results The genotypic alterations were identified by sequencing the genomes of the parent VSV-G/GFP and glioblastoma cell-adapted VSV-rp30 viruses using RT-PCR and automated nucleotide sequencing (Figures 5 A-C). Sequencing of the parent virus as a control showed an identical nucleotide sequence to that used in generating the virus, showing that the parent VSV had population stability, at least over the estimated minimum of 50 generations of viral progeny from the stock previously generated. The sequences of both viruses were found to be identical except for four point mutations located in the genes for the P protein (C1772T) and L protein (G7693T, A11712G, and C11736T) with nucleotide numbering according to SEQ ID NO: 1 (Genbank accession FJ478454)) (Figure 5 A-C).The P and L proteins of VSV form an RNA polymerase complex that is responsible for both viral mRNA transcription and genome replication. Whereas the P protein itself has not been found to display enzymatic activity, it is believed to modulate L protein activity, with phosphorylation of serine and threonine residues located on P being important for this function.
Inspection of the sequence chromatograph data indicated that all of the detected VSV-rp30 mutations were represented by a single unambiguous chromatographic peak (Figure 5C), suggesting that these mutations were present throughout the entire VSV-rp30 viral population. Since the C1772T mutation in SEQ ID NO: 1 results in the creation of a Bsr DI restriction site in VSV-rp30, the apparent homogeneity of this mutation within the viral population was determined by means of restriction digestion. Using a 2.1 kb PCR product encompassing the CI772T mutation site, Bsr DI application yielded a complete digestion of the VSV-rp30 amplified PCR product and no detectable digestion of VSV-G/GFP derived product. Thus, there appears to be no detectable 'residual1 parent VSV-G/GFP present in the VSV-rp30 population. Taken together these results indicate an absence of any detectable sequence heterogeneity within the VSV-rp30 population at the identified mutation sites.
The A11712G and Cl 1736T mutations in SEQ ID NO: 1 were both found to be silent base substitutions appearing in the third position of codons 1562 and 1570 of the amino acid sequence of the L protein (SEQ ID NO: 5), respectively. Additionally, these silent mutations appear to be relatively comparable substitutions with respect to human codon usage frequencies (1562: GAA-29.0 vs GAG=39.6 per thousand codons and 1570: ACC=I 8.9 vs ACT=I 3.1 per thousand codons) (Codon Usage Database [http://www.kazusa.orjp/codon/]). Not only are both mutations silent, but they also result in comparable substitutions with respect to codon usage frequency. Thus, it is possible, but less likely that these mutations play a significant role in the enhanced oncolytic phenotype displayed by VSV-rp30.
The C1772T mutation of SEQ ID NO: 1 appears in the second position of codon 126 of the P protein and results in a replacement of the serine (S) in VSV-G/GFP (SEQ ID NO: 3) with a leucine (L) in VSV-rp30 (S 126L) (SEQ ID NO: 8). A Genbank search (October 2008 [http://www.ncbi.nlm.nih.gov]) indicated that a number of Indiana serotype VSV strains have been identified that, like VSV~rp30, possess a leucine (L) at position 126 of the P protein, (SEQ ID NO: 8). These include strain 85CLB South America, strain 94GUB Central America, strain 98COE North America, strain Glasgow, and strain Mudd-Summers, with the P protein sequences of these strains available using Genbank accession numbers Q8B0H8, Q8B0H3, Q8B0I3, P04879, and P04880, respectively. The only Indiana serotype VSV strain found to possess a serine (S) at position 126 of the P protein, was the San Juan strain (Genbank accession P03520), the same strain from which VSV-G/GFP was originally recombinantly engineered (Lawson 1995). Thus, among the various strains of VSV that have been sequenced and are available on Genbank, the serine (S) at position 126 of the P protein (SEQ ID NO: 3) does not appear to be a residue that is strictly conserved. The oncolytic activity of the San Juan strain relative to the other Indiana serotype VSV strains is unknown.
The G7693T mutation of SEQ ID NO: 1 appears in the first position of codon 223 of the L protein and results in a replacement of the asparagine (D) in VSV-G/GFP (SEQ ID NO: 5) with a tyrosine (Y) in VSV-rp30 (D223Y) (SEQ ID NO: 10). A Genbank search (October 2008) indicated that the asparagine (D) at position 223 of the L protein (SEQ ID NO: 5) appears to be a highly conserved residue and is present among all the Indiana serotype VSV strains for which sequence data are available. Thus, the presence of a tyrosine (Y) at this site has not been previously reported and is apparently unique to VSV-rρ30 (SEQ ID NO: 10). Example 5: C1772T (S126L) and G7693T (D223Y) mutations are possible targets for cellular kinases Both serine and tyrosine can act as potential phosphorylation sites for cellular kinases. Both VSV-rρ30a amino acid alterations involved either a serine or a tyrosine. Phosphorylation events that target these sites may be one basis for the novel phenotype observed in VSV-rp30, specifically the loss of the serine at 126, (SEQ ID NO: 8), and the gain of the tyrosine at 223, (SEQ ID NO: 10), could remove and create, respectively serine and tyrosine kinase phosphorylation sites.
In order to investigate what (if any) serine or tyrosine kinases might recognize either of these mutated sites both the mutant and the wild-type P protein and L protein amino acid sequences were downloaded onto two bioinformatics servers located at the Center for Biological Sequence
Analysis (CBS) at the Technical University of Denmark (www.cbs.dtu.dk). The first server (NetPhos 2.0) is a database that predicts the likelihood that any particular serine, threonine or tyrosine in a protein sequence is a target of phosphorylation. The second server (NetPhosK 1.0) makes predictions as to what specific kinases would be likely to recognize these sites. These servers indicated the following with respect to the mutant VSV-rp30 sites. S126L in the P protein
The serine that is lost at position 126 of the P protein in VSV-rp30 (SEQ ID NO: 8) is predicted to have a very high likelihood of acting as a substrate for phosphorylation and displayed a score of 0.997. Two kinases were predicted to recognize this site, i.e. cdk5 and RSK. Cdk5 is a cyclin- dependent kinase that is specific to neurons and has an axonal subcellular localization. The serines at positions 60 and 64 were predicted to be phosphorylation sites and displayed scores of 0.985 and 0.989. respectively. The sites at 60 and 64 were predicted to be recognized by casein kinase 2 (CK2), the kinase that has been empirically identified as the kinase responsible for phosphorylating these sites in VSV. D223Yin the L protein
The tyrosine that is gained at position 223 of the L protein in VSV- rp30 (SEQ ID NO: 10) is predicted to be phosphorylated with a score of
0.665. Three kinases were predicted to recognize this site, i.e. EGFR, Src and INSR. The EGFR kinase prediction is of particular interest since this kinase (epidermal growth factor receptor kinase) is one that has been found to be highly upregulated in glioblastomas. In fact, this particular kinase has emerged as a therapeutic target for the treatment of glioblastomas and a number of EGFR kinase inhibitors are currently undergoing clinical trials. Example 6: Kinase inhibitors reduce VSV-rp3θ efficacy Materials and Methods
Kinase inhibitor assay The kinase inhibitors staurosporine, genistein and tyrphostin 51 were obtained from Sigma-Aldrich, St. Louis, MO (catalog numbers: 54400, G6649 and T7665, respectively) and used to prepare 3 niM, 100 mM and 100 mM stock solutions, respectively, in 100% DMSO. Stock solutions were aliquotted and stored in a lightproof container at -20°C until use. Confluent U-373 cell monolayers in six-well plates were grown as described earlier. Thirty minutes prior to the start of the experiment, the cell monolayers were aspirated and washed once with 2 mis of PBS before replacing the media with 0.9 ml of low-serum MEM media (1% FBS). Monolayers were then inoculated with either VSV-G/GFP or VSV- rp30 at a dilution selected to yield approximately 150 plaques per well and overlaid with 2 ml of agarose in low-serum MEM media as described earlier. After solidification of the agarose, a 0.5 ml volume of low-serum MEM media containing kinase inhibitor or vehicle (DMSO) at 5X the final concentration was overlaid onto the agarose. Plates were incubated at 370C in 5% CO2 for 24 hrs and 30 plaques from each condition were randomly selected, fluorescently visualized, measured and statistically compared as described earlier. The individual doses of each kinase inhibitor were prepared by first serially diluting the kinase inhibitor stock solution in DMSO, then adding a constant volume of inhibitor/DMSO solution or DMSO alone (vehicle) to the 0.5 ml volume of low-serum MEM media. In this manner, all conditions were exposed to the same concentration of vehicle, i.e. 0.03% DMSO in the genistein experiments and 0.01% DMSO in the staurosporine and tyrphostin 51 experiments. Results
An essential step in the replication cycle of VSV is the phosphorylation of the P protein by protein kinases expressed by the host cell (Bank and Banerjee, Proc. Nat. Acad. ScL USA 89: 6570-6574 (1992); Das and Pattnaik, J Virol, 78: 6420-6430 (2004); Lenard, Pharmacol Ther., 83: 39-48 (1999). Additionally, a wide range of cancer cells have been shown to display aberrant protein phosphorylation activity and a variety of oncogenic mutations have been identified in kinase and phosphatase genes (BardelH et al.f Science, 300: 949 (2003); Parsons et al.} Nature, 436: 792 (2005); Wang et al.} Science, 304: 1164-1166 (2004). In order to investigate whether host cell phosphorylation activity might play a role in the enhanced propagation of VSV-rp30, three different kinase inhibitors (staurosporine, genistein and tyrphostin 51) were selected their effects on VSV-rp30 and VSV-G/GFP propagation in U-373MG cells using the plaque size assay (described earlier) were examined (Figure 6 A-C). Staurosporine is a broad-spectrum inhibitor of serine, threonine, and tyrosine kinases. Staurosporine caused a significant attenuation of the difference in plaque size between VSV-rp30 and VSV- G/GFP at concentrations of 10 nM and 100 nM (Figure 6 A). Genistein is a protein kinase inhibitor selective for tyrosine kinases (Akiyama et aL, J. Biol. Chem., 262: 5592-5595 (1987). Genistein also significantly attenuated the difference in plaque size between VSV~rp30 and VSV-G/GFP at a concentration of 10 μM (Figure 6 B). Finally, tyrphostin 51 is a tyrosine kinase inhibitor selective for the epidermal growth factor receptor tyrosine kinase (EGFR). In contrast to the effects of both staurosporine and genistein, tyrphostin 51 had no significant effect on the difference in plaque size between VSV-rp30 and VSV-G/GFP at concentrations up to 10 μM, the highest dose tested (Figure 6C).
The wide-spectrum kinase inhibitors staurosporine and genistein both produced an attenuation of the enhanced replication of VSV-rp30 relative to VSV-G/GFP, whereas tyrphostin 51, an inhibitor specific to the epidermal growth factor receptor tyrosine kinase (EGFR), did not (Figure 6A-C). Taken together, these results suggest that the enhanced propagation (i.e. enhanced rate of infection) of VSV-rρ30 relative to VSV-G/GFP in cancer cells may be due, in part, to the activity of one or more cellular kinases sensitive to staurosporine and genistein. Example 7: Tumor cells stably transfected with red fluorescent protein gene reliably form tumors Materials and Methods Transfection
For stable transfection, RFP [tetrameric phosphorylated Discosoma red (pDsRedl)~Nl and monomeric pDsRed-monomer- Cl], cyan fluorescent protein [phosphorylated cytomegalovirus (pCMV)~ CFP], and blue fluorescent protein (pCMV-BFP) plasmids were used. pCMV-CFP and pCMV— BFP were generated by exchanging the RFP expression cassette from pDsRed monomer-Cl with CFP or BFP cassettes from pRSET/CFP (Invitrogen). Cells were transfected using Lipofectamine 2000 reagent (Invitrogen), enriched, and maintained with G418 (Sigma, St. Louis, MO). rU87 and rUl 18 cells were sorted for brightest fluorescence on a FACSvantage SE fluorescence-activated cell sorter (BD Biosciences, San Jose, CA). Growth characteristics were assessed using 3-(4,5- dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide (MTT) (Invitrogen) assay according to the instructions of the manufacturer. Optical density was read at 570 ran using a Dynatech (Alexandria, VA) MR500 ELISA plate reader and corrected from background control. Results
To choose the optimum nontoxic fluorescent protein that would allow simultaneous imaging with GFP encoding virus, several different fluorescent proteins, including cyan (pCMV-CFP), blue (pCMV-BFP), and red (tetrameric pDsRedl- Nl and monomeric pDsRedmonomer-Cl) were tested. BFP was subject to quick photobleaching, and CFP was not practical for use simultaneously with GFP-expressing VSV because of overlap in their fluorescent spectrum. Transfection of U87 high-grade glioma cells with tetrameric RFP resulted in toxicity in vitro. Stable transfection of U87MG or Ul 18MG glioma cells with a plasmid encoding the monomeric DsRed protein resulted in bright red fluorescence and did not alter growth characteristics as demonstrated by MTT assay. Over a 24 h period, absorbance measurements increased by 89.8+33.2% in rU87 cells and by 103.8+32.5% in U87MG cells (statistically nonsignificant p = 0.75. n = 65 Student's t test), indicating that the red glioma cells were replicating at their usual rate. After selection in G418 and fluorescence-activated cell sorting, all tumor cells expressed red fluorescent protein. Bilateral brain injections of either rU87 or rUl 18 cells in SCID or nude mice yielded tumors in 100% (90 of 90) of injections. Ten days after injection, nomnfected rU87 xenografts in SCID mice had a mean calculated volume of 7.13+5.76 mm3 (n = 4; calculated as ellipsoid volume: 4/3 x y z). Horizontal and vertical radi x and y represent half of the horizontal and vertical diameters in the coronal section that harbored the largest tumor cross-section area. The anteroposterior radius z represents half the tumor craniocaudal length, calculated by multiplying section thickness with the number of sections where the tumor is present. Tumor xenografts grew predominantly by expansion, although in a number of cases tumor cells separated from the main tumor body and invading the surrounding parenchyma. Tumors grew with no spontaneous regression or hemorrhage until they reached a lethal size. For humane reasons, mice were killed at the onset of symptoms before tumor induced death. Example 8; Intravenously injected VSVrp30a targets multifocal brain tumors with high selectivity Materials and Methods
Mouse procedures
Animal experiments and postoperative care were performed in accordance with institutional guidelines of the Yale University Animal Care and Use Committee. Immunodeficient homozygous CB17-SCID (CBl 7SC- M) and NCr-Nude mice (NCr-Foxnlnu) at an age of 4-5 weeks were obtained from Taconic Farms (Germantown, NY). Animals were stereotactically grafted with 3 x 105 tumor cells bilaterally into the striatum (2mmlateral, 0.4mmrostral to bregma at 3 mmdepth) or cortex or with 1 x 105 cells unilaterally in the left olfactory bulb (0.75 mm lateral, 4.5 mm rostral to bregma at 1.5 mm depth). For cranial window experiments, a teardrop-shaped skin flap (with an anteroposterior axis along the parasagittal plane crossing the midpupiHary line) was removed, and a 5 -mm- wide round craniectomy was drilled under an operating microscope (Zeiss, Oberkochen, Germany). rU87 glioma cells, 5 x 104, were injected along a trajectory parallel to the cortex immediately below the pia mater. The craniotomy was covered with a round glass coverslip of 8 mm diameter and glued to the bone margins using cyanoacrylate. Animals were followed with daily measurements of weight, food and water consumption, and overall health and activity, and the cranial window animals were given parenteral antibiotics. During in vivo brain imaging, mice were lightly anesthetized to reduce movement, and the head was maintained in a horizontal position during image acquisition. Animals were killed with a pentobarbital overdose and perfused transcardially with 4% paraformaldehyde. For determination of blood- brain barrier integrity, 2% Evans Blue (Sigma) in 100 μl of sterile saline was injected intravenously 1 h before the animals were killed. Viruses
Ten days after tumor grafting, 100 μl of medium containing virus (107 plaque forming units (PFU) of VSVrp30a, VSV-GFP5 VSV- ΔG-GFP, or recombinant pseudorabies virus (PRV)-GFP or 1012 virions adeno-associated viras serotype 2 (AAV)-GFP) was injected through the tail vein. VSV-GFP and VSV-ΔG-GFP were generously provided by Dr. J. K. Rose (Yale University). PRV-GFP strain 152 was kindly provided by Dr. L. W. Enquist (Princeton University, Princeton, NJ) (Smith et al., Proc Natl Acad Sd, 97:9264-9269 (2000)) and AAV-GFP was kindly provided by Dr. K. R. Clark (Ohio State University, Columbus, OH). Details on the generation and characteristics of the tumor-adapted VSV-GFP isolate VSVrp30a were described previously (Wollmann et al, J. Virol., 79(10): 6005-6022 (2005)). VSV, PRV, and AAV were all shown to infect glioma cells previously. Results
It was shown that in animals bearing two subcutaneous tumors, intraturaoral VSV injection into one tumor resulted in selective infection also in the second tumor on the contralateral side of the body. This strongly suggested vascular viral dissemination and led to the hypothesis that VSV could be delivered to brain tumors through the intravascular route. However, entry into brain tumors is more complex than elsewhere in the body because the blood™ brain barrier can be a major obstacle, even for relatively small- sized chemical or biological agents (Pardridge, Neuron, 36:555-558 (2002)). The ability of intravenously administered VSV to target intracranial tumor xenografts was tested. In mice that were implanted with bilateral brain rU87 xenografts (n — 9 animals, 18 tumors), intravenous injection of 107 PFU of VSVrp30a through the tail vein consistently resulted in infection of the intracranial tumors. A single injection was sufficient to infect gliomas. After an injection of 107 PFU, VSVrp30a infection was found in different regions inside the tumor, suggesting multiple sites of virus seeding. Infection inside the tumor started with a time lag after intravenous delivery but was found in all tumors analyzed after 24 h. Example 9: VSVrp30a replicates and spreads within the tumor mass Materials and Methods
VSV is a replication-competent virus and spreads within the tumor. Early in the course of infection in the non-infected areas, red tumor cells with intact cellular outlines were seen. Within the VSV-infected area, infected and dead tumor cells and debris were surrounded by VSV-infected cells with membranous GFP staining. The presence of newly infected cells at the boundary between killed and non-infected cells suggests that VSV spreads within the tumor. To document viral spread within the tumor mass, animals were killed 24, 48, and 72 h post-inoculation (HPI). Results
Analyzing animals at different time points within the course of VSV infection and using serial histological sections through the tumor, it was found that the virus had spread from initially infected foci to encompass the whole rumor. In addition to the widespread infection and tumor cell killing inside the main tumor mass, tumor cells that were migrating into the normal brain at the tumor margin were also infected, with remarkable sparing of neighboring normal brain cells in immediate contact with the tumor. There was a remarkably high degree of selective infection of the brain tumors with relatively little infection of the surrounding normal brain; the ratio of infected tumor cells to infected normal brain cells was 10 „000:1, or better. Although most tumor xenografts grew by expansion, some isolated cell clusters of tumor cells remote from the main tumor bulk were observed. Of note, these distant cell conglomerates were also targeted by VSV. The course of VSV oncolysis in the brain is schematized in Figure 7. The results demonstrated a continuously increasing area of infection in the tumor mass, resulting in tumor cell death, as indicated by the loss of cellular integrity and the appearance of small granular debris after viral infection. Six tumors were used for analysis of VSV and four for VSVrp30a infection at each time point. In animals killed early in the course of infection, areas of infected and killed tumor cells surrounded by other cells that appeared live at the time of death but with early signs of infection and expression of viral reporter gene were documented. Intact cellular outlines and homogeneous intracellular DsRed signal were used to distinguish healthy cells from dead or dying cells. In addition, DAPI counterstain showed nuclear breakdown commonly found in dead cells, and areas of dead cells showed small granular debris in the place of intact cells. The mean infected area in coronal brain sections with the largest tumor diameter increased from approximately 50 to 60% at 1 d post-inoculation (DPI) to what appeared to be infection of almost the entire tumor by 3 DPI (Figure 8). As shown in the fractionated bar graph in Figure 8, the proportion of viable tumor cells showing normal cellular and nuclear morphology decreased simultaneously.
Finally, the spread of infection was documented in real time using the cranial window animal model. In vitro, VSVrp30a was more effective at selective destruction of gliomas than the parental VSV-GFP. To determine whether this difference persisted in vivo, the relative abilities of the two VSVs to infect gliomas in the mouse brain were compared using the same concentration of virus inoculum. Both VSVrp30a (n = 9 animals, 18 tumors) and VSV-GFP (n = 9 animals, 18 tumors) successfully targeted the brain tumors after tail vein inoculation VSV-GFP. A high tumor selectivity of VSV infection was observed during the time period of our study. In animals implanted with multiple tumors, all brain tumors were infected simultaneously. VSV infection and resultant oncolysis were observed in all tumor masses regardless of the size and location.
Small and large tumors were infected at different localizations in the brain whether striatal, cortical, subventricular, or within the olfactory bulb. Tumors in the brain and periphery were also simultaneously infected (see below). In animals killed within the first 72 HPI5 when the entire tumor mass was infected by VSVrp30a, no GFP expression in the brain parenchyma surrounding the tumor, choroids plexus, or in the leptomeninges was observed. After this period of high tumor-specific infection (72-96 HPI in our model), when the whole tumor bulk showed marked cytopathy, select periventricular groups of infected neurons and ependymal cells in immunodeficient mice were observed. Example 10: VSVrp30a infection causes tumor ceϊl death Materials and Methods lmmunocytochemistry
Cryosections were mounted and counterstained with 4,6-diamidino-2- phenylindole (DAPI) (Invitrogen). For cleaved caspase 3 immunocytochemistry, 20 μm sections were incubated with a 1 : 150 dilution of polyclonal rabbit cleaved caspase 3 antiserum (Cell Signaling Technology, Danvers, MA)5 followed by detection with a 1:200 dilution of biotinylated anti-rabbit antibody (Invitrogen) and ABC reagents detected with diaminobenzidine and hydrogen peroxide (Vector Laboratories, i Burlingame, CA). For von Willebrand factor staining, a 1 :500 dilution of polyclonal rabbit antibody (Abeam, Cambridge, MA) was used following the same procedure outlined above. Imaging Histological sections were studied either on an Olympus Optical (Tokyo, Japan) 1X71 fluorescent microscope fitted with a SPOT-RT camera (Diagnostic Instruments, Sterling Heights, MI) or on an Olympus Optical Fluo-300 laser confocal microscope using Fluoview 300 software version 4.3. Corresponding phase-contrast, green, red, and blue fluorescence photomicrographs were fused and corrected for color and contrast using Adobe Photoshop 7 software (Adobe Systems, San Jose, CA). Several high- resolution pictures were used for montage of whole coronal sections.
Tumor area calculations and cell and nuclear counting were done using NIH ImageJ software. Animals with cranial windows were imaged . daily or more frequently under an Olympus Optical SZXZB 12 stereo microscope and Olympus Optical Fluo-300 laser confocal microscope. Results
VSV infection results in death of tumor cells in vitro. Similarly, VSVrp30a induced widespread tumor cell death in the brain in vivo. Such a fast and efficient elimination of the tumor is important because remaining resistant cells have the potential of repopulating the tumor mass, which is commonly observed in gliomas after conventional treatment. Widespread cell death was detected within the tumor mass. Cell death was indicated by loss of cellular outlines on confocal and light microscopy. Differential interference contrast (DIC) microscopy showed loss of cellular outlines and diffusion of intracellular tumor cell DsRed with fluorescent imaging and nuclear fragmentation assessed with DAPI staining. Infected tumors stained positively for the cellular apoptosis execution protein activated caspase 3. There was a statistically significant decrease in the number of cells with intact cellular (p = 0.0001, ANOVA test) and nuclear morphology (p = 0.0001, ANOVA test) and a statistically significant increase in the number of tumor cells immunostained positive for activated caspase 3 (p = 0.0001, ANOVA test) after infection (Figure 9A-C). Infected tumor cells underwent lysis several hours after expression of viral proteins. An important observation was that the mouse neo vasculature and its cellular constituents, including endothelial cells, were not infected, as the intact vessel architecture was visible by DIC microscopy and the positive staining for the endothelial marker von Willebrand factor of these non- infected cells. Blood vessels appeared mostly undamaged even late in infection. After widespread tumor cell lysis, both viral GFP and tumor DsRed intensity decreased in the tumor mass, which can be attributed to loss of cellular integrity and resultant diffusion of intracellular content. Example 11: Oncolytic potential of VSVrp30a generalizes to human glioma and mammary carcinoma
VSVrp30a was adapted to human gliomas by passaging it on U87MG cells for many generations. Therefore, to test the hypothesis that the in vivo oncolytic potential of VSVrp30a was not restricted to the cell line on which it was developed, two other types of tumor implanted into the mouse brain were also tested. One of the cell types was Ul 18MG, a cell line derived from high-grade human glioma but with different genetic anomalies than found in U87MG. The two glioma types have been shown to differ from each other in their p53 status, c-myc, and epidermal growth factor receptor and PDGF (platelet-derived growth factor) receptor overexpression; they share pi 4, pi 6 deletion, and low expression of multidrug resistance gene.
UI l 8 cells were stably transfected and sorted using the same protocol used for U87MG cells and will be called rU118 herein. SCID mice bearing rUl 18 human glioblastoma xenografts (n - 12 tumors) were killed 48 and 72 h (six tumors each) after a single intravenous injection of VSVrp30a; widespread selective infection, and apoptotic cell death was noted. There was no significant statistical difference in VSV induction of apoptosis between rUl 18 tumors and rU87 tumors 72 HPI ( p = 0 J 855, Student's t test), suggesting that the virus targeted both types of glioma cells. A mouse mammary carcinoma, the 4Tl cell, was also tested. 4Tl cells were transiently transfected with the monomeric DsRed gene and injected into the brain and periphery 48 h after transfection. 4Tl mouse mammary carcinoma cells were used to create an animal model with simultaneous peripheral and multiple brain tumors to mimic the setting of a disseminated systemic cancer. VSVrp30a infected all cranial and subcutaneous flank grafts in SCID mice (n - 2 mice) after a single intravenous injection. Example 12: IV delivery of VSV efficiently targets and lyses brain xenografts in nude mice Materials and Methods
SCID mice are deficient in both humoral and cellular immune defense. Nude mice, conversely, have an immune defect primarily affecting T-cells. To test whether the less compromised immune status would interfere with tumor targeting, striatal rU87 glioma xenografts were tested in NCr- Nude mice (n = 6 tumors). Results
Tumor xenografts were infected and destroyed with similar efficiency and kinetics in the nude mouse as earlier in the SCID mouse (Figure 10). At 72 h after virus inoculation, there was no significant difference in dying cells revealed by activated caspase 3 immunostaining between rU87 tumors in SCID animals, rUl 18 tumors in SCID animals, and rU87 tumors in nude mice ( p = 0.085, ANOVA test) (Figure 10). All brain tumors were similarly targeted by the virus.
After intravenous injection, selective viral infection was found in all tumors and tumor types, and in both SCID and nude mice on different genetic backgrounds, indicating a high efficiency of VSV-tumor targeting. A notable finding was the demonstration of simultaneous oncolytic infection in both subcutaneous flank and brain tumors in the same animal after a single systemic virus injection. In addition to demonstrating the efficiency of a systemic VSV-based therapy, this finding shows VSV infects widely metastatic cancers. Given the oncolytic activity of VSV against a range of cancer cells with diverse genetic defects (Stojdl et al., Cancer Cell, 4:263- 275 (2003); Lichty et al., Trends MoI Med, 10:210-216 (2004); Barber, Oncogene, 24:7710-7719 (2005)), an intravenous injection of VSV can be used to target simultaneously both brain and peripheral metastases of a systemic cancer.
Direct intratumoral injection may be useful for some tumors. To date, such intratumoral injections of viruses have resulted in a very limited viral spread around the injection site (Pulkkanen and Yla-Herttuala, MoI Ther, 12:585-598 (2005)). The ability of VSV to infect multiple independent central and peripheral sites and spread in them is substantive, making it possible to treat disseminated disease and even target minute tumor colonies that are otherwise difficult to detect. Xenograft models are limited in that human gliomas often grow expansively rather than infiltratively in mice. Nonetheless, infiltrating cells were observed within the host brain, and these were targeted by VSV. Example 13: Intranasal VSV targets olfactory bulb tumors Materials and Methods
After intranasal inoculation, VSV can enter the CNS. Nasal mucosal infection results in infection of olfactory neurons, and VSV can gain access to the CNS through the olfactory nerve, which projects to the glomeruli in the olfactory bulb (van den Pol et al, J Virol, 76:1309-1327 (2002)). The hypothesis that VSV could enter the brain along the olfactory nerve and target brain tumors in the olfactory bulb was tested. rU87 cells were stereotactically grafted into one of the two olfactory bulbs in SCID mice. Four days after tumor implantation, animals were inoculated in each nostril with 25 μl containing 2.5xlO7 PFU of VSVrp30a. Results
VSV was transported to the periphery of both olfactory bulbs after intranasal inoculation and infected the olfactory nerve and the tumor but did not show much infection in deeper parts of the control contralateral bulb lacking tumor. SCID mice with VSV in the olfactory bulb survived VSV infection for 2 weeks. A long survival in this tumor model demonstrated that few tumor cells could be found in the bulb after the viral challenge. In animals killed 3 DPI (four tumors) or 5 DPI (six tumors), VSV infection was located within the tumor but not in the surrounding parenchyma or in the intact contralateral olfactory bulb. In nine additional mice killed 7, 10, 15, 16, or 17 d after virus inoculation, cellular debris indicative of a viral infection was found, but surviving tumor cells were not found, suggesting that the virus was successful in eliminating the tumor. Although evidence was found of infected olfactory nerve fibers that could serve as entry to the CNS, there is still the possibility that VSV entered the blood circulation through intranasal application and might reach the olfactory bulb via the circulatory system. To address this question, peripheral sentinel tumors were placed into the flank of three animals simultaneously with olfactory tumor grafting. Seven days later, mice received 2.5x107 PFU VSVrp30a into each nostril. At 3 d after inoculation, both olfactory bulb and peripheral tumors were analyzed. No viral infection was found at the remote sentinel tumor, whereas strong GFP expression was evident at the nasal mucosa, olfactory nerve and bulb, and at the olfactory tumor graft, suggesting a direct path of VS Vrp30a through the olfactory nerve route. This finding indicates that neural routes of VSV dissemination in brain can be exploited for targeting tumors in specific regions and facilitating of distant tumors or infiltrative tumor cells with minimal infection in normal brain parenchyma. Example 14: Real-time microscopy of VSVrp30a oncolysis in cortical glioma xenografts Materials and Methods
To study the kinetics of VSV oncolysis, a time-lapse in situ human brain tumor imaging model was used. rU87 cells were implanted subpially into the SCID mouse cortex (n = 3) under a glass coverslip permanently mounted on a parasagittal craniectomy. Results
By imaging tumor cells in the living animal brain using fluorescent and laser confocal microscopy, VSV infection as early as 16 HPI after tail vein injection of 107 PFU of VSVrp30a could be detected (Figure 11) and followed through viral infection over several days in the live brain. Tumor growth and infection were observed every 4 - 8 h over a course of 4 d. VSV infection spread through the whole tumor bulk within 96 h (Figure 11); although multiple points of infection were seen, the majority of tumor cells appeared to be infected by a locally spreading VSV infection. Laser confocal microscopy gave a cellular or even subcellular resolution, making visible not only single cells but also their processes. Using this technique, it was found that VSV infected single infiltrating red tumor cells but not the surrounding normal brain tissue. Vascular patency and circulation appeared normal in tumor vessels within the infected area even at advanced stages of tumor cell lysis; in live real-time imaging, erythrocytes could be seen moving through the uninfected walls of the blood vessels within the tumor even when all surrounding tumor cells were infected and dying.
Example 15: Mechanism of VSV tumor targeting Materials and Methods
The blood-brain barrier may be leaky in some types of tumors. In normal circumstances, VSV does not enter the CNS through the hematogenous route. Therefore, to explore what makes tumor xenografts permeable to VSV, blood-brain barrier integrity was tested in the xenograft neovasculature. Results
Strong Evans Blue staining was detected within bilateral striatal tumors in SCID (n - 4 tumors) and nude mice (n = 2 tumors) 1 h after intravenous injection of the dye. On all sections, the Evans Blue stained area completely overlapped with the red tumor mass, indicating a uniform permeability of the tumor to dye. Control experiments were performed to address the effect of needle injury alone on Evans Blue leakage. Evans Blue leakage was observed only immediately after the injury. Ten days after injury, the same time given for tumor formation, no dye leakage could be observed. All brains showed dye leakage in circumventricular areas in which the blood- brain barrier is normally permissive for dye infiltration. Sterile needle injury or human astrocyte transplants do not get infected Materials and Methods
To test the hypothesis that tumor targeting of VSV was not a consequence of nonspecific parenchymal brain damage at the injection site, bilateral sterile stab wounds were done using the same (Hamilton point style
2) needle at the same striatal coordinates (w = 4 wounds).
Results
When the same amount of intravenous virus was injected 1O d after this needle injury, no viral GFP was detected within the brain. In parallel, the question of whether the virus targets human cells, or transplanted cells in general, rather than tumor cells specifically, was addressed. When human (n - 4 injections) or mouse (« = 4 injections) normal astrocytes were transplanted into the same coordinates used for tumor cells, no viral GFP expression was detected in the brain 72 h after intravenous virus injection. Is replication essential for infection Materials and Methods
These data demonstrate that VSVrp30a does not enter the brain because of the injury of cell transplantation, nor does it target normal human or mouse cells transplanted into the brain. Infection of glioma xenografts appears specific for replication-competent VSV. To test whether replication was essential for effective tumor targeting, a recombinant replication deficient VSV (VSV-ΔG-GFP) was tested for its capacity to infect intracranial xenografts. This virus can infect cells but, because of the deletion of the VSV-G gene, cannot produce infectious progeny, resulting in only a single cycle of infection. Results
Intravenous injection of 107 PFUs of VSV-ΔG-GFP to animals with bilateral striatal tumors (n - 2) did not result in tumor infection, As a positive control, GFP-expressing scattered cells were detected in the liver after intravenous injection of VSV-ΔG-GFP. To exclude the possibility that targeting of intracranial tumor xenografts by VSV was not the result of nonspecific viral entry, two other viruses that were previously shown to infect or Iy se glioma cells in vitro was used. Intravenous injection of a replication-incompetent adenoassociated virus type 2 (AAV-GFP; n = 2; 3 DPI) or a replication-competent pseudorabies virus (PRV-GFP; n - 2; 2 DPI) did not result in infection of intracranial rU87 xenografts. All three of these viruses were shown previously to infect tumor cells in vitro, and this was reconfirmed in vitro for the stocks used in this study. Example 16: VSV binding to the plasma membrane and virus internalization is greater in glioma than in normal astrocytes Materials and Methods
Virus binding and entry experiments.
Binding, entry, and uncoating of VSVrp30a were compared in rU87 glioma cells and normal human astrocytes using quantitative RT-PCR. To assess membrane-bound fraction, cells were incubated at 4°C with VSVrp30a for 20 min and washed five times before RNA extraction. To quantify intracellular virus, cells were trypsimzed for 10 min and washed five times in PBS. VSV was pooled in the endosomal compartment by incubating for 90 min in the presence of 5 niM ammonium chloride (Sigma). Ammonium chloride blocks acidification of the endosome and therefore blocks viral uncoating into the cytoplasm. These experiments were done in triplicate using an MOI of 10.
Real-Time PCR for viral GFP
RNA was extracted from cell lysates using RNeasy kit (Qiagen, Valencia, CA), and 1 μg of total RNA was reverse transcribed by random hexamer priming using the Super Script III reverse transcriptase kit
(ϊnvitrogen). This was followed by quantitative PCR using TaqMan gene expression assays (Applied Biosystems, Foster City, CA) for GFP and human glyceraldehyde-3 -phosphate dehydrogenase (GAPDH). Primer sequences for GFP were as follows: sense, 5' - GAG CGC ACC ATC TTC TTC AAG - 3' (SEQ ID NO: 40); antisense, 5' - TGT CGC CCT CGA ACT TCA G - 3' (SEQ ID NO: 41). Results
These data show that VSV selectively targets glioma in the brain, suggesting that some mechanism underlies the relative selectivity of the virus to the tumor. A correlation exists between VSV infection and various defects in the interferon system in tumor cells (Stojdl et al., Nat Med, 6:821-825 (2000); Balachandran et al, J Virol, 75:3474-3479 (2001)). A series of five different brain tumor cell lines and normal human control astrocytes was compared previously, and demonstrated an interferon-dependent selectivity of VSV for glial tumor cells over their nontumor counterpart (Wollmann et al., J Virol, 81:1479-1491 (2007)). However, antiviral defense may not exclusively account for the selectivity, and several additional mechanisms have been proposed (Wagner and Rose, Philadelphia Raven Press, (1996); Balachandran and Barber, Cancer Cell, 5:51-65 (2004); Barber, Oncogene, 24:7710-7719 (2005); Lyles and Rupprecht, Lippinscott Williams and Wilkins, 1363-1408 (2007). No specific receptor has been identified for VSV; after binding, the virion undergoes clathrin-mediated endocytosis, and, after acidification in the endosome, the uncoated virus enters the cytoplasm.
To test the hypothesis that VSVrp30a binds and enters tumor cells with a higher efficiency, viral binding and entry in rU87 glioma cells was compared to primary normal adult human astrocytes in vitro using quantitative PCR (Figure 12). Viral quantity was normalized against cellular GAPDH. In separate quantitative PCR experiments, it was confirmed that GAPDH was expressed at comparable quantities in normal astrocytes and glioma cells. To test for the quantity of VSV that binds to cell surface, cells were incubated with virus at 4°C. After 20 min of incubation, the cells were washed five times with buffered medium before RNA extraction. Compared with human astrocytes, the quantity of cell-bound VSVrp30a at 20 min after infection appeared to be slightly (1.8 times) greater for rU87 glioma cells (statistically significant; p = O.OO59 n = 6, Student's t test) (Figure 12 A). A some what greater viral quantity in rU87 cells was again found when surface-bound plus intracellular VSVrp30a was quantified after a 30 min incubation at an MOI of 10 (p = 0.05s n = 6, Student's t test) (Figure 12 B). It was next determined how efficiently the cells internalized VSV. For this purpose, cells were incubated with VSVrp30a at an MOI of 10 for 30 min and next incubated for another 1 h after changing the medium three times to eliminate unbound virus. At 90 min after infection, cells were washed five times with PBS and trypsimzed, and intracellular VSV was quantified.
Finally, to measure only the endosomal fraction, the same experiment was duplicated in the presence of ammonium chloride, which inhibits viral uncoating from the endosomes. At 90 min after infection, 2.6 times more virus in the endosomes and 3.6 times more virus intracellularly in rU87 cells compared with normal astrocytes (both statistically significant;/? = 0.001, n = 6, and p = 0.003, n = 6, respectively, Student's t test) (Figure 12 C, D). These data suggest that VSV binding to the plasma membrane and virus internalization appear to be greater in glioma than in normal astrocytes. These factors may contribute to the greater level of VSV infection found in glioma.
Example 17: VSV-rp30 targets colon cancer in mouse Materials and Methods Mouse procedures
Animal experiments were performed in accordance with institutional guidelines of the Yale University Animal Care and Use Committee. Immunodeficient NCr-Nude mice (NCr-Foxnlnu) were obtained from Taconic Farms (Germantown, NY). Six to eight-week-old mice were briefly anesthetized by i.p. injection using a combination of ketamine and xylazine (100 and 10 mg/kg, respectively) and injected in both flanks with 500,000 HCTl 16 cells suspended in 0.1 ml sterile saline. Sizeable subcutaneous tumors formed within 3 weeks. Tumor bearing mice received a single tail vein injection of 0.1 ml of virus solution containing 5x106 pfu VSV-rp3O. Body weight and mouse health were monitored daily. Three days post VSV inoculation mice were sacrificed by an overdose of pentobarbital and perfused transcardially with physiological saline for 1 minute followed by freshly prepared 4% paraformaldehyde solution. Subcutaneous tumor masses and control tissues (liver, spleen, and lung) were excised, stored in 4% paraformaldehyde solution, and cut in 20-μm sections using a microtome. Cryosections were mounted using 4t,6-diamidino-2-phenylindole (DAPI (Invitrogen) and analyzed on a fluorescence microscope (Olympus Optical IXTl; Tokyo, Japan) coupled to a SPOT color camera (Diagnostic Instruments, Sterling Heights, MI). Results
It has been shown that VSV-rp30 is oncolytic in vivo using U-87 brain tumor xenograft mouse models employing two different virus application strategies, direct intratumoral injection (34) as well as systemic injection (20). To test the ability of VSV-rp30 to infect non-brain tumor cells in vivo, a HCTl 16 human colon carcinoma xenograft model was used. Four immunocompromised NCr nude mice bearing bilateral subcutaneous human HCTl 16 tumors received a single bolus of 100 μl of saline containing 5xlO6 pfu VSV-rp30 via tail vein injection. Mouse body weight showed a transient decrease after VSV injection, but recovered to pre-application values at 2 dpi. Tumors were harvested 3 days post inoculation and microscopic analysis revealed wide spread virus dissemination throughout the tumor masses. Importantly, viral GFP expression was restricted to the tumor mass and did not extend into the surrounding subcutaneous tissue. High magnification revealed the characteristic plasma membrane fluorescence of the GFP signal based on the unique viral G-GFP-fusion protein. During the viral replication cycle, viral G-protein incorporates into the cellular membrane. In contrast, analysis of control tissue from liver, spleen, and lung showed no GFP signal, thus indicating a lack of infection by VSV-rρ30. In addition, no GFP signal was detected in tumors from mice (n = 2) that did not receive virus injection. Together, these data indicate that VSV-rp30 can be applied systemically and target and infect tumor xenografts remote from the injection site with a striking preference for tumor tissue over normal control tissue.
As a proof of principle test that the in vitro data suggesting VSV-rp30 is oncolytic to many types of cancer may generalize to the whole animal, human colon cancer tumor cells were transplanted into mice. Intravenous injections of VSV-rp30 resulted in selective infection and cell death of the tumor, with relatively little detectable infection of normal cells. The in vivo experiment suggests that the tissue culture experiments may generalize to in vivo situations.
Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs.

Claims

We claim:
1. An isolated oncolytic VSV virus comprising one or more changes in nucleic acid sequence resulting in substitution of the serine at codon 126 SEQ ID NO. 3, with an amino acid selected from the group consisting of alanine (A), arginine (R)5 asparagine (N)5 aspartic acid (D), cysteine (C), gϊutamme (Q), glutamic acid (E), glycine (G), histidine (H), isoleucine (I), leucine (L), lysine (K), methionine (M), phenylalanine (F), proline (P), tryptophan (W), or valine (V) and substitution of aspartic acid (D) at codon 223 of SEQ ID NO. 5 with an amino acid selected from the group consisting of serine (S), threonine (T), or tyrosine (Y).
2. The isolated oncolytic VSV virus of claim 1, wherein the serine (S) at codon 126 SEQ ID NO. 3, is substituted with leucine (L) and the aspartic acid (D) at codon 223 of SEQ ID NO. 5 is substituted with a tyrosine (Y).
3. An isolated oncolytic VSV virus with SEQ ID NO: 6.
4. An isolated oncolytic vesicular stomatitis virus (VSV) virus, comprising one or more mutations in the nucleic acid sequence encoding SEQ ID NO: 2 or SEQ ID NO: 4 that alter the post translational phosphorylation of the protein encoded by SEQ ID NO: 3 or SEQ ID: 5, or a combination thereof, in the presence of a kinase capable of phosphorylating amino acids in SEQ ID NO: 3 or SEQ ID: 5.
5. The isolated oncolytic VSV virus of claim 4, wherein the one or more changes in nucleic acid sequence increase the post translational phosphorylation of the protein encoded by SEQ ID NO: 3 or SEQ ID: 5, or a combination thereof.
6. The isolated oncolytic VSV virus of claim 4, wherein the one or more changes in nucleic acid sequence decrease the post translational phosphorylation of the protein encoded by SEQ ID NO: 3 or SEQ ID: 5, or a combination thereof.
7. The isolated oncolytic VSV virus of claim 4, wherein the one or more changes in nucleic acid sequence increase the post translational phosphorylation of the protein encoded by SEQ ID NO: 3 and decrease the post translational phosphorylation of the protein encoded by SEQ ID: 5.
8. The isolated oncolytic VSV virus of claim 4, wherein the one or more changes in nucleic acid sequence decrease the post translational phosphorylation of the protein encoded by SEQ ID NO: 3 and increase the post translational phosphorylation of the protein encoded by SEQ ID: 5.
9. An isolated oncolytic VSV virus, wherein the virus is engineered to express one or more additional genes encoding proteins selected from the group consisting of targeting proteins and therapeutic proteins.
10. An isolated oncolytic VSV virus, wherein one or more viral genes are rearranged, deleted, or inserted to alter the oncolytic potential of the virus.
11. The isolated oncolytic VSV virus of claim 10, wherein a gene not encoded by SEQ ID NO. 2 or SEQ ID NO. 4, is substituted for a variant gene that alters the oncolytic potential of the virus.
12. A sterile pharmaceutical dosage unit composition comprising an effective amount of an oncolytic virus to reduce tumor burden,
13. The dosage unit of claim 12, in an amount of virus effective to systemically treat an individual having metastastic cancer.
14. The dosage unit of claim 12, comprising an amount of virus effective to locally or regionally treat a tumor.
15. A method for treating cancer comprising administering to a subject in need thereof an effective amount of the viral dosage unit of any of claims 12-14.
16. The method of claim 15, wherein the cancer is selected from the group consisting of bone, bladder, brain, breast, cervical, colo-rectal, esophageal, kidney, liver, lung, nasopharangeal, pancreatic, prostate, skin, stomach, and uterine.
17. The method of claim 15, wherein the cancer is a vascular cancer such as multiple myeloma, an adenocarcinomas or a sarcoma.
18. The method of claim 16, comprising administering a viral dosage unit effective to treat a glioma.
19. The method of any of claims 15-18, wherein the viral dosage unit is administered intratumorally or parenterally.
20. The method of claims 15-19, wherein the viral dosage unit is administered in combination with a second therapeutic agent selected from the group consisting of immunosuppressants, anticancer agents, and therapeutic proteins.
PCT/US2010/020370 2009-01-08 2010-01-07 Compositions and methods of use of an oncolytic vesicular stomatitis virus Ceased WO2010080909A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
PCT/US2010/055480 WO2011056993A1 (en) 2009-11-04 2010-11-04 Compositions and methods for treating cancer with attenuated oncolytic viruses
US13/464,692 US20120315248A1 (en) 2009-11-04 2012-05-04 Compositions and methods for treating cancer with attenuated oncolytic viruses

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US14323609P 2009-01-08 2009-01-08
US61/143,236 2009-01-08

Related Child Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/048472 Continuation-In-Part WO2011032003A1 (en) 2009-09-10 2010-09-10 Immunization to reduce neurotoxicity during treatment with cytolytic viruses

Publications (2)

Publication Number Publication Date
WO2010080909A1 true WO2010080909A1 (en) 2010-07-15
WO2010080909A9 WO2010080909A9 (en) 2011-03-31

Family

ID=42106091

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/020370 Ceased WO2010080909A1 (en) 2009-01-08 2010-01-07 Compositions and methods of use of an oncolytic vesicular stomatitis virus

Country Status (2)

Country Link
US (1) US8481297B2 (en)
WO (1) WO2010080909A1 (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011032003A1 (en) 2009-09-10 2011-03-17 Yale University Immunization to reduce neurotoxicity during treatment with cytolytic viruses
WO2011056993A1 (en) 2009-11-04 2011-05-12 Yale University Compositions and methods for treating cancer with attenuated oncolytic viruses
US8481297B2 (en) 2009-01-08 2013-07-09 Yale University Compositions and methods of use of an oncolytic vesicular stomatitis virus
WO2015077714A1 (en) 2013-11-22 2015-05-28 Yale University Chimeric vsv virus compositions and methods of use thereof for treatment of cancer
WO2020018705A1 (en) 2018-07-17 2020-01-23 Yale University Methods for treatment of cancer using chikungunya-vsv chimeric virus
CN110819657A (en) * 2018-08-10 2020-02-21 苏州奥特铭医药科技有限公司 A kind of preparation method and application of attenuated baculovirus

Families Citing this family (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9289456B2 (en) 2010-11-22 2016-03-22 Nova Southeastern University Modulating oncolytic vesicular stomatitis virus (VSV) with statins for cancer treatment
WO2013052915A2 (en) 2011-10-05 2013-04-11 Genelux Corporation Method for detecting replication or colonization of a biological therapeutic
US20140087362A1 (en) 2012-03-16 2014-03-27 Aladar A. Szalay Methods for assessing effectiveness and monitoring oncolytic virus treatment
WO2013158265A1 (en) 2012-04-20 2013-10-24 Genelux Corporation Imaging methods for oncolytic virus therapy
US20140140959A1 (en) 2012-10-05 2014-05-22 Aladar A. Szalay Energy Absorbing-Based Diagnostic and Therapeutic Methods Employing Nucleic Acid Molecules Encoding Chromophore-Producing Enzymes
US10238700B2 (en) 2014-01-02 2019-03-26 Genelux Corporation Oncolytic virus adjunct therapy with agents that increase virus infectivity
BR112017007765B1 (en) 2014-10-14 2023-10-03 Halozyme, Inc COMPOSITIONS OF ADENOSINE DEAMINASE-2 (ADA2), VARIANTS THEREOF AND METHODS OF USING THE SAME
MX2018012472A (en) 2016-04-15 2019-08-12 Alpine Immune Sciences Inc Icos ligand variant immunomodulatory proteins and uses thereof.
WO2017181152A2 (en) 2016-04-15 2017-10-19 Alpine Immune Sciences, Inc. Cd80 variant immunomodulatory proteins and uses thereof
WO2018022946A1 (en) 2016-07-28 2018-02-01 Alpine Immune Sciences, Inc. Cd155 variant immunomodulatory proteins and uses thereof
WO2018022945A1 (en) 2016-07-28 2018-02-01 Alpine Immune Sciences, Inc. Cd112 variant immunomodulatory proteins and uses thereof
US11471488B2 (en) 2016-07-28 2022-10-18 Alpine Immune Sciences, Inc. CD155 variant immunomodulatory proteins and uses thereof
WO2018075978A1 (en) 2016-10-20 2018-04-26 Alpine Immune Sciences, Inc. Secretable variant immunomodulatory proteins and engineered cell therapy
CN110546265A (en) 2017-02-09 2019-12-06 因达普塔治疗公司 Engineered natural killer (NK) cells and compositions and methods thereof
SG11201907769XA (en) 2017-03-16 2019-09-27 Alpine Immune Sciences Inc Cd80 variant immunomodulatory proteins and uses thereof
KR20190141146A (en) 2017-03-16 2019-12-23 알파인 이뮨 사이언시즈, 인코포레이티드 PD-L2 variant immunomodulatory protein and uses thereof
EP3596116B1 (en) 2017-03-16 2023-09-06 Alpine Immune Sciences, Inc. Pd-l1 variant immunomodulatory proteins and uses thereof
BR112020007542A2 (en) 2017-10-18 2020-12-01 Alpine Immune Sciences, Inc. immunomodulatory binding proteins of single variants and related compositions and methods
US11505782B2 (en) 2018-06-04 2022-11-22 Calidi Biotherapeutics, Inc. Cell-based vehicles for potentiation of viral therapy
EA202000353A1 (en) 2018-06-04 2022-01-14 Калиди Биотерапьютикс, Инк. CELL-BASED CARRIERS FOR POTENTIALIZATION OF VIRAL THERAPY
WO2019241758A1 (en) 2018-06-15 2019-12-19 Alpine Immune Sciences, Inc. Pd-1 variant immunomodulatory proteins and uses thereof
US11242528B2 (en) 2018-08-28 2022-02-08 Actym Therapeutics, Inc. Engineered immunostimulatory bacterial strains and uses thereof
CA3116192C (en) 2018-11-06 2025-09-23 Calidi Biotherapeutics (Nevada), Inc. Enhanced systems for cell-mediated oncolytic viral therapy
EP3884041A2 (en) 2018-11-21 2021-09-29 Indapta Therapeutics, Inc. Methods for expansion of natural killer (nk) cell subset and related compositions and methods
CA3120868A1 (en) 2018-11-30 2020-06-04 Alpine Immune Sciences, Inc. Cd86 variant immunomodulatory proteins and uses thereof
US12024709B2 (en) 2019-02-27 2024-07-02 Actym Therapeutics, Inc. Immunostimulatory bacteria engineered to colonize tumors, tumor-resident immune cells, and the tumor microenvironment
JP2022524951A (en) 2019-02-27 2022-05-11 アクティム・セラピューティクス・インコーポレイテッド Tumors, tumor-resident immune cells and immunostimulatory bacteria engineered to colonize the tumor microenvironment
AU2021258194A1 (en) 2020-04-22 2022-11-24 Indapta Therapeutics, Inc. Natural killer (NK) cell compositions and methods for generating same
WO2022033469A1 (en) * 2020-08-14 2022-02-17 上海行深生物科技有限公司 Recombinant oncolytic virus, and construction method therefor and use thereof
WO2022147480A1 (en) 2020-12-30 2022-07-07 Ansun Biopharma, Inc. Oncolytic virus encoding sialidase and multispecific immune cell engager
WO2022239724A1 (en) * 2021-05-10 2022-11-17 Okinawa Institute Of Science And Technology School Corporation A modified rhabdovirus having a reduced toxicity

Citations (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR651814A (en) 1927-03-28 1929-02-28 Demag Ag Variable boom crane, with horizontal displacement of the boom pulley and the load
FR900520A (en) 1943-12-13 1945-07-02 New gauge system
FR900523A (en) 1942-11-11 1945-07-02 Process for preparing protein extracts of animal origin
GB2241703A (en) 1990-03-05 1991-09-11 Korea Inst Sci & Tech Preparation of IGF-1 and plasmids for use therein
US5571711A (en) 1993-06-17 1996-11-05 Ludwig Institute For Cancer Research Isolated nucleic acid molecules coding for BAGE tumor rejection antigen precursors
WO1996040039A2 (en) 1995-06-07 1996-12-19 Ludwig Institute For Cancer Research Isolated nucleic acid molecules, peptides which form complexes with mhc molecule hla-a2 and uses thereof
WO2000050900A2 (en) 1999-02-26 2000-08-31 Pacific Northwest Research Institute Methods and compositions for diagnosing carcinomas
US6673545B2 (en) 2000-07-28 2004-01-06 Incyte Corporation Prostate cancer markers
US6677157B1 (en) 1998-08-28 2004-01-13 Uropath Pty Ltd., A.C.N. Method of diagnosis of prostate cancer
US6699475B1 (en) 1987-09-02 2004-03-02 Therion Biologics Corporation Recombinant pox virus for immunization against tumor-associated antigens
US20040170607A1 (en) * 1999-09-17 2004-09-02 Bell John C. Oncolytic virus
US20070026012A1 (en) 2005-08-01 2007-02-01 Cornell Research Foundation, Inc. Compositions and methods for monitoring and altering protein folding and solubility
US7429481B2 (en) 2004-09-14 2008-09-30 University Of Pittsburgh Targeting viruses using a modified sindbis glycoprotein
US20090047234A1 (en) 2005-10-11 2009-02-19 Elka Touitou Compositions for nasal delivery
US20090252672A1 (en) 2006-05-11 2009-10-08 Eddington Natalie D Nasal delivery of therapeutic agents using tight junction agonists

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7470426B1 (en) * 1997-10-09 2008-12-30 Wellstat Biologics Corporation Treatment of neoplasms with viruses
US6428968B1 (en) * 1999-03-15 2002-08-06 The Trustees Of The University Of Pennsylvania Combined therapy with a chemotherapeutic agent and an oncolytic virus for killing tumor cells in a subject
US7306902B2 (en) * 2002-06-28 2007-12-11 Oncolyties Biotech Inc. Oncolytic viruses as phenotyping agents for neoplasms
CA2412493C (en) * 2000-06-26 2010-11-09 Wellstat Biologics Corporation Purging of cells using viruses
HUP0400882A3 (en) * 2001-05-11 2011-01-28 Wellstat Biologics Corp Oncolytic virus therapy
US6793240B2 (en) * 2002-07-25 2004-09-21 Autoliv Asp, Inc. Expandable section for inflatable curtains
US7731974B2 (en) * 2003-03-27 2010-06-08 Ottawa Hospital Research Institute Mutant vesicular stomatitis viruses and uses thereof
JP2007524363A (en) 2003-03-27 2007-08-30 オタワ ヘルス リサーチ インスティチュート Mutant vesicular stomatitis viruses and their use
KR101255016B1 (en) * 2004-04-09 2013-04-17 와이어쓰 엘엘씨 Synergistic attenuation of vesicular stomatitis virus, vectors thereof and immunogenic compositions thereof
US7778962B2 (en) * 2004-04-30 2010-08-17 Microsoft Corporation Client store synchronization through intermediary store change packets
RU2010124788A (en) * 2007-12-21 2012-01-27 Ваейт ЭлЭлСи (US) GENETICALLY MODIFIED ATTENUATED VESICULAR STOMATITIS VIRUS, COMPOSITIONS AND WAYS OF THEIR APPLICATION
US8481297B2 (en) 2009-01-08 2013-07-09 Yale University Compositions and methods of use of an oncolytic vesicular stomatitis virus
US20120171246A1 (en) 2009-09-10 2012-07-05 Yale University Immunization to reduce neurotoxicity during treatment with cytolytic viruses

Patent Citations (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR651814A (en) 1927-03-28 1929-02-28 Demag Ag Variable boom crane, with horizontal displacement of the boom pulley and the load
FR900523A (en) 1942-11-11 1945-07-02 Process for preparing protein extracts of animal origin
FR900520A (en) 1943-12-13 1945-07-02 New gauge system
US6699475B1 (en) 1987-09-02 2004-03-02 Therion Biologics Corporation Recombinant pox virus for immunization against tumor-associated antigens
GB2241703A (en) 1990-03-05 1991-09-11 Korea Inst Sci & Tech Preparation of IGF-1 and plasmids for use therein
US5571711A (en) 1993-06-17 1996-11-05 Ludwig Institute For Cancer Research Isolated nucleic acid molecules coding for BAGE tumor rejection antigen precursors
US5683886A (en) 1993-06-17 1997-11-04 Ludwig Institute For Cancer Research Tumor rejection antigens which correspond to amino acid sequences in tumor rejection antigen precursor bage, and uses thereof
WO1996040039A2 (en) 1995-06-07 1996-12-19 Ludwig Institute For Cancer Research Isolated nucleic acid molecules, peptides which form complexes with mhc molecule hla-a2 and uses thereof
US6677157B1 (en) 1998-08-28 2004-01-13 Uropath Pty Ltd., A.C.N. Method of diagnosis of prostate cancer
WO2000050900A2 (en) 1999-02-26 2000-08-31 Pacific Northwest Research Institute Methods and compositions for diagnosing carcinomas
US20040170607A1 (en) * 1999-09-17 2004-09-02 Bell John C. Oncolytic virus
US6673545B2 (en) 2000-07-28 2004-01-06 Incyte Corporation Prostate cancer markers
US7429481B2 (en) 2004-09-14 2008-09-30 University Of Pittsburgh Targeting viruses using a modified sindbis glycoprotein
US20070026012A1 (en) 2005-08-01 2007-02-01 Cornell Research Foundation, Inc. Compositions and methods for monitoring and altering protein folding and solubility
US20090047234A1 (en) 2005-10-11 2009-02-19 Elka Touitou Compositions for nasal delivery
US20090252672A1 (en) 2006-05-11 2009-10-08 Eddington Natalie D Nasal delivery of therapeutic agents using tight junction agonists

Non-Patent Citations (112)

* Cited by examiner, † Cited by third party
Title
ADEMA ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 20126
AHMED ET AL., VIROLOGY, vol. 330, 2004, pages 34 - 49
AKIYAMA ET AL., J. BIOL. CHEM., vol. 262, 1987, pages 5592 - 5595
ALFTHAN ET AL., CANCER RES., vol. 52, 1992, pages 4628 - 33
ANDO ET AL., INT. J CANCER, vol. 40, 1987, pages 12 - 17
B. J. AUNGST ET AL., J PHARM. SCI., vol. 89, no. 4, 2000, pages 429 - 442
BALACHANDRAN ET AL., J VIROL, vol. 75, 2001, pages 3474 - 3479
BALACHANDRAN; BARBER, CANCER CELL, vol. 5, 2004, pages 51 - 65
BARBER GLEN N: "Vesicular stomatitis virus as an oncolytic vector.", VIRAL IMMUNOLOGY, vol. 17, no. 4, 2004, pages 516 - 527, XP002579706, ISSN: 0882-8245 *
BARBER, ONCOGENE, vol. 24, 2005, pages 7710 - 7719
BARDELLI ET AL., SCIENCE, vol. 300, 2003, pages 949
BARIK; BANERJEE, PROC. NAT. ACAD SCI. USA, vol. 89, 1992, pages 6570 - 6574
BARNES ET AL., PROC. NAT. ACAD. SCI. USA, vol. 86, 1989, pages 7159
BAST ET AL., N ENG. J MED., vol. 309, 1983, pages 883
BROWN ET AL., J IMMUNOL., vol. 127, 1981, pages 539 - 46
CHANG ET AL., CANCER RES., vol. 52, 1992, pages 181
CHANG ET AL., INT. J CANCER, vol. 50, 1992, pages 373
CHANG ET AL., INT. J. CANCER, vol. 51, 1992, pages 548
CHANG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 136
CHIOCCA, NAT. REV. CANCER, vol. 2, 2002, pages 938 - 950
CHOWDHURY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 669
CLARKE ET AL., J VIRAL., vol. 81, 2007, pages 2056 - 2064
CLARKE ET AL., J VIROL., vol. 81, 2007, pages 2056 - 2064
CLARKE ET AL., J. VIROL., vol. 81, 2007, pages 2056 - 2064
DALTON; ROSE, VIROLOGY, vol. 279, 2001, pages 414 - 421
DALTON; ROSE, VIROLOGY, vol. 279, no. 2, 2001, pages 414 - 21
DAS; PATTNAIK, J. VIROL., vol. 78, 2004, pages 6420 - 6430
DATABASE EMBL [online] 24 December 2008 (2008-12-24), DAVIS J. N.: "Recombinant vesicular stomatitis Indiana virus rVSV-G/GFP, complete genome.", XP002579704, Database accession no. FJ478454 *
DATTA ET AL., J. CLIN. ONCOL., vol. 12, 1994, pages 475 - 82
DE MATTOS ET AL.: "Fields of Virology", 2001, pages: 1245 - 1277
DISIS ET AL., CANC. RES., vol. 54, 1994, pages 16
DRAKE ET AL., FROC. NATL. ACAD. SCI. USA, vol. 96, pages 13910 - 13913
EBERT ET AL., CANCER GENE THER, vol. 12, 2005, pages 350 - 358
FLANAGAN ET AL., J. VIROL., vol. 75, 2001, pages 6107 - 6114
FREEDMAN, J EXP. MED., vol. 121, 1985, pages 439
GEBAUER ET AL., ANTICANCER RES., vol. 17, no. 4B, 1997, pages 2939
GOODMAN; GILMAN: "The Pharmacological Basis of Therapeutics (11th Ed.,", 2005, MCGRAW-HILL PUBLISHING CO.
HIROKAWA ET AL., SURG. TODAY, vol. 28, 1998, pages 349
HOON ET AL., INT. J. CANCER, vol. 43, 1989, pages 857 - 62
J. VIROL., vol. 84, no. 3, 2010
J.VIROLOGY, vol. 84, no. 3, 2010
JAGER ET AL., INT. J. CANCER, vol. 106, 2003, pages 817 - 20
KAHN ET AL., VIROLOGY, vol. 254, 1999, pages 81 - 91
KAWAKAMI ET AL., PROC. NAT. ACAD SCI. USA, vol. 91, 1994, pages 3515
KAWAKAMI ET AL., PROC. NAT. ACAD. SCI. USA, vol. 91, 1994, pages 3515
KENNEDY ET AL., INT. REV. IMMUNOL., vol. 22, 2003, pages 141 - 72
KUDOH ET AL., GYNECOL. OBSTET. INVEST., vol. 47, 1999, pages 52
LAWSON ET AL., PNAS, vol. 92, 1995, pages 4477 - 4481
LEHMANN ET AL., CANCER RES., vol. 47, 1987, pages 841 - 45
LEHMANN ET AL., PROC. NATL. ACAD SCI. USA, vol. 86, 1989, pages 9891 - 95
LENARD, PHARMACOL. THER., vol. 83, 1999, pages 39 - 48
LICHTY ET AL., TRENDS MOL MED, vol. 10, 2004, pages 210 - 216
LLOYD ET AL., INT. J CANC., vol. 71, 1997, pages 842
LUN ET AL., CANCER RES., vol. 67, no. 18, 2007, pages 8818 - 8827
LUN ET AL., J. NAT. CAN. INSTIT., vol. 98, no. 21, 2006, pages 1546 - 1557
LYLES; RUPPRECHT, LIPPINSCOTT WILLIAMS AND WILKINS, 2007, pages 1363 - 1408
MCMANUS ET AL., CANCER RES., vol. 36, 1976, pages 3476 - 81
MEIER ET AL., ANTICANCER RES., vol. 17, no. 4B, 1997, pages 2945
NATALI ET AL., CANCER, vol. 59, 1987, pages 55 - 63
OKUMA ET AL., J. VIROL., vol. 346, no. 1, 2006, pages 86 - 97
OZDUMAN ET AL., J. OFNEUROSCI., vol. 28, no. 8, 2008, pages 1882 - 1893
OZDUMAN ET AL., J. VIRAL., vol. 83, no. 22, 2009, pages 11540 - 11549
PARDRIDGE, NEURON, vol. 36, 2002, pages 555 - 558
PARSONS ET AL., NATURE, vol. 436, 2005, pages 792
PLOWMAN ET AL., NATURE, vol. 366, 1993, pages 473
PUBLICOVER ET AL., J VIRAL., vol. 78, 2004, pages 9317 - 9324
PUBLICOVER ET AL., J. VIROL., vol. 78, 2004, pages 9317 - 9324
PUBLICOVER ET AL., J. VIROL., vol. 80, 2006, pages 7028 - 7036
PULKKANEN; YLA-HERTTUALA, MOL THER, vol. 12, 2005, pages 585 - 598
PUUMALAINEN, ADV EXP MED BIOL, vol. 451, 1998, pages 505 - 509
RAINOV; REN, ACTA NEUROCHIR SUPPL, vol. 88, 2003, pages 113 - 123
RAMSBURG ET AL., J. VIROL., vol. 79, 2005, pages 15043 - 15053
ROBERTS ET AL., J. VIRAL., vol. 73, 1999, pages 3723 - 32
ROBERTS ET AL., J. VIROL., vol. 78, 2004, pages 3196 - 3199
ROSE ET AL., CELL, vol. 106, 2001, pages 539 - 549
ROSE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 1261 - 61
SARANDAKOU ET AL., ACTA ONCOL., vol. 36, 1997, pages 755
SARANDAKOU ET AL., EUR. J GYNAECOL. ONCOL., vol. 19, 1998, pages 73
SCANLAN ET AL., CANCER 1MMUIT., vol. 4, 2004, pages 1
SCANLAN ET AL., CANCER IMMUN., vol. 4, 2004, pages 1
SCHNELL ET AL., EMBO JOURNAL, vol. 17, 1998, pages 1289 - 1296
SCHNELL ET AL., JOURNAL OF VIROLOGY, vol. 70, 1996, pages 2318 - 2323
SCHNELL ET AL., PNAS, vol. 93, 1996, pages 11359 - 11365
SMITH ET AL., PROC NATL ACAD SCI, vol. 97, 2000, pages 9264 - 9269
SPADAFORA ET AL., J. VIROL., vol. 70, no. 7, 1996, pages 4538 - 4548
STOJDL ET AL., CANCER CELL, vol. 4, 2003, pages 263 - 275
STOJDL ET AL., NAT MED, vol. 6, 2000, pages 821 - 825
SUNG CHIH-KWANG ET AL: "Combined VSV oncolytic virus and chemotherapy for squamous cell carcinoma.", THE LARYNGOSCOPE, vol. 118, no. 2, February 2008 (2008-02-01), pages 237 - 242, XP002579707, ISSN: 0023-852X *
TESH ET AL., AM. J EPIDEMIOL., vol. 90, 1969, pages 255 - 261
TOPALIAN ET AL., PROC. NAT. ACAD. SCI. USA, vol. 91, 1994, pages 9461
TROWBRIDGE; OMARY, PROC. NAT. ACAD. USA, vol. 78, 1981, pages 3039
TSUCHIDA ET AL., J NATL. CANCER, vol. 78, 1987, pages 55 - 60
TSUCHIDA ET AL., J. NATL. CANCER, vol. 78, 1987, pages 45 - 54
VAN DEN BRUGGEN ET AL., SCIENCE, vol. 254, 1991, pages 1643
VAN DEN POL ET AL., J VIROL, vol. 76, 2002, pages 1309 - 1327
VAN DEN POL ET AL., J. VIROL, vol. 76, 2002, pages 1309 - 27
VIJAYASARDAHI ET AL., J EXP. MED., vol. 171, 1990, pages 1375 - 80
WAGNER; ROSE: "Philadelphia", 1996, RAVEN PRESS
WANG ET AL., SCIENCE, vol. 304, 2004, pages 1164 - 1166
WEBER ET AL., J CLIN. INVEST, vol. 102, 1998, pages 1258
WOLLMANN ET AL., J VIROL, 2009
WOLLMANN ET AL., J VIROL, vol. 81, 2007, pages 1479 - 1491
WOLLMANN ET AL., J VIROL., vol. 81, no. 3, 2007, pages 1479 - 1491
WOLLMANN ET AL., J. VIROL., 2009
WOLLMANN ET AL., J. VIROL., vol. 79, no. 10, 2005, pages 6005 - 6022
WOLLMANN GUIDO ET AL: "Variable deficiencies in the interferon response enhance susceptibility to vesicular stomatitis virus oncolytic actions in glioblastoma cells but not in normal human glial cells.", JOURNAL OF VIROLOGY, vol. 81, no. 3, February 2007 (2007-02-01), pages 1479 - 1491, XP002579705, ISSN: 0022-538X *
WOLLMANN, J. VIROL., vol. 81, no. 3, 2007, pages 1479 - 1491
WOLLMARM ET AL., J VIROL., vol. 79, no. 1 0, pages 6005 - 6022
WU ET AL., CLIN. CANCER RES., vol. 14, no. 4, 2008, pages 1218 - 1227
YAMAGUCHI ET AL., BR. J CANCER, vol. 60, 1989, pages 382 - 84
YOSHIMURA ET AL., CANCER, vol. 73, 1994, pages 2745 - 52
YOSHINO ET AL., J IMMUNOL., vol. 152, 1994, pages 2393

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8481297B2 (en) 2009-01-08 2013-07-09 Yale University Compositions and methods of use of an oncolytic vesicular stomatitis virus
WO2011032003A1 (en) 2009-09-10 2011-03-17 Yale University Immunization to reduce neurotoxicity during treatment with cytolytic viruses
WO2011056993A1 (en) 2009-11-04 2011-05-12 Yale University Compositions and methods for treating cancer with attenuated oncolytic viruses
WO2015077714A1 (en) 2013-11-22 2015-05-28 Yale University Chimeric vsv virus compositions and methods of use thereof for treatment of cancer
US10179154B2 (en) 2013-11-22 2019-01-15 Yale University Chimeric VSV virus compositions and methods of use thereof for treatment of cancer
US10821143B2 (en) 2013-11-22 2020-11-03 Yale University Chimeric VSV virus compositions and methods of use thereof for treatment of cancer
WO2020018705A1 (en) 2018-07-17 2020-01-23 Yale University Methods for treatment of cancer using chikungunya-vsv chimeric virus
US12274724B2 (en) 2018-07-17 2025-04-15 Yale University Methods for treatment of cancer using chikungunya-VSV chimeric virus
CN110819657A (en) * 2018-08-10 2020-02-21 苏州奥特铭医药科技有限公司 A kind of preparation method and application of attenuated baculovirus
CN110819657B (en) * 2018-08-10 2021-11-19 睿丰康生物医药科技(浙江)有限公司 Preparation method and application of attenuated rhabdovirus

Also Published As

Publication number Publication date
WO2010080909A9 (en) 2011-03-31
US8481297B2 (en) 2013-07-09
US20100172877A1 (en) 2010-07-08

Similar Documents

Publication Publication Date Title
US8481297B2 (en) Compositions and methods of use of an oncolytic vesicular stomatitis virus
Özduman et al. Systemic vesicular stomatitis virus selectively destroys multifocal glioma and metastatic carcinoma in brain
US10821143B2 (en) Chimeric VSV virus compositions and methods of use thereof for treatment of cancer
JP7132339B2 (en) Pseudorabies virus for treating tumors
JP7239910B2 (en) Therapeutic agents and their use for drugs for the treatment of tumors and/or cancers
Hofmann et al. Combination treatment with oncolytic Vaccinia virus and cyclophosphamide results in synergistic antitumor effects in human lung adenocarcinoma bearing mice
JP6205012B2 (en) Vesicular stomatitis virus
Spunde et al. Recombinant viral vectors for therapeutic programming of tumour microenvironment: Advantages and limitations
Apostolidis et al. Host mediated anti-tumor effect of oncolytic Newcastle disease virus after locoregional application
JP2015514420A (en) Replicable vesicular stomatitis virus
Hatami et al. Interleukin-12 encoded by the oncolytic virus VSV-GP enhances therapeutic antitumor efficacy by inducing CD8+ T-cell responses with a long-lived effector cell phenotype
US20120171246A1 (en) Immunization to reduce neurotoxicity during treatment with cytolytic viruses
US12351812B2 (en) Recombinant oncolytic virus
JP2021534786A (en) Chimeric oncolytic herpes virus that stimulates the antitumor immune response
US20120315248A1 (en) Compositions and methods for treating cancer with attenuated oncolytic viruses
JP4423507B2 (en) Cancer gene therapy drug
KR20240022572A (en) TNFSF-L fusion protein and its uses
RU2730657C1 (en) Anti-tumour agent based on recombinant vaccinia virus strain and method for production thereof
WO2016047645A1 (en) Gene-modified measles virus for tumor treatment use
Pushparajah Design of a DNA-Encoded Human Papilloma Virus-Like Particle Displaying a Vascular Endothelial Growth Factor Antagonistic Peptide for Characterization in Mammalian Cells
Rossetto et al. Fire in an Icy Desert: Oncolytic Virotherapy for Pancreatic Adenocarcinoma
WO2025260921A1 (en) Recombinant oncolytic virus and use thereof
HK40104197A (en) Tnfsf-l fusion proteins and uses thereof
Biotech LOW PATHOGENIC HUMAN ENTEROVIRUSES AS NOVEL ANTI-CANCER AGENTS AGAINST MALIGNANT GLIOMA
Li et al. Oncolytic virotherapy

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10703713

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 10703713

Country of ref document: EP

Kind code of ref document: A1