WO2008105899A3 - Système de contrôle de trajectoire à deux axes - Google Patents

Système de contrôle de trajectoire à deux axes Download PDF

Info

Publication number
WO2008105899A3
WO2008105899A3 PCT/US2007/072918 US2007072918W WO2008105899A3 WO 2008105899 A3 WO2008105899 A3 WO 2008105899A3 US 2007072918 W US2007072918 W US 2007072918W WO 2008105899 A3 WO2008105899 A3 WO 2008105899A3
Authority
WO
WIPO (PCT)
Prior art keywords
pair
control mechanism
control
control system
trajectory control
Prior art date
Application number
PCT/US2007/072918
Other languages
English (en)
Other versions
WO2008105899A2 (fr
Inventor
Johnny E Banks
Original Assignee
Lockheed Corp
Johnny E Banks
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Lockheed Corp, Johnny E Banks filed Critical Lockheed Corp
Priority to EP07873817A priority Critical patent/EP2038602A2/fr
Publication of WO2008105899A2 publication Critical patent/WO2008105899A2/fr
Publication of WO2008105899A3 publication Critical patent/WO2008105899A3/fr

Links

Classifications

    • F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
    • F42—AMMUNITION; BLASTING
    • F42B—EXPLOSIVE CHARGES, e.g. FOR BLASTING, FIREWORKS, AMMUNITION
    • F42B15/00—Self-propelled projectiles or missiles, e.g. rockets; Guided missiles
    • F42B15/01—Arrangements thereon for guidance or control
    • F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
    • F42—AMMUNITION; BLASTING
    • F42B—EXPLOSIVE CHARGES, e.g. FOR BLASTING, FIREWORKS, AMMUNITION
    • F42B10/00—Means for influencing, e.g. improving, the aerodynamic properties of projectiles or missiles; Arrangements on projectiles or missiles for stabilising, steering, range-reducing, range-increasing or fall-retarding
    • F42B10/60—Steering arrangements
    • F42B10/62—Steering by movement of flight surfaces
    • F42B10/64—Steering by movement of flight surfaces of fins

Landscapes

  • Engineering & Computer Science (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Aviation & Aerospace Engineering (AREA)
  • Combustion & Propulsion (AREA)
  • Physics & Mathematics (AREA)
  • Fluid Mechanics (AREA)
  • Vehicle Body Suspensions (AREA)
  • Supercharger (AREA)

Abstract

L'invention concerne un système de contrôle de trajectoire comprenant un premier mécanisme de contrôle muni d'une paire de sorties associées de manière opérationnelle à une première paire de surfaces de contrôle ; le premier mécanisme de contrôle est opérationnel pour articuler la première paire de surfaces de contrôle à l'unisson ; un second mécanisme de contrôle est muni d'une paire de sorties associées de manière opérationnelle à une seconde paire de surfaces de contrôle et est opérationnel pour articuler la seconde paire de surfaces de contrôle à l'unisson. Le second mécanisme de contrôle est emboîté dans le premier mécanisme de contrôle, de sorte que la paire de sorties du premier mécanisme de contrôle est sensiblement coplanaire avec la paire de sorties du second mécanisme de contrôle.
PCT/US2007/072918 2006-07-07 2007-07-06 Système de contrôle de trajectoire à deux axes WO2008105899A2 (fr)

Priority Applications (1)

Application Number Priority Date Filing Date Title
EP07873817A EP2038602A2 (fr) 2006-07-07 2007-07-06 Système de contrôle de trajectoire à deux axes

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US11/482,338 2006-07-07
US11/482,338 US20080006736A1 (en) 2006-07-07 2006-07-07 Two-axis trajectory control system

Publications (2)

Publication Number Publication Date
WO2008105899A2 WO2008105899A2 (fr) 2008-09-04
WO2008105899A3 true WO2008105899A3 (fr) 2008-12-11

Family

ID=38918300

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2007/072918 WO2008105899A2 (fr) 2006-07-07 2007-07-06 Système de contrôle de trajectoire à deux axes

Country Status (3)

Country Link
US (1) US20080006736A1 (fr)
EP (1) EP2038602A2 (fr)
WO (1) WO2008105899A2 (fr)

Families Citing this family (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7800032B1 (en) * 2006-11-30 2010-09-21 Raytheon Company Detachable aerodynamic missile stabilizing system
US7755012B2 (en) * 2007-01-10 2010-07-13 Hr Textron, Inc. Eccentric drive control actuation system
US8319164B2 (en) * 2009-10-26 2012-11-27 Nostromo, Llc Rolling projectile with extending and retracting canards
US8680036B2 (en) * 2009-12-22 2014-03-25 The Procter & Gamble Company Liquid cleaning composition comprising color-stable polyurethane abrasive particles
ES2709655T3 (es) * 2011-05-13 2019-04-17 Leigh Aerosystems Corp Sistema de guiado de proyectil terrestre
FR3002319B1 (fr) 2013-02-18 2015-02-27 Nexter Munitions Projectile a gouvernes orientables et procede de commande des gouvernes d'un tel projectile
EP2963290A1 (fr) 2014-07-03 2016-01-06 NEM Energy B.V. Centrale solaire à tour
US9702673B1 (en) * 2014-09-24 2017-07-11 The United States Of America As Represented By The Secretary Of The Army Projectile tail boom with self-locking fin
US9410779B1 (en) * 2014-09-25 2016-08-09 The United States Of America As Represented By The Secretary Of The Army Breakaway fin ring for projectile
EP3341677A4 (fr) 2015-08-24 2019-04-24 Leigh Aerosystems Corporation Système de guidage de projectile au sol
US10280786B2 (en) 2015-10-08 2019-05-07 Leigh Aerosystems Corporation Ground-projectile system
FR3078152B1 (fr) * 2018-02-22 2021-11-05 Nexter Munitions Projectile a gouvernes orientables
US11543220B2 (en) * 2020-06-01 2023-01-03 Raytheon Company Small body dynamics control method
US11555678B2 (en) 2020-06-01 2023-01-17 Raytheon Company Small body dynamics control method
US11781844B2 (en) * 2021-08-03 2023-10-10 Raytheon Company Missile component attachment assembly

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2846080A (en) * 1955-04-12 1958-08-05 Paul E Freeman Knockdown display panel
US5593109A (en) * 1995-01-10 1997-01-14 Lucas Western, Inc. Actuator system and method
FR2846080A1 (fr) * 2002-10-17 2004-04-23 Giat Ind Sa Dispositif de deploiement et d'entrainement de gouvernes de projectile
US6726147B1 (en) * 2003-05-15 2004-04-27 Moog Inc. Multi-function actuator, and method of operating same

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2417434A (en) * 1945-02-13 1947-03-18 Bell Telephone Labor Inc Mechanical stop device
US2714821A (en) * 1954-06-04 1955-08-09 Orner Harry Deflector pin construction for ballbearing screw and nut mechanism
US3272124A (en) * 1960-11-28 1966-09-13 Pneumo Dynamics Corp Solid propellant actuation system
DE4019482A1 (de) * 1990-06-19 1992-01-09 Diehl Gmbh & Co Ruderstelleinrichtung
US6446906B1 (en) * 2000-04-06 2002-09-10 Versatron, Inc. Fin and cover release system
US6360987B1 (en) * 2000-05-23 2002-03-26 Bae Systems Integrated Defense Solutions Methods and apparatus for swash plate guidance and control

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2846080A (en) * 1955-04-12 1958-08-05 Paul E Freeman Knockdown display panel
US5593109A (en) * 1995-01-10 1997-01-14 Lucas Western, Inc. Actuator system and method
FR2846080A1 (fr) * 2002-10-17 2004-04-23 Giat Ind Sa Dispositif de deploiement et d'entrainement de gouvernes de projectile
US6726147B1 (en) * 2003-05-15 2004-04-27 Moog Inc. Multi-function actuator, and method of operating same

Also Published As

Publication number Publication date
EP2038602A2 (fr) 2009-03-25
US20080006736A1 (en) 2008-01-10
WO2008105899A2 (fr) 2008-09-04

Similar Documents

Publication Publication Date Title
WO2008105899A3 (fr) Système de contrôle de trajectoire à deux axes
WO2006104989A3 (fr) Anticorps a regions fc modifiees et utilisations
WO2008102128A3 (fr) Combinaisons pharmaceutiques
WO2008031023A3 (fr) Exosquelette haptique
WO2008121616A3 (fr) Anticorps présentant des profils de désamidation réduits
AU2007313300A8 (en) Molecules with reduced half-lives, compositions and uses thereof
WO2009083385A3 (fr) Dispositif de refroidissement
WO2008073446A3 (fr) Procédés et systèmes relatifs à la transmission d'informations associées à des nutraceutiques
WO2007148300A3 (fr) Méthodes et systèmes de stockage de contenus obtenus par la technologie 'pousser'
WO2011074834A3 (fr) Module de construction présentant un angle réglable de façon régulière et graduelle
WO2007044616A3 (fr) Anticorps anti-cd30 optimises
WO2007050569A3 (fr) Films de polypeptide multicouches et procedes
WO2007117708A3 (fr) figurINE adaptée pour transférer un objet
WO2008021638A3 (fr) Flux de données rs-232 par une liaison différentielle semi duplex
WO2010022027A3 (fr) Joint d’héliostat
WO2007136267A3 (fr) Ensemble d'ustensiles de table en plastique pour boire et/ou manger
WO2007112279A3 (fr) Résonateurs
WO2009044889A1 (fr) Cible d'oxyde d'indium
WO2007016791A8 (fr) Réduire la formation d’adhérences post-opératoires par le biais de glutamine intrapéritonéale
EP1820987A3 (fr) Ecluse à roue cellulaire dotée d'un accouplement enfichable à couple moteur
EP1696176B8 (fr) Lance oxy-combustible à haute vitesse et construction de brûleur
WO2008039678A3 (fr) Clavier de technologie accessible
WO2008033213A3 (fr) Commutateur mécanique à bicouche courbe
WO2008064903A3 (fr) Anticorps contre les épitopes grwirtqqhyyerdpkriyylslefymgrtlqntm ou ifnqkivngwqveeaddwlrygnpwekarp ou glgdvaevrksfnrhlhftlvkdrnvatprdyffa ou dsmatlglaaygygiryefg
WO2007039070A3 (fr) Polynucleotides de haemophilus parasuis et leur utilisation

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 07873817

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2007873817

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: RU