WO2008105899A3 - Système de contrôle de trajectoire à deux axes - Google Patents
Système de contrôle de trajectoire à deux axes Download PDFInfo
- Publication number
- WO2008105899A3 WO2008105899A3 PCT/US2007/072918 US2007072918W WO2008105899A3 WO 2008105899 A3 WO2008105899 A3 WO 2008105899A3 US 2007072918 W US2007072918 W US 2007072918W WO 2008105899 A3 WO2008105899 A3 WO 2008105899A3
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- pair
- control mechanism
- control
- control system
- trajectory control
- Prior art date
Links
Classifications
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F42—AMMUNITION; BLASTING
- F42B—EXPLOSIVE CHARGES, e.g. FOR BLASTING, FIREWORKS, AMMUNITION
- F42B15/00—Self-propelled projectiles or missiles, e.g. rockets; Guided missiles
- F42B15/01—Arrangements thereon for guidance or control
-
- F—MECHANICAL ENGINEERING; LIGHTING; HEATING; WEAPONS; BLASTING
- F42—AMMUNITION; BLASTING
- F42B—EXPLOSIVE CHARGES, e.g. FOR BLASTING, FIREWORKS, AMMUNITION
- F42B10/00—Means for influencing, e.g. improving, the aerodynamic properties of projectiles or missiles; Arrangements on projectiles or missiles for stabilising, steering, range-reducing, range-increasing or fall-retarding
- F42B10/60—Steering arrangements
- F42B10/62—Steering by movement of flight surfaces
- F42B10/64—Steering by movement of flight surfaces of fins
Landscapes
- Engineering & Computer Science (AREA)
- General Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Aviation & Aerospace Engineering (AREA)
- Combustion & Propulsion (AREA)
- Physics & Mathematics (AREA)
- Fluid Mechanics (AREA)
- Vehicle Body Suspensions (AREA)
- Supercharger (AREA)
Abstract
L'invention concerne un système de contrôle de trajectoire comprenant un premier mécanisme de contrôle muni d'une paire de sorties associées de manière opérationnelle à une première paire de surfaces de contrôle ; le premier mécanisme de contrôle est opérationnel pour articuler la première paire de surfaces de contrôle à l'unisson ; un second mécanisme de contrôle est muni d'une paire de sorties associées de manière opérationnelle à une seconde paire de surfaces de contrôle et est opérationnel pour articuler la seconde paire de surfaces de contrôle à l'unisson. Le second mécanisme de contrôle est emboîté dans le premier mécanisme de contrôle, de sorte que la paire de sorties du premier mécanisme de contrôle est sensiblement coplanaire avec la paire de sorties du second mécanisme de contrôle.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP07873817A EP2038602A2 (fr) | 2006-07-07 | 2007-07-06 | Système de contrôle de trajectoire à deux axes |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11/482,338 | 2006-07-07 | ||
US11/482,338 US20080006736A1 (en) | 2006-07-07 | 2006-07-07 | Two-axis trajectory control system |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2008105899A2 WO2008105899A2 (fr) | 2008-09-04 |
WO2008105899A3 true WO2008105899A3 (fr) | 2008-12-11 |
Family
ID=38918300
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2007/072918 WO2008105899A2 (fr) | 2006-07-07 | 2007-07-06 | Système de contrôle de trajectoire à deux axes |
Country Status (3)
Country | Link |
---|---|
US (1) | US20080006736A1 (fr) |
EP (1) | EP2038602A2 (fr) |
WO (1) | WO2008105899A2 (fr) |
Families Citing this family (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7800032B1 (en) * | 2006-11-30 | 2010-09-21 | Raytheon Company | Detachable aerodynamic missile stabilizing system |
US7755012B2 (en) * | 2007-01-10 | 2010-07-13 | Hr Textron, Inc. | Eccentric drive control actuation system |
US8319164B2 (en) * | 2009-10-26 | 2012-11-27 | Nostromo, Llc | Rolling projectile with extending and retracting canards |
WO2011087748A1 (fr) * | 2009-12-22 | 2011-07-21 | The Procter & Gamble Company | Composition liquide de nettoyage et/ou de purification |
ES2709655T3 (es) | 2011-05-13 | 2019-04-17 | Leigh Aerosystems Corp | Sistema de guiado de proyectil terrestre |
FR3002319B1 (fr) * | 2013-02-18 | 2015-02-27 | Nexter Munitions | Projectile a gouvernes orientables et procede de commande des gouvernes d'un tel projectile |
EP2963290A1 (fr) | 2014-07-03 | 2016-01-06 | NEM Energy B.V. | Centrale solaire à tour |
US9702673B1 (en) * | 2014-09-24 | 2017-07-11 | The United States Of America As Represented By The Secretary Of The Army | Projectile tail boom with self-locking fin |
US9410779B1 (en) * | 2014-09-25 | 2016-08-09 | The United States Of America As Represented By The Secretary Of The Army | Breakaway fin ring for projectile |
EP3341677A4 (fr) | 2015-08-24 | 2019-04-24 | Leigh Aerosystems Corporation | Système de guidage de projectile au sol |
US10280786B2 (en) | 2015-10-08 | 2019-05-07 | Leigh Aerosystems Corporation | Ground-projectile system |
FR3078152B1 (fr) * | 2018-02-22 | 2021-11-05 | Nexter Munitions | Projectile a gouvernes orientables |
US11543220B2 (en) * | 2020-06-01 | 2023-01-03 | Raytheon Company | Small body dynamics control method |
US11555678B2 (en) | 2020-06-01 | 2023-01-17 | Raytheon Company | Small body dynamics control method |
US11781844B2 (en) * | 2021-08-03 | 2023-10-10 | Raytheon Company | Missile component attachment assembly |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US2846080A (en) * | 1955-04-12 | 1958-08-05 | Paul E Freeman | Knockdown display panel |
US5593109A (en) * | 1995-01-10 | 1997-01-14 | Lucas Western, Inc. | Actuator system and method |
FR2846080A1 (fr) * | 2002-10-17 | 2004-04-23 | Giat Ind Sa | Dispositif de deploiement et d'entrainement de gouvernes de projectile |
US6726147B1 (en) * | 2003-05-15 | 2004-04-27 | Moog Inc. | Multi-function actuator, and method of operating same |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US2417434A (en) * | 1945-02-13 | 1947-03-18 | Bell Telephone Labor Inc | Mechanical stop device |
US2714821A (en) * | 1954-06-04 | 1955-08-09 | Orner Harry | Deflector pin construction for ballbearing screw and nut mechanism |
US3272124A (en) * | 1960-11-28 | 1966-09-13 | Pneumo Dynamics Corp | Solid propellant actuation system |
DE4019482A1 (de) * | 1990-06-19 | 1992-01-09 | Diehl Gmbh & Co | Ruderstelleinrichtung |
US6446906B1 (en) * | 2000-04-06 | 2002-09-10 | Versatron, Inc. | Fin and cover release system |
US6360987B1 (en) * | 2000-05-23 | 2002-03-26 | Bae Systems Integrated Defense Solutions | Methods and apparatus for swash plate guidance and control |
-
2006
- 2006-07-07 US US11/482,338 patent/US20080006736A1/en not_active Abandoned
-
2007
- 2007-07-06 WO PCT/US2007/072918 patent/WO2008105899A2/fr active Application Filing
- 2007-07-06 EP EP07873817A patent/EP2038602A2/fr not_active Withdrawn
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US2846080A (en) * | 1955-04-12 | 1958-08-05 | Paul E Freeman | Knockdown display panel |
US5593109A (en) * | 1995-01-10 | 1997-01-14 | Lucas Western, Inc. | Actuator system and method |
FR2846080A1 (fr) * | 2002-10-17 | 2004-04-23 | Giat Ind Sa | Dispositif de deploiement et d'entrainement de gouvernes de projectile |
US6726147B1 (en) * | 2003-05-15 | 2004-04-27 | Moog Inc. | Multi-function actuator, and method of operating same |
Also Published As
Publication number | Publication date |
---|---|
US20080006736A1 (en) | 2008-01-10 |
WO2008105899A2 (fr) | 2008-09-04 |
EP2038602A2 (fr) | 2009-03-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2008105899A3 (fr) | Système de contrôle de trajectoire à deux axes | |
WO2008102128A3 (fr) | Combinaisons pharmaceutiques | |
WO2008031023A3 (fr) | Exosquelette haptique | |
WO2009083385A3 (fr) | Dispositif de refroidissement | |
WO2007148300A3 (fr) | Méthodes et systèmes de stockage de contenus obtenus par la technologie 'pousser' | |
WO2011074834A3 (fr) | Module de construction présentant un angle réglable de façon régulière et graduelle | |
WO2007044616A3 (fr) | Anticorps anti-cd30 optimises | |
AU2007313300A8 (en) | Molecules with reduced half-lives, compositions and uses thereof | |
WO2007050569A3 (fr) | Films de polypeptide multicouches et procedes | |
WO2006047350A3 (fr) | Variants d'immunoglobuline igg a fonction effectrice optimisee | |
WO2007117708A3 (fr) | figurINE adaptée pour transférer un objet | |
WO2009147062A3 (fr) | Système de détection destiné à détecter un rapprochement | |
WO2008021638A3 (fr) | Flux de données rs-232 par une liaison différentielle semi duplex | |
WO2010022027A3 (fr) | Joint d’héliostat | |
WO2010042284A3 (fr) | Systèmes de commande microfluidique | |
WO2007136267A3 (fr) | Ensemble d'ustensiles de table en plastique pour boire et/ou manger | |
WO2007112279A3 (fr) | Résonateurs | |
WO2009044889A1 (fr) | Cible d'oxyde d'indium | |
WO2008039678A3 (fr) | Clavier de technologie accessible | |
WO2007016791A8 (fr) | Réduire la formation d’adhérences post-opératoires par le biais de glutamine intrapéritonéale | |
EP1696176B8 (fr) | Lance oxy-combustible à haute vitesse et construction de brûleur | |
EP1820987A3 (fr) | Ecluse à roue cellulaire dotée d'un accouplement enfichable à couple moteur | |
WO2012072076A3 (fr) | Soupape de détente à degré d'ouverture variable | |
WO2008033213A3 (fr) | Commutateur mécanique à bicouche courbe | |
WO2008064903A3 (fr) | Anticorps contre les épitopes grwirtqqhyyerdpkriyylslefymgrtlqntm ou ifnqkivngwqveeaddwlrygnpwekarp ou glgdvaevrksfnrhlhftlvkdrnvatprdyffa ou dsmatlglaaygygiryefg |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 07873817 Country of ref document: EP Kind code of ref document: A2 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2007873817 Country of ref document: EP |
|
NENP | Non-entry into the national phase |
Ref country code: RU |