WO2008104580A1 - New use of glutaminyl cyclase inhibitors - Google Patents

New use of glutaminyl cyclase inhibitors Download PDF

Info

Publication number
WO2008104580A1
WO2008104580A1 PCT/EP2008/052411 EP2008052411W WO2008104580A1 WO 2008104580 A1 WO2008104580 A1 WO 2008104580A1 EP 2008052411 W EP2008052411 W EP 2008052411W WO 2008104580 A1 WO2008104580 A1 WO 2008104580A1
Authority
WO
WIPO (PCT)
Prior art keywords
inhibitor
inhibitors
mcp
compound
formula
Prior art date
Application number
PCT/EP2008/052411
Other languages
French (fr)
Inventor
Stephan Schilling
Holger Cynis
Torsten Hoffmann
Hans-Ulrich Demuth
Original Assignee
Probiodrug Ag
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US11/685,881 external-priority patent/US7732162B2/en
Priority to AU2008220785A priority Critical patent/AU2008220785B2/en
Priority to EP08717208A priority patent/EP2117540A1/en
Priority to CA2679446A priority patent/CA2679446C/en
Priority to BRPI0808170-0A priority patent/BRPI0808170A2/en
Priority to KR1020147027487A priority patent/KR20140133897A/en
Application filed by Probiodrug Ag filed Critical Probiodrug Ag
Priority to EA200901140A priority patent/EA200901140A1/en
Priority to NZ579310A priority patent/NZ579310A/en
Priority to MX2009009234A priority patent/MX2009009234A/en
Priority to JP2009551208A priority patent/JP5930573B2/en
Publication of WO2008104580A1 publication Critical patent/WO2008104580A1/en
Priority to IL200315A priority patent/IL200315A/en

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/4164—1,3-Diazoles
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/4164—1,3-Diazoles
    • A61K31/4178—1,3-Diazoles not condensed 1,3-diazoles and containing further heterocyclic rings, e.g. pilocarpine, nitrofurantoin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D233/00—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings
    • C07D233/54—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D233/00—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings
    • C07D233/54—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members
    • C07D233/56—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, attached to ring carbon atoms
    • C07D233/61—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, attached to ring carbon atoms with hydrocarbon radicals, substituted by nitrogen atoms not forming part of a nitro radical, attached to ring nitrogen atoms
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D235/00—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, condensed with other rings
    • C07D235/02—Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, condensed with other rings condensed with carbocyclic rings or ring systems
    • C07D235/04—Benzimidazoles; Hydrogenated benzimidazoles
    • C07D235/06—Benzimidazoles; Hydrogenated benzimidazoles with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached in position 2
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D403/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
    • C07D403/06—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07D—HETEROCYCLIC COMPOUNDS
    • C07D417/00—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/12—Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings linked by a chain containing hetero atoms as chain links

Definitions

  • the present invention relates in general to an inhibitor of a glutaminyl peptide cyclotransferase, and the use thereof for the treatment and/or prevention of a disease or disorder selected from the group consisting of rheumatoid arthritis, atherosclerosis, restenosis, lung fibrosis, liver fibrosis, renal fibrosis, pancreatitis, mild cognitive impairment, Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, neuropathic pain, graft rejection/graft failure/graft vasculopathy, hypertension, HIV infections/AIDS, gestosis, cancer/hemangioendothelioma proliferation, tuberous sclerosis, and gastric carcinomas.
  • a disease or disorder selected from the group consisting of rheumatoid arthritis, atherosclerosis, restenosis, lung fibrosis, liver fibrosis, renal fibrosis, pancreatitis, mild cognitive impairment, Alzheimer
  • the present invention pertains to diagnostic kits and methods based on the use of a glutaminyl cyclase inhibitor.
  • Glutaminyl cyclase catalyzes the intramolecular cyclization of N-terminal glutaminyl residues into pyroglutamic acid (5-oxo-proline, pGlu*) under liberation of ammonia and the intramolecular cyclization of N-terminal glutamyl residues into pyroglutamic acid under liberation of water.
  • EP 02 011 349.4 discloses polynucleotides encoding insect glutaminyl cyclase, as well as polypeptides encoded thereby.
  • This application further provides host cells comprising expression vectors comprising polynucleotides of the invention. Isolated polypeptides and host cells comprising insect QC are useful in methods of screening for agents that reduce glutaminyl cyclase activity. Such agents are described as useful as pesticides .
  • Chemotactic cytokines are proteins that attract and activate leukocytes and are thought to play a fundamental role in inflammation. Chemokines are divided into four groups categorized by the appearance of N-terminal cysteine residues
  • Monocyte infiltration is considered to be a key event in a number of disease conditions (Gerard, C. and Rollins, B. J.
  • MCP-1-4 The MCP family, as one family of chemokines, consists of four members (MCP-1-4), displaying a preference for attracting monocytes but showing differences in their potential (Luini, W., et al . , (1994) Cytokine 6, 28-31; Uguccioni, M., et al . , (1995) Eur J Immunol 25, 64-68) .
  • MCP-1-4 cDNA as well as amino acid sequences of MCP-1-4 are indicated:
  • Liver Physiol 288, G1259-G1265) Liver Physiol 288, G1259-G1265) ; Alzheimer's disease (Yamamoto, M., et al . , (2005) Am. J Pathol. 166, 1475-1485); lung fibrosis (Inoshima, I., et al . , (2004) Am. J Physiol Lung Cell MoI. Physiol 286, L1038-L1044) ; renal fibrosis (Wada, T., et al., (2004) J Am. Soc .Nephrol . 15, 940-
  • MCP-I might also play a role in gestosis (Katabuchi, H., et al . ,
  • the mature form of human and rodent MCP-I is posttranslationally modified by Glutaminyl Cyclase (QC) to possess an N-terminal pyroglutamyl (pGlu) residue.
  • QC Glutaminyl Cyclase
  • pGlu N-terminal pyroglutamyl
  • the N-terminal pGlu modification makes the protein resistant against N-terminal degradation by aminopeptidases, which is of importance, since chemotactic potency of MCP-I is mediated by its N-terminus (Van Damme, J., et al., (1999) Chem Immunol 72, 42-56).
  • Artificial elongation or degradation leads to a loss of function although MCP-I still binds to its receptor (CCR2) (Proost, P., et al .
  • Inhibitors of Glutaminyl Cyclase are small orally available compounds, which target the important step of pGlu-formation at the N-terminus of MCP-I (Cynis, H., et al . , (2006) Blochlm.Blophys .Acta 1764, 1618-1625; Buchholz, M., et al . , (2006) J Med Chem 49, 664-677).
  • the N-terminus of MCP- 1 is not protected by a pGlu-residue .
  • the N-terminus possesses a glutamine-proline motif, which is prone to cleavage by dipeptidylpeptidases, e.g. dipeptidylpeptidase 4 and fibroblast activating protein (FAP, Seprase) , which are abundant on the endothelium and within the blood circulation.
  • dipeptidylpeptidases e.g. dipeptidylpeptidase 4 and fibroblast activating protein (FAP, Seprase)
  • FAP fibroblast activating protein
  • Atherosclerotic lesions which limit or obstruct coronary blood flow, are the major cause of ischemic heart disease related mortality, resulting in 500,000 - 600,000 deaths annually.
  • Percutaneous transluminal coronary angioplasty (PTCA) to open the obstructed artery was performed in over 550,000 patients in the U.S. and 945,000+ patients worldwide in 1996 (Lemaitre et al . , 1996) .
  • a major limitation of this technique is the problem of post-PTCA closure of the vessel, both immediately after PTCA
  • acute occlusion and in the long term (restenosis) : 30% of patients with subtotal lesions and 50% of patients with chronic total lesions will progress to restenosis after angioplasty. Additionally, restenosis is a significant problem in patients undergoing saphenous vein bypass graft.
  • the mechanism of acute occlusion appears to involve several factors and may result from vascular recoil with resultant closure of the artery and/or deposition of blood platelets along the damaged length of the newly opened blood vessel followed by formation of a fibrin/red blood cell thrombus.
  • Restenosis after angioplasty is a more gradual process and involves initial formation of a subcritical thrombosis with release from adherent platelets of cell derived growth factors with subsequent proliferation of intimal smooth muscle cells and local infiltration of inflammatory cells contributing to vascular hyperplasia. It is important to note that multiple processes, among those thrombosis, cell proliferation, cell migration and inflammation each seem to contribute to the restenotic process.
  • a 30-50% restenosis rate translates to 120,000 - 200,000 U.S. patients at risk from restenosis. If only 80% of such patients elect repeated angioplasty (with the remaining 20% electing coronary artery bypass graft) and this is added to the costs of coronary artery bypass graft for the remaining 20%, the total costs for restenosis tretment easily amounts to billions of dollars in the U.S.. Thus, successful prevention of restenosis could result not only in significant therapeutic benefit but also in significant health care savings.
  • Monocyte chemoattractant protein 1 (MCP-I, CCL2) belongs to a family of potent chemotactic cytokines (CC chemokines) , that regulate the trafficking of leukocytes, especially monocytes, macrophages and T-cells, to sites of inflammation (Charo,I.F. and Taubman,M.B. (2004) Circ.Res. 95, 858-866). Besides its role in, e.g. vascular disease, compelling evidence points to a role of MCP-I in Alzheimer's disease (AD) (Xia,M.Q. and Hyman,B.T.
  • AD Alzheimer's disease
  • Amyloid- ⁇ protein (A ⁇ ) induces chemokine secretion in vitro
  • activated microglia also phagocytose A ⁇ peptides leading to an amplified activation (Rogers, J. and Lue,L.F. (2001) Neurochem. Int . 39, 333-340) .
  • MCP-I shows an increased level in serum of patients with MCI and early AD (Clerici,F., et al . , (2006) Neurobiol .Aging 27, 1763-1768).
  • the present invention relates to inhibitors of a glutaminyl peptide cyclotransferase and the use thereof for the treatment and/or prevention of a disease or disorder selected from the group consisting of inflammatory diseases selected from a. neurodegenerative diseases, e.g. mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British
  • a disease or disorder selected from the group consisting of inflammatory diseases selected from a. neurodegenerative diseases, e.g. mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British
  • Dementia Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, e.g. rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, e.g. lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, e.g. cancer/hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, e.g. hypertension, f . and other inflammatory diseases, e.g. neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis.
  • chronic and acute inflammations e.g. rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis
  • c. fibrosis e.g. lung fibrosis, liver fibrosis, renal fibrosis
  • cancer
  • Figure 1 shows the incubation of MCP-IM -76 ) bearing an N- terminal glutaminyl (A) or Pyroglutamyl (5-oxo-L-Prolyl) residue (B) with recombinant human DP4 for 24 h.
  • A N- terminal glutaminyl
  • B Pyroglutamyl (5-oxo-L-Prolyl) residue
  • FIG. 2 shows the incubation of MCP-I ( i- ⁇ Q) bearing an N- terminal glutaminyl (A) or Pyroglutamyl (5-oxo-L-Prolyl) residue with human synovial fibroblast MMP-I for 24 h.
  • MCP-I N-terminal glutamine
  • A N-terminal glutaminyl
  • Pyroglutamyl 5-oxo-L-Prolyl
  • Figure 3 shows the incubation of MCP-I ( i- ⁇ Q) carrying an N- terminal glutaminyl (A) or Pyroglutamyl (5-oxo-L-Prolyl) with human synovial fibroblast MMP-I and recombinant human DP4 for 24 h.
  • MCP-I was incubated with recombinant human QC 3 h prior to assay start.
  • Resulting MMP-I cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h using Maldi-TOF mass spectrometry
  • Figure 4 shows the isolation of human MCP-I from human neuroblastoma cell line SH-SY5Y.
  • M DNA standard in bp; 1: full length human MCP-I isolated from SH-SY5Y
  • Figure 5 shows the nucleotide (A) and amino acid (B) alignment of human MCP-I isolated from SH-SY5Y (upper lane) and human MCP- 1 genebank accession M24545 (lower lane) . Single nucleotide polymorphism is depicted in bold.
  • C shows the concentration of human MCP-I ( i- ⁇ Q) (WT) and mutant human MCP-I lacking the N- terminal pGlu residue ( ⁇ Q1) in the supernatant of transfected HEK293 cells in comparison to vector transfected control (pcDNA) .
  • Figure 6 A shows the concentration of human MCP-IM -76 ) (WT) and mutant human MCP-I lacking the two N-terminal amino acids
  • Figure 7 A shows the concentration of human MCP-I (1-76) (WT) in the supernatant of transfected HEK293 cells in absence and presence of 10 ⁇ M 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride in comparison to vector transfected control (pcDNA) .
  • Figure 8 shows the quantification of the vascular remodeling of the cuffed vessel wall segments of untreated ApoE3 Leiden mice
  • vascular circumference i.e. the total area within the outer diameter of the vessel segment and the remaining lumen (B) in ⁇ m ⁇ .
  • Figure 9 shows the quantification of the vascular remodeling of the cuffed vessel wall segments of untreated ApoE3 Leiden mice (black bars) or mice treated with (open bars) 1- (3- (lH-imidazol- 1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydro-chloride .
  • Mice were sacrificed 14 days after cuff placement. Expressed is the lumen stenosis A in % and the area of neointima B in ⁇ m ⁇ . (*, P ⁇ 0.05, Student's t-test) .
  • Figure 10 shows the quantification of the vascular remodeling of the cuffed vessel wall segments of untreated ApoE3 Leiden mice (black bars) or mice, which were treated with (open bars) of 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride. Mice were sacrificed 14 days after cuff placement. Expressed is the area of the media A in ⁇ m ⁇ and the intima / media ratio B. (*, P ⁇ 0.05, Student's t-test).
  • Figure 11 shows adhering and infiltrating cells per cross section in absence (black bars) or presence (open bars) of 1- (3- ( lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride treatment.
  • Total number of adhering cells per cross section was counted in the cross section of the cuffed femoral arteries harvested two days after cuff placement.
  • a specific staining for monocytes/macrophages was used to identify the adhering and infiltrating monocytes. (*, P ⁇ 0.05, Student's t-test).
  • Figure 12 shows examples of MCP-I staining by immunohistochemistry of lesions at the early time point (2 days) and the late time point (14 days) in untreated mice (control) and mice, which were treated with 1- (3- (lH-imidazol-1- yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride .
  • Figure 13 shows the quantification of MCP-I staining in cross sections of mice sacrificed after 2 days (early time point) A or after 14 days (late time point) B within the media and neointima in absence (black bars) and presence (open bars) of 1-(3-(1H- imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride treatment. (*, P ⁇ 0.05; Student's t-test).
  • Figure 14 shows the relative amount of MCP-I staining (%) in cross sections of mice sacrificed after 2 days (early time point) (A) or after 14 days (late time point) (B) within the media and neointima in absence (black bars) and presence (open bars) of 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride treatment. (*, P ⁇ 0.05; Student' s t-test) .
  • Figure 15 shows the quantification of the accelerated atherosclerosis in the vessel wall based on the quantification of monocyte/macrophage staining using marker AIA31240.
  • FIG. 15 shows the quantification of the accelerated atherosclerosis in the vessel wall based on the quantification of monocyte/macrophage staining using marker AIA31240.
  • Foam cell accumulation is illustrated as (A) foam cell positive area / cross section in % and (B) foam cell positive area / cross section in ⁇ m 2 .
  • Figure 16 illustrates cleavage of human MCP-I ( i- ⁇ Q) bearing an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human Aminopeptidase P for 24 h.
  • the pyroglutamate formation at the N-Terminus was accomplished by incubation of MCP-I with recombinant human QC for 3 h prior to the assay.
  • the DP4 cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h using Maldi-TOF mass spectrometry.
  • Figure 17 illustrates the cleavage of human MCP-I ( i-76 ) bearing an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human DP4 for 4 h.
  • the pyroglutamate formation at the N-Terminus was accomplished by incubation of MCP-I with recombinant human QC for 3 h prior to assay.
  • Figure 18 shows the degradation of human MCP-IM -76 ) carrying an N-terminal glutaminyl residue (A) or pyroglutamyl (5-oxo-L- Prolyl) residue (B) in human serum for 7 and 24 h, respectively.
  • MCP-I was incubated with recombinant human QC for 3 h prior to assay start.
  • Gln 1 -MCP-l was incubated in human serum in the presence of 9.6 ⁇ M DP4 Inhibitor Isoleucyl-Thiazolidide (P32/98) for 24 h (C) .
  • the cleavage products were analyzed after 0 min, 10 min, 30 min, Ih, 2h, 3h 5h and 7 h for Glr ⁇ -MCP-l, 0 min, 30 min, Ih, 2h, 3h 5h, 7 h and 24 h for pGlu ⁇ MCP-l and 0 min, Ih, 2h, 3h, 5h, 7 h and 24 h for Gln 1 -MCP-l in combination with Isoleucyl-Thiazolidide using Maldi-TOF mass spectrometry.
  • Figure 19 shows the degradation of human bearing an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human DP4 for 24 h.
  • A N-terminal glutaminyl
  • B pyroglutamyl (5-oxo-L-Prolyl) residue
  • MCP-2 was incubated with recombinant human QC for 3 h prior to assay start.
  • the DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h.
  • Figure 20 shows the degradation of human MCP-3M-76) carrying an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human DP4 for 24 h.
  • A N-terminal glutaminyl
  • B pyroglutamyl (5-oxo-L-Prolyl) residue
  • B pyroglutamyl residue
  • Figure 21 illustrates the cleavage of human MCP-4/]__75 ) bearing an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human DP4 for 4 hours.
  • A N-terminal glutaminyl
  • B pyroglutamyl (5-oxo-L-Prolyl) residue
  • Figure 22 shows the chemotactic potency of human N-terminal MCP- 1 variants starting with N-terminal glutamine (Gln 1 -MCP-l) , pyroglutamic acid (pGlu 1 -MCP-l) (5-oxo-L-Proline) , starting with proline 2 (Pro 2 -MCP-l, the aminopeptidase P cleavage product), starting with aspartic acid 3 (Asp 3 -MCP-l, the DP4 cleavage product) and starting with isoleucine 5 (Ile 5 -MCP-l, the MMP-I cleavage product) towards human THP-I monocytes.
  • N-terminal glutamine Gln 1 -MCP-l
  • pGlu 1 -MCP-l pyroglutamic acid
  • pGlu 1 -MCP-l 5-oxo-L-Proline
  • Figure 23 shows the analysis of chemotactic potency of human MCP-I, which was incubated with human recombinant DP4 in presence (Glr ⁇ -MCP-l + QC + DP4) and absence (Glr ⁇ -MCP-l + DP4) of QC-mediated pGlu formation.
  • Figure 24 shows the chemotactic potency of human MCP-I (A) , MCP- 2 (B) , MCP-3 (C) and MCP-4 (D) in absence or presence of the N- terminal pyroglutamyl residue.
  • Figure 25 shows the chemotactic potency of full-length human MCP-I (A), MCP-3 (B), MCP-2 (C) and MCP-4 (D) starting with an N-terminal glutamine in comparison to their respective DP4 cleavage products.
  • Figure 26 shows the significant reduction of TNFCC-levels after application of QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride in a model of LPS- induced sepsis in rats (ANOVA, P ⁇ 0.05).
  • Figure 27 shows the dose-dependent reduction of infiltrating monocytes to the peritoneum in a model of thioglycollate-induced peritonitis in mice, caused by a QC-inhibitor .
  • Thioglycollate and QCI (1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride) in three different concentrations of 25 mg/kg, 50 mg/kg and 100 mg/kg were injected.
  • Cells infiltrating the peritoneum were classified using FACS analysis 4 h after inducing the peritonits. (*, P ⁇ 0.05, Student's t-test) .
  • Figure 28 shows the reduction of Moma2-positive cells in the peritoneal lavage fluid of mice, which received a thioglycollate challenge in combination with the QC-specific inhibitor QCI (1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea) , compared to animals receiving no QCI (*, P ⁇ 0.05, Student's t- test) .
  • a QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition selected from a. neurodegenerative diseases, comprising mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, and multiple sclerosis, b. chronic and acute inflammations, comprising rheumatoid arthritis, atherosclerosis, restenosis, and pancreatitis, c. fibrosis, comprising lung fibrosis, liver fibrosis, and renal fibrosis, d. cancer, comprising cancer/hemangioendothelioma proliferation, and gastric carcinomas, e. metabolic diseases, comprising hypertension, f . and other inflammatory diseases, comprising neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis.
  • MCI mild cognitive impairment
  • Alzheimer's disease neurodegeneration in Down Syndrome
  • the QC inhibitor according to item 1 wherein the neurodegenerative disease is selected from mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis. 3. The QC inhibitor according to item 1 or 2, wherein the disease is mild cognitive impairment.
  • MCI mild cognitive impairment
  • Alzheimer's disease neurodegeneration in Down Syndrome
  • Familial British Dementia Familial British Dementia
  • Familial Danish Dementia Familial Danish Dementia
  • multiple sclerosis multiple sclerosis.
  • QC inhibitor according to any of items 1 to 3, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • a further agent selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • the QC inhibitor according to item 1 wherein the disease is a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis .
  • a further agent selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors .
  • ACE angiotensin converting enzyme
  • CB calcium channel blockers
  • beta-blockers beta-blockers
  • platelet aggregation inhibitors cholesterol absorption modulators
  • HMG-Co-A reductase inhibitors high density lipoprotein (HDL) increasing compounds
  • renin inhibitors IL-6 inhibitors
  • a QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition selected from a. neurodegenerative diseases, comprising mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, comprising rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, comprising lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, comprising cancer/hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, comprising hypertension, f . and other inflammatory diseases, comprising neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis.
  • MCI mild cognitive impairment
  • Alzheimer's disease neurodegeneration in Down Syndrome
  • Familial British Dementia Fa
  • the disease is a neurodegenerative disease, selected from mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis.
  • MCI mild cognitive impairment
  • Alzheimer's disease neurodegeneration in Down Syndrome
  • Familial British Dementia Familial British Dementia
  • Familial Danish Dementia multiple sclerosis.
  • QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroptrotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • a further agent selected from the group consisting of nootropic agents, neuroptrotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • a further agent selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors .
  • ACE angiotensin converting enzyme
  • CB calcium channel blockers
  • beta-blockers beta-blockers
  • platelet aggregation inhibitors cholesterol absorption modulators
  • HMG-Co-A reductase inhibitors high density lipoprotein (HDL) increasing compounds
  • renin inhibitors IL-6 inhibitors
  • a QC inhibitor for the preparation of a medicament for treating and/or preventing an inflammatory disease or condition selected from a. neurodegenerative diseases, comprising mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial
  • MCI mild cognitive impairment
  • Alzheimer's disease neurodegeneration in Down Syndrome
  • Familial British Dementia Familial British Dementia
  • Danish Dementia multiple sclerosis, b. chronic and acute inflammations, comprising rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, comprising lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, comprising cancer/hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, comprising hypertension, f. and other inflammatory diseases, comprising neuropathic pain, graft rejection/graft failure/graft vasculopathy,
  • the disease is a neurodegenerative disease, selected from mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis.
  • MCI mild cognitive impairment
  • Alzheimer's disease neurodegeneration in Down Syndrome
  • Familial British Dementia Familial British Dementia
  • Familial Danish Dementia multiple sclerosis.
  • QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • a further agent selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • the disease is a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis.
  • a further agent selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE) ; angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors .
  • ACE angiotensin converting enzyme
  • CFB calcium channel blockers
  • beta-blockers beta-blockers
  • platelet aggregation inhibitors cholesterol absorption modulators
  • HMG-Co-A reductase inhibitors high density lipoprotein (HDL) increasing compounds
  • renin inhibitors IL-6
  • a Method of treatment and/or prevention of an inflammatory disease or condition selected from a. neurodegenerative diseases, comprising mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, comprising rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, comprising lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, comprising cancer / hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, comprising hypertension, f.
  • MCI mild cognitive impairment
  • Alzheimer's disease neurodegeneration in Down Syndrome
  • Familial British Dementia Familial British Dementia
  • Familial Danish Dementia multiple sclerosis
  • chronic and acute inflammations comprising rheumatoid arthritis, atherosclerosis, restenosis,
  • inflammatory diseases comprising neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis, wherein an effective amount of a QC inhibitor is administered to a subject in need thereof.
  • the disease is a neurodegenerative disease, selected from mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis .
  • MCI mild cognitive impairment
  • Alzheimer's disease neurodegeneration in Down Syndrome
  • Familial British Dementia Familial British Dementia
  • Familial Danish Dementia Familial Danish Dementia
  • MCI mild cognitive impairment
  • 25 The method of treatment and/or prevention according to any of items 23 to 25, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • a further agent selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • a further agent selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors.
  • ACE angiotensin converting enzyme
  • CB calcium channel blockers
  • beta-blockers beta-blockers
  • platelet aggregation inhibitors cholesterol absorption modulators
  • HMG-Co-A reductase inhibitors high density lipoprotein (HDL) increasing compounds
  • renin inhibitors IL-6 inhibitors
  • QC inhibitor is an inhibitor selected from formulae 1, 1*, Ia, Ib, Ic, Id, Ie, If, Ig, Ih, and Ii.
  • Diagnostic assay comprising a QC inhibitor.
  • a method of diagnosing any one of the diseases and/or conditions as defined in item 1, comprising the steps of collecting a sample from a subject who is suspected to be afflicted with said disease and/or condition, contacting said sample with a QC inhibitor, and determining whether or not said subject is afflicted by said disease and/or condition.
  • Diagnostic kit for carrying out the method of items 38 to 42 comprising as detection means the diagnostic assay of any of items 34 or 37 and a determination means.
  • composition comprising the QC inhibitor according to any of items 1 to 7 or 31 to 33.
  • the invention relates to the use of a QC inhibitor in methods of treating a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis, particularly restenosis and pancreatitis, most preferably restenosis.
  • a QC inhibitor for treating a chronic or acute inflammation selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis, can be tested using the in vivo assays described in examples 3, 7 and 8 of the present invention.
  • MCI mild cognitive impairment
  • a QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
  • a QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
  • MCI mild cognitive impairment
  • restenosis restenosis
  • pancreatitis pancreatitis
  • a QC inhibitor for the preparation of a medicament for treating and/or preventing an inflammatory disease or condition selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
  • MCI mild cognitive impairment
  • restenosis restenosis
  • pancreatitis an inflammatory disease or condition selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
  • QC inhibitor or use according to any of items 1 to 4, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroptrotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • a further agent selected from the group consisting of nootropic agents, neuroptrotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • a further agent selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors.
  • ACE angiotensin converting enzyme
  • CB calcium channel blockers
  • beta-blockers beta-blockers
  • platelet aggregation inhibitors cholesterol absorption modulators
  • HMG-Co-A reductase inhibitors high density lipoprotein (HDL) increasing compounds
  • renin inhibitors IL-6 inhibitors
  • a Method of treatment and/or prevention of an inflammatory disease or condition selected from mild cognitive impairment (MCI), restenosis and pancreatitis, wherein an effective amount of a QC inhibitor is administered to a subject in need thereof.
  • MCI mild cognitive impairment
  • QC inhibitor an effective amount of a QC inhibitor is administered to a subject in need thereof.
  • a further agent selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • a further agent selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors;
  • ACE angiotensin converting enzyme
  • CCB calcium channel blockers
  • beta-blockers beta-blockers
  • platelet aggregation inhibitors cholesterol absorption modulators
  • HMG-Co-A reductase inhibitors HMG-Co-A reductase inhibitors
  • HDL high density lipoprotein
  • IL-6 inhibitors antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors.
  • Diagnostic assay comprising a QC inhibitor.
  • a method of diagnosing any one of the diseases and/or conditions as defined in item 1, comprising the steps of collecting a sample from a subject who is suspected to be afflicted with said disease and/or condition, contacting said sample with an inhibitor of a glutaminyl peptide cyclotransferase, and determining whether or not said subject is afflicted by said disease and/or condition.
  • QC inhibitor is 1- (3- (lH-imidazole-1-yl) propyl) -3- (3, 4- dimethoxy-phenyl) thiourea hydrochloride.
  • Diagnostic kit for carrying out the method of items 25 to 30 comprising as detection means the diagnostic assay of any of items 21 to 24 and a determination means.
  • composition comprising the QC inhibitor according to any of items 1, 4 to 6 or 18 to 20.
  • Enzyme inhibitors in particular inhibitors of QC
  • Reversible enzyme inhibitors comprise competitive inhibitors, non-competitive reversible inhibitors, slow-binding or tight- binding inhibitors, transition state analogues and multisubstrate analogues.
  • Slow-binding or tight-binding inhibitors i) are competitive inhibitors where the equilibrium between inhibitor and enzyme is reached slowly, ii) (k on is slow) , possibly due to conformational changes that must occur in the enzyme or inhibitor a) are often transition state analogues b) are effective at concentrations similar to the enzyme concentration (subnanomolar KD values) c) due to k off values being so low these types of inhibitors are "almost" irreversible.
  • Multisubstrate analogues For a reaction involving two or more substrates, a competitive inhibitor or transition state analogue can be designed which contains structural characteristics resembling two or more of the substrates.
  • Irreversible enzyme inhibitors drive the equilibrium between the unbound enzyme and inhibitor and enzyme inhibitor complex (E
  • Active-site directed irreversible inhibitors are recognized by the enzyme (reversible, specific binding) followed by covalent bond formation, and i) are structurally similar to substrate, transition state or product allowing for specific interaction between drug and target enzyme, ii) contain reactive functional group (e.g. a nucleophile, -COCH2Br) allowing for covalent bond formation.
  • reactive functional group e.g. a nucleophile, -COCH2Br
  • reaction scheme describes an active-site directed reagent with its target enzyme where K is the dissociation constant and kmactivation is the rate of covalent bond formation.
  • Mechanism-based enzyme inactivators are active-site directed reagents (unreactive) which bind to the enzyme active site where they are transformed to a reactive form (activated) by the enzyme's catalytic capabilities. Once activated, a covalent bond between the inhibitor and the enzyme is formed.
  • the reaction scheme below shows the mechanism of action of a mechanism based enzyme inactivator, where K D is the dissociation complex, k2 is the rate of activation of the inhibitor once bound to the enzyme, k3 is the rate of dissociation of the activated inhibitor, P, from the enzyme (product can still be reactive) from the enzyme and k ⁇ is the rate of covalent bond formation between the activated inhibitor and the enzyme.
  • Inactivation covalent bond formation, ⁇ kq
  • dissociation k3
  • the partition ratio, k ⁇ /kq: ratio of released product to inactivation should be minimized for efficient inactivation of the system and minimal undesirable side reactions.
  • Uncompetitive enzyme inhibitors As a definition of uncompetitive inhibitor (an inhibitor which binds only to ES complexes) the following equilibria equation can be assumed:
  • the ES complex dissociates the subtrate with a dissociation constant equal to Ks, whereas the ESI complex does not dissociate it (i.e has a Ks value equal to zero) .
  • the Km's of Michaelis-Menten type enzymes are expected to be reduced.
  • Increasing substrate concentration leads to increasing ESI concentration (a complex incapable of progressing to reaction products) therefore the inhibition cannot be removed.
  • Preferred according to the present invention are competitive enzyme inhibitors.
  • K or "K” and “K” are binding constants, which describe the binding of an inhibitor to and the subsequent release from an enzyme. Another measure is the “IC50” value, which reflects the inhibitor concentration, which at a given substrate concentration results in 50 % enzyme activity.
  • QC as used herein comprises glutaminyl cyclase (QC) and QC-like enzymes.
  • QC and QC-like enzymes have identical or similar enzymatic activity, further defined as QC activity.
  • QC-like enzymes can fundamentally differ in their molecular structure from QC.
  • QC activity is defined as intramolecular cyclization of N-terminal glutaminyl residues into pyroglutamic acid (pGlu*) or of N-terminal L-homoglutaminyl or L-beta-homoglutaminyl to a cyclic pyro-homoglutamine derivative under liberation of ammonia. See schemes 1 and 2 in this regard.
  • EC as used herein comprises the side activity of QC and QC-like enzymes as glutamate cyclase (EC) , further defined as EC activity.
  • EC activity is defined as intramolecular cyclization of N-terminal glutamyl residues into pyroglutamic acid (pGlu*) by QC. See scheme 3 in this regard. Scheme 3: N-terminal cyclization of uncharged glutamyl peptides by QC (EC)
  • QC-inhibitor "glutaminyl cyclase inhibitor” is generally known to a person skilled in the art and means enzyme inhibitors as generally defined above, which inhibit the catalytic activity of glutaminyl cyclase (QC) or its glutamyl cyclase (EC) activity.
  • the subject method and medical use utilize an agent with a K 1 for QC inhibition of 10 ⁇ M or less, more preferably of 1 ⁇ M or less, even more preferably of 0.1 ⁇ M or less or 0.01 ⁇ M or less, or most preferably 0.001 ⁇ M or less.
  • K 1 for QC inhibition 10 ⁇ M or less, more preferably of 1 ⁇ M or less, even more preferably of 0.1 ⁇ M or less or 0.01 ⁇ M or less, or most preferably 0.001 ⁇ M or less.
  • K 1 for QC inhibition of 10 ⁇ M or less, more preferably of 1 ⁇ M or less, even more preferably of 0.1 ⁇ M or less or 0.01 ⁇ M or less, or most preferably 0.001 ⁇ M or less.
  • the QC inhibitors of the subject method or medical use will be small molecules, e.g., with molecular weights of 1000 g/mole or less, 500 g/mole or less, preferably of 400 g/mole or less, and even more preferably of 350 g/mole or less and even of 300 g/mole or less.
  • subject refers to an animal, preferably a mammal, most preferably a human, who has been the object of treatment, observation or experiment and/or is suspected of being afflicted with a disease and/or condition as defined in the items.
  • terapéuticaally effective amount means that amount of an active compound or a pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human being sought by a researcher, veterinarian, medical doctor or other clinician, which includes alleviation of the symptoms of the disease or disorder being treated.
  • the term "pharmaceutically acceptable” embraces both human and veterinary use: for example the term “pharmaceutically acceptable” embraces a veterinary acceptable compound or a compound acceptable in human medicine and health care .
  • Salts and solvates of the inhibitors of the present invention and physiologically functional derivatives thereof which are suitable for use in medicine are those wherein the counter-ion or associated solvent is pharmaceutically acceptable.
  • salts and solvates having non-pharmaceutically acceptable counter-ions or associated solvents are within the scope of the present invention, for example, for use as intermediates in the preparation of other compounds and their pharmaceutically acceptable salts and solvates.
  • Suitable salts according to the invention include those formed with both organic and inorganic acids or bases.
  • Pharmaceutically acceptable acid addition salts include those formed from hydrochloric, hydrobromic, sulphuric, nitric, citric, tartaric, phosphoric, lactic, pyruvic, acetic, trifluoroacetic, triphenylacetic, sulphamic, sulphanilic, succinic, oxalic, fumaric, maleic, malic, mandelic, glutamic, aspartic, oxaloacetic, methanesulphonic, ethanesulphonic, arylsulphonic (for example p-toluenesulphonic, benzenesulphonic, naphthalenesulphonic or naphthalene-disulphonic) , salicylic, glutaric, gluconic, tricarballylic, cinnamic, substituted cinnamic (for example, phenyl,
  • compositions for example 1, 4-benzenediacrylic
  • isethionic acids perchloric, propionic, glycolic, hydroxyethanesulfonic, pamoic, cyclohexanesulfamic, salicylic, saccharinic and trifluoroacetic acid.
  • Pharmaceutically acceptable base salts include ammonium salts, alkali metal salts such as those of sodium and potassium, alkaline earth metal salts such as those of calcium and magnesium and salts with organic bases such as dicyclohexylamine and N-methyl-D-glutamine .
  • solvates include hydrates.
  • crystalline forms of the inhibitors may exist as polymorphs and as such are intended to be included in the present invention.
  • some of the compounds may form solvates with water (i.e. hydrates) or common organic solvents, and such solvates are also intended to be encompassed within the scope of this invention.
  • the inhibitors, including their salts, can also be obtained in the form of their hydrates, or include other solvents used for their crystallization.
  • the present invention further includes within its scope prodrugs of the inhibitors of this invention.
  • prodrugs will be functional derivatives of the inhibitors, which are readily convertible in vivo into the desired therapeutically active inhibitors.
  • the term "administering" shall encompass the treatment of the various disorders described with prodrug versions of one or more of the itemed inhibitors, but which converts to the above specified inhibitors in vivo after administration to the subject.
  • Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in "Design of Prodrugs", ed. H. Bundgaard, Elsevier, 1985 and the patent applications DE 198 28 113, DE 198 28 114, WO 99/67228 and WO 99/67279 which are fully incorporated herein by reference.
  • any of the processes for preparation of the inhibitors of the present invention it may be necessary and/or desirable to protect sensitive or reactive groups on any of the molecules concerned. This may be achieved by means of conventional protecting groups, such as those described in Protective Groups in Organic Chemistry, ed. J. F. W. McOmie, Plenum Press, 1973; and T. W. Greene & P. G. M. Wuts, Protective Groups in Organic Synthesis, John Wiley & Sons, 1991, fully incorporated herein by reference.
  • the protecting groups may be removed at a convenient subsequent stage using methods known from the art.
  • composition is intended to encompass a product comprising the itemed compounds in the therapeutically effective amounts, as well as any product, which results, directly or indirectly, from combinations of the itemed compounds .
  • suitable carriers and additives may advantageously include water, glycols, oils, alcohols, flavouring agents, preservatives, colouring agents and the like;
  • suitable carriers and additives include starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like.
  • Carriers which can be added to the mixture, include necessary and inert pharmaceutical excipients, including, but not limited to, suitable binders, suspending agents, lubricants, flavorants, sweeteners, preservatives, coatings, disintegrating agents, dyes and colouring agents.
  • Soluble polymers as targetable drug carriers can include polyvinylpyrrolidone, pyran copolymer, polyhydroxypropylmeth- acrylamidephenol, polyhydroxyethylaspartamidephenol, or polyethyleneoxidepolyllysine substituted with palmitoyl residue (s).
  • the inhibitors of the present invention may be coupled to a class of biodegradable polymers useful in achieving controlled/sustained release of a drug, for example, poly actic acid, poly-epsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross-linked or amphipathic block copolymers of hydrogels.
  • Suitable binders include, without limitation, starch, gelatin, natural sugars such as glucose or beta-lactose, corn sweeteners, natural and synthetic gums such as acacia, tragacanth or sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and the like.
  • Disintegrating agents include, without limitation, starch, methyl cellulose, agar, bentonite, xanthan gum and the like.
  • QC-inhibitors which are suitable for uses and methods according to the present invention are disclosed in WO 2005/075436, which is incorporated herein in its entirety with regard to the structure, synthesis and methods of use of the QC-inhibitors.
  • the present invention provides novel inhibitors of QC (EC) of the formula 1,
  • A is either: an alkyl chain, alkenyl chain or alkynyl chain; or A is a group selected from:
  • R 6 , R 7 , R 8 , R 9 and R 10 are independently H or an alkyl chain, alkenyl chain, alkynyl chain, cycloalkyl, a carbocycle, aryl, heteroaryl, or a heterocycle; n and n 1 are independently 1 - 5; m is 1 - 5 ; o is 0 - 4;
  • D and E independently represent an alkyl chain, alkenyl chain, alkynyl chain, a cycloalkyl, carbocycle, aryl, -alkylaryl, heteroaryl, -alkylheteroaryl, acyl or a heterocycle.
  • R 19 is selected from the group consisting of H, alkyl, cycloalkyl, aryl, heteroaryl, -oxyalkyl, -oxyaryl, carbonyl, amido, hydroxy, NO2, NH 2 , CN;
  • R and R are independently selected from H, alkyl, cycloalkyl, heterocycle, aryl, heteroaryl, , -oxyalkyl, oxyaryl, carbonyl, amido, NO 2 , NH 2 , CN, CF 3 ;
  • X 1 , X 2 and X 3 are independently O or S provided that X 2 and X 3 are not both O;
  • Y is 0 or S, with the proviso that Y may not be 0, when the carbocycle formed by R 17 and R 18 has 3 members in the ring;
  • Z is CH or N
  • R 11 , R 12 , R 13 and R 14 can be independently selected from H, an alkyl chain, an alkenyl chain, an alkynyl chain, cycloalkyl, carbocycle, aryl, heteroaryl, a heterocycle, halogen, alkoxy-, -thioalkyl, carboxyl, carboxylic acid ester, carbonyl, carbamide, carbimide, thiocarbamide or thiocarbonyl, NH 2 , NO 2 ;
  • R 15 and R 16 are independently of each other H or a branched or unbranched alkyl chain, or a branched or unbranched alkenyl chain;
  • R 17 and R 18 are independently selected from H or an alkyl chain, alkenyl chain, a alkynyl chain, a carbocycle, aryl, heteroaryl, heteroalkyl or can be connected to form a carbocycle with up to 6 ring atoms;
  • n 0 or 1
  • A is selected from an alkyl chain, alkenyl chain or alkynyl chain
  • A is a C1-C7 alkyl chain, C1-C7 alkenyl chain or a C1-C7 alkynyl chain.
  • A is an unbranched C2-5 alkyl chain, in particular an unbranched C3-4 alkyl chain, especially an unbranched C 3 alkyl chain.
  • A represents a C3 alkyl chain which is substituted at the 2 position by one (i.e. in S or R configuration) or two methyl groups.
  • A represents a group of formula (I), (II) or (III), wherein n and n 1 are each equal to 1 and R 6 , R 7 , R 8 , R 9 and R 10 represent H.
  • R 6 , R 7 , R 8 , R 9 and R 10 represent H or methyl.
  • the group B is chosen from (VI), (Via), (VIb), (VII), (X), (XI), (XII), (XIII) and (XIV).
  • group B represents formula (VI) .
  • formula (VIa) In a third embodiment of the invention group B represents formula (Via) .
  • formula (VIb) In a fourth embodiment of the invention group B represents formula (VIb) .
  • formula (VII) In a sixth embodiment of the invention group B represents formula (X) .
  • a seventh embodiment of the invention group B represents formula (XI) .
  • In an eighth embodiment of the invention group B represents formula (XII).
  • another embodiment of the invention group B represents formula (XIII) .
  • formula (XIV) In a preferred embodiment of the invention B represents a group of formula (VI) or (VII) .
  • B represents a group (IX) suitably A does not represent alkynyl .
  • D and E independently represent benzyl, aryl, heteroaryl or a heterocycle.
  • D and E represent aryl, in particular phenyl or napthyl, especially substituted phenyl.
  • Preferred substituent groups when D represents phenyl include alkoxy-, -thioalkyl, halogen, or a carboxylic acid alkyl or aryl ester. Also preferred are fluoro, chloro, bromo, iodo, trifluoromethyl, trifluoromethoxy, methoxy, ethoxy, benzyloxy, cyano, acetyl, dimethyl amino, methylsulphanyl, nitro, oxazolyl, pyrazolyl, isopropyl, ethyl and methoxycarbonyl . Where a phenyl group is mono-substituted it is preferred that substitution is in the 4-position.
  • Suitable aryl groups which D and E may represent include dihydrobenzodioxine, benzodioxole, benzodithiole dihydrobenzodithiine, benzooxathiole and dihydrobenzooxathiine .
  • a particularly preferred group, which D or E may represent is 3, 4- (dimethoxy) -phenyl,
  • R 20 and R 21 represent NO 2 , CN, CF 3 or, if R 20 is H, R 21 is NO 2 , CN, CF 3 , or, if R 21 is H, R 20 is NO 2 , CN, CF 3 .
  • X or Y is S, 0 or NR 1 .
  • X or Y is S.
  • Z represents N.
  • R 11 and R 14 are H.
  • R 12 and R 13 are independently selected from oxyalkyl or thioalkyl, halogen, or carboxylic acid alkyl ester or phenyl.
  • At least one of R 15 and R 16 is H, more preferably, R 15 and R 16 are both H.
  • one of R 17 and R 18 is H and the other iiss MMee.
  • compounds wwhheerree RR 1177 aaind R 18 form a carbocycle with up to 6 members in the ring atoms .
  • Preferred compounds include those defined by Examples 13, 119 and 125 below.
  • the present invention provides compounds of formula 1 for use as a pharmaceutical.
  • the compounds of formula 1 in one embodiment regarding the use of the compounds of formula 1 as a pharmaceutical, the compounds:
  • the compound (a) of the proviso above is disclosed as compound 7 in Ganellin et al (1995) J Med Chem 38(17) 3342-3350. This paper discloses said compound as a weak inhibitor of the histamine H3 receptor.
  • the compound of proviso (b) is disclosed as compound 7 in Venkatachalam et al (2001) Bioorganic Med Chem Lett 11, 523-528. This discloses said compound as an HIVl reverse transcriptase inhibitor .
  • the compound of proviso (c) is disclosed as compound 19b in Moon et al (1991) J Med Chem 34, 2314-2327. This paper discloses said compound as a cholinergic agonist with potential use in the treatment of Alzheimer's disease.
  • proviso (d) The compounds of proviso (d) are disclosed as compounds 99, 100 and 102-103 in Wright et al (1986) J Med Chem 29, 523-530. This paper discloses said compounds as thromoxane synthetase inhibitors .
  • inhibitors of QC are those of formula Ia,
  • R is defined in examples 1 to 53.
  • inhibitors of QC are those of formula Ib, wherein R 1 and R 2 are defined in examples 54 to 95.
  • inhibitors of QC are those of formula Ic, wherein R 3 is defined in examples 96 to 102.
  • R and R are defined in examples 106 to 109,
  • inhibitors of QC are those of formula Ig, wherein R 7 , R 8 and R 9 are defined in examples 113 to 132.
  • inhibitors of QC are those of formula Ih, wherein n is defined in examples 133 to 135.
  • inhibitors of QC are those of formula Ii, wherein m is defined in examples 136 and 137.
  • inhibitors of QC are those of formula 13 ⁇ to 141.
  • a preferred inhibitor of glutaminyl peptide cyclotransferase is 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride (further named as QCI)
  • the present invention provides a composition, preferably a pharmaceutical composition, comprising at least one QC inhibitor optionally in combination with at least one other agent selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • at least one QC inhibitor optionally in combination with at least one other agent selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
  • the aforementioned other agent is selected from the group consisting of beta-amyloid antibodies, cysteine protease inhibitors, PEP-inhibitors, LiCl, acetylcholinesterase
  • AFOE PIMT enhancers
  • inhibitors of beta secretases inhibitors of gamma secretases, inhibitors of neutral endopeptidase, inhibitors of Phosphodiesterase-4 (PDE- 4), TNFalpha inhibitors, muscarinic Ml receptor antagonists, NMDA receptor antagonists, sigma-1 receptor inhibitors, histamine H3 antagonists, immunomodulatory agents, immunosuppressive agents, MCP-I antagonists or an agent selected from the group consisting of antegren (natalizumab) , Neurelan (fampridine-SR) , campath (alemtuzumab) , IR 208, NBI 5788/MSP 771 (tiplimotide) , paclitaxel, Anergix.MS (AG 284), SH636, Differin (CD 271, adapalene) , BAY 361677 (interleukin-4) , matrix- metalloproteinase-inhibitors
  • the other agent may be, for example, an antianxiety drug or antidepressant selected from the group consisting of
  • Benzodiazepines e.g. alprazolam, chlordiazepoxide, clobazam, clonazepam, clorazepate, diazepam, fludiazepam, loflazepate, lorazepam, methaqualone, oxazepam, prazepam, tranxene,
  • alprazolam chlordiazepoxide
  • clobazam clonazepam
  • clorazepate diazepam
  • fludiazepam fludiazepam
  • loflazepate lorazepam
  • methaqualone oxazepam
  • prazepam tranxene
  • SSRI' s Selective serotonin re-uptake inhibitors
  • SSRI' s Selective serotonin re-uptake inhibitors
  • Tricyclic antidepressants e.g. amitryptiline, clomipramine, desipramine, doxepin, imipramine
  • Azapirones e.g. buspirone, tandopsirone
  • Serotonin-norepinephrine reuptake inhibitors e.g. venlafaxine, duloxetine
  • NRI' s Norepinephrine reuptake inhibitors
  • reboxetine e.g. reboxetine
  • Bupropione e.g. Bupropione
  • Nefazodone e.g. Nefazodone
  • the other agent may be, for example, an anti-multiple sclerosis drug selected from the group consisting of a) dihydroorotate dehydrogenase inhibitors, e.g. SC-12267, teriflunomide, MNA-715, HMR-1279 (syn. to HMR-1715, MNA- 279), b) autoimmune suppressant, e.g. laquinimod, c) paclitaxel, d) antibodies, e.g.
  • an anti-multiple sclerosis drug selected from the group consisting of a) dihydroorotate dehydrogenase inhibitors, e.g. SC-12267, teriflunomide, MNA-715, HMR-1279 (syn. to HMR-1715, MNA- 279), b) autoimmune suppressant, e.g. laquinimod, c) paclitaxel, d) antibodies, e.g.
  • AGT-I anti-granulocyte-macrophage colony- stimulating factor (GM-CSF) monoclonal antibody, Nogo receptor modulators, ABT-874, alemtuzumab (CAMPATH), anti- OX40 antibody, CNTO-1275, DN-1921, natalizumab (syn. to AN- 100226, Antegren, VLA-4 Mab) , daclizumab (syn. to Zenepax, Ro-34-7375, SMART anti-Tac) , J-695, priliximab (syn.
  • GM-CSF granulocyte-macrophage colony- stimulating factor
  • peptide nucleic acid (PNA) preparations e.g. reticulose
  • interferon alpha e.g. Alfaferone, human alpha interferon
  • interferon beta e.g. Frone, interferon beta-la like Avonex, Betron (Rebif) , interferon beta analogs, interferon beta-transferrin fusion protein, recombinant interferon beta-lb like Betaseron, h) interferon tau, i) peptides, e.g. AT-008, AnergiX.MS, Immunokine (alpha-
  • Immunokine-NNS03 cyclic peptides like ZD-7349, j) therapeutic enzymes, e.g. soluble CD8 (sCD8), k) multiple sclerosis-specific autoantigen-encoding plasmid and cytokine-encoding plasmid, e.g. BHT-3009;
  • TNF-alpha e.g. BLX-1002, thalidomide, SH-636, m
  • TNF antagonists e.g. solimastat, lenercept (syn. to RO-45-
  • TNF alpha e.g. etanercept (syn. to Enbrel, TNR-OOl)
  • CD28 antagonists e.g. abatacept
  • p) Lck tyrosine kinase inhibitors q) cathepsin K inhibitors
  • analogs of the neuron-targeting membrane transporter protein taurine and the plant-derived calpain inhibitor leupeptin e.g. Neurodur
  • chemokine receptor-1 (CCRl) antagonist e.g. BX-471, t) CCR2 antagonists
  • AMPA receptor antagonists e.g. ER-167288-01 and ER-099487
  • L-alanine e.g. glatiramer acetate (syn. to Copaxone, COP- 1, copolymer-1) , dd) topoisomerase II modulators, e.g. mitoxantrone hydrochloride, ee) adenosine deaminase inhibitor, e.g. cladribine (syn. to
  • interleukin-10 e.g. ilodecakin (syn. to Tenovil, Sch-
  • interleukin-12 antagonists e.g. lisofylline (syn. to
  • TGF-beta e.g. GDF-I (growth and differentiation factor
  • TGF-beta-2 e.g. BetaKine, mm
  • MMP inhibitors e.g. glycomed, nn) phosphodiesterase 4 (PDE4) inhibitors, e.g. RPR-122818, oo) purine nucleoside phosphorylase inhibitors, e.g. 9- (3- pyridylmethyl) -9-deazaguanine, peldesine (syn. to BCX-34, TO-200) , pp) alpha-4/beta-l integrin antagonists, e.g. ISIS-104278, qq) antisense alpha4 integrin (CD49d), e.g. ISIS-17044,
  • MCP-I inhibitors e.g. nucleosides, ICN-17261, ss) cytokine inhibitor
  • compositions e.g. for parenteral, enteral or oral administration, comprising at least one QC inhibitor, optionally in combination with at least one of the other aforementioned agents .
  • the invention provides a method for the treatment of these conditions .
  • the method comprises either co-administration of at least one QC inhibitor and at least one of the other agents or the sequential administration thereof.
  • Co-administration includes administration of a formulation, which comprises at least one QC inhibitor and at least one of the other agents or the essentially simultaneous administration of separate formulations of each agent.
  • Beta-amyloid antibodies and compositions containing the same are described, e.g. in WO 2006/137354, WO 2006/118959, WO
  • beta-amyloid antibodies may be selected from, for example, polyclonal, monoclonal, chimenic or humanited antibodies. Furthermore, said antibodies may be useful to develop active and passive immune therapies, i.e. vaccines and monoclonal antibodies.
  • beta-amyloid antibodies are ACU-5A5, huC091 (Acumen/Merck); PF-4360365, RI-1014, RI-1219, RI-409, RN-1219 (Rinat Neuroscience Corp (Pfizer Inc) ) ; the nanobody therapeutics of Ablynx/Boehringer Ingelheim; beta-amyloid- specific humanized monoclonal antibodies of Intellect
  • a suitable antibody, which recognize the A ⁇ -N-Terminus is, for example Acl-24 (AC immune CA) .
  • a monoclonal antibody against beta-amyloid peptide is disclosed in WO 2007/068412.
  • Respective chimenic and humanized antibodies are disclosed in WO 2008/011348.
  • a method for producing a vaccine composition for treating an amyloid-associated diease si disclosed in WO 2007/068411.
  • Suitable cysteine protease inhibitors are for example inhibitors of cathepsin B.
  • Inhibitors of cathepsin B and compositions containing such inhibitors are described, e.g. in WO 2006/060473, WO 2006/042103, WO 2006/039807, WO 2006/021413, WO 2006/021409, WO 2005/097103, WO 2005/007199, WO2004/084830, WO 2004/078908, WO 2004/026851, WO 2002/094881, WO 2002/027418, WO 2002/021509, WO 1998/046559, WO 1996/021655.
  • PIMT enhancers are 10-aminoaliphatyl- dibenz[b, f] oxepines described in WO 98/15647 and WO 03/057204, respectively. Further useful according to the present invention are modulators of PIMT activity described in WO 2004/039773.
  • Inhibitors of beta secretase and compositions containing such inhibitors are described, e.g. in WO 03/059346, WO 2006/099352, WO 2006/078576, WO 2006/060109, WO 2006/057983, WO 2006/057945, WO 2006/055434, WO 2006/044497, WO 2006/034296, WO 2006/034277, WO 2006/029850, WO 2006/026204, WO 2006/014944, WO 2006/014762, WO 2006/002004, US 7,109,217, WO 2005/113484, WO 2005/103043, WO 2005/103020, WO 2005/065195, WO 2005/051914, WO 2005/044830, WO 2005/032471, WO 2005/018545, WO 2005/004803, WO 2005/004802, WO 2004/062625, WO 2004/043916, WO 2004/013098, WO 03/099202,
  • beta secretase inhibitors for the purpose of the present invention are WY-25105 (Wyeth) ; Posiphen, (+) - phenserine (TorreyPines / NIH); LSN-2434074, LY-2070275, LY- 2070273, LY-2070102 (Eli Lilly & Co.); PNU-159775A, PNU-178025A, PNU-17820A, PNU-33312, PNU-38773, PNU-90530 (Elan / Pfizer);
  • Inhibitors of gamma secretase and compositions containing such inhibitors are described, e.g. in WO 2005/008250, WO 2006/004880, US 7,122,675, US 7,030,239, US 6,992,081, US 6,982,264, WO 2005/097768, WO2005/028440, WO 2004/101562, US 6,756,511, US 6,683,091, WO 03/066592, WO 03/014075, WO 03/013527, WO 02/36555, WO 01/53255, US 7,109,217, US 7,101,895, US 7,049,296, US 7,034,182, US 6,984,626, WO 2005/040126, WO 2005/030731, WO 2005/014553, US 6,890,956, EP 1334085, EP 1263774, WO 2004/101538, WO 2004/00958, WO 2004/089911, WO 2004/073630, WO 2004/069826,
  • Suitable gamma secretase inhibitors for the purpose of the present invention are GSI-953, WAY-GSI-A, WAY-GSI-B (Wyeth) ; MK- 0752, MRK-560, L-852505, L-685-458, L-852631, L-852646 (Merck & Co. Inc.); LY-450139, LY-411575, AN-37124 (Eli Lilly & Co.); BMS-299897, BMS-433796 (Bristol-Myers Squibb Co.); E-2012 (Eisai Co. Ltd.); EHT-0206, EHT-206 (ExonHit Therapeutics SA); and NGX-555 (TorreyPines Therapeutics Inc.).
  • Suitable beta amyloid synthesis inhibitors for the purpose of the present invention are for example Bisnorcymserine (Axonyx Inc.); (R) -flurbiprofen (MCP-7869; Flurizan) (Myriad Genetics); nitroflurbiprofen (NicOx) ; BGC-20-0406 (Sankyo Co. Ltd.) and BGC-20-0466 (BTG pIc).
  • Suitable amyloid protein deposition inhibitors for the purpose of the present invention are for example SP-233 (Samaritan
  • AZD-103 Ellipsis Neurotherapeutics Inc.
  • AAB-OOl (Bapineuzumab) , AAB-002, ACC-OOl (Elan Corp pic);
  • AdPEDI- (amyloid-betal-6) 11) (Vaxin Inc.); MPI-127585, MPI-423948 (Mayo Foundation) ; SP-08 (Georgetown University) ; ACU-5A5
  • Suitable PDE-4 inhibitors for the purpose of the present invention are for example Doxofylline (Instituto Biologico Chemioterapica ABC SpA.); idudilast eye drops, tipelukast, ibudilast (Kyorin Pharmaceutical Co.
  • MAO inhibitors and compositions containing such inhibitors are described, e.g. in WO 2006/091988, WO 2005/007614, WO 2004/089351, WO 01/26656, WO 01/12176, WO 99/57120, WO 99/57119, WO 99/13878, WO 98/40102, WO 98/01157, WO 96/20946, WO 94/07890 and WO 92/21333.
  • Suitable MAO-inhibitors for the purpose of the present invention are for example Linezolid (Pharmacia Corp.); RWJ-416457 (RW Johnson Pharmaceutical Research Institute) ; budipine (Altana AG); GPX-325 (BioResearch Ireland); isocarboxazid; phenelzine; tranylcypromine; indantadol (Chiesi Farmaceutici SpA.); moclobemide (Roche Holding AG); SL-25.1131 (Sanofi-Synthelabo) ;
  • Suitable histamine H3 antagonists for the purpose of the present invention are, e.g. ABT-239, ABT-834 (Abbott Laboratories);
  • PEP inhibitors and compositions containing such inhibitors are described, e.g. in JP 01042465, JP 03031298, JP 04208299, WO 00/71144, US 5,847,155; JP 09040693, JP 10077300, JP 05331072, JP 05015314, WO 95/15310, WO 93/00361, EP 0556482, JP 06234693, JP 01068396, EP 0709373, US 5,965,556, US 5,756,763, US 6,121,311, JP 63264454, JP 64000069, JP 63162672, EP 0268190, EP 0277588, EP 0275482, US 4,977,180, US 5,091,406, US 4,983,624, US 5,112,847, US 5,100,904, US 5,254,550, US 5,262,431, US 5,340,832, US 4,956,380, EP 0303434, JP 03056486, JP 01143897, JP
  • Suitable prolyl endopeptidase inhibitors for the purpose of the present invention are, e.g. Fmoc-Ala-Pyrr-CN, Z-Phe-Pro- Benzothiazole (Probiodrug) , Z-321 (Zeria Pharmaceutical Co Ltd.); ONO-1603 (Ono Pharmaceutical Co Ltd); JTP-4819 (Japan Tobacco Inc.) and S-17092 (Servier) .
  • NPY neuropeptide Y
  • NPY mimetic NPY mimetic
  • NPY agonist or antagonist NPY agonist or antagonist
  • ligand of the NPY receptors NPY receptors
  • Preferred according to the present invention are antagonists of the NPY receptors.
  • Suitable ligands or antagonists of the NPY receptors are 3a, 4 , 5, 9b-tetrahydro-lh-benz [e] indol-2-yl amine-derived compounds as disclosed in WO 00/68197.
  • NPY receptor antagonists which may be mentioned include those disclosed in European patent applications EP 0 614 911, EP 0 747 357, EP 0 747 356 and EP 0 747 378; international patent applications WO 94/17035, WO 97/19911, WO 97/19913, WO 96/12489, WO 97/19914, WO 96/22305, WO 96/40660, WO 96/12490, WO 97/09308, WO 97/20820, WO 97/20821, WO 97/20822, WO 97/20823, WO 97/19682, WO 97/25041, WO 97/34843, WO 97/46250, WO 98/03492, WO 98/03493, WO 98/03494 and WO 98/07420; WO 00/30674, US patents Nos.
  • NPY antagonists include those compounds that are specifically disclosed in these patent documents. More preferred compounds include amino acid and non-peptide-based NPY antagonists.
  • Amino acid and non-peptide-based NPY antagonists which may be mentioned include those disclosed in European patent applications EP 0 614 911, EP 0 747 357, EP 0 747 356 and EP 0 747 378; international patent applications WO 94/17035, WO 97/19911, WO 97/19913, WO 96/12489, WO 97/19914, WO 96/22305, WO 96/40660, WO 96/12490, WO 97/09308, WO 97/20820, WO 97/20821, WO 97/20822, WO 97/20823, WO 97/19682, WO 97/25041, WO 97/34843, WO 97/46250, WO 98/03492, WO 98/03493, WO 98/03494, WO 98/07420 and WO 99/15498 ; US patents Nos. 5,552,411, 5,663,192 and 5,5
  • Particularly preferred compounds include amino acid-based NPY antagonists.
  • Amino acid-based compounds which may be mentioned include those disclosed in international patent applications WO 94/17035, WO 97/19911, WO 97/19913, WO 97/19914 or, preferably, WO 99/15498.
  • Preferred amino acid-based NPY antagonists include those that are specifically disclosed in these patent documents, for example BIBP3226 and, especially, (R) -N2- (diphenylacetyl) - (R) -N- [ 1- (4-hydroxy- phenyl) ethyl] arginine amide (Example 4 of international patent application WO 99/15498) .
  • Ml receptor agonists and compositions containing such inhibitors are described, e.g. in WO 2004/087158, WO 91/10664.
  • Suitable Ml receptor antagonists for the purpose of the present invention are for example CDD-0102 (Cognitive Pharmaceuticals) ; Cevimeline (Evoxac) (Snow Brand Milk Products Co.
  • Acetylcholinesterase inhibitors and compositions containing such inhibitors are described, e.g. in WO 2006/071274, WO 2006/070394, WO 2006/040688, WO 2005/092009, WO 2005/079789, WO 2005/039580, WO 2005/027975, WO 2004/084884, WO 2004/037234, WO 2004/032929, WO 03/101458, WO 03/091220, WO 03/082820, WO 03/020289, WO 02/32412, WO 01/85145, WO 01/78728, WO 01/66096, WO 00/02549, WO 01/00215, WO 00/15205, WO 00/23057, WO 00/33840, WO 00/30446, WO 00/23057, WO 00/15205, WO 00/09483, WO 00/07600, WO 00/02549, WO 99/
  • Suitable acetylcholinesterase inhibitors for the purpose of the present invention are for example Donepezil (Eisai Co. Ltd.); rivastigmine (Novartis AG); (-) -phenserine (TorreyPines Therapeutics) ; ladostigil (Hebrew University of Jerusalem) ; huperzine A (Mayo Foundation) ; galantamine (Johnson & Johnson) ;
  • BGC-20-1259 (Sankyo Co. Ltd.); physostigmine (Forest Laboratories Inc.); NP-0361 (Neuropharma SA); ZT-I (Debiopharm) ; tacrine (Warner-Lambert Co.); metrifonate (Bayer Corp.) and INM-176 (Whanln) .
  • NMDA receptor antagonists and compositions containing such inhibitors are described, e.g. in WO 2006/094674, WO 2006/058236, WO 2006/058059, WO 2006/010965, WO 2005/000216, WO 2005/102390, WO 2005/079779, WO 2005/079756, WO 2005/072705, WO 2005/070429, WO 2005/055996, WO 2005/035522, WO 2005/009421, WO 2005/000216, WO 2004/092189, WO 2004/039371, WO 2004/028522, WO 2004/009062, WO 03/010159, WO 02/072542, WO 02/34718, WO 01/98262, WO 01/94321, WO 01/92204, WO 01/81295, WO 01/32640, WO 01/10833, WO 01/10831, WO 00/56711, WO 00/29023, WO
  • Suitable NMDA receptor antagonists for the purpose of the present invention are for example Memantine (Merz & Co. GmbH); topiramate (Johnson & Johnson) ; AVP-923 (Neurodex) (Center for Neurologic Study); EN-3231 (Endo Pharmaceuticals Holdings Inc.); neramexane (MRZ-2/579) (Merz and Forest); CNS-5161 (CeNeS Pharmaceuticals Inc.); dexanabinol (HU-211; Sinnabidol; PA- 50211) (Pharmos) ; EpiCept NP-I (Dalhousie University); indantadol (V-3381; CNP-3381) (Vernalis) ; perzinfotel (EAA-090, WAY-126090, EAA-129) (Wyeth) ; RGH-896 (Gedeon Richter Ltd.); traxoprodil (CP-101606), besonprodil (PD-196860, CI-1041) (
  • the present invention relates to combination therapies useful for the treatment of atherosclerosis, restenosis, pancreatitis or arthritis, administering a QC inhibitor in combination with another therapeutic agent selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors providing beneficial or synergistic therapeutic effects over each monotherapy component alone.
  • ACE angiotensin converting enzyme
  • CB calcium channel blockers
  • beta-blockers beta-blockers
  • Angiotensin II receptor blockers are understood to be those active agents that bind to the ATI -receptor subtype of angiotensin II receptor but do not result in activation of the receptor. As a consequence of the blockade of the ATI receptor, these antagonists can, e.g. be employed as antihypertensive agents .
  • Suitable angiotensin II receptor blockers which may be employed in the combination of the present invention include ATi receptor antagonists having differing structural features, preferred are those with non-peptidic structures.
  • ATi receptor antagonists having differing structural features, preferred are those with non-peptidic structures.
  • Preferred ATI-receptor antagonists are those agents that have been approved and reached the market, most preferred is valsartan, or a pharmaceutically acceptable salt thereof.
  • the interruption of the enzymatic degradation of angiotensin to angiotensin II with ACE inhibitors is a successful variant for the regulation of blood pressure and thus also makes available a therapeutic method for the treatment of hypertension.
  • a suitable ACE inhibitor to be employed in the combination of the present invention is, e.g. a compound selected from the group consisting alacepril, benazepril, benazeprilat ; captopril, ceronapril, cilazapril, delapril, enalapril, enaprilat, fosinopril, imidapril, lisinopril, moveltopril, perindopril, quinapril, ramipril, spirapril, temocapril and trandolapril, or in each case, a pharmaceutically acceptable salt thereof.
  • Preferred ACE inhibitors are those agents that have been marketed, most preferred are benazepril and enalapril.
  • a diuretic is, for example, a thiazide derivative selected from the group consisting of chlorothiazide, hydrochlorothiazide, methylclothiazide, and chlorothalidon .
  • the most preferred diuretic is hydrochlorothiazide.
  • a diuretic furthermore comprises a potassium sparing diuretic such as amiloride or triameterine, or a pharmaceutically acceptable salt thereof.
  • the class of CCBs essentially comprises dihydropyridines (DHPs) and non- DHPs, such as diltiazem-type and verapamil-type CCBs.
  • DHPs dihydropyridines
  • non- DHPs such as diltiazem-type and verapamil-type CCBs.
  • a CCB useful in said combination is preferably a DHP representative selected from the group consisting of amlodipine, felodipine, ryosidine, isradipine, lacidipine, nicardipine, nifedipine, niguldipine, niludipine, nimodipine, nisoldipine, nitrendipine and nivaldipine, and is preferably a non-DHP representative selected from the group consisting of flunarizine, prenylamine, diltiazem, fendiline, gallopamil, mibefradil, anipamil, tiapamil and verapamil, and in each case, a pharmaceutically acceptable salt thereof. All these CCBs are therapeutically used, e.g. as anti-hypertensive, anti-angina pectoris or anti-arrhythmic drugs.
  • Preferred CCBs comprise amlodipine, diltiazem, isradipine, nicardipine, nifedipine, nimodipine, nisoldipine, nitrendipine and verapamil or, e.g. dependent on the specific CCB, a pharmaceutically acceptable salt thereof.
  • DHP is amlodipine or a pharmaceutically acceptable salt thereof, especially the besylate.
  • An especially preferred representative of non-DHPs is verapamil or a pharmaceutically acceptable salt, especially the hydrochloride, thereof.
  • Beta-blockers suitable for use in the present invention include beta-adrenergic blocking agents (beta-blockers) , which compete with epinephrine for beta-adrenergic receptors and interfere with the action of epinephrine.
  • beta-blockers are selective for the beta-adrenergic receptor as compared to the alpha-adrenergic receptors, and so do not have a significant alpha-blocking effect.
  • Suitable beta-blockers include compounds selected from acebutolol, atenolol, betaxolol, bisoprolol, carteolol, carvedilol, esmolol, labetalol, metoprolol, nadolol, oxprenolol, penbutolol, pindolol, propranolol, sotalol and timolol.
  • beta-blocker is an acid or base or otherwise capable of forming pharmaceutically acceptable salts or prodrugs
  • these forms are considered to be encompassed herein, and it is understood that the compounds may be administered in free form or in the form of a pharmaceutically acceptable salt or a prodrug, such as a physiologically hydrolyzable and acceptable ester.
  • a pharmaceutically acceptable salt or a prodrug such as a physiologically hydrolyzable and acceptable ester.
  • metoprolol is suitably administered as its tartrate salt
  • propranolol is suitably administered as the hydrochloride salt, and so forth.
  • Platelet aggregation inhibitors include PLAVIX® (clopidogrel bisulfate) , PLETAL® (cilostazol) and aspirin.
  • Cholesterol absorption modulators include ZETIA® (ezetimibe) and KT6-971 (Kotobuki Pharmaceutical Co. Japan).
  • HMG-Co-A reductase inhibitors also called beta-hydroxy-beta- methylglutaryl-co-enzyme-A reductase inhibitors or statins
  • statins are understood to be those active agents which may be used to lower lipid levels including cholesterol in blood.
  • the class of HMG-Co-A reductase inhibitors comprises compounds having differing structural features.
  • the compounds which are selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, pitavastatin, pravastatin, rosuvastatin and simvastatin, or in each case, a pharmaceutically acceptable salt thereof .
  • HMG-Co-A reductase inhibitors are those agents, which have been marketed, most preferred is atorvastatin, pitavastatin or simvastatin, or a pharmaceutically acceptable salt thereof.
  • HDL-increasing compounds include, but are not limited to, cholesterol ester transfer protein (CETP) inhibitors.
  • CETP inhibitors include JTT7O5 disclosed in Example 26 of U.S. Patent No. 6,426,365 issued July 30, 2002, and pharmaceutically acceptable salts thereof.
  • Inhibition of interleukin 6 mediated inflammation may be achieved indirectly through regulation of endogenous cholesterol synthesis and isoprenoid depletion or by direct inhibition of the signal transduction pathway utilizing interleukin-6 inhibitor/antibody, interleukin-6 receptor inhibitor/antibody, interleukin-6 antisense oligonucleotide (ASON), gpl30 protein inhibitor/antibody, tyrosine kinase inhibitors/antibodies, serine/threonine kinase inhibitors/antibodies, mitogen-activated protein (MAP) kinase inhibitors/antibodies, phosphatidylinositol
  • PI3K 3-kinase inhibitors/antibodies
  • Nuclear factor kappaB 3-kinase inhibitors/antibodies
  • NF-KB 1KB kinase
  • IKK 1KB kinase
  • API activator protein-1
  • STAT transcription factors inhibitors/antibodies altered IL-6, partial peptides of IL-6 or IL-6 receptor, or SOCS (suppressors of cytokine signaling) protein, PPAR gamma and/or PPAR beta/delta activators/ligands or a functional fragment thereof.
  • a suitable antiinflammatory corticosteroid is dexamethasone .
  • Suitable antiproliferative agents are cladribine, rapamycin, vincristine and taxol.
  • a suitable inhibitor of extracellular matrix synthesis is halofuginone .
  • a suitable growth factor or cytokine signal transduction inhibitor is, e.g. the ras inhibitor R115777.
  • a suitable tyrosine kinase inhibitor is tyrphostin.
  • Suitable renin inhibitors are described, e.g. in WO 2006/116435.
  • a preferred renin inhibitor is aliskiren, preferably in the form of the hemi-fumarate salt thereof.
  • MCP-I antagonists may, e.g. be selected from anti-MCP-1 antibodies, preferably monoclonal or humanized monoclonal antibodies, MCP-I expression inhibitors, CCR2-antagonists, TNF- alpha inhibitors, VCAM-I gene expression inhibitors and anti-C5a monoclonal antibodies.
  • MCP-I antagonists and compositions containing such inhibitors are described, e.g. in WO 02/070509, WO 02/081463, WO 02/060900, US 2006/670364, US 2006/677365, WO 2006/097624, US 2006/316449, WO 2004/056727, WO 03/053368, WO 00/198289, WO 00/157226, WO 00/046195, WO 00/046196, WO 00/046199, WO 00/046198, WO 00/046197, WO 99/046991, WO 99/007351, WO 98/006703, WO 97/012615, WO 2005/105133, WO 03/037376, WO 2006/125202, WO
  • Suitable MCP-I antagonists are, for instance, C-243 (Telik Inc.); NOX-E36 (Noxxon Pharma AG); AP-761 (Actimis Pharmaceuticals Inc.); ABN-912, NIBR-177 (Novartis AG); CC- 11006 (Celgene Corp.); SSR-150106 (Sanofi-Aventis) ; MLN-1202 (Millenium Pharmaceuticals Inc.); AGI-1067, AGIX-4207, AGI-1096 (AtherioGenics Inc.); PRS-211095, PRS-211092 (Pharmos Corp.); anti-C5a monoclonal antibodies, e.g.
  • neutrazumab G2 Therapies Ltd.
  • AZD-6942 AstraZeneca pic
  • 2-mercaptoimidazoles Johnson & Johnson
  • TEI-E00526, TEI-6122 Deltagen
  • RS-504393 Roche Holding AG
  • SB-282241, SB-380732, ADR-7 GaxoSmithKline
  • anti-MCP-1 monoclonal antibodies Johnson & Johnson
  • Combinations of QC-inhibitors with MCP-I antagonists may be useful for the treatment of inflammatory diseases in general, including neurodegenerative diseases.
  • Combinations of QC-inhibitors with MCP-I antagonists are preferred for the treatment of Alzheimer's disease.
  • the QC inhibitor is combined with one or more compounds selected from the following group: PF-4360365, m266, bapineuzumab, R-1450, Posiphen, (+) - phenserine, MK-0752, LY-450139, E-2012, (R) -flurbiprofen, AZD- 103, AAB-OOl (Bapineuzumab), Tramiprosate, EGb-761, TAK-070, Doxofylline, theophylline, cilomilast, tofimilast, roflumilast, tetomilast, tipelukast, ibudilast, HT-0712, MEM-1414, oglemilast, Linezolid, budipine, isocarboxazid, phenelzine, tranylcypromine, indantadol, moclobemide, rasagiline, ladostigil, sa
  • a QC inhibitor in particular QCI, in combination with Atorvastatin for the treatment and/or prevention of artherosclerosis
  • a QC inhibitor in particular QCI
  • immunosuppressive agents preferably rapamycin for the prevention and/or treatment of restenosis - a QC inhibitor, in particular QCI
  • immunosuppressive agents preferably paclitaxel for the prevention and/or treatment of restenosis
  • QC inhibitor in particular QCI
  • AChE inhibitors preferably Donepezil
  • QC inhibitor in particular QCI, in combination with interferones, preferably Aronex, for the prevention and/or treatment of multiple sclerosis - a QC inhibitor, in particular QCI, in combination with interferones, preferably betaferon, for the prevention and/or treatment of multiple sclerosis
  • a QC inhibitor in particular QCI, in combination with dexamethasone, for the prevention and/or treatment of atherosclerosis - a QC inhibitor, in particular QCI, in combination with dexamethasone, for the prevention and/or treatment of rheumatid arthritis
  • HMG-Co-A-reductase inhibitor in particular QCI, in combination with HMG-Co-A-reductase inhibitors, for the prevention and/or treatment of restenosis
  • the HMG-Co-A-reductase inhibitor is selected from atorvastatin, cerivastatin, fluvastatin, lovastatin, pitavastatin, pravastatin, rosuvastatin and simvastatin - a QC inhibitor, in particular QCI, in combination with HMG-Co-A reductase inhibitors, for the prevention and/or treatment of atherosclerosis
  • the HMG-Co-A- reductase inhibitor is selected from atorvastatin, cerivastatin, fluvastatin, lovastatin, pitavastatin, pravastatin, rosuvastatin and simvastatin
  • HMG-Co-A reductase inhibitor in particular QCI, in combination with HMG-Co-A reductase inhibitors, for the prevention and/or treatment of rheumatoid arthritis
  • HMG-Co-A- reductase inhibitor is selected from atorvastatin, cerivastatin, fluvastatin, lovastatin, pitavastatin, pravastatin, rosuvastatin and simvastatin
  • Such a combination therapy is in particular useful for AD, FAD, FDD and neurodegeneration in Down syndrome as well as atherosclerosis, rheumatoid arthritis, restenosis and pancreatitis .
  • Such combination therapies might result in a better therapeutic effect (less proliferation as well as less inflammation, a stimulus for proliferation) than would occur with either agent alone .
  • the present invention provides a method for preventing or treating a disease or condition, selected from a group consisting of inflammatory diseases selected from a. neurodegenerative diseases, e.g. mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, e.g. rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, e.g. lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, e.g.
  • a disease or condition selected from a group consisting of inflammatory diseases selected from a. neurodegenerative diseases, e.g. mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, e.g
  • cancer/hemangioendothelioma proliferation gastric carcinomas, e. metabolic diseases, e.g. hypertension, f. and other inflammatory diseases, e.g. neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis.
  • metabolic diseases e.g. hypertension
  • f. and other inflammatory diseases e.g. neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis.
  • the present invention includes the use of the compounds of this invention and their corresponding pharmaceutically acceptable acid salt forms for the preparation of a medicament for the prevention or treatment of any of the above diseases or conditions.
  • the present QC inhibitors are used for the treatment of the above-mentioned neurodegenerative diseases. Even prefered is the use of the QC inhibitors of the present invention for the treatment of a disease selected from restenosis, pancreatitis, rheumatoid arthritis and atherosclerosis, most preferably restenosis or pancreatitis.
  • the compound may be administered to a patient by any conventional route of administration, including, but not limited to, intravenous, oral, subcutaneous, intramuscular, intradermal, parenteral and combinations thereof.
  • the invention relates to pharmaceutical compositions, that is to say, medicaments, that contain at least one compound of the invention or salts thereof, optionally in combination with one or more pharmaceutically acceptable carriers and/or solvents.
  • compositions may, for example, be in the form of parenteral or enteral formulations and contain appropriate carriers, or they may be in the form of oral formulations that may contain appropriate carriers suitable for oral administration. Preferably, they are in the form of oral formulations .
  • the inhibitors of QC activity administered according to the invention may be employed in pharmaceutically administrable formulations or formulation complexes as inhibitors or in combination with inhibitors, substrates, pseudosubstrates, inhibitors of QC expression, binding proteins or antibodies of those enzyme proteins that reduce the QC protein concentration in mammals.
  • the compounds of the invention make it possible to adjust treatment individually to patients and diseases, it being possible, in particular, to avoid individual intolerances, allergies and side-effects.
  • the compounds also exhibit differing degrees of activity as a function of time.
  • the physician providing treatment is thereby given the opportunity to respond differently to the individual situation of patients: he is able to adjust precisely, on the one hand, the speed of the onset of action and, on the other hand, the duration of action and especially the intensity of action .
  • the compounds may be advantageously administered, for example, in the form of pharmaceutical preparations that contain the active ingredient in combination with customary additives like diluents, excipients and/or carriers known from the prior art.
  • they can be administered parenterally (for example i.v. in physiological saline solution) or enterally (for example orally, formulated with customary carriers) .
  • one or more doses of the compounds can be given per day in order to achieve the desired reduction of MCP activity.
  • a dosage range in humans may be in the range of from about 0.01 mg to 250.0 mg per day, preferably in the range of about 0.01 to 100 mg of compound per kilogram of body weight per day.
  • the compounds used according to the invention can accordingly be converted in a manner known per se into conventional formulations, such as, for example, tablets, (bitable) capsules, dragees, pills, suppositories, granules, aerosols, syrups, drops, liquid, solid and cream-like emulsions and suspensions and/or also as suppositories or as nasal sprays solutions, using inert, non-toxic, pharmaceutically suitable carriers and additives or solvents.
  • the therapeutically effective compounds are preferably present in a concentration of approximately from 0.1 to 80% by weight, more preferably from 1 to 50% by weight, of the total mixture, that is to say, in amounts sufficient for the mentioned dosage latitude to be obtained.
  • the formulations may be advantageously prepared, for example, by extending the active ingredient with solvents and/or carriers, optionally with the use of emulsifiers and/or dispersants, it being possible, for example, in the case where water is used as diluent, for organic solvents to be optionally used as auxiliary solvents .
  • excipients useful in connection with the present invention include: water, non-toxic organic solvents, such as paraffins (for example natural oil fractions) , vegetable oils
  • solid carriers such as, for example, natural powdered minerals (for example highly dispersed silica, silicates) , sugars (for example raw sugar, lactose and dextrose) ; emulsifiers, such as non-ionic and anionic emulsifiers (for example polyoxyethylene fatty acid esters, polyoxyethylene fatty alcohol ethers, alkylsulphonates and arylsulphonates) , dispersants (for example lignin, sulphite liquors, methylcellulose, starch and polyvinylpyrrolidone) and lubricants (for example magnesium stearate, talcum, stearic acid and sodium lauryl sulphate) and optionally flavourings.
  • natural powdered minerals for example highly dispersed silica, silicates
  • sugars for example raw sugar, lactose and dextrose
  • emulsifiers such as non-ionic and anionic emulsifiers (for example polyoxy
  • Administration may be carried out in the usual manner, preferably enterally or parenterally, especially orally.
  • tablets may contain in addition to the mentioned carriers further additives such as sodium citrate, calcium carbonate and calcium phosphate, together with various additives, such as starch, preferably potato starch, gelatin and the like.
  • lubricants such as magnesium stearate, sodium lauryl sulphate and talcum, can be used concomitantly for tabletting.
  • various taste correctives or colourings can be added to the active ingredients in addition to the above-mentioned excipients.
  • solutions of the active ingredients using suitable liquid carriers can be employed.
  • Pichia pastoris strain X33 (AOXl, A0X2), used for the expression of human QC was grown, transformed and analyzed according to the manufacturer's instructions (Invitrogen) . The media required for
  • P. pastoris i.e. buffered glycerol (BMGY) complex or methanol
  • the pQE-31 vector (Qiagen) was used to express the human QC in E. coll.
  • the cDNA of the mature QC starting with codon 38 was fused in frame with the plasmid encoded ⁇ xhistidine tag.
  • the fragment was inserted into the expression vector employing the restriction sites of Sphl and Hindlll.
  • Plasmid DNA was amplified in E. coll JM109 and purified according to the recommendations of the manufacturer (Qiagen) .
  • pPICZCCB three restriction sites are provided for linearization. Since Sad and BstXI cut within the QC cDNA, Pmel was chosen for linearization. 20-30 ⁇ g plasmid DNA was linearized with Pmel, precipitated by ethanol, and dissolved in sterile, deionized water. 10 ⁇ g of the DNA was then applied for transformation of competent P. pastoris cells by electroporation according to the manufacturer's instructions (BioRad) . Selection was done using plates containing 150 ⁇ g/ml Zeocin. One transformation using the linearized plasmid yielded several hundred transformants .
  • recombinant yeast clones were grown for 24 h in 10 ml conical tubes containing 2 ml BMGY. Afterwards, the yeast was centrifuged and resuspended in 2 ml BMMY containing 0.5 % methanol. This concentration was maintained by addition of methanol every 24 h up to 72 h. Subsequently, QC activity in the supernatant was determined. The presence of the fusion protein was confirmed by western blot analysis using an antibody directed against the ⁇ xhistidine tag (Qiagen) . Clones that displayed the highest QC activity were chosen for further experiments and fermentation.
  • the resulting eluate was dialyzed against 20 mM Bis-Tris/HCI, pH 6.8, at 4°C overnight. Subsequently, the QC was further purified by anion exchange chromatography an a Mono Q6 column (BioRad) , equilibrated with dialysis buffer. The QC-containing fraction was loaded onto the column using a flow rate of 4 ml/min. The column was then washed with equilibration buffer containing 100 mM NaCl. The elution was performed by two gradients resulting in equilibration buffer containing 240 mM and 360 mM NaCl in 30 or 5 column volumes, respectively.
  • the construct encoding the QC was transformed into M15 cells (Qiagen) and grown an selective LB agar plates at 37°C. Protein expression was carried out in LB medium containing 1% glucose and 1% ethanol at room temperature. When the culture reached an ODg QQ of approximately 0.8, expression was induced with 0,1 mM IPTG overnight. After one cycle of freezing and thawing, cells were lysed at 4°C by addition of 2.5 mg/ml lysozyme in 50 mM phosphate buffer, pH 8.0, containing 300 mM NaCl and 2 mM histidine for approximately 30 min.
  • the solution was clarified by centrifugation at 37000xg, 4 0 C for 30 min, followed by a filtration applying a glass frit (DNA separation) and two additional filtration steps applying cellulose filters for crude and fine precipitates.
  • the supernatant (approx. 500 ml) was applied onto a Ni2+-affinity column (1.6 x 20 cm) at a flow rate of 1 ml/min.
  • Elution of QC was carried out with 50 mM phosphate buffer containing 150 mM NaCl and 100 mM histidine.
  • the QC- containing fraction was concentrated by ultrafiltration.
  • Matrix-assisted laser desorption/ionization mass spectrometry was carried out using the Voyager De-Pro (Applied Biosystems, Darmstadt) with a linear time of flight analyzer. The instrument was equipped with a 337 nm nitrogen laser, a potential acceleration source and a 1.4 m flight tube. Detector operation was in the positive-ion mode. Samples (5 ⁇ l) were mixed with equal volumes of the matrix solution.
  • sinapinic acid prepared by solving 20 mg sinapinic acid (Sigma-Aldrich) in 1 ml acetonitrile/0.1% TFA in water (1/1, v/v) . A small volume ( ⁇ 1 ⁇ l) of the matrix-analyte-mixture was transferred to a probe tip.
  • a ⁇ -derived peptides were incubated in 100 ⁇ l 0.1 M sodium acetate buffer, pH 5.2 or 0.1 M Bis-Tris buffer, pH 6.5 at 30 0 C. Peptides were applied in 0.5 mM [A ⁇ 3-ll a] or 0.15 mM [A ⁇ 3-21a] concentrations, and 0.2 U QC was added all 24 hours. In case of A ⁇ 3-21a, the assays contained 1 % DMSO. At different times, samples were removed from the assay tube, peptides extracted using ZipTips
  • Human neuroblastoma cell line SH-SY5Y, human embryonic kidney cell line HEK293 and human monocyte cell line THP-I were cultured in appropriate cell culture media (DMEM, 10% FBS for SH-SY5Y and HEK293), (RPMI1640, 10 % FBS for THP-I), in a humidified atmosphere of 5% CO 2 (HEK293, THP-I) or 10% CO 2 (SH- SY5Y) at 37°C.
  • DMEM 10% FBS for SH-SY5Y and HEK293
  • RPMI1640 10 % FBS for THP-I
  • RNA of human MCP-I was isolated from SH-SY5Y cells using RT-PCR. Total RNA of SH-SY5Y cells was reversely transcribed by Superscript II (Invitrogen) and subsequently, human MCP-I was amplified on a 1:12,5 dilution of generated cDNA product in a 25 ⁇ l reaction with Pfu-DNA-Polymerase (Promega) using primers hMCP-1-1 (sense) and hMCP-1-2 (antisense) (Table 1) . The resulting PCR-product was cloned into vector pcDNA 3.1 using the HindIII and Notl restriction sites and the sequence confirmed by DNA-sequencing.
  • Site-directed mutagenesis of human MCP-I Deletions of the first ( ⁇ Q1) and first and second ( ⁇ Q1P2) amino acids of the mature human MCP-I were generated by site-directed mutagenesis using primer ⁇ Q1-1 and ⁇ Q1-2 for ⁇ Q1 (Table 1) and primers ⁇ Q1P2-1 and ⁇ Q1P2-2 for ⁇ Q1P2 (Table 1) .
  • Parental DNA was digested with Dpn I.
  • the pcDNA 3.1 plasmids with the deletions ⁇ Q1 and ⁇ Q1P2 of the mature human MCP-I were transformed into E. coli JM109. Ampicillin-resistant clones were confirmed by sequencing and subsequently isolated for cell culture purposes using the EndoFree Maxi Kit (Qiagen) .
  • N-terminal variants of human MCP-I in HEK293 cells
  • HEK293 cells were cultured in collagen I coated 6-well dishes and grown until 80% confluency, transfected using Lipofectamin2000 (Invitrogen) according to manufacturer's manual and incubated in the transfection solution for 5 hours. Afterwards, cells were allowed to recover in normal growth media over night. The next day, cells were incubated another 24 h in growth media. For analysis of efficacy of QC-inhibition, cells were incubated for 24 h in absence or presence of the specific inhibitor.
  • Lipofectamin2000 Invitrogen
  • the media containing the human MCP-I variants were collected and investigated in a migration assay for chemotactic potency. Furthermore, an aliquot of cell culture supernatant was stored at -80°C for quantification of human MCP-I concentration using a human MCP-I-ELISA (Pierce) .
  • the chemotaxis assay was performed using 24 well TransWell plates with a pore size of 5 ⁇ m (Corning) .
  • Media containing the human MCP-I variants expressed in HEK293 were used as chemoattractant .
  • 600 ⁇ l of the culture media of N-terminal human MCP-I variants was applied undiluted or in dilutions 1:3, 1:10 and 1:30 in RPMI1640 to the lower chamber of the TransWell plate.
  • undiluted media of HEK293 cells transfected with vector control were applied as negative control to the lower chamber.
  • THP-I cells were harvested and resuspended in RPMI1640 in a concentration of 1*10 ⁇ cells / 100 ⁇ l and applied in 100 ⁇ l aliquots to the upper chamber. Cells were allowed to migrate towards the chemoattractant for 2 h at 37 0 C. Subsequently, cells from the upper chamber were discarded and the lower chamber was mixed with 50 ⁇ l 70 mM EDTA in PBS and incubated for 15 min at 37°C to release cells attached to the membrane. Afterwards, cells migrated to the lower chamber were counted using a cell counter system (Scharfe System) . The chemotactic index was calculated by dividing cells migrated to the stimulus from cells migrated to the negative control.
  • Example 2 Investigations on the proteolytic degradation of human MCP-I (i-76)
  • Full length recombinant human MCP-I ( 1-76 ) (SEQ ID NO: 1) encoded by the nucleic acid sequence as shown in SEQ ID NO: 2, obtained in Example 1 above, starting with an N-terminal glutamine (Peprotech) was dissolved in 25 mM Tris/HCl pH 7.6 in a concentration of 10 ⁇ g/ml .
  • the MCP-I solution was either pre- incubated with recombinant human QC (0.0006 mg/ml) (obtained according to Reference Example 1 above, SEQ ID No: 3 for nucleic acid sequence and SEQ ID No: 4 for amino acid sequence) for 3 h at 30 0 C and subsequently incubated with recombinant human DP4
  • APMA enzyme-mixture of 10:1.
  • MCP-I was either pre-incubated with recombinant human QC (0.0006 mg/ml) for 3 h at 30 0 C and subsequently incubated with MMP-I at 30 0 C or incubated with MMP-I without prior QC application.
  • Resulting MMP-I cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h using Maldi-TOF mass spectrometry.
  • MMP-I proenzyme from human rheumatoid synovial fibroblasts (Calbiochem) was activated using
  • the APMA enzyme-mixture of 10:1 was incubated at 37°C for 3h.
  • MCP-I solution was either pre-incubated with recombinant human QC (0.0006 mg/ml) for 3 h at 30 0 C and subsequently incubated with MMP-I and DP4 at 30 0 C or incubated with MMP-I and DP4 without QC application.
  • Resulting MMP-I cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h using Maldi-TOF mass spectrometry.
  • Example 3 Effect of QC specific inhibitor 1- (3- (lH-imidazol-Ziyi) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride (in the following also designated as QCI) on cuff-induced accelerated atherosclerosis in ApoE3*Leiden mice
  • mice 30 male ApoE3*Leiden mice (age 12 weeks) were fed a mildly hypercholesterolemic diet for 3 weeks prior to surgical cuff placement .
  • mice After 3 weeks, the mice underwent surgical non-constricting cuff placement (day 0) and were divided into 2 groups, matched for plasma cholesterol levels. The mice either received control
  • mice were anaesthetized with an intraperitoneal injection of 5 mg/kg Dormicum, 0.5 mg/kg Domitor and 0.05 mg/kg Fentanyl .
  • This cocktail gives complete narcosis for at least one hour and can be quickly antagonized with Antisedan 2.5 mg/kg and Anexate 0.5 mg/kg.
  • a longitudinal 1 cm incision is made in the internal side of the leg and the femoral artery is dissected for 3 mm length from the femoral nerve and femoral vein.
  • the femoral artery is looped with a ligature and a non-constrictive fine bore polyethylene tubing (0.4 mm inner diameter, 0.8 mm outer diameter, length 2 mm) is longitudinally opened and sleeved loosely around the femoral artery.
  • the cuff is closed up with two ligature knots.
  • the skin is closed with a continued suture.
  • mice were sacrificed either 2 days or 14 days after cuff placement. After anaesthesia, the thorax was opened and a mild pressure-perfusion (100 mmHg) with 4% formaldehyde was performed for 3 minutes by cardiac puncture. After perfusion, a longitudinal 2 cm incision was made in the internal side of the leg and the cuffed femoral artery was harvested as a whole and fixed overnight in 4% formaldehyde and processed to paraffin.
  • a mild pressure-perfusion 100 mmHg
  • formaldehyde 4% formaldehyde
  • Adhesion of leukocytes in general and monocytes/macrophages in particular to the activated endothelium of the cuffed vessel wall was analyzed by microscopic analysis of cross sections harvested 2 days after cuff placement.
  • the number of adhering and/or infiltrating leukocytes in general, identified as adhering cells at the luminal side of the vessel segment, and monocytes/macrophages in particular was counted and illustrated as cells per cross-section or as defined areas per cross section.
  • Monocytes were identified by specific immunohistochemical staining by the polyclonal rabbit AIA31240 antibody, recognizing monocytes and macrophages. In addition on these sections a specific immunohistochemical staining for MCP-I was performed.
  • Vessel wall remodeling Analysis of vascular remodeling and accelerated athero-sclerosis Vessel wall remodeling, accelerated atherosclerosis and neoinitima formation were analyzed morphometrically in all mice sacrificed after 14 days. A full comparison between the two groups was performed for all relevant vessel wall parameters (neointima formation, vascular circumference (i.e. outward remodelling) , media thickness, lumen stenosis) . Accelerated atherosclerosis was analyzed by immunohistochemical staining for macrophages and foam cells in the lesion area by AIA31240 antibody. Furthermore, these sections were also stained for MCP- 1.
  • Example 4 Proteolytic degradation of human MCP-I ⁇ -76) by Dipeptidyl-peptidase 4 (DP4) , , Aminopeptidase P, and by proteases present in human serum
  • Recombinant human MCP-I ( i- ⁇ Q) (SEQ ID NO: 1) encoded by the nucleic acid sequence as shown in SEQ ID NO: 2, obtained in Example 1 above, starting with an N-terminal glutamine (Peprotech) was dissolved in 25 mM Tris/HCl pH 7.6 in a concentration of 10 ⁇ g/ml .
  • the MCP-I solution was either pre- incubated with recombinant human QC (0.0006 mg/ml) (obtained according to Reference Example 1 above) for 3 h at 30 0 C and subsequently incubated with recombinant human DP4 (0.0012 mg/ml) at 30 0 C (see Fig. 1) or incubated with DP4 without prior QC application.
  • MCP-I N-terminal degradation of human MCP-I in human serum
  • Human recombinant MCP-I carrying an N-terminal glutaminyl instead of a pyroglutamyl residue (Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6, in a concentration of 100 ⁇ g/ml.
  • MCP-I was either pre-incubated with recombinant human QC (0.006 mg/ml) for 3 h at 30 0 C and subsequently incubated with human serum at 30 °C or incubated with human serum without addition of QC.
  • the cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 10 min, 30 min, Ih, 2h, 3h 5h and 7 h for Glr ⁇ -MCP-l and 0 min, 30 min, Ih, 2h, 3h 5h, 7 h and 24 h for pGlu ⁇ MCP-l.
  • Example 5 Degradation of human MCP-2, MCP-3 and MCP-4
  • MCP-3 Human recombinant MCP-3 carrying an N-terminal glutaminyl instead of a pyroglutamyl residue (Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6, in a concentration of 10 ⁇ g/ml .
  • MCP-3 was either pre-incubated with recombinant human QC (0.0006 mg/ml) for 3 h at 30 0 C and subsequently incubated with recombinant human DP4 (0.00012 mg/ml) at 30 0 C or incubated with recombinant human DP4 (0.00012 mg/ml) without prior QC application.
  • Resulting DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h.
  • N-terminal degradation of human MCP-4 by DP4 Human recombinant MCP-4 carrying an N-terminal glutaminyl instead of a pyroglutamyl residue (Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6, in a concentration of 10 ⁇ g/ml. MCP-4 was either pre-incubated with recombinant human QC (0.0006 mg/ml) for 3 h at 30 0 C and subsequently incubated with recombinant human DP4 (0.00006 mg/ml) at 30 °C or incubated with recombinant human DP4 (0.00006 mg/ml) without prior QC application. Resulting DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h .
  • Example 6 Chemotactic Potency of different N-terminal variants of human MCP-I, MCP-2, MCP-3, MCP-4
  • Chemotactic Potency of N-terminal variants of human MCP-I MCP-I starting with glutamine 1 (Glr ⁇ -MCP-l) (Peprotech) was incubated with (i) recombinant human QC to generate pGlu 1 -MCP-l, (ii) human recombinant DP4 to generate Asp 3 -MCP-l, (iii) human synovial fibroblast MMP-I to generate Ile 5 -MCP-l and human recombinant Aminopeptidase P to generate Pro 2 -MCP-l.
  • the QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride was formulated using 0.9% (w/v) saline at the highest concentration required. Lower doses were obtained by serial dilution using 0.9% (w/v) saline.
  • a stock solution (lmg/mL) of LPS was prepared using 0.9% (w/v) saline and diluted using 0.9% (w/v) saline to provide the required concentration for dosing.
  • Dose levels were expressed in terms of the amount of inhibitor administered without regard to purity or active content.
  • a terminal blood sample was collected at 2 hours post-LPS. Blood samples were centrifuged at 2300 x g for 10 minutes at 4°C and subsequently analyzed for TNFCC. Samples were analysed using a quantitative sandwich enzyme immunoassay.
  • Example 8 Evaluation of a QC-inhibitor in a mouse model of thioglycollate-induced peritonitis
  • mice were purchased from Charles River Laboratories Inc. For each experiment the mice were age- and sex-matched.
  • mice were injected i.p. with various concentrations of QC-inhibitor.
  • the animals were anesthesized using 2% isofluran.
  • Peritoneal exudates were collected at time points (4, 24 hours) after thioglycollate injection by washing the peritoneum with 8 ml of sterile phosphate-buffered saline (PBS) . Subsequently, the lavage fluids were centrifuged to pellet the cells and stained for FACS analysis.
  • PBS sterile phosphate-buffered saline
  • CD3-FITC (Caltag) /CD13-PE (BD) /F4/80-APC (Caltag); Moma2-FITC
  • Purified human MCP-I displays a bell-shaped chemotactic dose response curve, when attracting, e.g. monocytes, showing an optimum at approx. 1-50 ng/ml . Therefore, the generated cell culture supernatants containing MCP 1 variants were sequentially diluted in order to achieve the optimal working concentration of MCP-I for chemotaxis assay attracting THP-I monocytes. After expression of MCP-I (WT) and MCP-I ( ⁇ Q1), the concentrations of MCP-I variants did not significantly differ (Figure 5C) .
  • MCP-I is protected by a N-terminal pGlu- residue, which confers resistance against N-terminal cleavage by aminopeptidases, e.g. DP4.
  • N-terminal truncation leads to inactivation of human MCP-I ( Figure 5 and 6) .
  • MMP-I inactivates mature MCP-I by cleavage of the 4 N-terminal amino acids (pE/Q-P-D-A) .
  • the reaction is independent from the presence of a N-terminal pGlu residue. This process reflects the situation of MCP-I inactivation within the circulation.
  • the resulting cleavage product MCP 1 ( 5-75 ) has been shown to be present within plasma and resembles a naturally occurring CCR2 receptor antagonist.
  • the present experiments point to the finding that MMP-I cleavage is slightly faster in case of a N-terminal glutamine residue (Figure 2A: 2h, 4h vs. 2B: 2h, 4h) .
  • N-terminal pGlu formation represents a mechanism of protection, conferring resistance against N-terminal degradation by post-proline cleaving enzymes, e.g. DP4, aminopeptidases and, as implied by the results with MMP-I, to a certain extent also endoproteases .
  • DP4 post-proline cleaving enzymes
  • MMP-I aminopeptidases
  • MCP-I expression was reduced in the vessel segments of 1-(3-(1H- imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride treated mice 2 days after surgery, the moment of the highest elevation of MCP-I expression in the model used
  • aminopeptidase P cleaves between the N- terminal amino acids GIn 1 and Pro 2 and liberates the N-terminal glutaminyl residue ( Figure 16 A) .
  • pre-incubation of Gln 1 -MCP-l with human QC causes the formation of the N-terminal pGlu-residue and, therefore, the protection against aminopeptidase P cleavage ( Figure 16 B).
  • the formation of the N-terminal pGlu-residue is also a protection mechanism against aminopeptidase P cleavage and against the cleavage of presumably all other proline-specific aminopeptidases .
  • the uncyclized variants starting with an N-terminal glutamine are readily truncated by DP4 as shown for Gln 1 -MCP-2 ( Figure 19 A), Glr ⁇ -MCP- 3 ( Figure 20 A) and Gln 1 -MCP-4 ( Figure 21 A) . Therefore, the N- terminal pGlu-residue stabilizes all MCPs against truncation by aminopeptidases, such as DP4.
  • the presented concept to reduce QC acitivity in vivo in order to provoke accelerated turnover and diminished chemotaxis and receptor activation, applies for all members of the MCP-family.
  • MCP-I The full-length MCP-I possessing an N-terminal glutaminyl or pyroglutamyl-residue were found to be equally potent in attracting THP-I monocytes with a maximum response between 50 ng/ml and 100 ng/ml .
  • the truncation of MCP-I by aminopeptidase P (Pro 2 -MCP-l) and DP4 (Asp 3 -MCP-l) leads to a loss of potency of the respective variant.
  • the dose- response-curve shifts to higher concentrations needed to elicit the maximum response, which corresponds to an inactivation of MCP-I by N-terminal truncation.
  • the MMP-I cleavage product (He 5 - MCP-I) has an equal maximum as Glu 1 -MCP-l and pGlu 1 -MCP-l between 50 ng/ml and 100 ng /ml, however, the amount of cells migrating to this variant, ie. the chomotactic potency, is much lower, compared to full-length MCP-I ( Figure 22) .
  • Gln 1 -MCP-l was incubated with human DP4.
  • MCP-I was pre- incubated with human QC prior to DP4 application.
  • the obtained dose-response curves imply a proteolytic stability of pGlu 1 -MCP-l reflected by a maximum response at 50 - 100 ng / ml.
  • Gln 1 -MCP-l is truncated by DP4, which leads to a shift of the dose-response curve to higher MCP-I concentrations (500-1000 ng / ml) needed to elicit the maximum response.
  • the inhibition of QC leads to the N-terminal destabilization of MCP-I through degradation by DP4 and, thus, to its inactivation with respect to the monocyte chemotactic activity.
  • MCP-2, MCP-3 and MCP-4 possessing an N-terminal glutamine or pyroglutamate to attract human THP-I monocytes was investigated.
  • the pGlu-formation at the N-terminus of MCP-2 and MCP-3 has no influence on the potency, compared to the respective glutamine-precursors .
  • the pGlu-formation slightly increases the potency of the peptide ( Figure 24) .
  • Synthesis scheme 1 Synthesis of the examples 1-53, 96-102, 136- 137
  • Reagents and conditions (a) NaH, DMF, 4h, rt . ; (b) , 8h, 100 0 C; (c) H 2 N-NH 2 , EtOH, 8h, reflux then 4N HCl, 6h, reflux, (d) R 3 -NCO, EtOH, 6h, reflux, (e) 3,4 dimethoxy-phenyl-isothiocyanate, Synthesis scheme 2 : Synthes i s of the examples 54 - 95
  • Reagents and conditions (a) R-NCS, EtOH, 6h, reflux; (b) WSCD, lH-imidazole-1-propanamine, DMF, 2h, r.t.
  • Synthesis scheme 3 Synthesis of the examples 103-105
  • Reagents and conditions (a) NaH, DMF, rt.,3h; (b) LiAlH 4 , dioxane, reflux, Ih; (c) R-NCS, EtOH, reflux 6h,
  • Synthesis scheme 4 Synthesis of the examples 106 - 109
  • Synthesis scheme 6 Synthesis of the examples 113 -132
  • Synthesis scheme 7 Synthesis of the examples 133 - 135
  • Synthesis scheme 11 Synthesis of the example 141
  • Reagents and conditions (a) NaH, DMF, 4h, rt.; (b) , 8h, 100 0 C; (c) H 2 N-NH 2 , EtOH, 8h, reflux then 4N HCl, 6h, reflux, (d) 3,4 dimethoxy-phenyl-isothiocyanate, EtOH, 6h, reflux
  • Splitting patterns have been designated as follows: s (singulet) , d (doublet) , dd (doublet of doublet) , t (triplet) , m (multiplet) , and br (broad signal) .
  • Examples 1 - 12 and 14 - 53 lH-imidazole-1-propanamine was reacted with the corresponding isothiocyanate in ethanol under reflux for 8h. After that the solvent was removed and the remaining oil was dissolved in methylene chloride. The organic layer was washed twice with a saturated solution of NaHC ⁇ 3 followed by NaHSO 4 and brine, dried then evaporated. The remaining solid was re-crystallized from ethyl acetate, yielding the example thiourea in yields of 80 - 98%.
  • Examples 96 - 102 lH-imidazole-1-propanamine was reacted with the corresponding isocyanate in ethanol under reflux for 8h. After that the solvent was removed and the remaining oil was dissolved in methylene chloride. The organic layer was washed twice with a saturated solution of NaHCO 3 followed by NaHSO 4 and brine, dried then evaporated. The remaining solid was re-crystallized from ethyl acetate, yielding the example urea in yields of 85 - 90%.
  • the lH-imidazole-1-alkylamines were prepared according to the literature from -brom-alkyl-phtalimides and imidazolium salt and. subsequent hydrazinolysis .
  • the resulting products were transformed into the thioureas according to example 1 - 53 giving a 88% (example 136) and 95% (example 137) yield.
  • Examples 103 - 105 Imidazole was reacted with the corresponding brommethylphenylcyanide in DMF, utilizing 1 equivalent of NaH for 3h under rt., giving the lH-imidazole-1- methylphenylcyanides .
  • the solvent was removed and the resulting oil was re-dissolved in dioxane.
  • the cyanides were converted in the corresponding amines using 1 equivalent of LiAlH 4 .
  • dioxane was evaporated and the aqueous layer was extracted by means of CHCI3.
  • the organic layer was concentrated in vacuo and the amine was converted in the corresponding thioureas according to example 1 — 53 giving a 78% (example 103) and 65% (example 104) and 81% (example 105) yield.
  • Examples 110 - 112 lH-imidazole-1-propanamine was reacted with the corresponding 2- chlorobenzo [d] thiazole in toluol for 24h at a temperature of 130 0 C. After removing the solvent and recristallization from methanol example 110 - 112 was yielded in an amount of 55 - 65%.
  • Examples 113 - 118, 120 - 124 and 126 - 132 lH-imidazole-1-propanamine was reacted with the corresponding 2- phenyl acetic acid in dry dioxane by adding one equivalent of CAIBE and N-methylmorpholine at a temperature of 0 0 C. After 2h the mixture was allowed to warm to r.t. and the mixture was stirred for 12h. After removing the solvent the resulting oil was redissolved in methylene chloride and the organic layer was washed by means of an aqueous solution of NaHC ⁇ 3 and water, dried and the solvent was evaporated. The remaining oil was dissolved in dioxane adding Laweson's Reagent.
  • the organic solution was dried, filtered, and the solvent was removed under reduced pressure. After redissolving in 50 mL of dry dioxane 2.2 mmol of Lawesson' s reagent was added, and the mixture was heated to 90 0 C and stirred for 8 h. The solvent was removed by reduced pressure, and the residue was redissolved in 50 mL of dichloromethane. The organic layer was washed three times by means of a saturated aqueous solution of NaHC ⁇ 3, followed three times by water, dried, filtered, and then the organic solvent was removed.
  • the compound was purified by chromatography using a centrifugal-force-chromatography device, (Harrison Research Ltd.) utilizing silica plates of a layer thickness of 2 mm, and a CHCl 3 /MeOH gradient as eluting system.
  • Examples 133 - 135 A mixture of 1 equivalent triethylamine and 3, 4-dimethoxyaniline in dioxane was added to an stirred solution of the corresponding C ⁇ -bromoalkyl acidic chloride at a temperature of 0 0 C. The solution was allowed to warm to r.t. and stirred for 2h. The solvent was evaporated, and the remaining oil was redissolved in dichloromethane . The organic layer was washed by means of water, dried, filtered, and the solvent was removed under reduced pressure.
  • Example 1 1- (3- (lH-imidazol-1-yl)propyl) -3-methylthiourea melting point: 122 - 122.5°C
  • Example 3 1- (3- (lH-imidazol-1-yl)propyl) -3-benzylthiourea melting point: 127.0 - 128.0 0 C
  • Example 5 1- (3- ( IH- lmldazol-1-yl) propyl) -3 -phenyl thiourea melting point: 166.5 - 167.0 0 C
  • Example 6 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- fluorophenyl) thiourea melting point: 147.0 - 148.0°C
  • Example 7 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- ethylphenyl) thiourea melting point: 100.0 - 100.5 0 C
  • Example 8 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- (trifluoromethyl)phenyl) thiourea melting point: 154.5 - 155.0 0 C
  • Example 10 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- acetylphenyl) thiourea melting point: 170.0 - 171.0 0 C 1H NMR ⁇ 1.9 - 2.1 (br m, 2H), 2.4 - 2.5 (s, 3H), 3.2 - 3.5 (br m, 2H), 3.9 - 4.1 (m, 2H), 6.85 (d, IH), 7.15 (d, IH), 7.5 - 7.65 (br m, 3H), 7.8 - 7.9 (m, 2H), 8.1 (m, 2H), 9.8 (br s, IH); MS m/z 303.2 (M+H), 235.1 (M-C 3 H 3 N 2 O
  • Example 11 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- methoxyphenyl) thiourea melting point: 125.0 - 125.5°C
  • Example 14 1- (3- (lH-imidazol-1-yl)propyl) -3- (2, 4- dimethoxyphenyl) thiourea melting point: 120.0 - 120.5 0 C
  • Example 15 1- (3- (lH-imidazol-1-yl)propyl) -3- (3, 5- dimethoxyphenyl) thiourea melting point: 142.0 - 143.0 0 C
  • Example 23 1- (3- (lH-imidazol-1-yl)propyl) -3- (2, 3- dihydrobenzo [b] [1 , 4] dioxin-7-yl) -thiourea melting point: 103.0 - 103.5 0 C 1H NMR ⁇ 1.9 - 2.0 (br m, 2H), 3.3 - 3.5 (br d, 2H), 3.9 - 4.0
  • Example 25 1- (3- (lH-imidazol-1-yl)propyl) -3- (3, 4 , 5- trimethoxyphenyl) thiourea melting point: 124.5 - 125.5°C
  • Example 26 1- (3- (lH-imidazol-1-yl)propyl) -3- (3- methoxyphenyl) thiourea melting point: 89.5 - 90.0 0 C
  • Example 27 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- ethoxyphenyl) thiourea melting point: 126.0 - 126.5°C 1H NMR ⁇ 1.5 (br m, 3H), 1.9 - 2.0 (br m, 2H), 3.4 - 3.5 (br m, 2H), 3.9 - 4.0 (br m, 4H), 6.8 - 6.9 (m, 2H), 6.95 (s, IH), 7.15 - 7.2 (m, 2H), 7.25 (s, IH), 7.55 - 7.6 (br s, IH), 7.8 (s, IH), 9.3 (s, IH); MS m/z 305.2 (M+H), 237.2 (M-C 3 H 3 N 2 *)
  • Example 42 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- nitrophenyl) thiourea melting point: 165.0 . 166.0 0 C
  • Example 50 1- (3- (lH-imidazol-1-yl) propyl) -3- (4- (dimethylamino) phenyl) thiourea melting point: 146.5 - 147.0 0 C
  • Example 102 1- (3- (lH-imidazol-1-yl)propyl) -3- (3, 4- dimethoxyphenyl) urea melting point: 114.5 - 115.0 0 C 1H NMR ⁇ 1.7 - 1.9 (m, 2H), 2.9 - 3.1 (m, 2H), 3.7 (2s, 6H), 3.9 - 4.0 (m, 2H), 6.1 (t, IH), 6.7 (s, 2H), 6.8 (s, IH), 7.15 (d, 2H), 7.6 (s, IH), 8.2 (s, IH); MS m/z 321.2 (M+H), 253.3 (M- C 3 H 3 N 2 *)
  • Example 106 1- ( (S) -3- (lH-imidazol-1-yl) -2-methylpropyl) -3- (3, 4- dimethoxyphenyl) -thiourea melting point:: 150.5 - 151.5°C
  • Example 107 1- ( (R) -3- (lH-imidazol-1-yl) -2-methylpropyl) -3- (3, 4- dimethoxyphenyl) -thiourea melting point: 155.0 - 157.5 0 C
  • Example 109 1- ( (1- ( (lH-lmldazol-1- yl) methyl) cyclopropyl) methyl) -3- (3, 4-dlmethoxy-phenyl) thiourea melting point: 166.5 - 168.5°C
  • Example 121 N- (3- (lH-lmldazol-1-yl)propyl) -1- (4- chlorophenyl) cyclobutanecarbo-thloamide melting point: 137.5 - 139.0 0 C 1H NMR ⁇ 1.55 - 1.75 (br m, 2H) , 1.85 - 1.95 (br m, 2H) , 2.4 - 2.5 (br m, 2H) , 2.7 - 2.85 (br m, 2H) , 3.3 - 3.5 (br m, 2H) , 3.8 (m, 2H) , 6.9 (s, IH) , 7.0 (s, IH) , 7.3 (m, 2H) , 7.45 (s, IH) , 7.5 (m, 2H) , 9.6 (t, IH) ; MS m/z 334.3 (M+H) , 266.1 (M-C 3 H 3 N 2 O
  • Example 122 N- (3- (lH-lmldazol-1-yl) propyl) -1- (4- chlorophenyl ) cycl open tanecarbo-thloaml de melting point: 140.0 - 141.0 0 C 1 H NMR ⁇ 1.5 - 1.65 (br m, 4H), 1.8 - 1.9 ( m, 2H), 2.0 - 2.1 (m, 2H), 2.6 (m, 2H), 3.4 - 3.5 (m, 2H), 3.7 - 3.8 (m, 2H), 6.85 (s, IH), 7.0 (s, IH), 7.35 (m, 2H), 7.4 (m, 2H), 7.5 (s, IH), 9.4 (t, IH); MS m/z 348.2 (M+H) , 280.2 (M-C 3 H 3 N 2 O
  • Example 123 N- (3- (lH-imidazol-1-yl)propyl) -1- (4- methoxyphenyl) cyclohexanecarbo-thioamide melting point: 162.5 - 164.0 0 C
  • Example 124 N- (3- (lH-imidazol-1-yl)propyl) -1- (4- methoxyphenyl) cyclopropanecar-bothloamlde melting point:: 129.0 - 129.5°C
  • Example 134 5- (lH-imidazol-1-yl) -N- (3, 4- dimethoxyphenyl)pentanethioamide melting point:: 128.0 - 128.5°C 1H NMR ⁇ 1.65 - 1.70 (m, 2H), 1.75 - 1.80 (m, 2H), 2.7 - 2.75 (m, 2H), 3.7 (s, 3H), 3.75 (s, 3H), 4.0 - 4.05 (t, 2H), 6.9 - 7.0 (m, 2H), 7.2 (s, IH), 7.3 (d, IH), 7.5 (s, IH), 7.75 (s, IH), 11.0 (s, IH); MS m/z 320.2 (M+H), 252.2 (M-C 3 H 3 N 2 O
  • Example 136 1- (2- (lH-imidazol-1-yl) ethyl) -3- (3, 4- dlmethoxyphenyl) thiourea melting point: 157.5 - 159.0 0 C 1 H NMR ⁇ 3.7 (2 s, 6H), 3.8 (m, 2H), 4.2 (m, 2H), 6.7 (m, IH), 6.85 (m, IH), 6.9 (m, 2H), 7.15 (s, IH), 7.5 (br s, IH), 7.6 (s, IH), 9.5 (s, IH); MS m/z 307.2 (M+H) , 239.1 (M-C 3 H 3 N 2 ')

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Diabetes (AREA)
  • Urology & Nephrology (AREA)
  • Hospice & Palliative Care (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Emergency Medicine (AREA)
  • Endocrinology (AREA)
  • Vascular Medicine (AREA)
  • Cardiology (AREA)
  • Psychiatry (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Plural Heterocyclic Compounds (AREA)

Abstract

The present invention relates in general to an inhibitor of a glutaminyl peptide cyclotransferase, and use thereof for the treatment and/or prevention of a disease or disorder selected from the group consisting of inflammatory diseases selected from a. neurodegenerative diseases, e.g. mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, e.g. rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, e.g. lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, e.g. cancer/hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, e.g. hypertension, f. and other inflammatory diseases, e.g. neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis. Further, the invention relates to a respective diagnostic method, assay and kit.

Description

NEW USE OF GLUTAMINYL CYCLASE INHIBITORS
The present invention relates in general to an inhibitor of a glutaminyl peptide cyclotransferase, and the use thereof for the treatment and/or prevention of a disease or disorder selected from the group consisting of rheumatoid arthritis, atherosclerosis, restenosis, lung fibrosis, liver fibrosis, renal fibrosis, pancreatitis, mild cognitive impairment, Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, neuropathic pain, graft rejection/graft failure/graft vasculopathy, hypertension, HIV infections/AIDS, gestosis, cancer/hemangioendothelioma proliferation, tuberous sclerosis, and gastric carcinomas.
Further, the present invention pertains to diagnostic kits and methods based on the use of a glutaminyl cyclase inhibitor.
Glutaminyl cyclase (QC, EC 2.3.2.5) catalyzes the intramolecular cyclization of N-terminal glutaminyl residues into pyroglutamic acid (5-oxo-proline, pGlu*) under liberation of ammonia and the intramolecular cyclization of N-terminal glutamyl residues into pyroglutamic acid under liberation of water.
A QC was first isolated by Messer from the Latex of the tropical plant Carica papaya in 1963 (Messer, M. 1963 Nature 4874, 1299) . 24 years later, a corresponding enzymatic activity was discovered in animal pituitary (Busby, W. H. J. et al . 1987 J Biol Chem 262, 8532-8536; Fischer, W. H. and Spiess, J. 1987 Proc Natl Acad Sci U S A 84, 3628-3632) . For the mammalian QCs, the conversion of GIn into pGlu by QC could be shown for the precursors of TRH and GnRH (Busby, W. H. J. et al . 1987 J Biol Chem 262, 8532-8536; Fischer, W. H. and Spiess, J. 1987 Proc Natl Acad Sci U S A 84, 3628-3632) . In addition, initial localization experiments of QC revealed a co-localization with its putative products of catalysis in the bovine tractus hypothalamo-hypophysalisfurther improving the suggested function in peptide hormone maturation (Bockers, T. M. et al . 1995 J Neuroendocrinal 7, 445-453) . In contrast, the physiological function of the plant QC is less clear. In case of the enzyme from C. papaya, a role in the plant defence against pathogenic microorganisms was suggested (El Moussaoui, A. et al . 2001 Cell MoI Life Sci 58, 556-570) . Putative QCs from other plants were identified by sequence comparisons recently (Dahl, S. W. et al . 2000 Protein Expr Purif 20, 27-36) . The physiological function of these enzymes, however, is still ambiguous.
The QCs known from plants and animals show a strict specificity for L-Glutamine in the N-terminal position of the substrates and their kinetic behaviour was found to obey the Michaelis-Menten equation (Pohl, T. et al . 1991 Proc Natl Acad Sci U S A 88, 10059-10063; Consalvo, A. P. et al . 1988 Anal Biochem 175, 131- 138; Gololobov, M. Y. et al . 1996 Biol Chem Hoppe Seyler 377, 395-398) . A comparison of the primary structures of the QCs from C. papaya and that of the highly conserved QC from mammals, however, did not reveal any sequence homology (Dahl, S. W. et al. (2000) Protein Expr Purif 20, 27-36). Whereas the plant QCs appear to belong to a new enzyme family (Dahl, S. W. et al .
(2000) Protein Expr Purif 20, 27-36), the mammalian QCs were found to have a pronounced sequence homology to bacterial aminopeptidases (Bateman, R. C. et al . 2001 Biochemistry 40, 11246-11250), leading to the conclusion that the QCs from plants and animals have different evolutionary origins.
EP 02 011 349.4 discloses polynucleotides encoding insect glutaminyl cyclase, as well as polypeptides encoded thereby. This application further provides host cells comprising expression vectors comprising polynucleotides of the invention. Isolated polypeptides and host cells comprising insect QC are useful in methods of screening for agents that reduce glutaminyl cyclase activity. Such agents are described as useful as pesticides .
Chemotactic cytokines (chemokines) are proteins that attract and activate leukocytes and are thought to play a fundamental role in inflammation. Chemokines are divided into four groups categorized by the appearance of N-terminal cysteine residues
("C"-; "CC"-; "CXC"- and "CX3C"-chemokines) . "CXC"-chemokines preferentially act on neutrophils. In contrast, "CC"-chemokines attract preferentially monocytes to sites of inflammation.
Monocyte infiltration is considered to be a key event in a number of disease conditions (Gerard, C. and Rollins, B. J.
(2001) Nat. Immunol 2, 108-115; Bhatia, M., et al . , (2005)
Pancreatology. 5, 132-144; Kitamoto, S., Egashira, K., and Takeshita, A. (2003) J Pharmacol ScI. 91, 192-196) . The MCP family, as one family of chemokines, consists of four members (MCP-1-4), displaying a preference for attracting monocytes but showing differences in their potential (Luini, W., et al . , (1994) Cytokine 6, 28-31; Uguccioni, M., et al . , (1995) Eur J Immunol 25, 64-68) . In the following both cDNA as well as amino acid sequences of MCP-1-4 are indicated:
Human MCP-I (CCL2) (GeneBank Accession: M24545)
cDNA (300 bp) SEQ ID NO: 2
1 atgaaagtct ctgccgccct tctgtgcctg ctgctcatag cagccacctt cattccccaa
61 gggctcgctc agccagatgc aatcaatgcc ccagtcacct gctgttataa cttcaccaat 121 aggaagatct cagtgcagag gctcgcgagc tatagaagaa tcaccagcag caagtgtccc
181 aaagaagctg tgatcttcaa gaccattgtg gccaaggaga tctgtgctga ccccaagcag
241 aagtgggttc aggattccat ggaccacctg gacaagcaaa cccaaactcc gaagacttga Protein (Signal Sequence in bold: 23 aa; Mature MCP-I: 76 aa)
SEQ ID NO: 1
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
Human MCP-2 (CCL8) (GeneBank Accession: Y10802) cDNA (300 bp) SEQ ID NO: 12
1 atgaaggttt ctgcagcgct tctgtgcctg ctgctcatgg cagccacttt cagccctcag
61 ggacttgctc agccagattc agtttccatt ccaatcacct gctgctttaa cgtgatcaat
121 aggaaaattc ctatccagag gctggagagc tacacaagaa tcaccaacat ccaatgtccc 181 aaggaagctg tgatcttcaa gacccaacgg ggcaaggagg tctgtgctga ccccaaggag
241 agatgggtca gggattccat gaagcatctg gaccaaatat ttcaaaatct gaagccatga
Protein (Signal Sequence in bold: 23 aa; Mature MCP-2 : 76 aa)
SEQ ID NO: 11
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP KEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Human MCP-3 (CCL7) (GeneBank Accession: X71087) cDNA (300 bp) SEQ ID NO: 14 1 atgaaagcct ctgcagcact tctgtgtctg ctgctcacag cagctgcttt cagcccccag
61 gggcttgctc agccagttgg gattaatact tcaactacct gctgctacag atttatcaat 121 aagaaaatcc ctaagcagag gctggagagc tacagaagga ccaccagtag ccactgtccc
181 cgggaagctg taatcttcaa gaccaaactg gacaaggaga tctgtgctga ccccacacag
241 aagtgggtcc aggactttat gaagcacctg gacaagaaaa cccaaactcc aaagctttga
Protein (Signal Sequence in bold: 23 aa; Mature MCP-3: 76 aa)
SEQ ID NO: 13
MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSH CP
REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
Human MCP-4 (CCL13) (GeneBank Accession: U46767) cDNA (297 bp) SEQ ID
NO: 16
1 atgaaagtct ctgcagtgct tctgtgcctg ctgctcatga cagcagcttt caacccccag 61 ggacttgctc agccagatgc actcaacgtc ccatctactt gctgcttcac atttagcagt
121 aagaagatct ccttgcagag gctgaagagc tatgtgatca ccaccagcag gtgtccccag
181 aaggctgtca tcttcagaac caaactgggc aaggagatct gtgctgaccc aaaggagaag
241 tgggtccaga attatatgaa acacctgggc cggaaagctc acaccctgaa gacttga Protein (Signal Sequence in bold: 23 aa; Mature MCP-4: 75 aa)
SEQ ID NO: 15
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
A number of studies have underlined in particular the crucial role of MCP-I for the development of atherosclerosis (Gu, L., et al., (1998) MoI. Cell 2, 275-281; Gosling, J., et al . , (1999) J Clin. Invest 103, 773-778); rheumatoid arthritis (Gong, J. H., et al., (1997) J Exp.Med 186, 131-137; Ogata, H., et al . , (1997) J Pathol. 182, 106-114); pancreatitis (Bhatia, M., et al . , (2005) Am. J Physiol Gastrolntest . Liver Physiol 288, G1259-G1265) ; Alzheimer's disease (Yamamoto, M., et al . , (2005) Am. J Pathol. 166, 1475-1485); lung fibrosis (Inoshima, I., et al . , (2004) Am. J Physiol Lung Cell MoI. Physiol 286, L1038-L1044) ; renal fibrosis (Wada, T., et al., (2004) J Am. Soc .Nephrol . 15, 940-
948), and graft rejection (Saiura, A., et al . , (2004)
Arterioscler. Thromb . Vase. Biol. 24, 1886-1890) . Furthermore,
MCP-I might also play a role in gestosis (Katabuchi, H., et al . ,
(2003) Med Electron Microsc. 36, 253-262), as a paracrine factor in tumor development (Ohta, M., et al . , (2003) Int. J Oncol. 22, 773-778; Li, S., et al . , (2005) J Exp.Med 202, 617-624), neuropathic pain (White, F. A., et al., (2005) Proc . Natl. Acad.Sci.U.S.A) and AIDS (Park, I. W., Wang, J. F., and Groopman, J. E. (2001) Blood 97, 352-358; Coll, B., et al . , (2006) Cytokine 34, 51-55) .
The mature form of human and rodent MCP-I is posttranslationally modified by Glutaminyl Cyclase (QC) to possess an N-terminal pyroglutamyl (pGlu) residue. The N-terminal pGlu modification makes the protein resistant against N-terminal degradation by aminopeptidases, which is of importance, since chemotactic potency of MCP-I is mediated by its N-terminus (Van Damme, J., et al., (1999) Chem Immunol 72, 42-56). Artificial elongation or degradation leads to a loss of function although MCP-I still binds to its receptor (CCR2) (Proost, P., et al . , (1998), J Immunol 160, 4034-4041; Zhang, Y. J., et al . , 1994, J Biol. Chem 269, 15918-15924; Masure, S., et al., 1995, J Interferon Cytokine Res. 15, 955-963; Hemmerich, S., et al . , (1999) Biochemistry 38, 13013-13025) .
Due to the major role of MCP-I in a number of disease conditions, an anti-MCP-1 strategy is required. Therefore, small orally available compounds inhibiting the action of MCP-I are promising candidates for a drug development. Inhibitors of Glutaminyl Cyclase are small orally available compounds, which target the important step of pGlu-formation at the N-terminus of MCP-I (Cynis, H., et al . , (2006) Blochlm.Blophys .Acta 1764, 1618-1625; Buchholz, M., et al . , (2006) J Med Chem 49, 664-677). In consequence, caused by QC-inhibition, the N-terminus of MCP- 1 is not protected by a pGlu-residue . Instead, the N-terminus possesses a glutamine-proline motif, which is prone to cleavage by dipeptidylpeptidases, e.g. dipeptidylpeptidase 4 and fibroblast activating protein (FAP, Seprase) , which are abundant on the endothelium and within the blood circulation. This cleavage results in the formation of N-terminal truncated MCP-I. These molecules unfold, in turn, an antagonistic action at the CCR2 receptor and therefore, monocyte-related disease conditions are inhibited efficiently.
Atherosclerotic lesions, which limit or obstruct coronary blood flow, are the major cause of ischemic heart disease related mortality, resulting in 500,000 - 600,000 deaths annually. Percutaneous transluminal coronary angioplasty (PTCA) to open the obstructed artery was performed in over 550,000 patients in the U.S. and 945,000+ patients worldwide in 1996 (Lemaitre et al . , 1996) . A major limitation of this technique is the problem of post-PTCA closure of the vessel, both immediately after PTCA
(acute occlusion) and in the long term (restenosis) : 30% of patients with subtotal lesions and 50% of patients with chronic total lesions will progress to restenosis after angioplasty. Additionally, restenosis is a significant problem in patients undergoing saphenous vein bypass graft. The mechanism of acute occlusion appears to involve several factors and may result from vascular recoil with resultant closure of the artery and/or deposition of blood platelets along the damaged length of the newly opened blood vessel followed by formation of a fibrin/red blood cell thrombus.
Restenosis after angioplasty is a more gradual process and involves initial formation of a subcritical thrombosis with release from adherent platelets of cell derived growth factors with subsequent proliferation of intimal smooth muscle cells and local infiltration of inflammatory cells contributing to vascular hyperplasia. It is important to note that multiple processes, among those thrombosis, cell proliferation, cell migration and inflammation each seem to contribute to the restenotic process.
In the U.S., a 30-50% restenosis rate translates to 120,000 - 200,000 U.S. patients at risk from restenosis. If only 80% of such patients elect repeated angioplasty (with the remaining 20% electing coronary artery bypass graft) and this is added to the costs of coronary artery bypass graft for the remaining 20%, the total costs for restenosis tretment easily amounts to billions of dollars in the U.S.. Thus, successful prevention of restenosis could result not only in significant therapeutic benefit but also in significant health care savings.
Monocyte chemoattractant protein 1 (MCP-I, CCL2) belongs to a family of potent chemotactic cytokines (CC chemokines) , that regulate the trafficking of leukocytes, especially monocytes, macrophages and T-cells, to sites of inflammation (Charo,I.F. and Taubman,M.B. (2004) Circ.Res. 95, 858-866). Besides its role in, e.g. vascular disease, compelling evidence points to a role of MCP-I in Alzheimer's disease (AD) (Xia,M.Q. and Hyman,B.T.
(1999) J Neurovirol. 5, 32-41). The presence of MCP-I in senile plaques and in reactive microglia, the residential macrophages of the CNS have been observed in brains of patients suffering from AD (Ishizuka, K. , et al . , (1997) Psychiatry Clin .Neurosci .
51, 135-138). Stimulation of monocytes and microglia with
Amyloid-β protein (Aβ) induces chemokine secretion in vitro
(Meda,L., et al . , (1996) J Immunol 157, 1213-1218; Szczepanik,A.M. , et al . , (2001) J Neuroimmunol . 113, 49-62) and intracerebroventricular infusion of Aβ(i_42) into murine hippocampus significantly increases MCP-I in vivo. Moreover, Aβ deposits attract and activate microglial cells and force them to produce inflammatory mediators such as MCP-I, which in turn leads to a feed back to induce further chemotaxis, activation and tissue damage. At the site of Aβ deposition, activated microglia also phagocytose Aβ peptides leading to an amplified activation (Rogers, J. and Lue,L.F. (2001) Neurochem. Int . 39, 333-340) .
Examination of chemokine expression in a 3xTg mouse model for AD revealed that neuronal inflammation precedes plaque formation and MCP-I is upregulated by a factor of 11. Furthermore, the upregulation of MCP-I seems to correlate with the occurrence of first intracellular Aβ deposits (Janelsins, M. C . , et al., (2005) J Neuroinflammation . 2, 23). Cross-breeding of the Tg2575 mouse model for AD with a MCP-I overexpressing mouse model has shown an increased microglia accumulation around Aβ deposits and that this accumulation was accompanied by increased amount of diffuse plaques compared to single-transgenic Tg2576 littermates (Yamamoto,M., et al . (2005) Am. J Pathol. 166, 1475-1485). MCP-I levels are increased in CSF of AD patients and patients showing mild cognitive impairment (MCI) (Galimberti, D. , et al . ,
(2006) Arch. Neurol. 63, 538-543). Furthermore, MCP-I shows an increased level in serum of patients with MCI and early AD (Clerici,F., et al . , (2006) Neurobiol .Aging 27, 1763-1768).
Summary of the invention
The present invention relates to inhibitors of a glutaminyl peptide cyclotransferase and the use thereof for the treatment and/or prevention of a disease or disorder selected from the group consisting of inflammatory diseases selected from a. neurodegenerative diseases, e.g. mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British
Dementia, Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, e.g. rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, e.g. lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, e.g. cancer/hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, e.g. hypertension, f . and other inflammatory diseases, e.g. neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis.
Brief description of the Drawings
Figure 1 shows the incubation of MCP-IM -76) bearing an N- terminal glutaminyl (A) or Pyroglutamyl (5-oxo-L-Prolyl) residue (B) with recombinant human DP4 for 24 h. For cyclization of N- terminal glutamine into pyroglutamate MCP-I was incubated with recombinant human QC 3 h prior to assay start. The DP4 cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 4h and 24 h using Maldi-TOF mass spectrometry.
Figure 2 shows the incubation of MCP-I (i-η Q) bearing an N- terminal glutaminyl (A) or Pyroglutamyl (5-oxo-L-Prolyl) residue with human synovial fibroblast MMP-I for 24 h. For cyclization of N-terminal glutamine into pyroglutamate MCP-I was incubated with recombinant human QC 3 h prior to assay start. The MMP-I cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h using Maldi-TOF mass spectrometry.
Figure 3 shows the incubation of MCP-I (i-η Q) carrying an N- terminal glutaminyl (A) or Pyroglutamyl (5-oxo-L-Prolyl) with human synovial fibroblast MMP-I and recombinant human DP4 for 24 h. For cyclization of N-terminal glutamine into pyroglutamate, MCP-I was incubated with recombinant human QC 3 h prior to assay start. Resulting MMP-I cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h using Maldi-TOF mass spectrometry
Figure 4 shows the isolation of human MCP-I from human neuroblastoma cell line SH-SY5Y. (M:DNA standard in bp; 1: full length human MCP-I isolated from SH-SY5Y)
Figure 5 shows the nucleotide (A) and amino acid (B) alignment of human MCP-I isolated from SH-SY5Y (upper lane) and human MCP- 1 genebank accession M24545 (lower lane) . Single nucleotide polymorphism is depicted in bold. C: shows the concentration of human MCP-I (i-η Q) (WT) and mutant human MCP-I lacking the N- terminal pGlu residue (ΔQ1) in the supernatant of transfected HEK293 cells in comparison to vector transfected control (pcDNA) . (n.s.: not significant, Student's t-test; n=6) D: Migration of THP-I monocytes towards the generated supernatant of transfected HEK293 cells in dilutions 1:1, 1:3, 1:10 and 1:30. (*, P<0.05; **, P< 0.01; ***, P<0.001; Student's t-test, n=3) .
Figure 6 A: shows the concentration of human MCP-IM -76) (WT) and mutant human MCP-I lacking the two N-terminal amino acids
(ΔQ1P2) in the supernatant of transfected HEK293 cells in comparison to vector transfected control (pcDNA) . (**, P<0.01;
Student's t-test; n=6) B: Migration of THP-I monocytes towards the generated supernatant of transfected HEK293 cells in dilutions 1:1, 1:3, 1:10 and 1:30. (*, P<0.05; **, P< 0.01; ***,
P<0.001; Student's t-test, n=3) .
Figure 7 A: shows the concentration of human MCP-I (1-76) (WT) in the supernatant of transfected HEK293 cells in absence and presence of 10 μM 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride in comparison to vector transfected control (pcDNA) . (n.s.: not significant; Student's t-test; n=6) B: Migration of THP-I monocytes towards the generated supernatant of transfected HEK293 cells in absence or presence of 10 μM 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride in dilutions of 1:1, 1:3, 1:10 and 1:30. (**, P< 0.01; Student's t-test, n=3) .
Figure 8 shows the quantification of the vascular remodeling of the cuffed vessel wall segments of untreated ApoE3 Leiden mice
(black bars) and mice, which were treated (open bars) with 1- (3-
(lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride. Mice were sacrificed 14 days after cuff placement. Expressed is the vascular circumference (A) i.e. the total area within the outer diameter of the vessel segment and the remaining lumen (B) in μm^ .
Figure 9 shows the quantification of the vascular remodeling of the cuffed vessel wall segments of untreated ApoE3 Leiden mice (black bars) or mice treated with (open bars) 1- (3- (lH-imidazol- 1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydro-chloride . Mice were sacrificed 14 days after cuff placement. Expressed is the lumen stenosis A in % and the area of neointima B in μm^ . (*, P<0.05, Student's t-test) .
Figure 10 shows the quantification of the vascular remodeling of the cuffed vessel wall segments of untreated ApoE3 Leiden mice (black bars) or mice, which were treated with (open bars) of 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride. Mice were sacrificed 14 days after cuff placement. Expressed is the area of the media A in μm^ and the intima / media ratio B. (*, P<0.05, Student's t-test).
Figure 11 shows adhering and infiltrating cells per cross section in absence (black bars) or presence (open bars) of 1- (3- ( lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride treatment. Total number of adhering cells per cross section was counted in the cross section of the cuffed femoral arteries harvested two days after cuff placement. Within the total population of adhering cells a specific staining for monocytes/macrophages was used to identify the adhering and infiltrating monocytes. (*, P<0.05, Student's t-test).
Figure 12 shows examples of MCP-I staining by immunohistochemistry of lesions at the early time point (2 days) and the late time point (14 days) in untreated mice (control) and mice, which were treated with 1- (3- (lH-imidazol-1- yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride .
Figure 13 shows the quantification of MCP-I staining in cross sections of mice sacrificed after 2 days (early time point) A or after 14 days (late time point) B within the media and neointima in absence (black bars) and presence (open bars) of 1-(3-(1H- imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride treatment. (*, P<0.05; Student's t-test).
Figure 14 shows the relative amount of MCP-I staining (%) in cross sections of mice sacrificed after 2 days (early time point) (A) or after 14 days (late time point) (B) within the media and neointima in absence (black bars) and presence (open bars) of 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride treatment. (*, P<0.05; Student' s t-test) .
Figure 15 shows the quantification of the accelerated atherosclerosis in the vessel wall based on the quantification of monocyte/macrophage staining using marker AIA31240. Presented are cross sections of mice sacrificed at the late time point (14 days) treated in absence (black bars) and presence (open bars) of 1- (3- (lH-imidazol-l-yl)propyl) -3- (3,4- dimethoxyphenyl) thiourea hydrochloride. Foam cell accumulation is illustrated as (A) foam cell positive area / cross section in % and (B) foam cell positive area / cross section in μm2.
Figure 16 illustrates cleavage of human MCP-I (i-η Q) bearing an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human Aminopeptidase P for 24 h. The pyroglutamate formation at the N-Terminus was accomplished by incubation of MCP-I with recombinant human QC for 3 h prior to the assay. The DP4 cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h using Maldi-TOF mass spectrometry.
Figure 17 illustrates the cleavage of human MCP-I (i-76) bearing an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human DP4 for 4 h. The pyroglutamate formation at the N-Terminus was accomplished by incubation of MCP-I with recombinant human QC for 3 h prior to assay. In addition, the incubation of Gln1-MCP-l with recombinant human QC was carried out in presence of 10 μM QC-specific inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride. The DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h and 4h.
Figure 18 shows the degradation of human MCP-IM -76) carrying an N-terminal glutaminyl residue (A) or pyroglutamyl (5-oxo-L- Prolyl) residue (B) in human serum for 7 and 24 h, respectively. For cyclization of the N-terminal glutamine residue into pyroglutamate, MCP-I was incubated with recombinant human QC for 3 h prior to assay start. In addition, Gln1-MCP-l was incubated in human serum in the presence of 9.6 μM DP4 Inhibitor Isoleucyl-Thiazolidide (P32/98) for 24 h (C) . The cleavage products were analyzed after 0 min, 10 min, 30 min, Ih, 2h, 3h 5h and 7 h for Glr^-MCP-l, 0 min, 30 min, Ih, 2h, 3h 5h, 7 h and 24 h for pGlu^MCP-l and 0 min, Ih, 2h, 3h, 5h, 7 h and 24 h for Gln1-MCP-l in combination with Isoleucyl-Thiazolidide using Maldi-TOF mass spectrometry.
Figure 19 shows the degradation of human
Figure imgf000016_0001
bearing an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human DP4 for 24 h. For cyclization of N-terminal glutamine into pyroglutamate, MCP-2 was incubated with recombinant human QC for 3 h prior to assay start. The DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h.
Figure 20 shows the degradation of human MCP-3M-76) carrying an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human DP4 for 24 h. For cyclization of N-terminal glutamine into pyroglutamate, MCP-3 was incubated with recombinant human QC for 3 h prior to assay start. The DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h.
Figure 21 illustrates the cleavage of human MCP-4/]__75) bearing an N-terminal glutaminyl (A) or pyroglutamyl (5-oxo-L-Prolyl) residue (B) by recombinant human DP4 for 4 hours. For cyclization of N-terminal glutamine into pyroglutamate, MCP-4 was incubated with recombinant human QC for 3 h prior to assay start. The DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, and 4h.
Figure 22 shows the chemotactic potency of human N-terminal MCP- 1 variants starting with N-terminal glutamine (Gln1-MCP-l) , pyroglutamic acid (pGlu1-MCP-l) (5-oxo-L-Proline) , starting with proline 2 (Pro2-MCP-l, the aminopeptidase P cleavage product), starting with aspartic acid 3 (Asp3-MCP-l, the DP4 cleavage product) and starting with isoleucine 5 (Ile5-MCP-l, the MMP-I cleavage product) towards human THP-I monocytes.
Figure 23 shows the analysis of chemotactic potency of human MCP-I, which was incubated with human recombinant DP4 in presence (Glr^-MCP-l + QC + DP4) and absence (Glr^-MCP-l + DP4) of QC-mediated pGlu formation. In addition, the influence of the QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride (QCI) (10 μM) on the formation of the N-terminal pGlu-residue, followed by subsequent DP4 cleavage (Glr^-MCP-l + QC + QCI + DP4) is shown.
Figure 24 shows the chemotactic potency of human MCP-I (A) , MCP- 2 (B) , MCP-3 (C) and MCP-4 (D) in absence or presence of the N- terminal pyroglutamyl residue.
Figure 25 shows the chemotactic potency of full-length human MCP-I (A), MCP-3 (B), MCP-2 (C) and MCP-4 (D) starting with an N-terminal glutamine in comparison to their respective DP4 cleavage products.
Figure 26 shows the significant reduction of TNFCC-levels after application of QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride in a model of LPS- induced sepsis in rats (ANOVA, P<0.05).
Figure 27 shows the dose-dependent reduction of infiltrating monocytes to the peritoneum in a model of thioglycollate-induced peritonitis in mice, caused by a QC-inhibitor . Thioglycollate and QCI (1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride) in three different concentrations of 25 mg/kg, 50 mg/kg and 100 mg/kg were injected. Cells infiltrating the peritoneum, were classified using FACS analysis 4 h after inducing the peritonits. (*, P<0.05, Student's t-test) . Figure 28 shows the reduction of Moma2-positive cells in the peritoneal lavage fluid of mice, which received a thioglycollate challenge in combination with the QC-specific inhibitor QCI (1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea) , compared to animals receiving no QCI (*, P<0.05, Student's t- test) .
Detailed description of the Invention In particular the present invention pertains to the following items :
1. A QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition, selected from a. neurodegenerative diseases, comprising mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, and multiple sclerosis, b. chronic and acute inflammations, comprising rheumatoid arthritis, atherosclerosis, restenosis, and pancreatitis, c. fibrosis, comprising lung fibrosis, liver fibrosis, and renal fibrosis, d. cancer, comprising cancer/hemangioendothelioma proliferation, and gastric carcinomas, e. metabolic diseases, comprising hypertension, f . and other inflammatory diseases, comprising neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis.
2. The QC inhibitor according to item 1, wherein the neurodegenerative disease is selected from mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis. 3. The QC inhibitor according to item 1 or 2, wherein the disease is mild cognitive impairment.
4. The QC inhibitor according to any of items 1 to 3, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
5. The QC inhibitor according to item 1, wherein the disease is a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis .
6. The QC inhibitor according to item 1 or 5, wherein the disease is selected from restenosis and pancreatitis.
7. The QC inhibitor according to item 1, 5 or 6, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors .
8. Use of a QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition selected from a. neurodegenerative diseases, comprising mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, comprising rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, comprising lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, comprising cancer/hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, comprising hypertension, f . and other inflammatory diseases, comprising neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis.
9. The use according to item 8, wherein the disease is a neurodegenerative disease, selected from mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis.
10. The use according to item 8 or 9, wherein the disease is mild cognitive impairment (MCI) .
11. The use according to any of items 8 to 10, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroptrotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
12. The use according to item 8, wherein the disease is a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis. 13. The use according to item 8 or 12, wherein the disease is selected from restenosis and pancreatitis.
14. The use according to item 8, 12 or 13, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors .
15. Use of a QC inhibitor for the preparation of a medicament for treating and/or preventing an inflammatory disease or condition selected from a. neurodegenerative diseases, comprising mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial
Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, comprising rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, comprising lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, comprising cancer/hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, comprising hypertension, f. and other inflammatory diseases, comprising neuropathic pain, graft rejection/graft failure/graft vasculopathy,
HIV infections/AIDS, gestosis, tuberous sclerosis. 16. The use according to item 15, wherein the disease is a neurodegenerative disease, selected from mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis.
17. The use according to item 15 or 16, wherein the disease is mild cognitive impairment (MCI).
18. The use according to any of items 15 to 17, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
19. The use according to item 15, wherein the disease is a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis.
20. The use according to item 15 or 19, wherein the disease is selected from restenosis and pancreatitis.
21. The use according to any of items 15, 19 or 20, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE) ; angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors .
22. A Method of treatment and/or prevention of an inflammatory disease or condition, selected from a. neurodegenerative diseases, comprising mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, comprising rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, comprising lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, comprising cancer / hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, comprising hypertension, f. and other inflammatory diseases, comprising neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis, wherein an effective amount of a QC inhibitor is administered to a subject in need thereof.
23. The method of treatment and/or prevention according to item 22, wherein the disease is a neurodegenerative disease, selected from mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis .
24. The method of treatment and/or prevention according to item 23 or 24, wherein the disease is mild cognitive impairment (MCI) . 25. The method of treatment and/or prevention according to any of items 23 to 25, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
26. The method of treatment and/or prevention according to item 23, wherein the disease is a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis.
27. The method of treatment and/or prevention according to item 23 or 26, wherein the disease is selected from restenosis and pancreatitis.
28. The method of treatment and/or prevention according to item 23, 26 or 27 wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors.
29. The use according to any of items 7 to 21, wherein the disease and/or condition afflict a human being. 30. The method of any of items 22 to 28, wherein the disease and/or condition afflicts a human being.
31. The use or method according to any one of the preceding items, wherein said QC inhibitor is an inhibitor selected from formulae 1, 1*, Ia, Ib, Ic, Id, Ie, If, Ig, Ih, and Ii.
32. The use or method according to any one of items 1 to 31, wherein said QC inhibitor is an inhibitor selected from examples 1 to 141.
33. The use or method according to any one of items 1 to 32, wherein said QC inhibitor is 1- (3- (lH-imidazole-1- yl) propyl) -3- (3, 4-dimethoxy-phenyl) thiourea hydrochloride.
34. Diagnostic assay, comprising a QC inhibitor.
35. Diagnostic assay according to item 34, wherein said QC inhibitor is an inhibitor selected from formulae 1, 1*, Ia, Ib, Ic, Id, Ie, If, Ig, Ih, and Ii.
36. Diagnostic assay according to item 34 or 35, wherein said QC inhibitor is an inhibitor selected from examples 1 to 141.
37. Diagnostic assay according to any of items 34 to 36, wherein said QC inhibitor is 1- (3- (lH-imidazole-1-yl) propyl) -3- (3, 4- dimethoxy-phenyl) thiourea hydrochloride.
38. A method of diagnosing any one of the diseases and/or conditions as defined in item 1, comprising the steps of collecting a sample from a subject who is suspected to be afflicted with said disease and/or condition, contacting said sample with a QC inhibitor, and determining whether or not said subject is afflicted by said disease and/or condition.
39. The method according to item 38, wherein said subject is a human being.
40. The method according to item 38 or 39, wherein said QC inhibitor is an inhibitor selected from formulae 1, 1*, Ia, Ib, Ic, Id, Ie, If, Ig, Ih, and Ii.
41. The method according to any of items 38 to 40, wherein said QC inhibitor is an inhibitor selected from examples 1 to 141.
42. The method according to any of items 38 to 41, wherein said QC inhibitor is 1- (3- (lH-imidazole-1-yl) propyl) -3- (3, 4- dimethoxy-phenyl) thiourea hydrochloride.
43. The method of any of items 38 to 42, wherein said sample is a blood sample, a serum sample, a sample of cerebrospinal liquor or a urine sample.
44. Diagnostic kit for carrying out the method of items 38 to 42 comprising as detection means the diagnostic assay of any of items 34 or 37 and a determination means.
45. Pharmaceutical composition, comprising the QC inhibitor according to any of items 1 to 7 or 31 to 33.
In an especially preferred embodiment, the invention relates to the use of a QC inhibitor in methods of treating a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis, particularly restenosis and pancreatitis, most preferably restenosis. The effect of a QC inhibitor for treating a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis, can be tested using the in vivo assays described in examples 3, 7 and 8 of the present invention.
Even preferred according to the present invention is the use of a QC inhibitor in methods of treating mild cognitive impairment (MCI) .
Accordingly, the present invention pertains more prepferably to the following items:
1. A QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition, selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
2. Use of a QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
3. Use of a QC inhibitor for the preparation of a medicament for treating and/or preventing an inflammatory disease or condition selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
4. The QC inhibitor or use according to any of items 1 to 3, wherein the disease is mild cognitive impairment (MCI).
5. The QC inhibitor or use according to any of items 1 to 4, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroptrotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
6. The QC inhibitor or use according to any of items 1 to 3, wherein the disease is selected from restenosis and pancreatitis .
7. The QC inhibitor or use according to any of items 1 to 3 or 6, wherein the disease is restenosis.
8. The QC-inhibitor or use according to any of items 1 to 3, 6 or 7, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors.
9. A Method of treatment and/or prevention of an inflammatory disease or condition, selected from mild cognitive impairment (MCI), restenosis and pancreatitis, wherein an effective amount of a QC inhibitor is administered to a subject in need thereof.
10. The method of treatment and/or prevention according to item 9, wherein the disease is mild cognitive impairment (MCI).
11. The method of treatment and/or prevention according to item 9 or 10, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
12. The method of treatment and/or prevention according to item 9, wherein the disease is a chronic or acute inflammation, selected from rheumatoid arthritis, atherosclerosis, restenosis and pancreatitis.
13. The method of treatment and/or prevention according to item 9 or 12, wherein the disease is selected from restenosis and pancreatitis.
14. The method of treatment and/or prevention according to any of item 9, 12 or 13, wherein the disease is restenosis.
15. The method of treatment and/or prevention according to any of items 9, or 12 to 14, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors;
IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors.
16. The use according to any of items 2 to 8, wherein the disease and/or condition afflict a human being. 17. The method of any of items 9 to 15, wherein the disease and/or condition afflicts a human being.
18. The QC-inhibitor, use or method according to any one of items 1 to 17, wherein said QC inhibitor is an inhibitor selected from formulae 1, 1*, Ia, Ib, Ic, Id, Ie, If, Ig, Ih, and Ii .
19. The QC-inhibitor, use or method according to any one of items 1 to 18, wherein said QC inhibitor is an inhibitor selected from examples 1 to 141.
20. The QC-inhibitor, use or method according to any one of items 1 to 19, wherein said QC inhibitor is 1-(3-(1H- imidazole-1-yl) propyl) -3- (3, 4-dimethoxy-phenyl) thiourea hydrochloride .
21. Diagnostic assay, comprising a QC inhibitor.
22. Diagnostic assay according to item 21, wherein said QC inhibitor is an inhibitor selected from formulae 1, 1*, Ia, Ib, Ic, Id, Ie, If, Ig, Ih, and Ii.
23. Diagnostic assay according to item 21 or 22, wherein said QC inhibitor is an inhibitor selected from examples 1 to 141.
24. Diagnostic assay according to any of items 21 to 23, wherein said QC inhibitor is 1- (3- (lH-imidazole-1-yl) propyl) -3- (3, 4- dimethoxy-phenyl) thiourea hydrochloride.
25. A method of diagnosing any one of the diseases and/or conditions as defined in item 1, comprising the steps of collecting a sample from a subject who is suspected to be afflicted with said disease and/or condition, contacting said sample with an inhibitor of a glutaminyl peptide cyclotransferase, and determining whether or not said subject is afflicted by said disease and/or condition.
26. The method according to item 26, wherein said subject is a human being.
27. The method according to item 26 or 27, wherein said QC inhibitor is an inhibitor selected from formulae 1, 1*, Ia,
Ib, Ic, Id, Ie, If, Ig, Ih, and Ii.
28. The method according to any of items 25 to 27, wherein said QC inhibitor is an inhibitor selected from examples 1 to 141.
29. The method according to any of items 25 to 28, wherein said
QC inhibitor is 1- (3- (lH-imidazole-1-yl) propyl) -3- (3, 4- dimethoxy-phenyl) thiourea hydrochloride.
30. The method of any of items 25 to 29, wherein said sample is a blood sample, a serum sample, a sample of cerebrospinal liquor or a urine sample.
31. Diagnostic kit for carrying out the method of items 25 to 30 comprising as detection means the diagnostic assay of any of items 21 to 24 and a determination means.
32. Pharmaceutical composition, comprising the QC inhibitor according to any of items 1, 4 to 6 or 18 to 20. Definitions
Enzyme inhibitors , in particular inhibitors of QC
Reversible enzyme inhibitors: comprise competitive inhibitors, non-competitive reversible inhibitors, slow-binding or tight- binding inhibitors, transition state analogues and multisubstrate analogues.
Competitive inhibitors show i) non-covalent interactions with the enzyme, ii) compete with substrate for the enzyme active site.
The principal mechanism of action of a reversible enzyme inhibitor and the definition of the dissociation constant can be visualized as follows:
Figure imgf000032_0001
The formation of the enzyme-inhibitor [E-I] complex prevents binding of substrates, therefore the reaction cannot proceed to the normal physiological product, P. A larger inhibitor concentration [I] leads to larger [E-I], leaving less free enzyme to which the substrate can bind. Non-competitive reversible inhibitors i) bind at a site other than active site (allosteric binding site) ii) cause a conformational change in the enzyme which decreases or stops catalytic activity.
Slow-binding or tight-binding inhibitors i) are competitive inhibitors where the equilibrium between inhibitor and enzyme is reached slowly, ii) (kon is slow) , possibly due to conformational changes that must occur in the enzyme or inhibitor a) are often transition state analogues b) are effective at concentrations similar to the enzyme concentration (subnanomolar KD values) c) due to koff values being so low these types of inhibitors are "almost" irreversible.
Transition state analogues
Are competitive inhibitors which mimic the transition state of an enzyme catalyzed reaction. Enzyme catalysis occurs due to a lowering of the energy of the transition state, therefore, transition state binding is favored over substrate binding.
Multisubstrate analogues For a reaction involving two or more substrates, a competitive inhibitor or transition state analogue can be designed which contains structural characteristics resembling two or more of the substrates.
Irreversible enzyme inhibitors: drive the equilibrium between the unbound enzyme and inhibitor and enzyme inhibitor complex (E
+ I < > E-I) all the way to the E-I-side with a covalent bond
(-100 kcal/mole) , making the inhibition irreversible.
Affinity labeling agents
• Active-site directed irreversible inhibitors (competitive irreversible inhibitor) are recognized by the enzyme (reversible, specific binding) followed by covalent bond formation, and i) are structurally similar to substrate, transition state or product allowing for specific interaction between drug and target enzyme, ii) contain reactive functional group (e.g. a nucleophile, -COCH2Br) allowing for covalent bond formation.
The reaction scheme below describes an active-site directed reagent with its target enzyme where K is the dissociation constant and kmactivation is the rate of covalent bond formation.
Figure imgf000034_0001
• Mechanism-based enzyme inactivators (also called suicide inhibitors) are active-site directed reagents (unreactive) which bind to the enzyme active site where they are transformed to a reactive form (activated) by the enzyme's catalytic capabilities. Once activated, a covalent bond between the inhibitor and the enzyme is formed.
The reaction scheme below shows the mechanism of action of a mechanism based enzyme inactivator, where KD is the dissociation complex, k2 is the rate of activation of the inhibitor once bound to the enzyme, k3 is the rate of dissociation of the activated inhibitor, P, from the enzyme (product can still be reactive) from the enzyme and k^ is the rate of covalent bond formation between the activated inhibitor and the enzyme.
Figure imgf000035_0001
Inactivation (covalent bond formation, ~kq) must occur prior to dissociation (k3) otherwise the now reactive inhibitor is released into the environment. The partition ratio, k^/kq: ratio of released product to inactivation should be minimized for efficient inactivation of the system and minimal undesirable side reactions.
A large partition ratio (favors dissocation) leads to nonspecific reactions.
Uncompetitive enzyme inhibitors: As a definition of uncompetitive inhibitor (an inhibitor which binds only to ES complexes) the following equilibria equation can be assumed:
Figure imgf000035_0002
The ES complex dissociates the subtrate with a dissociation constant equal to Ks, whereas the ESI complex does not dissociate it (i.e has a Ks value equal to zero) . The Km's of Michaelis-Menten type enzymes are expected to be reduced. Increasing substrate concentration leads to increasing ESI concentration (a complex incapable of progressing to reaction products) therefore the inhibition cannot be removed. Preferred according to the present invention are competitive enzyme inhibitors.
Most preferred are competitive reversible enzyme inhibitors.
The terms "K " or "K " and "K " are binding constants, which describe the binding of an inhibitor to and the subsequent release from an enzyme. Another measure is the "IC50" value, which reflects the inhibitor concentration, which at a given substrate concentration results in 50 % enzyme activity.
QC
The term "QC" as used herein comprises glutaminyl cyclase (QC) and QC-like enzymes. QC and QC-like enzymes have identical or similar enzymatic activity, further defined as QC activity. In this regard, QC-like enzymes can fundamentally differ in their molecular structure from QC.
The term "QC activity" as used herein is defined as intramolecular cyclization of N-terminal glutaminyl residues into pyroglutamic acid (pGlu*) or of N-terminal L-homoglutaminyl or L-beta-homoglutaminyl to a cyclic pyro-homoglutamine derivative under liberation of ammonia. See schemes 1 and 2 in this regard.
Scheme 1 : Cyclization of glutamine by QC
Figure imgf000037_0001
Scheme 2 : Cyclization of L-homoglutamine by QC
Figure imgf000037_0002
The term "EC" as used herein comprises the side activity of QC and QC-like enzymes as glutamate cyclase (EC) , further defined as EC activity.
The term "EC activity" as used herein is defined as intramolecular cyclization of N-terminal glutamyl residues into pyroglutamic acid (pGlu*) by QC. See scheme 3 in this regard. Scheme 3: N-terminal cyclization of uncharged glutamyl peptides by QC (EC)
Figure imgf000038_0001
The term "QC-inhibitor" "glutaminyl cyclase inhibitor" is generally known to a person skilled in the art and means enzyme inhibitors as generally defined above, which inhibit the catalytic activity of glutaminyl cyclase (QC) or its glutamyl cyclase (EC) activity.
Potency of QC inhibition
In light of the correlation with QC inhibition, in preferred embodiments, the subject method and medical use utilize an agent with a K1 for QC inhibition of 10 μM or less, more preferably of 1 μM or less, even more preferably of 0.1 μM or less or 0.01 μM or less, or most preferably 0.001 μM or less. Indeed, inhibitors with K1 values in the lower micromolar, preferably the nanomolar and even more preferably the picomolar range are contemplated. Thus, while the active agents are described herein, for convenience, as "QC inhibitors", it will be understood that such nomenclature is not intended to limit the subject matter of the invention in any way.
Molecular weight of QC inhibitors
In general, the QC inhibitors of the subject method or medical use will be small molecules, e.g., with molecular weights of 1000 g/mole or less, 500 g/mole or less, preferably of 400 g/mole or less, and even more preferably of 350 g/mole or less and even of 300 g/mole or less.
The term "subject" as used herein, refers to an animal, preferably a mammal, most preferably a human, who has been the object of treatment, observation or experiment and/or is suspected of being afflicted with a disease and/or condition as defined in the items.
The term "therapeutically effective amount" as used herein, means that amount of an active compound or a pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human being sought by a researcher, veterinarian, medical doctor or other clinician, which includes alleviation of the symptoms of the disease or disorder being treated.
As used herein, the term "pharmaceutically acceptable" embraces both human and veterinary use: for example the term "pharmaceutically acceptable" embraces a veterinary acceptable compound or a compound acceptable in human medicine and health care .
Pharmaceutically acceptable salts: In view of the close relationship between the free compounds and the compounds in the form of their salts or solvates, whenever a compound or inhibitor, respectively, is referred to in this context, a corresponding salt or solvate is also intended, provided such is possible or appropriate under the circumstances.
Salts and solvates of the inhibitors of the present invention and physiologically functional derivatives thereof which are suitable for use in medicine are those wherein the counter-ion or associated solvent is pharmaceutically acceptable. However, salts and solvates having non-pharmaceutically acceptable counter-ions or associated solvents are within the scope of the present invention, for example, for use as intermediates in the preparation of other compounds and their pharmaceutically acceptable salts and solvates.
Suitable salts according to the invention include those formed with both organic and inorganic acids or bases. Pharmaceutically acceptable acid addition salts include those formed from hydrochloric, hydrobromic, sulphuric, nitric, citric, tartaric, phosphoric, lactic, pyruvic, acetic, trifluoroacetic, triphenylacetic, sulphamic, sulphanilic, succinic, oxalic, fumaric, maleic, malic, mandelic, glutamic, aspartic, oxaloacetic, methanesulphonic, ethanesulphonic, arylsulphonic (for example p-toluenesulphonic, benzenesulphonic, naphthalenesulphonic or naphthalene-disulphonic) , salicylic, glutaric, gluconic, tricarballylic, cinnamic, substituted cinnamic (for example, phenyl, methyl, methoxy or halo substituted cinnamic, including 4-methyl and 4-methoxycinnamic acid) , ascorbic, oleic, naphthoic, hydroxynaphthoic (for example 1- or 3-hydroxy-2-naphthoic) , naphthaleneacrylic (for example naphthalene-2-acrylic) , benzoic, 4 methoxybenzoic, 2- or 4- hydroxybenzoic, 4-chlorobenzoic, 4-phenylbenzoic, benzeneacrylic
(for example 1, 4-benzenediacrylic) , isethionic acids, perchloric, propionic, glycolic, hydroxyethanesulfonic, pamoic, cyclohexanesulfamic, salicylic, saccharinic and trifluoroacetic acid. Pharmaceutically acceptable base salts include ammonium salts, alkali metal salts such as those of sodium and potassium, alkaline earth metal salts such as those of calcium and magnesium and salts with organic bases such as dicyclohexylamine and N-methyl-D-glutamine .
All pharmaceutically acceptable acid addition salt forms of the inhibitors of the present invention are intended to be embraced by the scope of this invention.
Examples of solvates include hydrates.
Polymorph crystal forms:
Furthermore, some of the crystalline forms of the inhibitors may exist as polymorphs and as such are intended to be included in the present invention. In addition, some of the compounds may form solvates with water (i.e. hydrates) or common organic solvents, and such solvates are also intended to be encompassed within the scope of this invention. The inhibitors, including their salts, can also be obtained in the form of their hydrates, or include other solvents used for their crystallization.
Prodrugs :
The present invention further includes within its scope prodrugs of the inhibitors of this invention. In general, such prodrugs will be functional derivatives of the inhibitors, which are readily convertible in vivo into the desired therapeutically active inhibitors. Thus, in these cases, the methods of treatment of the present invention, the term "administering" shall encompass the treatment of the various disorders described with prodrug versions of one or more of the itemed inhibitors, but which converts to the above specified inhibitors in vivo after administration to the subject. Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in "Design of Prodrugs", ed. H. Bundgaard, Elsevier, 1985 and the patent applications DE 198 28 113, DE 198 28 114, WO 99/67228 and WO 99/67279 which are fully incorporated herein by reference.
Protective Groups:
During any of the processes for preparation of the inhibitors of the present invention, it may be necessary and/or desirable to protect sensitive or reactive groups on any of the molecules concerned. This may be achieved by means of conventional protecting groups, such as those described in Protective Groups in Organic Chemistry, ed. J. F. W. McOmie, Plenum Press, 1973; and T. W. Greene & P. G. M. Wuts, Protective Groups in Organic Synthesis, John Wiley & Sons, 1991, fully incorporated herein by reference. The protecting groups may be removed at a convenient subsequent stage using methods known from the art.
As used herein, the term "composition" is intended to encompass a product comprising the itemed compounds in the therapeutically effective amounts, as well as any product, which results, directly or indirectly, from combinations of the itemed compounds .
Carriers and Additives for galenic formulations:
For liquid oral preparations, such as for example, suspensions, elixirs and solutions, suitable carriers and additives may advantageously include water, glycols, oils, alcohols, flavouring agents, preservatives, colouring agents and the like; for solid oral preparations such as, for example, powders, capsules, gelcaps and tablets, suitable carriers and additives include starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like.
Carriers, which can be added to the mixture, include necessary and inert pharmaceutical excipients, including, but not limited to, suitable binders, suspending agents, lubricants, flavorants, sweeteners, preservatives, coatings, disintegrating agents, dyes and colouring agents.
Soluble polymers as targetable drug carriers can include polyvinylpyrrolidone, pyran copolymer, polyhydroxypropylmeth- acrylamidephenol, polyhydroxyethylaspartamidephenol, or polyethyleneoxidepolyllysine substituted with palmitoyl residue (s). Furthermore, the inhibitors of the present invention may be coupled to a class of biodegradable polymers useful in achieving controlled/sustained release of a drug, for example, poly actic acid, poly-epsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross-linked or amphipathic block copolymers of hydrogels.
Suitable binders include, without limitation, starch, gelatin, natural sugars such as glucose or beta-lactose, corn sweeteners, natural and synthetic gums such as acacia, tragacanth or sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and the like. Disintegrating agents include, without limitation, starch, methyl cellulose, agar, bentonite, xanthan gum and the like.
EXAMPLES OF QC-INHIBITORS
QC-inhibitors, which are suitable for uses and methods according to the present invention are disclosed in WO 2005/075436, which is incorporated herein in its entirety with regard to the structure, synthesis and methods of use of the QC-inhibitors.
The present invention provides novel inhibitors of QC (EC) of the formula 1,
Figure imgf000043_0002
wherein:
A is either: an alkyl chain, alkenyl chain or alkynyl chain; or A is a group selected from:
Figure imgf000043_0001
wherein :
R6, R7, R8, R9 and R10 are independently H or an alkyl chain, alkenyl chain, alkynyl chain, cycloalkyl, a carbocycle, aryl, heteroaryl, or a heterocycle; n and n1 are independently 1 - 5; m is 1 - 5 ; o is 0 - 4;
and B is a group selected from (VI) - (XIV)
Figure imgf000044_0001
Figure imgf000044_0002
wherein :
D and E independently represent an alkyl chain, alkenyl chain, alkynyl chain, a cycloalkyl, carbocycle, aryl, -alkylaryl, heteroaryl, -alkylheteroaryl, acyl or a heterocycle. X represents CR20R21, O, S, NR19, with the proviso for formulas (VIII) and (IX) that, if Z = CH, X is O or S;
R19 is selected from the group consisting of H, alkyl, cycloalkyl, aryl, heteroaryl, -oxyalkyl, -oxyaryl, carbonyl, amido, hydroxy, NO2, NH2, CN;
R and R are independently selected from H, alkyl, cycloalkyl, heterocycle, aryl, heteroaryl, , -oxyalkyl, oxyaryl, carbonyl, amido, NO2 , NH2, CN, CF3 ;
X1, X2 and X3 are independently O or S provided that X2 and X3 are not both O;
Y is 0 or S, with the proviso that Y may not be 0, when the carbocycle formed by R17 and R18 has 3 members in the ring;
Z is CH or N;
R11, R12, R13 and R14 can be independently selected from H, an alkyl chain, an alkenyl chain, an alkynyl chain, cycloalkyl, carbocycle, aryl, heteroaryl, a heterocycle, halogen, alkoxy-, -thioalkyl, carboxyl, carboxylic acid ester, carbonyl, carbamide, carbimide, thiocarbamide or thiocarbonyl, NH2, NO2;
R15 and R16 are independently of each other H or a branched or unbranched alkyl chain, or a branched or unbranched alkenyl chain;
R17 and R18 are independently selected from H or an alkyl chain, alkenyl chain, a alkynyl chain, a carbocycle, aryl, heteroaryl, heteroalkyl or can be connected to form a carbocycle with up to 6 ring atoms;
n is 0 or 1;
one proviso, the following compounds: and
Figure imgf000046_0001
and
Figure imgf000046_0002
and
Figure imgf000046_0003
are excluded from formula 1.
When A is selected from an alkyl chain, alkenyl chain or alkynyl chain, preferably A is a C1-C7 alkyl chain, C1-C7 alkenyl chain or a C1-C7 alkynyl chain. In one embodiment of the invention A is an unbranched C2-5 alkyl chain, in particular an unbranched C3-4 alkyl chain, especially an unbranched C3 alkyl chain. In a second embodiment of the invention A represents a C3 alkyl chain which is substituted at the 2 position by one (i.e. in S or R configuration) or two methyl groups. When A is selected from the formulae (I) to (V), preferably A is selected from groups (I) to (IV) . In one embodiment of the invention A represents a group of formula (IV), wherein n1 are each equal to 1 and m = 1-4, especially m = 1. In a second embodiment of the invention A represents a group of formula (I), (II) or (III), wherein n and n1 are each equal to 1 and R6, R7, R8, R9 and R10 represent H.
Preferably R6, R7, R8, R9 and R10 represent H or methyl.
In one embodiment of the invention the group B is chosen from (VI), (Via), (VIb), (VII), (X), (XI), (XII), (XIII) and (XIV). In a second embodiment of the invention group B represents formula (VI) . In a third embodiment of the invention group B represents formula (Via) . In a fourth embodiment of the invention group B represents formula (VIb) . In a fifth embodiment of the invention group B represents formula (VII). In a sixth embodiment of the invention group B represents formula (X) . In a seventh embodiment of the invention group B represents formula (XI) . In an eighth embodiment of the invention group B represents formula (XII). In another embodiment of the invention group B represents formula (XIII) . In a further embodiment of the invention group B represents formula (XIV) . In a preferred embodiment of the invention B represents a group of formula (VI) or (VII) .
When B represents a group (IX) suitably A does not represent alkynyl .
Preferably D and E independently represent benzyl, aryl, heteroaryl or a heterocycle.
In one embodiment of the invention D and E represent aryl, in particular phenyl or napthyl, especially substituted phenyl.
Preferred substituent groups when D represents phenyl include alkoxy-, -thioalkyl, halogen, or a carboxylic acid alkyl or aryl ester. Also preferred are fluoro, chloro, bromo, iodo, trifluoromethyl, trifluoromethoxy, methoxy, ethoxy, benzyloxy, cyano, acetyl, dimethyl amino, methylsulphanyl, nitro, oxazolyl, pyrazolyl, isopropyl, ethyl and methoxycarbonyl . Where a phenyl group is mono-substituted it is preferred that substitution is in the 4-position. Other suitable aryl groups, which D and E may represent include dihydrobenzodioxine, benzodioxole, benzodithiole dihydrobenzodithiine, benzooxathiole and dihydrobenzooxathiine . A particularly preferred group, which D or E may represent is 3, 4- (dimethoxy) -phenyl,
Preferably R20 and R21 represent NO2, CN, CF3 or, if R20 is H, R21 is NO2, CN, CF3, or, if R21 is H, R20 is NO2, CN, CF3.
In one embodiment, X or Y is S, 0 or NR1. Preferably X or Y is S.
Preferably Z represents N.
In a preferred embodiment, R11 and R14 are H.
In a further preferred embodiment, R12 and R13 are independently selected from oxyalkyl or thioalkyl, halogen, or carboxylic acid alkyl ester or phenyl.
In a preferred embodiment, at least one of R15 and R16 is H, more preferably, R15 and R16 are both H.
In a preferred embodiment, one of R17 and R18 is H and the other iiss MMee.. AAllssoo pprreeffeerrrreedd aarree ccoommppoouunnddss wwhheerreeiinn oonnee ooff RR1177 aanndd RR1188 iiss H and t :hhee ootthheerr i_s phenyl. Additionally preferred are compounds wwhheerree RR1177 aaind R18 form a carbocycle with up to 6 members in the ring atoms .
Preferred compounds include those defined by Examples 13, 119 and 125 below. The present invention provides compounds of formula 1 for use as a pharmaceutical. In one embodiment regarding the use of the compounds of formula 1 as a pharmaceutical, the compounds:
Figure imgf000049_0001
and
Figure imgf000049_0002
and
Figure imgf000049_0003
and
Figure imgf000049_0004
are excluded from formula 1.
The compound (a) of the proviso above is disclosed as compound 7 in Ganellin et al (1995) J Med Chem 38(17) 3342-3350. This paper discloses said compound as a weak inhibitor of the histamine H3 receptor. The compound of proviso (b) is disclosed as compound 7 in Venkatachalam et al (2001) Bioorganic Med Chem Lett 11, 523-528. This discloses said compound as an HIVl reverse transcriptase inhibitor .
The compound of proviso (c) is disclosed as compound 19b in Moon et al (1991) J Med Chem 34, 2314-2327. This paper discloses said compound as a cholinergic agonist with potential use in the treatment of Alzheimer's disease.
The compounds of proviso (d) are disclosed as compounds 99, 100 and 102-103 in Wright et al (1986) J Med Chem 29, 523-530. This paper discloses said compounds as thromoxane synthetase inhibitors .
Certain compounds which would be embraced by formula 1 if it were not for the proviso "provided that X2 and X3 are not both O" are disclosed in Wright et al (1987) J Med Chem 30, 2277-2283 as thromboxane synthetase inhibitors.
Certain compounds which would be embraced by formula 1 if it were not for the proviso "that Y may not be O, when the carbocycle formed by R17 and R18 has 3 members in the ring" are disclosed in EP 0 117 462 A2 as thromboxane synthetase inhibitors .
In particular:
A suitable compound, that of formula 1* shown below, is a inhbitor of QC:
Figure imgf000051_0001
In a further embodiment, the inhibitors of QC (EC) are those of formula Ia,
Figure imgf000051_0002
wherein R is defined in examples 1 to 53.
Figure imgf000051_0003
Figure imgf000053_0001
Figure imgf000054_0001
Further suitable inhibitors of QC (EC) are those of formula Ib,
Figure imgf000055_0001
wherein R1 and R2 are defined in examples 54 to 95.
Figure imgf000055_0002
Figure imgf000056_0001
Figure imgf000057_0002
Further suitable inhibitors of QC (EC) are those of formula Ic,
Figure imgf000057_0001
wherein R3 is defined in examples 96 to 102.
Figure imgf000057_0003
Figure imgf000058_0003
Further suitable inhibitors of QC (EC) are those of formula Id,
Figure imgf000058_0001
wherein the position on the ring is defined in examples 103 to 105.
Figure imgf000058_0004
Further suitable inhibitors of QC (EC) are those of formula Ie,
Figure imgf000058_0002
wherein R and R are defined in examples 106 to 109,
Figure imgf000059_0003
Further suitable inhibitors of QC (EC) are those of formula If,
Figure imgf000059_0001
wherein R6 is defined in examples 110 to 112.
Figure imgf000059_0004
Further suitable inhibitors of QC (EC) are those of formula Ig,
Figure imgf000059_0002
wherein R7, R8 and R9 are defined in examples 113 to 132.
Figure imgf000060_0001
Figure imgf000061_0002
Further suitable inhibitors of QC (EC) are those of formula Ih,
Figure imgf000061_0001
wherein n is defined in examples 133 to 135.
Figure imgf000061_0003
Further suitable inhibitors of QC (EC) are those of formula Ii,
Figure imgf000062_0001
wherein m is defined in examples 136 and 137.
Figure imgf000062_0002
Further suitable inhibitors of QC (EC) are those of formula 13Ϊ to 141.
Figure imgf000062_0003
A preferred inhibitor of glutaminyl peptide cyclotransferase is 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride (further named as QCI)
Figure imgf000063_0001
In a preferred embodiment, the present invention provides a composition, preferably a pharmaceutical composition, comprising at least one QC inhibitor optionally in combination with at least one other agent selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
More specifically, the aforementioned other agent is selected from the group consisting of beta-amyloid antibodies, cysteine protease inhibitors, PEP-inhibitors, LiCl, acetylcholinesterase
(AChE) inhibitors, PIMT enhancers, inhibitors of beta secretases, inhibitors of gamma secretases, inhibitors of neutral endopeptidase, inhibitors of Phosphodiesterase-4 (PDE- 4), TNFalpha inhibitors, muscarinic Ml receptor antagonists, NMDA receptor antagonists, sigma-1 receptor inhibitors, histamine H3 antagonists, immunomodulatory agents, immunosuppressive agents, MCP-I antagonists or an agent selected from the group consisting of antegren (natalizumab) , Neurelan (fampridine-SR) , campath (alemtuzumab) , IR 208, NBI 5788/MSP 771 (tiplimotide) , paclitaxel, Anergix.MS (AG 284), SH636, Differin (CD 271, adapalene) , BAY 361677 (interleukin-4) , matrix- metalloproteinase-inhibitors (e.g. BB 76163), interferon-tau (trophoblastin) and SAIK-MS.
Furthermore, the other agent may be, for example, an antianxiety drug or antidepressant selected from the group consisting of
(a) Benzodiazepines, e.g. alprazolam, chlordiazepoxide, clobazam, clonazepam, clorazepate, diazepam, fludiazepam, loflazepate, lorazepam, methaqualone, oxazepam, prazepam, tranxene,
(b) Selective serotonin re-uptake inhibitors (SSRI' s), e.g. citalopram, fluoxetine, fluvoxamine, escitalopram, sertraline, paroxetine, (c) Tricyclic antidepressants, e.g. amitryptiline, clomipramine, desipramine, doxepin, imipramine
(d) Monoamine oxidase (MAO) inhibitors,
(e) Azapirones, e.g. buspirone, tandopsirone,
(f) Serotonin-norepinephrine reuptake inhibitors (SNRI' s), e.g. venlafaxine, duloxetine,
(g) Mirtazapine,
(h) Norepinephrine reuptake inhibitors (NRI' s), e.g. reboxetine, (i) Bupropione, (j) Nefazodone,
(k) beta-blockers,
(1) NPY-receptor ligands: NPY agonists or antagonists.
In a further embodiment, the other agent may be, for example, an anti-multiple sclerosis drug selected from the group consisting of a) dihydroorotate dehydrogenase inhibitors, e.g. SC-12267, teriflunomide, MNA-715, HMR-1279 (syn. to HMR-1715, MNA- 279), b) autoimmune suppressant, e.g. laquinimod, c) paclitaxel, d) antibodies, e.g. AGT-I, anti-granulocyte-macrophage colony- stimulating factor (GM-CSF) monoclonal antibody, Nogo receptor modulators, ABT-874, alemtuzumab (CAMPATH), anti- OX40 antibody, CNTO-1275, DN-1921, natalizumab (syn. to AN- 100226, Antegren, VLA-4 Mab) , daclizumab (syn. to Zenepax, Ro-34-7375, SMART anti-Tac) , J-695, priliximab (syn. to Centara, CEN-000029, CM-T412), MRA, Dantes, anti-IL-12- antibody, e) peptide nucleic acid (PNA) preparations, e.g. reticulose, f) interferon alpha, e.g. Alfaferone, human alpha interferon
(syn. to Omniferon, Alpha Leukoferon) , g) interferon beta, e.g. Frone, interferon beta-la like Avonex, Betron (Rebif) , interferon beta analogs, interferon beta-transferrin fusion protein, recombinant interferon beta-lb like Betaseron, h) interferon tau, i) peptides, e.g. AT-008, AnergiX.MS, Immunokine (alpha-
Immunokine-NNS03) , cyclic peptides like ZD-7349, j) therapeutic enzymes, e.g. soluble CD8 (sCD8), k) multiple sclerosis-specific autoantigen-encoding plasmid and cytokine-encoding plasmid, e.g. BHT-3009;
1) inhibitor of TNF-alpha, e.g. BLX-1002, thalidomide, SH-636, m) TNF antagonists, e.g. solimastat, lenercept (syn. to RO-45-
2081, Tenefuse) , onercept (sTNFRl), CC-1069, n) TNF alpha, e.g. etanercept (syn. to Enbrel, TNR-OOl) o) CD28 antagonists, e.g. abatacept, p) Lck tyrosine kinase inhibitors, q) cathepsin K inhibitors, r) analogs of the neuron-targeting membrane transporter protein taurine and the plant-derived calpain inhibitor leupeptin, e.g. Neurodur, s) chemokine receptor-1 (CCRl) antagonist, e.g. BX-471, t) CCR2 antagonists, u) AMPA receptor antagonists, e.g. ER-167288-01 and ER-099487,
E-2007, talampanel, v) potassium channel blockers, e.g. fampridine, w) tosyl-proline-phenylalanine small-molecule antagonists of the VLA-4/VCAM interaction, e.g. TBC-3342, x) cell adhesion molecule inhibitors, e.g. TBC-772, y) antisense oligonucleotides, e.g. EN-IOl, z) antagonists of free immunoglobulin light chain (IgLC) binding to mast cell receptors, e.g. F-991, aa) apoptosis inducing antigens, e.g. Apogen MS, bb) alpha-2 adrenoceptor agonist, e.g. tizanidine (syn. to
Zanaflex, Ternelin, Sirdalvo, Sirdalud, Mionidine) , cc) copolymer of L-tyrosine, L-lysine, L-glutamic acid and
L-alanine, e.g. glatiramer acetate (syn. to Copaxone, COP- 1, copolymer-1) , dd) topoisomerase II modulators, e.g. mitoxantrone hydrochloride, ee) adenosine deaminase inhibitor, e.g. cladribine (syn. to
Leustatin, Mylinax, RWJ-26251), ff) interleukin-10 , e.g. ilodecakin (syn. to Tenovil, Sch-
52000, CSIF), gg) interleukin-12 antagonists, e.g. lisofylline (syn. to
CT-1501R, LSF, lysofylline) , hh) Ethanaminum, e.g. SRI-62-834 (syn. to CRC-8605, NSC- 614383), ii) immunomodulators, e.g. SAIK-MS, PNU-156804, alpha- fetoprotein peptide (AFP), IPDS, jj) retinoid receptor agonists, e.g. adapalene (syn. to
Differin, CD-271), kk) TGF-beta, e.g. GDF-I (growth and differentiation factor
D,
11) TGF-beta-2, e.g. BetaKine, mm) MMP inhibitors, e.g. glycomed, nn) phosphodiesterase 4 (PDE4) inhibitors, e.g. RPR-122818, oo) purine nucleoside phosphorylase inhibitors, e.g. 9- (3- pyridylmethyl) -9-deazaguanine, peldesine (syn. to BCX-34, TO-200) , pp) alpha-4/beta-l integrin antagonists, e.g. ISIS-104278, qq) antisense alpha4 integrin (CD49d), e.g. ISIS-17044,
ISIS-27104, rr) cytokine-inducing agents, e.g. nucleosides, ICN-17261, ss) cytokine inhibitors, tt) heat shock protein vaccines, e.g. HSPPC-96, uu) neuregulin growth factors, e.g. GGF-2 (syn. to neuregulin, glial growth factor 2), vv) cathepsin S - inhibitors, ww) bropirimine analogs, e.g. PNU-56169, PNU-63693, xx) Monocyte chemoattractant protein-1 inhibitors, e.g. benzimidazoles like MCP-I inhibitors, LKS-1456, PD-064036, PD-064126, PD-084486, PD-172084, PD-172386.
Further, the present invention provides pharmaceutical compositions e.g. for parenteral, enteral or oral administration, comprising at least one QC inhibitor, optionally in combination with at least one of the other aforementioned agents .
These combinations provide a particularly beneficial effect. Such combinations are therefore shown to be effective and useful for the treatment of the aforementioned diseases. Accordingly, the invention provides a method for the treatment of these conditions . The method comprises either co-administration of at least one QC inhibitor and at least one of the other agents or the sequential administration thereof.
Co-administration includes administration of a formulation, which comprises at least one QC inhibitor and at least one of the other agents or the essentially simultaneous administration of separate formulations of each agent.
Beta-amyloid antibodies and compositions containing the same are described, e.g. in WO 2006/137354, WO 2006/118959, WO
2006/103116, WO 2006/095041, WO 2006/081171, WO 2006/066233, WO
2006/066171, WO 2006/066089, WO 2006/066049, WO 2006/055178, WO
2006/046644, WO 2006/039470, WO 2006/036291, WO 2006/026408, WO 2006/016644, WO 2006/014638, WO 2006/014478, WO 2006/008661, WO
2005/123775, WO 2005/120571, WO 2005/105998, WO 2005/081872, WO
2005/080435, WO 2005/028511, WO 2005/025616, WO 2005/025516, WO
2005/023858, WO 2005/018424, WO 2005/011599, WO 2005/000193, WO
2004/108895, WO 2004/098631, WO 2004/080419, WO 2004/071408, WO 2004/069182, WO 2004/067561, WO 2004/044204, WO 2004/032868, WO
2004/031400, WO 2004/029630, WO 2004/029629, WO 2004/024770, WO
2004/024090, WO 2003/104437, WO 2003/089460, WO 2003/086310, WO
2003/077858, WO 2003/074081, WO 2003/070760, WO 2003/063760, WO
2003/055514, WO 2003/051374, WO 2003/048204, WO 2003/045128, WO 2003/040183, WO 2003/039467, WO 2003/016466, WO 2003/015691, WO
2003/014162, WO 2003/012141, WO 2002/088307, WO 2002/088306, WO
2002/074240, WO 2002/046237, WO 2002/046222, WO 2002/041842, WO
2001/062801, WO 2001/012598, WO 2000/077178, WO 2000/072880, WO
2000/063250, WO 1999/060024, WO 1999/027944, WO 1998/044955, WO 1996/025435, WO 1994/017197, WO 1990/014840, WO 1990/012871, WO 1990/012870, WO 1989/006242. The beta-amyloid antibodies may be selected from, for example, polyclonal, monoclonal, chimenic or humanited antibodies. Furthermore, said antibodies may be useful to develop active and passive immune therapies, i.e. vaccines and monoclonal antibodies.
Suitable examples of beta-amyloid antibodies are ACU-5A5, huC091 (Acumen/Merck); PF-4360365, RI-1014, RI-1219, RI-409, RN-1219 (Rinat Neuroscience Corp (Pfizer Inc) ) ; the nanobody therapeutics of Ablynx/Boehringer Ingelheim; beta-amyloid- specific humanized monoclonal antibodies of Intellect
Neurosciences/IBL; m266, m266.2 (Eli Lilly & Co.); AAB-02
(Elan); bapineuzumab (Elan); BAN-2401 (Bioarctic Neuroscience
AB); ABP-102 (Abiogen Pharma SpA); BA-27, BC-05 (Takeda) ; R-1450
(Roche) ; ESBA-212 (ESBATech AG) ; AZD-3102 (AstraZeneca) and beta-amyloid antibodies of Mindset BioPharmaceuticals Inc.
Especcially preferred are antibodies, which recognize the N- terminus of the Aβ peptide. A suitable antibody, which recognize the Aβ-N-Terminus is, for example Acl-24 (AC immune CA) . A monoclonal antibody against beta-amyloid peptide is disclosed in WO 2007/068412. Respective chimenic and humanized antibodies are disclosed in WO 2008/011348. A method for producing a vaccine composition for treating an amyloid-associated diease si disclosed in WO 2007/068411.
Suitable cysteine protease inhibitors are for example inhibitors of cathepsin B. Inhibitors of cathepsin B and compositions containing such inhibitors are described, e.g. in WO 2006/060473, WO 2006/042103, WO 2006/039807, WO 2006/021413, WO 2006/021409, WO 2005/097103, WO 2005/007199, WO2004/084830, WO 2004/078908, WO 2004/026851, WO 2002/094881, WO 2002/027418, WO 2002/021509, WO 1998/046559, WO 1996/021655.
Examples of suitable PIMT enhancers are 10-aminoaliphatyl- dibenz[b, f] oxepines described in WO 98/15647 and WO 03/057204, respectively. Further useful according to the present invention are modulators of PIMT activity described in WO 2004/039773.
Inhibitors of beta secretase and compositions containing such inhibitors are described, e.g. in WO 03/059346, WO 2006/099352, WO 2006/078576, WO 2006/060109, WO 2006/057983, WO 2006/057945, WO 2006/055434, WO 2006/044497, WO 2006/034296, WO 2006/034277, WO 2006/029850, WO 2006/026204, WO 2006/014944, WO 2006/014762, WO 2006/002004, US 7,109,217, WO 2005/113484, WO 2005/103043, WO 2005/103020, WO 2005/065195, WO 2005/051914, WO 2005/044830, WO 2005/032471, WO 2005/018545, WO 2005/004803, WO 2005/004802, WO 2004/062625, WO 2004/043916, WO 2004/013098, WO 03/099202, WO 03/043987, WO 03/039454, US 6,562,783, WO 02/098849 and WO 02/096897.
Suitable examples of beta secretase inhibitors for the purpose of the present invention are WY-25105 (Wyeth) ; Posiphen, (+) - phenserine (TorreyPines / NIH); LSN-2434074, LY-2070275, LY- 2070273, LY-2070102 (Eli Lilly & Co.); PNU-159775A, PNU-178025A, PNU-17820A, PNU-33312, PNU-38773, PNU-90530 (Elan / Pfizer);
KMI-370, KMI-358, kmi-008 (Kyoto University); OM-99-2, OM-003
(Athenagen Inc.); AZ-12304146 (AstraZeneca / Astex) ; GW-840736X
(GlaxoSmithKline pic.) and DNP-004089 (De Novo Pharmaceuticals
Ltd.) .
Inhibitors of gamma secretase and compositions containing such inhibitors are described, e.g. in WO 2005/008250, WO 2006/004880, US 7,122,675, US 7,030,239, US 6,992,081, US 6,982,264, WO 2005/097768, WO2005/028440, WO 2004/101562, US 6,756,511, US 6,683,091, WO 03/066592, WO 03/014075, WO 03/013527, WO 02/36555, WO 01/53255, US 7,109,217, US 7,101,895, US 7,049,296, US 7,034,182, US 6,984,626, WO 2005/040126, WO 2005/030731, WO 2005/014553, US 6,890,956, EP 1334085, EP 1263774, WO 2004/101538, WO 2004/00958, WO 2004/089911, WO 2004/073630, WO 2004/069826, WO 2004/039370, WO 2004/031139, WO 2004/031137, US 6,713,276, US 6,686,449, WO 03/091278, US 6,649,196, US 6,448,229, WO 01/77144 and WO 01/66564.
Suitable gamma secretase inhibitors for the purpose of the present invention are GSI-953, WAY-GSI-A, WAY-GSI-B (Wyeth) ; MK- 0752, MRK-560, L-852505, L-685-458, L-852631, L-852646 (Merck & Co. Inc.); LY-450139, LY-411575, AN-37124 (Eli Lilly & Co.); BMS-299897, BMS-433796 (Bristol-Myers Squibb Co.); E-2012 (Eisai Co. Ltd.); EHT-0206, EHT-206 (ExonHit Therapeutics SA); and NGX-555 (TorreyPines Therapeutics Inc.).
Suitable beta amyloid synthesis inhibitors for the purpose of the present invention are for example Bisnorcymserine (Axonyx Inc.); (R) -flurbiprofen (MCP-7869; Flurizan) (Myriad Genetics); nitroflurbiprofen (NicOx) ; BGC-20-0406 (Sankyo Co. Ltd.) and BGC-20-0466 (BTG pIc).
Suitable amyloid protein deposition inhibitors for the purpose of the present invention are for example SP-233 (Samaritan
Pharmaceuticals); AZD-103 (Ellipsis Neurotherapeutics Inc.);
AAB-OOl (Bapineuzumab) , AAB-002, ACC-OOl (Elan Corp pic);
Colostrinin (ReGen Therapeutics pic); Tramiprosate (Neurochem) ;
AdPEDI- (amyloid-betal-6) 11) (Vaxin Inc.); MPI-127585, MPI-423948 (Mayo Foundation) ; SP-08 (Georgetown University) ; ACU-5A5
(Acumen / Merck) ; Transthyretin (State University of New York) ;
PTI-777, DP-74, DP 68, Exebryl (ProteoTech Inc.); m266 (Eli
Lilly & Co.); EGb-761 (Dr. Willmar Schwabe GmbH); SPI-014
(Satori Pharmaceuticals Inc.); ALS-633, ALS-499 (Advanced Life Sciences Inc.); AGT-160 (ArmaGen Technologies Inc.); TAK-070
(Takeda Pharmaceutical Co. Ltd.); CHF-5022, CHF-5074, CHF-5096 and CHF-5105 (Chiesi Farmaceutici SpA.). Suitable PDE-4 inhibitors for the purpose of the present invention are for example Doxofylline (Instituto Biologico Chemioterapica ABC SpA.); idudilast eye drops, tipelukast, ibudilast (Kyorin Pharmaceutical Co. Ltd.); theophylline (Elan Corp.); cilomilast (GlaxoSmithKline pic); Atopik (Barrier Therapeutics Inc.); tofimilast, CI-1044, PD-189659, CP-220629, PDE 4d inhibitor BHN (Pfizer Inc.); arofylline, LAS-37779 (Almirall Prodesfarma SA.); roflumilast, hydroxypumafentrine (Altana AG), tetomilast (Otska Pharmaceutical Co. Ltd.); tipelukast, ibudilast (Kyorin Pharmaceutical), CC-10004 (Celgene Corp.); HT-0712, IPL-4088 (Inflazyme Pharmaceuticals Ltd.); MEM- 1414, MEM-1917 (Memory Pharmaceuticals Corp.); oglemilast, GRC- 4039 (Glenmark Pharmaceuticals Ltd.); AWD-12-281, ELB-353, ELB- 526 (Elbion AG); EHT-0202 (ExonHit Therapeutics SA.); ND-1251 (Neuro3d SA.); 4AZA-PDE4 (4 AZA Bioscience NV.); AVE-8112 (Sanofi-Aventis) ; CR-3465 (Rottapharm SpA.); GP-0203, NCS-613 (Centre National de Ia Recherche Scientifique) ; KF-19514 (Kyowa Hakko Kogyo Co. Ltd.); ONO-6126 (Ono Pharmaceutical Co. Ltd.); OS-0217 (Dainippon Pharmaceutical Co. Ltd.); IBFB-130011, IBFB- 150007, IBFB-130020, IBFB-140301 (IBFB Pharma GmbH); IC-485 (ICOS Corp.); RBx-14016 and RBx-11082 (Ranbaxy Laboratories Ltd.). A preferred PDE-4-inhibitor is Rolipram.
MAO inhibitors and compositions containing such inhibitors are described, e.g. in WO 2006/091988, WO 2005/007614, WO 2004/089351, WO 01/26656, WO 01/12176, WO 99/57120, WO 99/57119, WO 99/13878, WO 98/40102, WO 98/01157, WO 96/20946, WO 94/07890 and WO 92/21333.
Suitable MAO-inhibitors for the purpose of the present invention are for example Linezolid (Pharmacia Corp.); RWJ-416457 (RW Johnson Pharmaceutical Research Institute) ; budipine (Altana AG); GPX-325 (BioResearch Ireland); isocarboxazid; phenelzine; tranylcypromine; indantadol (Chiesi Farmaceutici SpA.); moclobemide (Roche Holding AG); SL-25.1131 (Sanofi-Synthelabo) ;
CX-1370 (Burroughs Wellcome Co.); CX-157 (Krenitsky
Pharmaceuticals Inc.); desoxypeganine (HF Arzneimittelforschung
GmbH & Co. KG); bifemelane (Mitsubishi-Tokyo Pharmaceuticals Inc.); RS-1636 (Sankyo Co. Ltd.); esuprone (BASF AG); rasagiline
(Teva Pharmaceutical Industries Ltd.); ladostigil (Hebrew
University of Jerusalem) ; safinamide (Pfizer) and NW-1048
(Newron Pharmaceuticals SpA.) .
Suitable histamine H3 antagonists for the purpose of the present invention are, e.g. ABT-239, ABT-834 (Abbott Laboratories);
3874-H1 (Aventis Pharma) ; UCL-2173 (Berlin Free University),
UCL-1470 (BioProjet, Societe Civile de Recherche); DWP-302
(Daewoong Pharmaceutical Co Ltd); GSK-189254A, GSK-207040A (GlaxoSmithKline Inc.); cipralisant, GT-2203 (Gliatech Inc.); Ciproxifan (INSERM), IS, 2S) -2- (2-Aminoethyl) -1- (lH-imidazol-4- yl) cyclopropane (Hokkaido University); JNJ-17216498, JNJ-5207852 (Johnson & Johnson); NNC-0038-0000-1049 (Novo Nordisk A/S) ; and Sch-79687 (Schering-Plough) .
PEP inhibitors and compositions containing such inhibitors are described, e.g. in JP 01042465, JP 03031298, JP 04208299, WO 00/71144, US 5,847,155; JP 09040693, JP 10077300, JP 05331072, JP 05015314, WO 95/15310, WO 93/00361, EP 0556482, JP 06234693, JP 01068396, EP 0709373, US 5,965,556, US 5,756,763, US 6,121,311, JP 63264454, JP 64000069, JP 63162672, EP 0268190, EP 0277588, EP 0275482, US 4,977,180, US 5,091,406, US 4,983,624, US 5,112,847, US 5,100,904, US 5,254,550, US 5,262,431, US 5,340,832, US 4,956,380, EP 0303434, JP 03056486, JP 01143897, JP 1226880, EP 0280956, US 4,857,537, EP 0461677, EP 0345428, JP 02275858, US 5,506,256, JP 06192298, EP 0618193, JP 03255080, EP 0468469, US 5,118,811, JP 05025125, WO 9313065, JP 05201970, WO 9412474, EP 0670309, EP 0451547, JP 06339390, US 5,073,549, US 4,999,349, EP 0268281, US 4,743,616, EP 0232849, EP 0224272, JP 62114978, JP 62114957, US 4,757,083, US 4,810,721, US 5,198,458, US 4,826,870, EP 0201742, EP 0201741, US 4,873,342, EP 0172458, JP 61037764, EP 0201743, US 4,772,587, EP 0372484, US 5,028,604, WO 91/18877, JP 04009367, JP 04235162, US 5,407,950, WO 95/01352, JP 01250370, JP 02207070, US 5,221,752, EP 0468339, JP 04211648, WO 99/46272, WO 2006/058720 and WO 2006/120104.
Suitable prolyl endopeptidase inhibitors for the purpose of the present invention are, e.g. Fmoc-Ala-Pyrr-CN, Z-Phe-Pro- Benzothiazole (Probiodrug) , Z-321 (Zeria Pharmaceutical Co Ltd.); ONO-1603 (Ono Pharmaceutical Co Ltd); JTP-4819 (Japan Tobacco Inc.) and S-17092 (Servier) .
Other suitable compounds that can be used according to the present invention in combination with QC-inhibitors are NPY, an NPY mimetic or an NPY agonist or antagonist or a ligand of the NPY receptors .
Preferred according to the present invention are antagonists of the NPY receptors.
Suitable ligands or antagonists of the NPY receptors are 3a, 4 , 5, 9b-tetrahydro-lh-benz [e] indol-2-yl amine-derived compounds as disclosed in WO 00/68197.
NPY receptor antagonists which may be mentioned include those disclosed in European patent applications EP 0 614 911, EP 0 747 357, EP 0 747 356 and EP 0 747 378; international patent applications WO 94/17035, WO 97/19911, WO 97/19913, WO 96/12489, WO 97/19914, WO 96/22305, WO 96/40660, WO 96/12490, WO 97/09308, WO 97/20820, WO 97/20821, WO 97/20822, WO 97/20823, WO 97/19682, WO 97/25041, WO 97/34843, WO 97/46250, WO 98/03492, WO 98/03493, WO 98/03494 and WO 98/07420; WO 00/30674, US patents Nos. 5,552,411, 5,663,192 and 5,567,714; 6,114,336, Japanese patent application JP 09157253; international patent applications WO 94/00486, WO 93/12139, WO 95/00161 and WO 99/15498; US Patent No. 5,328,899; German patent application DE 393 97 97; European patent applications EP 355 794 and EP 355 793; and Japanese patent applications JP 06116284 and JP 07267988. Preferred NPY antagonists include those compounds that are specifically disclosed in these patent documents. More preferred compounds include amino acid and non-peptide-based NPY antagonists. Amino acid and non-peptide-based NPY antagonists which may be mentioned include those disclosed in European patent applications EP 0 614 911, EP 0 747 357, EP 0 747 356 and EP 0 747 378; international patent applications WO 94/17035, WO 97/19911, WO 97/19913, WO 96/12489, WO 97/19914, WO 96/22305, WO 96/40660, WO 96/12490, WO 97/09308, WO 97/20820, WO 97/20821, WO 97/20822, WO 97/20823, WO 97/19682, WO 97/25041, WO 97/34843, WO 97/46250, WO 98/03492, WO 98/03493, WO 98/03494, WO 98/07420 and WO 99/15498 ; US patents Nos. 5,552,411, 5,663,192 and 5,567,714; and Japanese patent application JP 09157253. Preferred amino acid and non-peptide-based NPY antagonists include those compounds that are specifically disclosed in these patent documents.
Particularly preferred compounds include amino acid-based NPY antagonists. Amino acid-based compounds, which may be mentioned include those disclosed in international patent applications WO 94/17035, WO 97/19911, WO 97/19913, WO 97/19914 or, preferably, WO 99/15498. Preferred amino acid-based NPY antagonists include those that are specifically disclosed in these patent documents, for example BIBP3226 and, especially, (R) -N2- (diphenylacetyl) - (R) -N- [ 1- (4-hydroxy- phenyl) ethyl] arginine amide (Example 4 of international patent application WO 99/15498) .
Ml receptor agonists and compositions containing such inhibitors are described, e.g. in WO 2004/087158, WO 91/10664. Suitable Ml receptor antagonists for the purpose of the present invention are for example CDD-0102 (Cognitive Pharmaceuticals) ; Cevimeline (Evoxac) (Snow Brand Milk Products Co. Ltd.); NGX-267 (TorreyPines Therapeutics) ; sabcomeline (GlaxoSmithKline) ; alvameline (H Lundbeck A/S) ; LY-593093 (Eli Lilly & Co.); VRTX-3 (Vertex Pharmaceuticals Inc.); WAY-132983 (Wyeth) and CI-IOl 7/ (PD-151832) (Pfizer Inc.).
Acetylcholinesterase inhibitors and compositions containing such inhibitors are described, e.g. in WO 2006/071274, WO 2006/070394, WO 2006/040688, WO 2005/092009, WO 2005/079789, WO 2005/039580, WO 2005/027975, WO 2004/084884, WO 2004/037234, WO 2004/032929, WO 03/101458, WO 03/091220, WO 03/082820, WO 03/020289, WO 02/32412, WO 01/85145, WO 01/78728, WO 01/66096, WO 00/02549, WO 01/00215, WO 00/15205, WO 00/23057, WO 00/33840, WO 00/30446, WO 00/23057, WO 00/15205, WO 00/09483, WO 00/07600, WO 00/02549, WO 99/47131, WO 99/07359, WO 98/30243, WO 97/38993, WO 97/13754, WO 94/29255, WO 94/20476, WO 94/19356, WO 93/03034 and WO 92/19238.
Suitable acetylcholinesterase inhibitors for the purpose of the present invention are for example Donepezil (Eisai Co. Ltd.); rivastigmine (Novartis AG); (-) -phenserine (TorreyPines Therapeutics) ; ladostigil (Hebrew University of Jerusalem) ; huperzine A (Mayo Foundation) ; galantamine (Johnson & Johnson) ;
Memoquin (Universita di Bologna); SP-004 (Samaritan
Pharmaceuticals Inc.); BGC-20-1259 (Sankyo Co. Ltd.); physostigmine (Forest Laboratories Inc.); NP-0361 (Neuropharma SA); ZT-I (Debiopharm) ; tacrine (Warner-Lambert Co.); metrifonate (Bayer Corp.) and INM-176 (Whanln) .
NMDA receptor antagonists and compositions containing such inhibitors are described, e.g. in WO 2006/094674, WO 2006/058236, WO 2006/058059, WO 2006/010965, WO 2005/000216, WO 2005/102390, WO 2005/079779, WO 2005/079756, WO 2005/072705, WO 2005/070429, WO 2005/055996, WO 2005/035522, WO 2005/009421, WO 2005/000216, WO 2004/092189, WO 2004/039371, WO 2004/028522, WO 2004/009062, WO 03/010159, WO 02/072542, WO 02/34718, WO 01/98262, WO 01/94321, WO 01/92204, WO 01/81295, WO 01/32640, WO 01/10833, WO 01/10831, WO 00/56711, WO 00/29023, WO 00/00197, WO 99/53922, WO 99/48891, WO 99/45963, WO 99/01416, WO 99/07413, WO 99/01416, WO 98/50075, WO 98/50044, WO 98/10757, WO 98/05337, WO 97/32873, WO 97/23216, WO 97/23215, WO 97/23214, WO 96/14318, WO 96/08485, WO 95/31986, WO 95/26352, WO 95/26350, WO 95/26349, WO 95/26342, WO 95/12594, WO 95/02602, WO 95/02601, WO 94/20109, WO 94/13641, WO 94/09016 and WO 93/25534.
Suitable NMDA receptor antagonists for the purpose of the present invention are for example Memantine (Merz & Co. GmbH); topiramate (Johnson & Johnson) ; AVP-923 (Neurodex) (Center for Neurologic Study); EN-3231 (Endo Pharmaceuticals Holdings Inc.); neramexane (MRZ-2/579) (Merz and Forest); CNS-5161 (CeNeS Pharmaceuticals Inc.); dexanabinol (HU-211; Sinnabidol; PA- 50211) (Pharmos) ; EpiCept NP-I (Dalhousie University); indantadol (V-3381; CNP-3381) (Vernalis) ; perzinfotel (EAA-090, WAY-126090, EAA-129) (Wyeth) ; RGH-896 (Gedeon Richter Ltd.); traxoprodil (CP-101606), besonprodil (PD-196860, CI-1041) (Pfizer Inc.); CGX-1007 (Cognetix Inc.); delucemine (NPS-1506) (NPS Pharmaceuticals Inc.); EVT-101 (Roche Holding AG); acamprosate (Synchroneuron LLC); CR-3991, CR-2249, CR-3394 (Rottapharm SpA.); AV-IOl (4-Cl-kynurenine (4-Cl-KYN)), 7- chloro-kynurenic acid (7-Cl-KYNA) (VistaGen) ; NPS-1407 (NPS Pharmaceuticals Inc.); YT-1006 (Yaupon Therapeutics Inc.); ED-
1812 (Sosei R&D Ltd.); himantane (hydrochloride N-2- (adamantly) - hexamethylen-imine) (RAMS) ; Lancicemine (AR-R-15896)
(AstraZeneca) ; EVT-102, Ro-25-6981 and Ro-63-1908 (Hoffmann-La
Roche AG / Evotec) . Furthermore, the present invention relates to combination therapies useful for the treatment of atherosclerosis, restenosis, pancreatitis or arthritis, administering a QC inhibitor in combination with another therapeutic agent selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors providing beneficial or synergistic therapeutic effects over each monotherapy component alone.
Angiotensin II receptor blockers are understood to be those active agents that bind to the ATI -receptor subtype of angiotensin II receptor but do not result in activation of the receptor. As a consequence of the blockade of the ATI receptor, these antagonists can, e.g. be employed as antihypertensive agents .
Suitable angiotensin II receptor blockers which may be employed in the combination of the present invention include ATi receptor antagonists having differing structural features, preferred are those with non-peptidic structures. For example, mention may be made of the compounds that are selected from the group consisting of valsartan (EP 443983), losartan (EP 253310), candesartan (EP 459136), eprosartan (EP 403159), irbesartan (EP 454511), olmesartan (EP 503785), tasosartan (EP 539086), telmisartan (EP 522314), the compound with the designation E-41 77 of the formula
Figure imgf000079_0001
the compound with the designation SC-52458 of the following formula
Figure imgf000079_0002
and the compound with the designation the compound ZD-8731 of the formula
Figure imgf000079_0003
or, in each case, a pharmaceutically acceptable salt thereof, Preferred ATI-receptor antagonists are those agents that have been approved and reached the market, most preferred is valsartan, or a pharmaceutically acceptable salt thereof.
The interruption of the enzymatic degradation of angiotensin to angiotensin II with ACE inhibitors is a successful variant for the regulation of blood pressure and thus also makes available a therapeutic method for the treatment of hypertension.
A suitable ACE inhibitor to be employed in the combination of the present invention is, e.g. a compound selected from the group consisting alacepril, benazepril, benazeprilat ; captopril, ceronapril, cilazapril, delapril, enalapril, enaprilat, fosinopril, imidapril, lisinopril, moveltopril, perindopril, quinapril, ramipril, spirapril, temocapril and trandolapril, or in each case, a pharmaceutically acceptable salt thereof.
Preferred ACE inhibitors are those agents that have been marketed, most preferred are benazepril and enalapril.
A diuretic is, for example, a thiazide derivative selected from the group consisting of chlorothiazide, hydrochlorothiazide, methylclothiazide, and chlorothalidon . The most preferred diuretic is hydrochlorothiazide. A diuretic furthermore comprises a potassium sparing diuretic such as amiloride or triameterine, or a pharmaceutically acceptable salt thereof.
The class of CCBs essentially comprises dihydropyridines (DHPs) and non- DHPs, such as diltiazem-type and verapamil-type CCBs.
A CCB useful in said combination is preferably a DHP representative selected from the group consisting of amlodipine, felodipine, ryosidine, isradipine, lacidipine, nicardipine, nifedipine, niguldipine, niludipine, nimodipine, nisoldipine, nitrendipine and nivaldipine, and is preferably a non-DHP representative selected from the group consisting of flunarizine, prenylamine, diltiazem, fendiline, gallopamil, mibefradil, anipamil, tiapamil and verapamil, and in each case, a pharmaceutically acceptable salt thereof. All these CCBs are therapeutically used, e.g. as anti-hypertensive, anti-angina pectoris or anti-arrhythmic drugs.
Preferred CCBs comprise amlodipine, diltiazem, isradipine, nicardipine, nifedipine, nimodipine, nisoldipine, nitrendipine and verapamil or, e.g. dependent on the specific CCB, a pharmaceutically acceptable salt thereof. Especially preferred as DHP is amlodipine or a pharmaceutically acceptable salt thereof, especially the besylate. An especially preferred representative of non-DHPs is verapamil or a pharmaceutically acceptable salt, especially the hydrochloride, thereof.
Beta-blockers suitable for use in the present invention include beta-adrenergic blocking agents (beta-blockers) , which compete with epinephrine for beta-adrenergic receptors and interfere with the action of epinephrine. Preferably, the beta-blockers are selective for the beta-adrenergic receptor as compared to the alpha-adrenergic receptors, and so do not have a significant alpha-blocking effect. Suitable beta-blockers include compounds selected from acebutolol, atenolol, betaxolol, bisoprolol, carteolol, carvedilol, esmolol, labetalol, metoprolol, nadolol, oxprenolol, penbutolol, pindolol, propranolol, sotalol and timolol. Where the beta-blocker is an acid or base or otherwise capable of forming pharmaceutically acceptable salts or prodrugs, these forms are considered to be encompassed herein, and it is understood that the compounds may be administered in free form or in the form of a pharmaceutically acceptable salt or a prodrug, such as a physiologically hydrolyzable and acceptable ester. For example, metoprolol is suitably administered as its tartrate salt, propranolol is suitably administered as the hydrochloride salt, and so forth.
Platelet aggregation inhibitors include PLAVIX® (clopidogrel bisulfate) , PLETAL® (cilostazol) and aspirin.
Cholesterol absorption modulators include ZETIA® (ezetimibe) and KT6-971 (Kotobuki Pharmaceutical Co. Japan).
HMG-Co-A reductase inhibitors (also called beta-hydroxy-beta- methylglutaryl-co-enzyme-A reductase inhibitors or statins) are understood to be those active agents which may be used to lower lipid levels including cholesterol in blood.
The class of HMG-Co-A reductase inhibitors comprises compounds having differing structural features. For example, mention may be made of the compounds, which are selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, pitavastatin, pravastatin, rosuvastatin and simvastatin, or in each case, a pharmaceutically acceptable salt thereof .
Preferred HMG-Co-A reductase inhibitors are those agents, which have been marketed, most preferred is atorvastatin, pitavastatin or simvastatin, or a pharmaceutically acceptable salt thereof.
HDL-increasing compounds include, but are not limited to, cholesterol ester transfer protein (CETP) inhibitors. Examples of CETP inhibitors include JTT7O5 disclosed in Example 26 of U.S. Patent No. 6,426,365 issued July 30, 2002, and pharmaceutically acceptable salts thereof.
Inhibition of interleukin 6 mediated inflammation may be achieved indirectly through regulation of endogenous cholesterol synthesis and isoprenoid depletion or by direct inhibition of the signal transduction pathway utilizing interleukin-6 inhibitor/antibody, interleukin-6 receptor inhibitor/antibody, interleukin-6 antisense oligonucleotide (ASON), gpl30 protein inhibitor/antibody, tyrosine kinase inhibitors/antibodies, serine/threonine kinase inhibitors/antibodies, mitogen-activated protein (MAP) kinase inhibitors/antibodies, phosphatidylinositol
3-kinase (PI3K) inhibitors/antibodies, Nuclear factor kappaB
(NF-KB) inhibitors/antibodies, 1KB kinase (IKK) inhibitors/antibodies, activator protein-1 (AP-I) inhibitors/antibodies, STAT transcription factors inhibitors/antibodies, altered IL-6, partial peptides of IL-6 or IL-6 receptor, or SOCS (suppressors of cytokine signaling) protein, PPAR gamma and/or PPAR beta/delta activators/ligands or a functional fragment thereof.
A suitable antiinflammatory corticosteroid is dexamethasone .
Suitable antiproliferative agents are cladribine, rapamycin, vincristine and taxol.
A suitable inhibitor of extracellular matrix synthesis is halofuginone .
A suitable growth factor or cytokine signal transduction inhibitor is, e.g. the ras inhibitor R115777.
A suitable tyrosine kinase inhibitor is tyrphostin.
Suitable renin inhibitors are described, e.g. in WO 2006/116435. A preferred renin inhibitor is aliskiren, preferably in the form of the hemi-fumarate salt thereof. MCP-I antagonists may, e.g. be selected from anti-MCP-1 antibodies, preferably monoclonal or humanized monoclonal antibodies, MCP-I expression inhibitors, CCR2-antagonists, TNF- alpha inhibitors, VCAM-I gene expression inhibitors and anti-C5a monoclonal antibodies.
MCP-I antagonists and compositions containing such inhibitors are described, e.g. in WO 02/070509, WO 02/081463, WO 02/060900, US 2006/670364, US 2006/677365, WO 2006/097624, US 2006/316449, WO 2004/056727, WO 03/053368, WO 00/198289, WO 00/157226, WO 00/046195, WO 00/046196, WO 00/046199, WO 00/046198, WO 00/046197, WO 99/046991, WO 99/007351, WO 98/006703, WO 97/012615, WO 2005/105133, WO 03/037376, WO 2006/125202, WO
2006/085961, WO 2004/024921, WO 2006/074265.
Suitable MCP-I antagonists are, for instance, C-243 (Telik Inc.); NOX-E36 (Noxxon Pharma AG); AP-761 (Actimis Pharmaceuticals Inc.); ABN-912, NIBR-177 (Novartis AG); CC- 11006 (Celgene Corp.); SSR-150106 (Sanofi-Aventis) ; MLN-1202 (Millenium Pharmaceuticals Inc.); AGI-1067, AGIX-4207, AGI-1096 (AtherioGenics Inc.); PRS-211095, PRS-211092 (Pharmos Corp.); anti-C5a monoclonal antibodies, e.g. neutrazumab (G2 Therapies Ltd.); AZD-6942 (AstraZeneca pic); 2-mercaptoimidazoles (Johnson & Johnson) ; TEI-E00526, TEI-6122 (Deltagen) ; RS-504393 (Roche Holding AG); SB-282241, SB-380732, ADR-7 (GlaxoSmithKline) ; anti-MCP-1 monoclonal antibodies (Johnson & Johnson) .
Combinations of QC-inhibitors with MCP-I antagonists may be useful for the treatment of inflammatory diseases in general, including neurodegenerative diseases.
Combinations of QC-inhibitors with MCP-I antagonists are preferred for the treatment of Alzheimer's disease.
Most preferably the QC inhibitor is combined with one or more compounds selected from the following group: PF-4360365, m266, bapineuzumab, R-1450, Posiphen, (+) - phenserine, MK-0752, LY-450139, E-2012, (R) -flurbiprofen, AZD- 103, AAB-OOl (Bapineuzumab), Tramiprosate, EGb-761, TAK-070, Doxofylline, theophylline, cilomilast, tofimilast, roflumilast, tetomilast, tipelukast, ibudilast, HT-0712, MEM-1414, oglemilast, Linezolid, budipine, isocarboxazid, phenelzine, tranylcypromine, indantadol, moclobemide, rasagiline, ladostigil, safinamide, ABT-239, ABT-834, GSK-189254A, Ciproxifan, JNJ-17216498, Fmoc-Ala-Pyrr-CN, Z-Phe-Pro- Benzothiazole, Z-321, ONO-1603, JTP-4819, S-17092, BIBP3226;
(R) -N2- (diphenylacetyl) - (R) -N- [1- (4-hydroxyphenyl) ethyl] arginine amide, Cevimeline, sabcomeline, (PD-151832), Donepezil, rivastigmine, (-) -phenserine, ladostigil, galantamine, tacrine, metrifonate, Memantine, topiramate, AVP-923, EN-3231, neramexane, valsartan, benazepril, enalapril, hydrochlorothiazide, amlodipine, diltiazem, isradipine, nicardipine, nifedipine, nimodipine, nisoldipine, nitrendipine, verapamil, amlodipine, acebutolol, atenolol, betaxolol, bisoprolol, carteolol, carvedilol, esmolol, labetalol, metoprolol, nadolol, oxprenolol, penbutolol, pindolol, propranolol, sotalol, timolol, PLAVIX® (clopidogrel bisulfate) , PLETAL® (cilostazol) , aspirin, ZETIA® (ezetimibe) and KT6-971, statins, atorvastatin, pitavastatin or simvastatin; dexamethasone, cladribine, rapamycin, vincristine, taxol, aliskiren, C-243, ABN-912, SSR-150106, MLN-1202 and betaferon.
In particular, the following combinations are considered:
a QC inhibitor, in particular QCI, in combination with Atorvastatin for the treatment and/or prevention of artherosclerosis
- a QC inhibitor, in particular QCI, in combination with immunosuppressive agents, preferably rapamycin for the prevention and/or treatment of restenosis - a QC inhibitor, in particular QCI, in combination with immunosuppressive agents, preferably paclitaxel for the prevention and/or treatment of restenosis
- a QC inhibitor, in particular QCI, in combination with AChE inhibitors, preferably Donepezil, for the prevention and/or treatment of Alzheimer's disease
- a QC inhibitor, in particular QCI, in combination with interferones, preferably Aronex, for the prevention and/or treatment of multiple sclerosis - a QC inhibitor, in particular QCI, in combination with interferones, preferably betaferon, for the prevention and/or treatment of multiple sclerosis
- a QC inhibitor, in particular QCI, in combination with interferones, preferably Rebif, for the prevention and/or treatment of multiple sclerosis
- a QC inhibitor, in particular QCI, in combination with Copaxone, for the prevention and/or treatment of multiple sclerosis
- a QC inhibitor, in particular QCI, in combination with dexamethasone, for the prevention and/or treatment of restenosis
- a QC inhibitor, in particular QCI, in combination with dexamethasone, for the prevention and/or treatment of atherosclerosis - a QC inhibitor, in particular QCI, in combination with dexamethasone, for the prevention and/or treatment of rheumatid arthritis
- a QC inhibitor, in particular QCI, in combination with HMG-Co-A-reductase inhibitors, for the prevention and/or treatment of restenosis, wherein the HMG-Co-A-reductase inhibitor is selected from atorvastatin, cerivastatin, fluvastatin, lovastatin, pitavastatin, pravastatin, rosuvastatin and simvastatin - a QC inhibitor, in particular QCI, in combination with HMG-Co-A reductase inhibitors, for the prevention and/or treatment of atherosclerosis wherein the HMG-Co-A- reductase inhibitor is selected from atorvastatin, cerivastatin, fluvastatin, lovastatin, pitavastatin, pravastatin, rosuvastatin and simvastatin
- a QC inhibitor, in particular QCI, in combination with HMG-Co-A reductase inhibitors, for the prevention and/or treatment of rheumatoid arthritis wherein the HMG-Co-A- reductase inhibitor is selected from atorvastatin, cerivastatin, fluvastatin, lovastatin, pitavastatin, pravastatin, rosuvastatin and simvastatin
Such a combination therapy is in particular useful for AD, FAD, FDD and neurodegeneration in Down syndrome as well as atherosclerosis, rheumatoid arthritis, restenosis and pancreatitis .
Such combination therapies might result in a better therapeutic effect (less proliferation as well as less inflammation, a stimulus for proliferation) than would occur with either agent alone .
With regard to the specific combination of inhibitors of QC and further compounds it is referred in particular to WO 2004/098625 in this regard, which is incorporated herein by reference.
In a further embodiment the present invention provides a method for preventing or treating a disease or condition, selected from a group consisting of inflammatory diseases selected from a. neurodegenerative diseases, e.g. mild cognitive impairment (MCI), Alzheimer's disease, neurodegeneration in Down Syndrome, Familial British Dementia, Familial Danish Dementia, multiple sclerosis, b. chronic and acute inflammations, e.g. rheumatoid arthritis, atherosclerosis, restenosis, pancreatitis, c. fibrosis, e.g. lung fibrosis, liver fibrosis, renal fibrosis, d. cancer, e.g. cancer/hemangioendothelioma proliferation, gastric carcinomas, e. metabolic diseases, e.g. hypertension, f. and other inflammatory diseases, e.g. neuropathic pain, graft rejection/graft failure/graft vasculopathy, HIV infections/AIDS, gestosis, tuberous sclerosis.
Additionally, the present invention includes the use of the compounds of this invention and their corresponding pharmaceutically acceptable acid salt forms for the preparation of a medicament for the prevention or treatment of any of the above diseases or conditions.
Most preferably, the present QC inhibitors are used for the treatment of the above-mentioned neurodegenerative diseases. Even prefered is the use of the QC inhibitors of the present invention for the treatment of a disease selected from restenosis, pancreatitis, rheumatoid arthritis and atherosclerosis, most preferably restenosis or pancreatitis.
The compound may be administered to a patient by any conventional route of administration, including, but not limited to, intravenous, oral, subcutaneous, intramuscular, intradermal, parenteral and combinations thereof.
In a further preferred form of implementation, the invention relates to pharmaceutical compositions, that is to say, medicaments, that contain at least one compound of the invention or salts thereof, optionally in combination with one or more pharmaceutically acceptable carriers and/or solvents.
The pharmaceutical compositions may, for example, be in the form of parenteral or enteral formulations and contain appropriate carriers, or they may be in the form of oral formulations that may contain appropriate carriers suitable for oral administration. Preferably, they are in the form of oral formulations .
The inhibitors of QC activity administered according to the invention may be employed in pharmaceutically administrable formulations or formulation complexes as inhibitors or in combination with inhibitors, substrates, pseudosubstrates, inhibitors of QC expression, binding proteins or antibodies of those enzyme proteins that reduce the QC protein concentration in mammals. The compounds of the invention make it possible to adjust treatment individually to patients and diseases, it being possible, in particular, to avoid individual intolerances, allergies and side-effects.
The compounds also exhibit differing degrees of activity as a function of time. The physician providing treatment is thereby given the opportunity to respond differently to the individual situation of patients: he is able to adjust precisely, on the one hand, the speed of the onset of action and, on the other hand, the duration of action and especially the intensity of action .
The compounds may be advantageously administered, for example, in the form of pharmaceutical preparations that contain the active ingredient in combination with customary additives like diluents, excipients and/or carriers known from the prior art.
For example, they can be administered parenterally (for example i.v. in physiological saline solution) or enterally (for example orally, formulated with customary carriers) .
Depending on their endogenous stability and their bioavailability, one or more doses of the compounds can be given per day in order to achieve the desired reduction of MCP activity. For example, such a dosage range in humans may be in the range of from about 0.01 mg to 250.0 mg per day, preferably in the range of about 0.01 to 100 mg of compound per kilogram of body weight per day. The compounds used according to the invention can accordingly be converted in a manner known per se into conventional formulations, such as, for example, tablets, (bitable) capsules, dragees, pills, suppositories, granules, aerosols, syrups, drops, liquid, solid and cream-like emulsions and suspensions and/or also as suppositories or as nasal sprays solutions, using inert, non-toxic, pharmaceutically suitable carriers and additives or solvents. In each of those formulations, the therapeutically effective compounds are preferably present in a concentration of approximately from 0.1 to 80% by weight, more preferably from 1 to 50% by weight, of the total mixture, that is to say, in amounts sufficient for the mentioned dosage latitude to be obtained.
The formulations may be advantageously prepared, for example, by extending the active ingredient with solvents and/or carriers, optionally with the use of emulsifiers and/or dispersants, it being possible, for example, in the case where water is used as diluent, for organic solvents to be optionally used as auxiliary solvents .
Examples of excipients useful in connection with the present invention include: water, non-toxic organic solvents, such as paraffins (for example natural oil fractions) , vegetable oils
(for example rapeseed oil, groundnut oil, sesame oil) , alcohols
(for example ethyl alcohol, glycerol) , glycols (for example propylene glycol, polyethylene glycol) ; solid carriers, such as, for example, natural powdered minerals (for example highly dispersed silica, silicates) , sugars (for example raw sugar, lactose and dextrose) ; emulsifiers, such as non-ionic and anionic emulsifiers (for example polyoxyethylene fatty acid esters, polyoxyethylene fatty alcohol ethers, alkylsulphonates and arylsulphonates) , dispersants (for example lignin, sulphite liquors, methylcellulose, starch and polyvinylpyrrolidone) and lubricants (for example magnesium stearate, talcum, stearic acid and sodium lauryl sulphate) and optionally flavourings. Administration may be carried out in the usual manner, preferably enterally or parenterally, especially orally. In the case of enteral administration, tablets may contain in addition to the mentioned carriers further additives such as sodium citrate, calcium carbonate and calcium phosphate, together with various additives, such as starch, preferably potato starch, gelatin and the like. Furthermore, lubricants, such as magnesium stearate, sodium lauryl sulphate and talcum, can be used concomitantly for tabletting. In the case of aqueous suspensions and/or elixirs intended for oral administration, various taste correctives or colourings can be added to the active ingredients in addition to the above-mentioned excipients.
In the case of parenteral administration, solutions of the active ingredients using suitable liquid carriers can be employed. In general, it has been found advantageous to administer, in the case of intravenous administration, amounts of approximately from 0.01 to 2.0 mg/kg, preferably approximately from 0.01 to 1.0 mg/kg, of body weight per day to obtain effective results and, in the case of enteral administration, the dosage is approximately from 0.01 to 2 mg/kg, preferably approximately from 0.01 to 1 mg/kg, of body weight per day.
It may nevertheless be necessary in some cases to deviate from the stated amounts, depending upon the body weight of the experimental animal or the patient or upon the type of administration route, but also on the basis of the species of animal and its individual response to the medicament or the interval at which administration is carried out. Accordingly, it may be sufficient in some cases to use less than the above- mentioned minimum amount, while, in other cases, the mentioned upper limit will have to be exceeded. In cases where relatively large amounts are being administered, it may be advisable to divide those amounts into several single doses over the day. For administration in human medicine, the same dosage latitude is provided. The above remarks apply analogously in that case. The above disclosure describes the present invention in general. A more complete understanding can be obtained by reference to the following figures and examples. These examples are described solely for purposes of illustration and are not intended to limit the scope of the invention. Although specific terms have been employed herein, such terms are intended in a descriptive sense and not for purposes of limitation.
Reference Example 1 : Preparation of Human QC
Host strains and media
Pichia pastoris strain X33 (AOXl, A0X2), used for the expression of human QC was grown, transformed and analyzed according to the manufacturer's instructions (Invitrogen) . The media required for
P. pastoris, i.e. buffered glycerol (BMGY) complex or methanol
(BMMY) complex medium, and the fermentation basal salts medium were prepared according to the manufacturer's recommendations.
Molecular cloning of plasmid vectors encodinq the human QC
All cloning procedures were done applying standard molecular biology techniques. For expression in yeast, the vector pPICZCCB
(Invitrogen) was used. The pQE-31 vector (Qiagen) was used to express the human QC in E. coll. The cDNA of the mature QC starting with codon 38 was fused in frame with the plasmid encoded βxhistidine tag. After amplification utilizing the primers pQCyc-1 and pQCyc-2 (WO 2004/098625) and subcloning, the fragment was inserted into the expression vector employing the restriction sites of Sphl and Hindlll.
Transformation of P. pastoris and mini-scale expression Plasmid DNA was amplified in E. coll JM109 and purified according to the recommendations of the manufacturer (Qiagen) . In the expression plasmid used, pPICZCCB, three restriction sites are provided for linearization. Since Sad and BstXI cut within the QC cDNA, Pmel was chosen for linearization. 20-30 μg plasmid DNA was linearized with Pmel, precipitated by ethanol, and dissolved in sterile, deionized water. 10 μg of the DNA was then applied for transformation of competent P. pastoris cells by electroporation according to the manufacturer's instructions (BioRad) . Selection was done using plates containing 150 μg/ml Zeocin. One transformation using the linearized plasmid yielded several hundred transformants .
In order to test the recombinant yeast clones for QC expression, recombinants were grown for 24 h in 10 ml conical tubes containing 2 ml BMGY. Afterwards, the yeast was centrifuged and resuspended in 2 ml BMMY containing 0.5 % methanol. This concentration was maintained by addition of methanol every 24 h up to 72 h. Subsequently, QC activity in the supernatant was determined. The presence of the fusion protein was confirmed by western blot analysis using an antibody directed against the βxhistidine tag (Qiagen) . Clones that displayed the highest QC activity were chosen for further experiments and fermentation.
Large-scale expression in a fermenter
Expression of the QC was performed in a 5 1 reactor (Biostat B, B. Braun biotech) , essentially as described in the "Pichia fermentation process guidelines" (Invitrogen) . Briefly, the cells were grown in the fermentation basal salts medium supplemented with trace salts, and with glycerol as the sole carbon source (pH 5.5) . During an initial batch phase for about 24 h and a subsequent fed-batch phase for about 5 h, cell mass was accumulated. Once a cell wet weight of 200 g/1 was achieved, induction of QC expression was performed using methanol applying a three-step feeding profile for an entire fermentation time of approximately 60 h. Subsequently, cells were removed from the QC-containing supernatant by centrifugation at 6000xg, 4°C for 15 min. The pH was adjusted to 6.8 by addition of NaOH, and the resultant turbid solution was centrifuged again at 37000xg, 4°C for 40 min. In cases of continued turbidity, an additional filtration step was applied using a cellulose membrane (pore width 0.45 μm) . Purification of 6 x histidine tagged QC expressed in P. pastoris The His-tagged QC was first purified by immobilized metal affinity chromatography (IMAC) . In a typical purification, 1000 ml of culture supernatant were applied to a Ni2+-loaded Chelating Sepharose FF column (1.6 x 20 cm, Pharmacia), that was equilibrated with 50 mM phosphate buffer, pH 6.8, containing 750 mM NaCl, at a flow rate of 5 ml/min. After washing with 10 column volumes of equilibration buffer and 5 column volumes of equilibration buffer containing 5 mM histidine, the bound protein was eluted by a shift to 50 mM phosphate buffer, pH 6.8, containing 150 mM NaCl and 100 mM histidine. The resulting eluate was dialyzed against 20 mM Bis-Tris/HCI, pH 6.8, at 4°C overnight. Subsequently, the QC was further purified by anion exchange chromatography an a Mono Q6 column (BioRad) , equilibrated with dialysis buffer. The QC-containing fraction was loaded onto the column using a flow rate of 4 ml/min. The column was then washed with equilibration buffer containing 100 mM NaCl. The elution was performed by two gradients resulting in equilibration buffer containing 240 mM and 360 mM NaCl in 30 or 5 column volumes, respectively. Fractions of 6 ml were collected and the purity was analyzed by SDS-PAGE. Fractions containing homogenous QC were pooled and concentrated by ultrafiltration. For long-term storage (-200C), glycerol was added to a final concentration of 50 %. Protein was quantified according to the methods of Bradford or Gill and von Hippel (Bradford, M. M. 1976 Anal Biochem 72, 248-254; Gill, S. C. and von Hippel, P. H. 1989 Anal Biochem 182, 319-326.).
Expression and purification of QC in E. coli
The construct encoding the QC was transformed into M15 cells (Qiagen) and grown an selective LB agar plates at 37°C. Protein expression was carried out in LB medium containing 1% glucose and 1% ethanol at room temperature. When the culture reached an ODgQQ of approximately 0.8, expression was induced with 0,1 mM IPTG overnight. After one cycle of freezing and thawing, cells were lysed at 4°C by addition of 2.5 mg/ml lysozyme in 50 mM phosphate buffer, pH 8.0, containing 300 mM NaCl and 2 mM histidine for approximately 30 min. The solution was clarified by centrifugation at 37000xg, 4 0C for 30 min, followed by a filtration applying a glass frit (DNA separation) and two additional filtration steps applying cellulose filters for crude and fine precipitates. The supernatant (approx. 500 ml) was applied onto a Ni2+-affinity column (1.6 x 20 cm) at a flow rate of 1 ml/min. Elution of QC was carried out with 50 mM phosphate buffer containing 150 mM NaCl and 100 mM histidine. The QC- containing fraction was concentrated by ultrafiltration.
Reference Example 2: MALDI-TOF mass spectrometry
Matrix-assisted laser desorption/ionization mass spectrometry was carried out using the Voyager De-Pro (Applied Biosystems, Darmstadt) with a linear time of flight analyzer. The instrument was equipped with a 337 nm nitrogen laser, a potential acceleration source and a 1.4 m flight tube. Detector operation was in the positive-ion mode. Samples (5 μl) were mixed with equal volumes of the matrix solution. For matrix solution we used sinapinic acid, prepared by solving 20 mg sinapinic acid (Sigma-Aldrich) in 1 ml acetonitrile/0.1% TFA in water (1/1, v/v) . A small volume (~ 1 μl) of the matrix-analyte-mixture was transferred to a probe tip.
For long-term testing of Glu^-cyclization, Aβ-derived peptides were incubated in 100 μl 0.1 M sodium acetate buffer, pH 5.2 or 0.1 M Bis-Tris buffer, pH 6.5 at 300C. Peptides were applied in 0.5 mM [Aβ3-ll a] or 0.15 mM [Aβ3-21a] concentrations, and 0.2 U QC was added all 24 hours. In case of Aβ3-21a, the assays contained 1 % DMSO. At different times, samples were removed from the assay tube, peptides extracted using ZipTips
(Millipore) according to the manufacturer's recommendations, mixed with matrix solution (1:1 v/v) and subsequently the mass spectra recorded. Negative controls contained either no QC or heat deactivated enzyme. For the inhibitor studies the sample composition was the same as described above, with exception of the inhibitory compound added (5 mM benzimidazole or 2 mM 1,10- phenanthroline) . Example 1: Preparation and Expression of human MCP-I in mammalian cell culture
Cell lines and media
Human neuroblastoma cell line SH-SY5Y, human embryonic kidney cell line HEK293 and human monocyte cell line THP-I were cultured in appropriate cell culture media (DMEM, 10% FBS for SH-SY5Y and HEK293), (RPMI1640, 10 % FBS for THP-I), in a humidified atmosphere of 5% CO2 (HEK293, THP-I) or 10% CO2 (SH- SY5Y) at 37°C.
Isolation of human MCP-I
Full-length cDNA of human MCP-I was isolated from SH-SY5Y cells using RT-PCR. Total RNA of SH-SY5Y cells was reversely transcribed by Superscript II (Invitrogen) and subsequently, human MCP-I was amplified on a 1:12,5 dilution of generated cDNA product in a 25 μl reaction with Pfu-DNA-Polymerase (Promega) using primers hMCP-1-1 (sense) and hMCP-1-2 (antisense) (Table 1) . The resulting PCR-product was cloned into vector pcDNA 3.1 using the HindIII and Notl restriction sites and the sequence confirmed by DNA-sequencing.
Site-directed mutagenesis of human MCP-I Deletions of the first (ΔQ1) and first and second (ΔQ1P2) amino acids of the mature human MCP-I were generated by site-directed mutagenesis using primer ΔQ1-1 and ΔQ1-2 for ΔQ1 (Table 1) and primers ΔQ1P2-1 and ΔQ1P2-2 for ΔQ1P2 (Table 1) . Parental DNA was digested with Dpn I. The pcDNA 3.1 plasmids with the deletions ΔQ1 and ΔQ1P2 of the mature human MCP-I were transformed into E. coli JM109. Ampicillin-resistant clones were confirmed by sequencing and subsequently isolated for cell culture purposes using the EndoFree Maxi Kit (Qiagen) .
Expression of N-terminal variants of human MCP-I in HEK293 cells For expression of N-terminal variants of human MCP-I, HEK293 cells were cultured in collagen I coated 6-well dishes and grown until 80% confluency, transfected using Lipofectamin2000 (Invitrogen) according to manufacturer's manual and incubated in the transfection solution for 5 hours. Afterwards, cells were allowed to recover in normal growth media over night. The next day, cells were incubated another 24 h in growth media. For analysis of efficacy of QC-inhibition, cells were incubated for 24 h in absence or presence of the specific inhibitor. After 24 h, the media containing the human MCP-I variants were collected and investigated in a migration assay for chemotactic potency. Furthermore, an aliquot of cell culture supernatant was stored at -80°C for quantification of human MCP-I concentration using a human MCP-I-ELISA (Pierce) .
TransWell chemotaxis assay
The chemotaxis assay was performed using 24 well TransWell plates with a pore size of 5 μm (Corning) . Media containing the human MCP-I variants expressed in HEK293 were used as chemoattractant . To this avail, 600 μl of the culture media of N-terminal human MCP-I variants was applied undiluted or in dilutions 1:3, 1:10 and 1:30 in RPMI1640 to the lower chamber of the TransWell plate. Furthermore, undiluted media of HEK293 cells transfected with vector control were applied as negative control to the lower chamber. THP-I cells were harvested and resuspended in RPMI1640 in a concentration of 1*10^ cells / 100 μl and applied in 100 μl aliquots to the upper chamber. Cells were allowed to migrate towards the chemoattractant for 2 h at 370C. Subsequently, cells from the upper chamber were discarded and the lower chamber was mixed with 50 μl 70 mM EDTA in PBS and incubated for 15 min at 37°C to release cells attached to the membrane. Afterwards, cells migrated to the lower chamber were counted using a cell counter system (Scharfe System) . The chemotactic index was calculated by dividing cells migrated to the stimulus from cells migrated to the negative control. Example 2: Investigations on the proteolytic degradation of human MCP-I (i-76)
Methods
N-terminal degradation by recombinant human DP4
Full length recombinant human MCP-I (1-76) (SEQ ID NO: 1) encoded by the nucleic acid sequence as shown in SEQ ID NO: 2, obtained in Example 1 above, starting with an N-terminal glutamine (Peprotech) was dissolved in 25 mM Tris/HCl pH 7.6 in a concentration of 10 μg/ml . The MCP-I solution was either pre- incubated with recombinant human QC (0.0006 mg/ml) (obtained according to Reference Example 1 above, SEQ ID No: 3 for nucleic acid sequence and SEQ ID No: 4 for amino acid sequence) for 3 h at 300C and subsequently incubated with recombinant human DP4
(0.0012 mg/ml) at 300C (see Fig. 1) or incubated with DP4 without prior QC application. Resulting DP4 cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 4h and 24 h using
Maldi-TOF mass spectrometry.
N-terminal degradation by human rheumatoid synovial fibroblast
MMP-I
Human recombinant MCP-I carrying an N-terminal glutaminyl instead of a pyroglutamyl residue (Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6, in a concentration of 10 μg/ml. The MMP-
1 proenzyme from human rheumatoid synovial fibroblasts
(Calbiochem) was activated using 25 mM p-aminophenylmercuric acetate (APMA), dissolved in 0.1 N NaOH at 37°C for 3h in a
APMA: enzyme-mixture of 10:1. MCP-I was either pre-incubated with recombinant human QC (0.0006 mg/ml) for 3 h at 300C and subsequently incubated with MMP-I at 30 0C or incubated with MMP-I without prior QC application. Resulting MMP-I cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h using Maldi-TOF mass spectrometry. N-terminal degradation by human rheumatoid synovial fibroblast MMP-I and recombinant human DP4
Human recombinant MCP-I starting with a N-terminal glutamine
(Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6, in a concentration of 10 μg/ml . MMP-I proenzyme from human rheumatoid synovial fibroblasts (Calbiochem) was activated using
25 mM p-aminophenylmercuric acetate (APMA) dissolved in 0.1 N
NaOH. The APMA: enzyme-mixture of 10:1 was incubated at 37°C for 3h. MCP-I solution was either pre-incubated with recombinant human QC (0.0006 mg/ml) for 3 h at 300C and subsequently incubated with MMP-I and DP4 at 300C or incubated with MMP-I and DP4 without QC application. Resulting MMP-I cleavage products were analyzed after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h using Maldi-TOF mass spectrometry.
Example 3: Effect of QC specific inhibitor 1- (3- (lH-imidazol-Ziyi) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride (in the following also designated as QCI) on cuff-induced accelerated atherosclerosis in ApoE3*Leiden mice
Timeline
30 male ApoE3*Leiden mice (age 12 weeks) were fed a mildly hypercholesterolemic diet for 3 weeks prior to surgical cuff placement .
After 3 weeks, the mice underwent surgical non-constricting cuff placement (day 0) and were divided into 2 groups, matched for plasma cholesterol levels. The mice either received control
(acidified) drinking water or drinking water containing the QC specific inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride in a concentration of 2.4-mg/ml. 7 days after start of treatment, the inhibitor concentration was reduced to 1.2 mg/ml. 5 Mice of each group were sacrificed after 2 days for analysis of monocyte adhesion and infiltration, and 10 mice were sacrificed after 2 weeks for histomorphometric analysis to quantify the inhibition of accelerated atherosclerotic lesions and neointima formation. Surgical procedure of cuff placement
At the time of surgery, mice were anaesthetized with an intraperitoneal injection of 5 mg/kg Dormicum, 0.5 mg/kg Domitor and 0.05 mg/kg Fentanyl . This cocktail gives complete narcosis for at least one hour and can be quickly antagonized with Antisedan 2.5 mg/kg and Anexate 0.5 mg/kg.
A longitudinal 1 cm incision is made in the internal side of the leg and the femoral artery is dissected for 3 mm length from the femoral nerve and femoral vein. The femoral artery is looped with a ligature and a non-constrictive fine bore polyethylene tubing (0.4 mm inner diameter, 0.8 mm outer diameter, length 2 mm) is longitudinally opened and sleeved loosely around the femoral artery. The cuff is closed up with two ligature knots. The skin is closed with a continued suture.
After surgery, the animals were antagonized and placed in a clean cage on top of a heating pad for a few hours.
Sacrifice of the animals
For histological analysis, animals were sacrificed either 2 days or 14 days after cuff placement. After anaesthesia, the thorax was opened and a mild pressure-perfusion (100 mmHg) with 4% formaldehyde was performed for 3 minutes by cardiac puncture. After perfusion, a longitudinal 2 cm incision was made in the internal side of the leg and the cuffed femoral artery was harvested as a whole and fixed overnight in 4% formaldehyde and processed to paraffin.
Analysis of monocyte adhesion and MCP-I expression
Adhesion of leukocytes in general and monocytes/macrophages in particular to the activated endothelium of the cuffed vessel wall was analyzed by microscopic analysis of cross sections harvested 2 days after cuff placement. The number of adhering and/or infiltrating leukocytes in general, identified as adhering cells at the luminal side of the vessel segment, and monocytes/macrophages in particular was counted and illustrated as cells per cross-section or as defined areas per cross section. Monocytes were identified by specific immunohistochemical staining by the polyclonal rabbit AIA31240 antibody, recognizing monocytes and macrophages. In addition on these sections a specific immunohistochemical staining for MCP-I was performed.
Analysis of vascular remodeling and accelerated athero-sclerosis Vessel wall remodeling, accelerated atherosclerosis and neoinitima formation were analyzed morphometrically in all mice sacrificed after 14 days. A full comparison between the two groups was performed for all relevant vessel wall parameters (neointima formation, vascular circumference (i.e. outward remodelling) , media thickness, lumen stenosis) . Accelerated atherosclerosis was analyzed by immunohistochemical staining for macrophages and foam cells in the lesion area by AIA31240 antibody. Furthermore, these sections were also stained for MCP- 1.
Example 4: Proteolytic degradation of human MCP-I π-76) by Dipeptidyl-peptidase 4 (DP4) , , Aminopeptidase P, and by proteases present in human serum
N-terminal degradation by recombinant human Aminopeptidase P Human recombinant MCP-I carrying an N-terminal glutaminyl instead of a pyroglutamyl residue (Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6 in a concentration of 10 μg/ml . MCP-I was incubated with 30 μg/ml Aminopeptidase P (R&D Systems) at 30 °C. Gln1-MCP-l was either used without pGlu-modification or was pre-incubated with recombinant human QC (6 μg/ml) for 3 h at 300C in order to generate pGlu.. Resulting Aminopeptidase P cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h.
N-terminal degradation of MCP-I by recombinant human DP4 in absence and presence of a QC-specific inhibitor
Recombinant human MCP-I (i-η Q) (SEQ ID NO: 1) encoded by the nucleic acid sequence as shown in SEQ ID NO: 2, obtained in Example 1 above, starting with an N-terminal glutamine (Peprotech) was dissolved in 25 mM Tris/HCl pH 7.6 in a concentration of 10 μg/ml . The MCP-I solution was either pre- incubated with recombinant human QC (0.0006 mg/ml) (obtained according to Reference Example 1 above) for 3 h at 300C and subsequently incubated with recombinant human DP4 (0.0012 mg/ml) at 300C (see Fig. 1) or incubated with DP4 without prior QC application. In addition, the incubation of Gln1-MCP-l with recombinant human QC was carried out in presence of 10 μM of 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride. Resulting DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h and 4h .
N-terminal degradation of human MCP-I in human serum Human recombinant MCP-I carrying an N-terminal glutaminyl instead of a pyroglutamyl residue (Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6, in a concentration of 100 μg/ml. MCP-I was either pre-incubated with recombinant human QC (0.006 mg/ml) for 3 h at 300C and subsequently incubated with human serum at 30 °C or incubated with human serum without addition of QC. The cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 10 min, 30 min, Ih, 2h, 3h 5h and 7 h for Glr^-MCP-l and 0 min, 30 min, Ih, 2h, 3h 5h, 7 h and 24 h for pGlu^MCP-l.
Example 5: Degradation of human MCP-2, MCP-3 and MCP-4
N-terminal degradation of human MCP-2 by DP4
Human recombinant MCP-2 carrying an N-terminal glutaminyl instead of a pyroglutamyl residue (Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6, in a concentration of 10 μg/ml. MCP-2 was either pre-incubated with recombinant human QC (0.0006 mg/ml) for 3 h at 300C and subsequently incubated with recombinant human DP4 (0.0012 mg/ml) at 30 0C or incubated with recombinant human DP4 (0.0012 mg/ml) without pre-incubation with QC. Resulting DP4 cleavage products were analyzed using Maldi- TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 . N-terminal degradation of human MCP-3 by DP4
Human recombinant MCP-3 carrying an N-terminal glutaminyl instead of a pyroglutamyl residue (Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6, in a concentration of 10 μg/ml . MCP-3 was either pre-incubated with recombinant human QC (0.0006 mg/ml) for 3 h at 300C and subsequently incubated with recombinant human DP4 (0.00012 mg/ml) at 30 0C or incubated with recombinant human DP4 (0.00012 mg/ml) without prior QC application. Resulting DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h.
N-terminal degradation of human MCP-4 by DP4 Human recombinant MCP-4 carrying an N-terminal glutaminyl instead of a pyroglutamyl residue (Peprotech) was dissolved in 25 mM Tris/HCl, pH 7.6, in a concentration of 10 μg/ml. MCP-4 was either pre-incubated with recombinant human QC (0.0006 mg/ml) for 3 h at 300C and subsequently incubated with recombinant human DP4 (0.00006 mg/ml) at 30 °C or incubated with recombinant human DP4 (0.00006 mg/ml) without prior QC application. Resulting DP4 cleavage products were analyzed using Maldi-TOF mass spectrometry after 0 min, 15 min, 30 min, Ih, 2h, 4h and 24 h .
Example 6: Chemotactic Potency of different N-terminal variants of human MCP-I, MCP-2, MCP-3, MCP-4
Chemotactic Potency of N-terminal variants of human MCP-I MCP-I starting with glutamine 1 (Glr^-MCP-l) (Peprotech) was incubated with (i) recombinant human QC to generate pGlu1-MCP-l, (ii) human recombinant DP4 to generate Asp3-MCP-l, (iii) human synovial fibroblast MMP-I to generate Ile5-MCP-l and human recombinant Aminopeptidase P to generate Pro2-MCP-l. Concentrations of 1, 5, 10, 50, 100, 500 and 1000 ng / ml of the generated MCP-I variants were tested using the THP-I chemotaxis assay (n=3) . Chemotactic potency of human MCP-I in absence or presence of a QC-inhibitor
MCP-I with N-terminal glutamine (Gln1-MCP-l) (Peprotech) was incubated with recombinant human QC and DP4 (Glr^-MCP-l +QC +DP4), human recombinant DP4 alone (Gln1-MCP +DP4) and with recombinant human QC in combinaton with 10 μM of QC-inhibitor 1- (3- ( lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride and DP4 (Glr^-MCP-l +QC +QCI +DP4) . Concentrations of 1, 5, 10, 50, 100, 500 and 1000 ng / ml of generated MCP-I variants were tested using chemotaxis assay (n=3) .
Comparison of the chemotactic potency of variants of human MCP- 1, MCP-2, MCP-3 and MCP-4 possessing an N-terminal glutaminyl or pyroglutamyl residue. Human MCP-I, MCP-2, MCP-3 and MCP-4 with an N-terminal glutamine
(Peprotech) or pyroglutamyl-residue (incubation of Gln1-MCPs with human recombinant QC at a dilution of 1:100 for 2h at 300C) were tested for chemotactic potency. Concentrations of 1, 5, 10, 50,
100, 500 and 1000 ng / ml of a particular MCP were tested using chemotaxis assay (n=3) .
Comparison of the chemotactic potency of variants of human MCP- 1, MCP-2, MCP-3 and MCP-4 possessing an N-terminal glutaminyl residue with the respective DP4 cleavage product The human MCP-I, MCP-2, MCP-3 and MCP-4 starting with an N- terminal glutamine (Peprotech) was directly applied to the chemotaxis assay and compared to chemotactic potency of the DP4 cleavage products of MCP-I, MCP-2, MCP-3 and MCP-4. For the generation of the DP4 cleavage product, the respective MCPs were incubated with human recombinant DP4 at a 1:100 dilution for 2h at 300C prior to assay. Concentrations of 1, 5, 10, 50, 100, 500 and 1000 ng / ml of a particular MCP were tested using chemotaxis assay (n=3) . Example 7 : Application of a QC-inhibitor to a model of LPS- induced sepsis in rats
Preparation The QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride was formulated using 0.9% (w/v) saline at the highest concentration required. Lower doses were obtained by serial dilution using 0.9% (w/v) saline. In addition, a stock solution (lmg/mL) of LPS was prepared using 0.9% (w/v) saline and diluted using 0.9% (w/v) saline to provide the required concentration for dosing.
Concentrations
Dose levels were expressed in terms of the amount of inhibitor administered without regard to purity or active content.
Species
Male Han Wistar rats were obtained from Charles River (UK) Ltd.,
Margate, Kent.
Acclimatisation and health procedures
On arrival, all animals were examined for ill-health. Animals were acclimatised for a period of at least 5 days prior to dosing. During this time animals were identified by their cage labels. A veterinary examination was performed before the start of any experimental procedures to ensure their suitability for the study.
Experimental Design The study was performed over two days (five animals from each treatment group on each day) .
Food and water was available ad libitum, except when the animals are removed from the home cage for the study procedures. Each animal received two single intravenous administrations of vehicle or QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea in a low, intermediate and high dose (Table 2) at 3.5 hours and 0.5 hours before LPS administration, using a constant dose volume of 2 mL/kg as a slow bolus. Thirty minutes following the last administration of vehicle or test article each animal received an intraperitoneal injection of LPS or saline, using a constant dose volume of 5mL/kg. Individual dose volumes were based on the individual body weights obtained on the day of dosing. The treatment groups employed for the study are depicted in Table 2.
Sampling and TNFCC determination
A terminal blood sample was collected at 2 hours post-LPS. Blood samples were centrifuged at 2300 x g for 10 minutes at 4°C and subsequently analyzed for TNFCC. Samples were analysed using a quantitative sandwich enzyme immunoassay.
Example 8 : Evaluation of a QC-inhibitor in a mouse model of thioglycollate-induced peritonitis
Animals
For each experiment C57/B16J wild type mice were purchased from Charles River Laboratories Inc. For each experiment the mice were age- and sex-matched.
Induction of thioglycollate-induced peritonitis
For induction of peritonitis mice were injected intraperitoneally (i.p.) with 25 ml/kg body weight of sterile 8% (w/v) thioglycollate (Sigma-Aldrich; time: t=0) . At different time points before and after thioglycollate application, mice were injected i.p. with various concentrations of QC-inhibitor. For lavage of the peritoneum, the animals were anesthesized using 2% isofluran. Peritoneal exudates were collected at time points (4, 24 hours) after thioglycollate injection by washing the peritoneum with 8 ml of sterile phosphate-buffered saline (PBS) . Subsequently, the lavage fluids were centrifuged to pellet the cells and stained for FACS analysis.
Analysis of cellular composition of collected exudates using FACS-analysis
Samples were stained for BD Trucount tubes (BD Trucount tubes; catalog no. 340334; BD Biosciences) according to the manufacturer's instructions. Cells were blocked with CD16/32
(Caltag) and stained with the following antibodies for 15 min:
CD3-FITC (Caltag) /CD13-PE (BD) /F4/80-APC (Caltag); Moma2-FITC
(Acris) and IgGl-PE (BD) /IgG2a-APC (Caltag) as isotype controls. After staining, cells were lysed with BD FACSLyse (BD) for 15 min in the dark at room temperature. Flow cytometric analysis of
5000 beads per sample as reference standard was performed on a
BD FACSCalibur (BD Biosciences) .
Results
Preparation and Expression of human MCP-I in mammalian cell culture
Amplification of human MCP-I from human neuroblastoma cell line SH-SY5Y RNA resulted in a PCR-product of 300 bp . Sequencing of the isolated cDNA revealed a silent single nucleotide polymorphism of codon 105 coding for cysteine 35.
Expression of human MCP-I variants in HEK293 leads to elevated levels within cell culture supernatant as monitored by human
MCP-I ELISA. Thereby, the level between the expressions of MCP-I
(WT) and MCP-I (ΔQ1) (Figure 5C), and MCP-I (WT) in absence or presence of 10 μM 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride (Figure 7A) are not significantly changed. However, the expression of MCP-I (ΔQ1P2) is reduced by 28 % compared to MCP-I (WT) . The supernatant was collected and applied in TransWell migration assays (see Figures
4 and 5 C and D in this regard) .
TransWell chemotaxis assay
Purified human MCP-I displays a bell-shaped chemotactic dose response curve, when attracting, e.g. monocytes, showing an optimum at approx. 1-50 ng/ml . Therefore, the generated cell culture supernatants containing MCP 1 variants were sequentially diluted in order to achieve the optimal working concentration of MCP-I for chemotaxis assay attracting THP-I monocytes. After expression of MCP-I (WT) and MCP-I (ΔQ1), the concentrations of MCP-I variants did not significantly differ (Figure 5C) . Application of MCP-I (WT) to the chemotaxis assay led to a chemotactic response of THP-I cells (Figure 5D) , implied by the elevated chemotactic index. However, MCP-I (ΔQ1) failed to induce chemotaxis of THP-I (Figure 5D) suggested by a chemotactic index of approx. 1. These results support previous results, that N-truncated MCP-I is inactive. This finding is further substantiated by the inability of MCP-I (ΔQ1P2) to induce chemotaxis of THP-I cells (Figure 6B) . Expression of MCP- 1 (WT) in HEK293 cells has no influence on MCP-I concentration in absence or presence of chemotactic cytokines (chemokines) . However, the application of chemokines leads to significantly lower chemotaxis of THP 1 cells at dilutions 1:3 and 1:10 (Figure 7B) . This suggests a prevention of N-terminal pGlu- formation of MCP-I (WT) by QC-specific inhibitor 1-(3-(1H- imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride and, therefore, an inactivation of MCP-I (WT), either by N-terminal proteolytic degradation or by the sole prevention of pGlu formation.
Investigations on the proteolytic degradation of human MCP-I(I-
76)
Within the circulation, MCP-I is protected by a N-terminal pGlu- residue, which confers resistance against N-terminal cleavage by aminopeptidases, e.g. DP4. As a result of QC inhibitor administration, the unprotected N-terminus is readily cleaved by DP4. The N-terminal truncation, in turn, leads to inactivation of human MCP-I (Figure 5 and 6) . MMP-I inactivates mature MCP-I by cleavage of the 4 N-terminal amino acids (pE/Q-P-D-A) . The reaction is independent from the presence of a N-terminal pGlu residue. This process reflects the situation of MCP-I inactivation within the circulation. The resulting cleavage product MCP 1(5-75) has been shown to be present within plasma and resembles a naturally occurring CCR2 receptor antagonist. The present experiments point to the finding that MMP-I cleavage is slightly faster in case of a N-terminal glutamine residue (Figure 2A: 2h, 4h vs. 2B: 2h, 4h) . Furthermore, incubation of human MCP-I carrying an N-terminal GIn residue (Figure 3A) with human DP4 and human MMP-I shows an accelerated degradation in comparison to pGlu-MCP-1 (Figure 3B) .
Taken together, the results imply that the N-terminal pGlu formation represents a mechanism of protection, conferring resistance against N-terminal degradation by post-proline cleaving enzymes, e.g. DP4, aminopeptidases and, as implied by the results with MMP-I, to a certain extent also endoproteases . Prevention of N-terminal pGlu formation by QC inhibitor application leads to a faster inactivation of human MCP-I.
Analysis of vascular remodeling and accelerated atherosclerosis in ApoE3*Leiden mice Treatment of cuff-induced accelerated atherosclerosis in ApoE3*Leiden mice had no effect on the total area within the outer diameter of the vessel segment (Figure 8A) and no statistically significant effect on the remaining lumen (Figure 8 B) , although a slight increase in the remaining lumen can be observed. However, 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride shows a profound reduction of 40 % on the percentage of lumen stenosis (Figure 9A) and 45 % reduction of the area of neointima formation (Figure 9B). Both values are statistically significant. Furthermore, the inhibitor also reduced the area of the media (Figure 10 A) and the intima / media ratio (Figure 10B), although the reduction in intima / media ration lacks statistically significance (P<0.102).
The analysis of the cellular composition in the specific vessel wall layers shows no differences in relative contribution of smooth muscle cells and macrophages/foam cells to the composition of both the media and the adventitia after 2 days and 14 days (Figure 15) . Although one could expect a more specific effect on monocyte/macrophage content in the vessel wall due to the effect of 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride on MCP-I, and therefore on monocyte attraction, it should be noted that MCP-I also has a direct effect on smooth muscle cell proliferation as recently has been discovered and published by Schepers, A. 2006 Arterioscler Thromb Vase Biol. 26, 2063-2069.
Analysis of monocyte adhesion and MCP-I expression
Treatment of the mildly hypercholesterolemic ApoE3*Leiden mice (plasma cholesterol levels 12-15 mM) with 1- (3- (lH-imidazol-1- yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride resulted in a profound reduction of total adhering cells by 45%, (p < 0.05) after 2 days. Specific analysis of adhering monocytes revealed an even stronger reduction of 67% (p < 0.05) to the treated cuffed vessel segments (Figure 11).
MCP-I expression was reduced in the vessel segments of 1-(3-(1H- imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride treated mice 2 days after surgery, the moment of the highest elevation of MCP-I expression in the model used
(Figure 12, 13A, 14A) . These results indicate that early after vascular injury within the lesions a reduction of MCP-I expression can be detected in both the media and the intima (i.e inside the Lamina elastica interna) of the vessel wall segment, when 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride is administered. Analysis of the relative area of the cross sections positive for MCP-I revealed a 52% (P=O.01) reduction of MCP 1 expression in the media and a 36% (P=O.001) reduction in the intima (Figure 14A) . Analysis of the absolute area positive for MCP-I (expressed in μm^ positive per cross section) reveals a similar reduction of MCP-I expression in the media (41% reduction, p=0.09) and the intima (40% reduction, p=0.05), although the reduction within the media is statistically not significant (Student's T-test) (Figure 13A) .
At the later time point of 14 days, when the neointima formation / accelerated atherosclerosis has progressed, the overall MCP-I expression is lower than observed for the early time point and in contrast, no reduction of MCP-I expression can be monitored, in the media or in the neointima (Figure 13B, 14B) suggesting an effect of 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride only for the time of strong induction of MCP-I.
Taken together, these data indicate that oral dosing of 1- (3- ( lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride has a beneficial effect on post interventional vascular remodelling and accelerated atherosclerosis in the ApoE3*Leiden cuff model.
Proteolytic degradation of human MCP-I π -η ^ ^y human Aminopeptidases and human Serum in combination with a QC- specific inhibitor
For further illustration of the effect of the QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride on the generation of the N-terminal pGlu-residue and its subsequent impact on proteolytic stability, human MCP-I carrying either N-trminal glutamine (Figure 17 A) or pyroglutamic acid (Figure 17 B) was incubated with DP4. N- terminal pGlu-formation was achieved by pre-incubation of the precursor with human QC, reflecting the physiological maturation process. As expected, in absence of the pre-incubation with human QC, MCP-I is susceptible to DP4 cleavage (Figure 17 A) . In contrast, the pre-incubation with human QC leads to the formation of the N-terminal pGlu-residue and, therefore, to its protection against DP4 cleavage (Figure 17 B) . In addition, the pre-incubation of human MCP-I with human QC in presence of the QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride results in the inhibition of QC and, therefore, to a prevention of pGlu-MCP-1 formation. The prevention of pGlu-MCP-1 formation by 1- (3- (lH-imidazol-1- yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride renders the MCP-I peptide again susceptible to DP4 cleavage (Figure 17 C) . Thus, the inhibition of QC leads to the de-stabilization of the N-Terminus of MCP-I in vitro and in vivo. In analogy to the N-terminal truncation of human MCP-I by DP4, the incubation of Gln1-MCP-l with recombinant human aminopeptidase P leads to the cleavage of the unprotected N- Terminus . Thereby, aminopeptidase P cleaves between the N- terminal amino acids GIn1 and Pro2 and liberates the N-terminal glutaminyl residue (Figure 16 A) . However, pre-incubation of Gln1-MCP-l with human QC causes the formation of the N-terminal pGlu-residue and, therefore, the protection against aminopeptidase P cleavage (Figure 16 B). Thus, the formation of the N-terminal pGlu-residue is also a protection mechanism against aminopeptidase P cleavage and against the cleavage of presumably all other proline-specific aminopeptidases . For further investigations on the proteolytic stability of human MCP-I, the data obtained by incubation of MCP-I with the purified proteases, were substantiated by the incubation of human MCP-I with human serum. The incubation of human Gln1-MCP-l with human serum shows the N-terminal truncation of the substrate and the liberation of the first 2 amino acids
(GIn1PrO2) . In addition, QC activity in plasma competes with the N-terminal proteolysis and stabilizes MCP-I, ending at a final ratio of approx. 60 % truncated Asp3-MCP-l and 40 % full-length pGlu1-MCP-l (Figure 18 A) . Furthermore, the pre-incubation of human MCP-I with human QC leads to the formation of the N- terminal pGlu-residue and, thus, to the stabilization of human MCP-I. At least in the chosen time-frame and dilution of the serum, no degradation of pGlu1-MCP-l was observed (Figure 18 B) . In addition, the incubation of MCP-I in serum in presence of 9.6 μM of the DP4-inhibitor Isoleucyl-Thiyzolidide also prevents the N-terminal degradation, proving, that MCP-I is degraded by DP4 or a DP4-like activity in human serum (Figure 18 C) .
Proteolytic degradation of human MCP-2, MCP-3 and MCP-4 In analogy to the N-terminal degradation of human MCP-I, the susceptibility of other human MCPs, namely MCP-2, MCP-3 and MCP- 4, against N-terminal truncation by DP4 was investigated. As observed for MCP-I before, the N-terminal pGlu-residue protects MCP-2 (Figure 19 B), MCP-3 (Figure 20 B) and MCP-4 (Figure 21 B) against proteolytic degradation by DP4. However, the uncyclized variants, starting with an N-terminal glutamine are readily truncated by DP4 as shown for Gln1-MCP-2 (Figure 19 A), Glr^-MCP- 3 (Figure 20 A) and Gln1-MCP-4 (Figure 21 A) . Therefore, the N- terminal pGlu-residue stabilizes all MCPs against truncation by aminopeptidases, such as DP4. Thus, the presented concept, to reduce QC acitivity in vivo in order to provoke accelerated turnover and diminished chemotaxis and receptor activation, applies for all members of the MCP-family.
Chemotactic Potency of different N-terminal variants of human MCP-I, MCP-2, MCP-3, MCP-4
In order to investigate the influence of different N-terminal variants of MCP-I on the ability to attract human THP-I monocytes, Gln1-MCP-l, pGlu1-MCP-l, the aminopeptidase P cleavage product Pro2-MCP-l, the DP4 cleavage product Asp3-MCP-l and the MMP-I cleavage product Ile5-MCP-l were tested in a chemotaxis assay in vitro. The full-length MCP-I possessing an N-terminal glutaminyl or pyroglutamyl-residue were found to be equally potent in attracting THP-I monocytes with a maximum response between 50 ng/ml and 100 ng/ml . In contrast, the truncation of MCP-I by aminopeptidase P (Pro2-MCP-l) and DP4 (Asp3-MCP-l) leads to a loss of potency of the respective variant. The dose- response-curve shifts to higher concentrations needed to elicit the maximum response, which corresponds to an inactivation of MCP-I by N-terminal truncation. The MMP-I cleavage product (He5- MCP-I) has an equal maximum as Glu1-MCP-l and pGlu1-MCP-l between 50 ng/ml and 100 ng /ml, however, the amount of cells migrating to this variant, ie. the chomotactic potency, is much lower, compared to full-length MCP-I (Figure 22) . To further investigate the role of QC in stabilizing MCP-I and its impact on the migration of THP-I monocytes, Gln1-MCP-l was incubated with human DP4. In parallel samples, MCP-I was pre- incubated with human QC prior to DP4 application. As expected, the obtained dose-response curves imply a proteolytic stability of pGlu1-MCP-l reflected by a maximum response at 50 - 100 ng / ml. In contrast, in absence of QC, Gln1-MCP-l is truncated by DP4, which leads to a shift of the dose-response curve to higher MCP-I concentrations (500-1000 ng / ml) needed to elicit the maximum response. In addition, the pre-incubation of Gln1-MCP-l with QC and the QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3-
(3, 4-dimethoxyphenyl) thiourea hydrochloride prevents pGlu- formation and, thus, renders the peptide vulnerable to DP4 cleavage, as observed by the shift of the dose-response curve to higher MCP-I concentrations compared to pGlu1-MCP-l (Figure 23) .
Therefore, the inhibition of QC leads to the N-terminal destabilization of MCP-I through degradation by DP4 and, thus, to its inactivation with respect to the monocyte chemotactic activity.
In addition, the ability of MCP-2, MCP-3 and MCP-4 possessing an N-terminal glutamine or pyroglutamate to attract human THP-I monocytes was investigated. In analogy to MCP-I, the pGlu- formation at the N-terminus of MCP-2 and MCP-3 has no influence on the potency, compared to the respective glutamine-precursors . However, for MCP-4 the pGlu-formation slightly increases the potency of the peptide (Figure 24) . However, since the glutaminyl-precursors are cleaved by DP4 (Figures 19, 20 21), also the potencies of the N-truncated DP4 cleavage products of MCP-2, MCP-3 and MCP-4 were investigated using the chemotaxis assay. For all three variants, the truncation by 2 amino acids leads to a partial inactivation of the chemokines (Figure 25) . Therefore, the pGlu-formation at the N-Terminus of all known MCPs not only protects against N-terminal truncation, but also protects against the loss of chemotactic potency. The presented approach to alleviate the activity of MCP-I by suppression of N- terminal maturation therefore applies for all members of the MCP family in human beings.
Application of a QC-inhibitor to a model of LPS-induced sepsis in rats
In order to investigate the general anti-inflammatory properties of 1- (3- ( IH-imidazol-1-yl) propyl) -3- (3, 4- dimethoxyphenyl) thiourea hydrochloride, the inhibitor was applied to a model of LPS-induced sepsis in rats. As a marker for the initiated inflammatory response, the levels of the cytokine TNFCC were determined depending on QC-inhibitor treatment. As depicted in Figure 26, the application of 1- (3- (lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride leads to a dose-dependent reduction in TNFCC levels ranging from the low dose (5 mg/kg) to the intermediate dose (20 mg/kg) . In addition, also the highest dose (80 mg/kg) reduces the TNFCC-level in plasma, however, a slight increase was observed compared to the intermediate dose. Therefore, QC- inhibitor application is able to significantly reduce the inflammatory responseas shown here exemplarilyfor TNFCC. The experiment shows, that, although the effect of QC-inhibitors is highly specific for the de-stabilization of the N-Terminus of MCPs, the inactivation of this chemokines has an impact also on other inflammatory parameters such as TNFCC. Therefore, suppression of other pro-inflammatory cytokines is a further result of the presented concept of destabilizing MCPs. The approach is therefore suitable to develop medications for different inflammatory disorders with varying degree of MCP action .
Application of a QC-inhibitor to a model of thioglycollate- induced peritonitis in mice
To further investigate the effect of QC-inhibitor administration on the migration of immune cells in vivo, 1- (3- (lH-imidazol-1- yl) propyl) -3- (3, 4-dimethoxyphenyl) thiourea hydrochloride was applied to a model of thioglycollate-induced peritonitis in mice. The cellular composition of the peritoneal lavage fluid was determined with special emphasis on infiltrating monocytes 4 h and 24 hours after thioglycollate-challenge . As shown in
Figure 27, the QC-inhibitor 1- (3- (lH-imidazol-1-yl) propyl) -3-
(3, 4-dimethoxy phenyl) thiourea hydrochloride reduced the number of infiltrating monocytes to the peritoneum dose-dependently after 4 h. In addition, the presence of Moma2-positive monocytes/macrophages was assessed 24 h after thioglycollate application. As depicted in Figure 28, the QC-inhibitor 1- (3-
( lH-imidazol-1-yl) propyl) -3- (3, 4-dimethoxy- phenyl) thiourea hydrochloride also significantly reduced the number of Moma2- positive cells. Therefore, the inhibition of QC destabilizes the N-Terminus of MCPs in vivo. The experiment proves the applicability of MCP destabilization by QC inhibition to observe a therapeutic effect. The recruitment of monocytes, which is a generalfeature of several inflammatory disorders, for instance, but not limited to atherosclerosis and restenosis, is suppressed. The experiment therefore provides a method for chracterizing QC inhibitors for their applicability in different inflammatory disorders.
Table 1: Utilized primers
Figure imgf000116_0001
Figure imgf000117_0002
Synthesis of the QC inhibitors
Synthesis scheme 1: Synthesis of the examples 1-53, 96-102, 136- 137
Figure imgf000117_0001
Reagents and conditions: (a) NaH, DMF, 4h, rt . ; (b) , 8h, 1000C; (c) H2N-NH2, EtOH, 8h, reflux then 4N HCl, 6h, reflux, (d) R3-NCO, EtOH, 6h, reflux, (e) 3,4 dimethoxy-phenyl-isothiocyanate, Synthesis scheme 2 : Synthes i s of the examples 54 - 95
Figure imgf000118_0001
Reagents and conditions : (a) R-NCS, EtOH, 6h, reflux; (b) WSCD, lH-imidazole-1-propanamine, DMF, 2h, r.t.
Synthesis scheme 3: Synthesis of the examples 103-105
Figure imgf000118_0002
Reagents and conditions: (a) NaH, DMF, rt.,3h; (b) LiAlH4, dioxane, reflux, Ih; (c) R-NCS, EtOH, reflux 6h,
Synthesis scheme 4: Synthesis of the examples 106 - 109
Figure imgf000118_0003
Reagents and conditions : (a) EtOH, 2 h, reflux Synthesis scheme 5: Synthesis of the examples 110 - 112
Figure imgf000119_0001
Reagents and conditions : (a) lH-imidazole-1-propanamine, Triethylamine, Toluene, 12 h, reflux
Synthesis scheme 6: Synthesis of the examples 113 -132
Figure imgf000119_0002
Reagents and conditions : (a) CAIBE, lH-imidazole-1-propanamine, Dioxan, 00C, 12h; (b) Laweson's Reaent, EtOH, reflux, 8h
Synthesis scheme 7: Synthesis of the examples 133 - 135
Figure imgf000119_0003
Reagents and conditions : (a) lH-imidazole-1-propan acidic chloride, CH2CI2, - 100C, 1 h; (b) Lawesson's Reagent, Dioxane, reflux, 8 h Synthesis scheme 8: Synthesis of the example 138
Figure imgf000120_0001
Reagents and conditions : (a) EtOH, reflux, 8 h Synthesis scheme 9: Synthesis of the example 139
Figure imgf000120_0002
Reagents and conditions : (a) 75% cone. H2SO4 , 4h
Synthesis scheme 10: Synthesis of the example 140
Figure imgf000120_0003
Reagents and conditions : (a) Acetonitrile, reflux 2h
Synthesis scheme 11: Synthesis of the example 141
Figure imgf000121_0001
Reagents and conditions: (a) NaH, DMF, 4h, rt.; (b) , 8h, 1000C; (c) H2N-NH2, EtOH, 8h, reflux then 4N HCl, 6h, reflux, (d) 3,4 dimethoxy-phenyl-isothiocyanate, EtOH, 6h, reflux
Analytical conditions
ESI-Mass spectra were obtained with a SCIEX API 365 spectrometer (Perkin Elmer) . The 1H-NMR (500 MHz) data was recorded on a
BRUKER AC 500, using DMSO-D6 as solvent. Chemical shifts are expressed as parts per million downfield from tetramethylsilane .
Splitting patterns have been designated as follows: s (singulet) , d (doublet) , dd (doublet of doublet) , t (triplet) , m (multiplet) , and br (broad signal) .
Detailed synthesis description
Examples 1 - 12 and 14 - 53 lH-imidazole-1-propanamine was reacted with the corresponding isothiocyanate in ethanol under reflux for 8h. After that the solvent was removed and the remaining oil was dissolved in methylene chloride. The organic layer was washed twice with a saturated solution of NaHCθ3 followed by NaHSO4 and brine, dried then evaporated. The remaining solid was re-crystallized from ethyl acetate, yielding the example thiourea in yields of 80 - 98%. Example 13
1- (3- (IH-imidazol-1-yl)propyl) -3- (3, 4-dime-thoxyphenyl) thiourea 4.0 mmol of 3, 4-dimethoxyphenyl isothiocyanate and 4.0 mmol of 3- ( lH-imidazol-1-yl) alkyl-1-amine were dissolved in 10 mL of absolute ethanol. After stirring for 2 h under reflux, the solvent was evaporated and the resulting solid was recrystallized from ethanol.
Yield: 0.66 g (51.3 %) ; mp : 160.0 - 161.00C
1H NMR δ 1.8 - 2.0 (m, 2H) , 3.4 - 3.5 (m, 2H) , 3.75 (s, 6H) , 3.9 - 4.0 (m, 2H) , 6.7 - 6.8 (m, IH) , 6.9 (br m, 2H) , 6.95 (s, IH) , 7.15 (s, IH) , 7.55 (br s, IH) , 7.6 (s, IH) , 9.3 (s, IH) ; MS m/z 321.2 (M+H) , 253.3 (M-C3H3N2O
Examples 96 - 102 lH-imidazole-1-propanamine was reacted with the corresponding isocyanate in ethanol under reflux for 8h. After that the solvent was removed and the remaining oil was dissolved in methylene chloride. The organic layer was washed twice with a saturated solution of NaHCO3 followed by NaHSO4 and brine, dried then evaporated. The remaining solid was re-crystallized from ethyl acetate, yielding the example urea in yields of 85 - 90%.
Examples 136, 137
The lH-imidazole-1-alkylamines were prepared according to the literature from -brom-alkyl-phtalimides and imidazolium salt and. subsequent hydrazinolysis . The resulting products were transformed into the thioureas according to example 1 - 53 giving a 88% (example 136) and 95% (example 137) yield.
Examples 54 - 95
All examples were made from the corresponding thioureas by reacting with Water-soluble-carbodiimide (WSCD) and IH- imidazole-1-propanamine in dry dimethyl form- amide for 2h at r.t. giving the trisubstituted guanidines with yields from 40 - 87%.
Examples 103 - 105 Imidazole was reacted with the corresponding brommethylphenylcyanide in DMF, utilizing 1 equivalent of NaH for 3h under rt., giving the lH-imidazole-1- methylphenylcyanides . The solvent was removed and the resulting oil was re-dissolved in dioxane. The cyanides were converted in the corresponding amines using 1 equivalent of LiAlH4. After adding a saturated solution of KHSO4, dioxane was evaporated and the aqueous layer was extracted by means of CHCI3. The organic layer was concentrated in vacuo and the amine was converted in the corresponding thioureas according to example 1 — 53 giving a 78% (example 103) and 65% (example 104) and 81% (example 105) yield.
Examples 106 - 109
Starting from the corresponding methansulfonate-2-methylpropyl- phthalimides the amines were synthesized as described for the amines in example 136 - 137. The resulting products were transformed into the thioureas according to example 1 - 53 giving example 106 - 109 in total yields of 25 - 30%.
Examples 110 - 112 lH-imidazole-1-propanamine was reacted with the corresponding 2- chlorobenzo [d] thiazole in toluol for 24h at a temperature of 1300C. After removing the solvent and recristallization from methanol example 110 - 112 was yielded in an amount of 55 - 65%.
Examples 113 - 118, 120 - 124 and 126 - 132 lH-imidazole-1-propanamine was reacted with the corresponding 2- phenyl acetic acid in dry dioxane by adding one equivalent of CAIBE and N-methylmorpholine at a temperature of 00C. After 2h the mixture was allowed to warm to r.t. and the mixture was stirred for 12h. After removing the solvent the resulting oil was redissolved in methylene chloride and the organic layer was washed by means of an aqueous solution of NaHCθ3 and water, dried and the solvent was evaporated. The remaining oil was dissolved in dioxane adding Laweson's Reagent. After stirring for 12h a saturated solution of NaHCθ3 was added. Dioxane was evaporated and the aqueous layer was extracted by means of ethyl acetate. The organic layer was separated, dried and the solvent was evaporated. The remainig solid was crystallized from acetyl acetate/ether, giving 113 - 118, 120 - 124 and 126 - 132 with total yields of 62 - 85%.
Example 119
1 N- (3- (lH-imidazol-1-yl)propyl) -2- (3,4- dimethoxyphenyl) ethanethioamide
A mixture of 4.0 mmol triethylamine and 4.0 mmol of 3-(1H- imidazol-1-yl) alkyl-1-amine 20 mL of dioxane was added drop wise to an ice cooled, stirred solution of 4.0 mmol of 2- (3, 4- dimethoxyphenyl) acetyl chloride in 30 mL of dioxane. The mixture was allowed to warm to r.t., and then stirred for 1 h. After removing the solvent by reduced pressure, the residue was redissolved in 50 mL of dichloromethane . The organic layer was washed by means of 30 mL of saturated aqueous solution of NaHCθ3, and water. The organic solution was dried, filtered, and the solvent was removed under reduced pressure. After redissolving in 50 mL of dry dioxane 2.2 mmol of Lawesson' s reagent was added, and the mixture was heated to 900C and stirred for 8 h. The solvent was removed by reduced pressure, and the residue was redissolved in 50 mL of dichloromethane. The organic layer was washed three times by means of a saturated aqueous solution of NaHCθ3, followed three times by water, dried, filtered, and then the organic solvent was removed. The compound was purified by chromatography using a centrifugal-force-chromatography device, (Harrison Research Ltd.) utilizing silica plates of a layer thickness of 2 mm, and a CHCl3/MeOH gradient as eluting system. Yield: 0.14 g (10.6 %) ; melting point: 148.0 - 150.0ºC 1H NMR δ 2.0 - 2.15 (br m, 2H), 3.4 - 3.5 (m, 2H), 3.7 (s, 6H), 6.75 - 6.8 (m, 2H), 4.1 - 4.2 (m, 2H), 6.8 - 6.9 (m, 2H), 6.95 - 7.0 (m, IH), 7.4 (s, IH), 7.75 - 7.85 (br m, IH), 8.6 (s, IH), 10.2 (s, IH); MS m/z 320.2 (M+H) , 252.2 (M-C3H3N2●)
Example 125
N- (3- ( IH-imidazol-1-yl)propyl)-1-(3,4- dimethoxyphenyl) cyc1opropanecarbothioamide
11.06 mraol of 3, 4-dimethoxyphenyl acetonitrile, 34.8 mmol of 2-
Bromo-1-chloroethanole and 1.16 mmol of triethylbenzylammonium hydrochloride were dissolved in 10 mL of an aqueous solution of KOH (60%) . The mixture was transferred into an ultrasonic bath and vigorously stirred for 3h at room temperature. The resulting suspension was diluted with 40 mL of water and extracted three times by means of 20 mL of dichloromethane. The combined organic layers where washed by means of an aqueous solution of hydrochloric acid (IN), dried over Na2SO4 and the solvent was removed under reduced pressure. The remaining oil was purified by flash-chromatography using silica gel and ethyl acetate/heptane as eluting system, resulting in 0.81 g (34.4 %) of 1- (3,4-dimethoxypheryl) cyclopropanecarbonitrile
3.9 mmol of 1- (3, 4-dimethoxyphenyl) cyclopropanecarbonitrile and 11.2 mmol of KOH were suspended in 80 mL of ethylene glycol. The mixture was stirred for 12 h under reflux. Then 80 mL of water were added and the aqueous layer was extracted two times with ether. After pH adjustment to a value of pH = 4 - 5 using HCl
(1N) the aqueous layer was extracted three times by means of ether, then the combined organic layers were dried over Na2SO4 and the solvent was removed, resulting in 0.81 g (93.5%) of 1- (3,4-dimethoxyρhenyl) cyclopropanecarboxylic acid.
3.44 mmol of 1- (3,4-dimethoxyρhenyl) cyclopropanecarboxylic acid., 3,5 mmol of N-Methyl morpholine, and 3.5 mmol of isobυtyl chloroformiat were dissolved in dry tetrahydrofurane and stirred for 15 rain at -15°C. Then 3.5 mmol of 3- (1H-imidazol-1- yl) alkyl-1-amine was added and the mixture was allowed to warm to 0ºC and was stirred for 12h. The solvent was removed under reduced pressure and the remaining oil was redissolved in chloroform. Then the organic layer was washed two times by means of a saturated aqueous solution of NaHCO3, then dried over Na2SO4 and the solvent was removed. Purification was performed by means of centrifugal forced chromatography using a chrormatotron® device (Harrison Research Ltd.) utilizing silica plates of a layer thickness of 2 mm, and a CHC13/MeOH gradient as eluting system resulting in 0.671 g (59.3%) of N- (3- (1H-imidazol-1-yl)propyl)- 1- (3,4-dimethoxyphenyl)cyclopropane-carboxamide .
After redissolving in 30 mL of dry dioxane 1.43 mmol of Lawesson's reagent were added, and the mixture was heated to 90ºC and stirred for 8h. The solvent was removed by reduced pressure, and the residue was remains were dissolved in 50 mL of dichloromethane . The organic layer was washed three times by means of a saturated aqueous solution of NaHCO3, followed three times by water, dried, filtered, and then the organic solvent was removed. The compound was purified by chromatography using a centrifugal-force-chromatography device, (Harrison Research Ltd.) utilizing silica plates of a layer thickness of 2 mm, and a CHCl3/MeOH gradient as eluting system.
Yield: 0.33 g (46.2 %) ; melting point: 127.0 - 127.5°C
1H NMR δ 1.1 - 1.2 (t, 2H), 1.55 - 1.6 (t, 2H), 2.0 - 2.1 (m,
2H), 3.5 - 3.6 (m, 2H), 3.7 - 3.8 (s, 6H), 4.1 - 4.2 (t, 2H), 6.8 - 6.9 (m, 3H), 7.65 (s, IH), 7.75 (s, IH), 8.8 (m, IH), 9.05 (s, IH; MS m/z 346.0 (M+H) , 278.2 (M-C3H3N2'), 177.1 (M-C6H8N3S*)
Examples 133 - 135 A mixture of 1 equivalent triethylamine and 3, 4-dimethoxyaniline in dioxane was added to an stirred solution of the corresponding Cϋ-bromoalkyl acidic chloride at a temperature of 00C. The solution was allowed to warm to r.t. and stirred for 2h. The solvent was evaporated, and the remaining oil was redissolved in dichloromethane . The organic layer was washed by means of water, dried, filtered, and the solvent was removed under reduced pressure.
Imidazole and sodium hydride were suspended in and the mixture was stirred under inert conditions at r.t. for 3 h. Cϋ-Bromo-N- (3, 4-dimethoxy-phenyl) alkylamide was added and the mixture was heated to 1000C and stirred for 8 h. After that, the solvent was evaporated, hot toluene were added and the solution was filtered. Then the solvent was removed under reduced pressure. The transformation into the thioamides was performed as described for example 113 - 132 by means of Laweson's reagent, giving 133 - 135 in total yields of 13 - 20 %.
The analytical data for further examples, which were syntesized according to the general synthesis schemes described above, are as follows:
Example 1: 1- (3- (lH-imidazol-1-yl)propyl) -3-methylthiourea melting point: 122 - 122.5°C
1H NMR δ 1.85 - 1.95 (m, 2H), 2.8 (s, 3H), 3.2 - 3.5 (br d, 2H), 3.8 - 3.9 (m, 2H), 6.85 (d, IH), 7.15 (d, IH), 7.3 - 7.5 (br d, 2H), 7.65 (s, IH); MS m/z 199.1 (M+H), 221.3 (M+Na) , 131.0 (M- C3H3N2') Example 2:1- (3- (lH-imidazol-1-yl)propyl) -3-tert-butylthlourea melting point: 147.0 - 147.5°C
1H NMR δ 1.3 - 1.4 (s, 9H) , 1.85 -1.95 (m, 2H) , 3.5 (t, 2H) , 3.8 (t, 2H) , 6.85 (d, IH) , 7.15 (d, IH) , 7.3 - 7.5 (br d, 2H) , 7.65 (s, IH) ; MS m/z 241.1 (M+H) , 173.1 (M-C3H3N2O
Example 3: 1- (3- (lH-imidazol-1-yl)propyl) -3-benzylthiourea melting point: 127.0 - 128.00C
1H NMR δ 1.85 - 1.95 (m, 2H) , 3.2 - 3.5 (br d, 2H) , 3.8 - 3.9 (m, 2H) , 4.6 (s, 2H) , 6.8 (d, IH) , 7.15 (d, IH) , 7.19 - 7.35 (m, 5H) , 7.5 - 7.6 (br d, 2H) , 7.85 (s, IH) ; MS m/z 275.3 (M+H) , 207.1 (M-C3H3N2O
Example 5 : 1- (3- ( IH- lmldazol-1-yl) propyl) -3 -phenyl thiourea melting point: 166.5 - 167.00C
1H NMR δ 1.95 - 2.05 (m, 2H) , 3.3 - 3.5 (br d, 2H) , 3.9 - 4.0 (m,
2H) , 6.85 (d, IH) , 7.05 (m, IH) 7.15 (d, IH) , 7.25 (m, 2H) , 7.35
(m, 2H) , 7.6 (s, IH) , 7.8 (br s, IH) , 9.5 (br s, IH) ; MS m/z
261.1 (M+H) , 193.2 (M-C3H3N2O
Example 6: 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- fluorophenyl) thiourea melting point: 147.0 - 148.0°C
1H NMR δ 1.95 - 2.05 (m, 2H), 3.3 - 3.5 (br d, 2H), 3.9 - 4.05 (m, 2H), 6.85 (d, IH), 7.05 - 7.15 (m, 3H), 7.3 - 7.4 (m, 2H),
7.6 (s, IH), 7.7 - 7.8 (br s, IH), 9.4 (br s, IH); MS m/z 279.3
(M+H), 211.2 (M-C3H3N2O
Example 7: 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- ethylphenyl) thiourea melting point: 100.0 - 100.50C
1H NMR δ 1.15 - 1.2 (t, 3H), 1.9 - 2.0 (m, 2H), 2.5 - 2.6 (m,
2H), 3.3 - 3.5 (br d, 2H), 3.9 - 4.05 (m, 2H), 6.85 (d, IH), 7.1 - 7.2 (m, 3H), 7.25 - 7.3 (m, 2H), 7.6 (s, IH), 7.7 - 7.8 (br s, IH), 9.4 (br s, IH); MS m/z 289.3 (M+H) , 221.1 (M-C3H3N2O
Example 8: 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- (trifluoromethyl)phenyl) thiourea melting point: 154.5 - 155.00C
1H NMR δ 1.9 - 2.1 (br m, 2H), 3.4 - 3.6 (br d, 2H), 3.95 - 4.1 (br m, 2H), 6.85 (d, IH), 7.2 (d, IH), 7.6 - 7.8 (m, 5H), 8.2 (br s, IH), 9.9 (br s, IH); MS m/z 329.3 (M+H), 261.2 (M- C3H3N2O
Example 10: 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- acetylphenyl) thiourea melting point: 170.0 - 171.00C 1H NMR δ 1.9 - 2.1 (br m, 2H), 2.4 - 2.5 (s, 3H), 3.2 - 3.5 (br m, 2H), 3.9 - 4.1 (m, 2H), 6.85 (d, IH), 7.15 (d, IH), 7.5 - 7.65 (br m, 3H), 7.8 - 7.9 (m, 2H), 8.1 (m, 2H), 9.8 (br s, IH); MS m/z 303.2 (M+H), 235.1 (M-C3H3N2O
Example 11: 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- methoxyphenyl) thiourea melting point: 125.0 - 125.5°C
1H NMR δ 1.8 - 2.0 (br m, 2H), 3.2 - 3.5 (br m, 2H), 3.7 (s, 3H),
3.9 - 4.0 (m, 2H), 6.7 - 6.9 (m, 3H), 7.1 - 7.2 (m, 3H), 7.5 (s, IH), 7.6 (s, IH), 9.2 (s, IH); MS m/z 291.1 (M+H), 223.2 (M-
C3H3N2O
Example 14: 1- (3- (lH-imidazol-1-yl)propyl) -3- (2, 4- dimethoxyphenyl) thiourea melting point: 120.0 - 120.50C
1H NMR δ 1.8 - 2.0 (br m, 2H), 3.4 - 3.5 (br m, 2H), 3.75 (s, 6H), 3.9 - 4.0 (m, 2H), 6.5 (d, IH), 6.6 (s, IH), 6.9 (s, IH), 7.15 (s, IH), 7.3 (d, IH), 7.5 (br s, IH), 7.6 (s, IH), 9.75 (s, IH); MS m/z 321.2 (M+H) , 253.3 (M-C3H3N2O
Example 15: 1- (3- (lH-imidazol-1-yl)propyl) -3- (3, 5- dimethoxyphenyl) thiourea melting point: 142.0 - 143.00C
1H NMR δ 1.8 - 2.0 (br m, 2H), 3.4 - 3.5 (br m, 2H), 3.6 (s, 6H), 3.95 - 4.0 (m, 2H), 6.25 (m, IH), 6.6 (m, 2H), 6.9 (s, IH), 7.2 (s, IH), 7.6 (s, IH), 7.8 (s, IH), 9.5 (s, IH); MS m/z 321.2 (M+H), 253.3 (M-C3H3N2O
Example 23: 1- (3- (lH-imidazol-1-yl)propyl) -3- (2, 3- dihydrobenzo [b] [1 , 4] dioxin-7-yl) -thiourea melting point: 103.0 - 103.50C 1H NMR δ 1.9 - 2.0 (br m, 2H), 3.3 - 3.5 (br d, 2H), 3.9 - 4.0
(m, 2H), 4.2 - 4.3 (m, 4H), 6.7 (m, IH), 6.8 - 6.8 (m, IH), 6.9
(m, 2H), 7.2 (s, IH), 7.6 (m, 2H), 9.3 (s, IH); MS m/z 319.3
(M+H), 251.3 (M-C3H3N2O
Example 24: 1- (3- (lH-imidazol-1-yl)propyl) -3-
(benzo [d] [1 , 3] dioxol-6-yl) thiourea melting point: 115.0 - 115.6°C
1H NMR δ 1.9 - 2.1 (br m, 2H), 3.4 - 3.5 (br d, 2H), 4.05 - 4.15
(m, 2H), 6.0 (s, 2H), 6.7 (m, IH), 6.8 - 6.85 (m, IH), 6.95 (d, IH), 7.25 (s, IH), 7.45 (s, IH), 7.7 (br s, IH), 8.5 (br s, IH),
9.4 (br s, IH); MS m/z 305.2 (M+H), 237.2 (M-C3H3N2O
Example 25: 1- (3- (lH-imidazol-1-yl)propyl) -3- (3, 4 , 5- trimethoxyphenyl) thiourea melting point: 124.5 - 125.5°C
1H NMR δ 1.8 - 2.0 (m, 2H), 3.4 - 3.5 (br m, 2H), 3.6 (s, 3H), 3.7 (s, 6H), 3.9 - 4.0 (m, 2H), 6.65 (m, 2H), 6.85 (s, IH), 7.2 (s, IH), 7.6 (s, IH), 7.7 (br s, IH), 9.4 (s, IH); MS m/z 351.3 (M+H) , 283.2 (M-C3H3N2')
Example 26: 1- (3- (lH-imidazol-1-yl)propyl) -3- (3- methoxyphenyl) thiourea melting point: 89.5 - 90.00C
1H NMR δ 1.9 - 2.1 (br m, 2H) , 3.4 - 3.5 (br m, 2H) , 3.7 (s, 3H) , 3.9 - 4.0 (m, 2H) , 6.6 - 6.7 (m, IH) , 6.8 - 6.9 (m, 2H) , 7.1 (m, 2H) , 7.15 - 7.25 (br m, IH) , 7.6 (s, IH) , 7.8 (br s, IH) , 9.5 (s, IH) ; MS m/z 291.1 (M+H) , 223.2 (M-C3H3N2O
Example 27: 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- ethoxyphenyl) thiourea melting point: 126.0 - 126.5°C 1H NMR δ 1.5 (br m, 3H), 1.9 - 2.0 (br m, 2H), 3.4 - 3.5 (br m, 2H), 3.9 - 4.0 (br m, 4H), 6.8 - 6.9 (m, 2H), 6.95 (s, IH), 7.15 - 7.2 (m, 2H), 7.25 (s, IH), 7.55 - 7.6 (br s, IH), 7.8 (s, IH), 9.3 (s, IH); MS m/z 305.2 (M+H), 237.2 (M-C3H3N2*)
Example 33: 1- (3- (lH-imidazol-1-yl)propyl) -3- (4-
(methylthio)phenyl) thiourea melting point: 140.0 - 140.50C
1H NMR δ 1.8 - 2.05 (br m, 2H), 2.5 (s, 3H), 3.3 - 3.5 (br m,
2H), 3.9 - 4.1 (m, 2H), 6.9 (m, IH), 7.1 - 7.3 (br m, 5H), 7.6 (s, IH), 7.75 (br s, IH), 9.4 (s, IH); MS m/z 307.2 (M+H), 239.2
(M-C3H3N2')
Example 42: 1- (3- (lH-imidazol-1-yl)propyl) -3- (4- nitrophenyl) thiourea melting point: 165.0 . 166.00C
1H NMR δ 1.9 - 2.05 (m, 2H), 3.3 - 3.5 (br d, 2H), 3.95 - 4.05 (m, 2H), 6.85 (d, IH), 7.15 (d, IH), 7.6 (d, IH), 7.7 (m, 2H), 8.1 (m, 2H) , 8.3 (br s, IH) , 10.1 (br s, IH) ; MS m/z 306.2 (M+H) , 237.9 (M-C3H3N2')
Example 50: 1- (3- (lH-imidazol-1-yl) propyl) -3- (4- (dimethylamino) phenyl) thiourea melting point: 146.5 - 147.00C
1H NMR δ 1.9 - 2.0 (m, 2H) , 2.9 (s, 6H) , 3.4 (m, 2H) , 3.9 - 4.0 (m, 2H) , 6.7 (m, 2H) , 6.9 (s, IH) , 7.05 - 7.1 (m, 2H) , 7.15 (s, IH) , 7.4 (br s, IH) , 7.6 (s, IH) , 9.2 (s, IH) ; MS m/z 304.2 (M+H) , 236.0 (M-C3H3N2O
Example 102: 1- (3- (lH-imidazol-1-yl)propyl) -3- (3, 4- dimethoxyphenyl) urea melting point: 114.5 - 115.00C 1H NMR δ 1.7 - 1.9 (m, 2H), 2.9 - 3.1 (m, 2H), 3.7 (2s, 6H), 3.9 - 4.0 (m, 2H), 6.1 (t, IH), 6.7 (s, 2H), 6.8 (s, IH), 7.15 (d, 2H), 7.6 (s, IH), 8.2 (s, IH); MS m/z 321.2 (M+H), 253.3 (M- C3H3N2*)
Example 106: 1- ( (S) -3- (lH-imidazol-1-yl) -2-methylpropyl) -3- (3, 4- dimethoxyphenyl) -thiourea melting point:: 150.5 - 151.5°C
1H NMR δ 0.9 (d, 3H), 2.3 - 2.4 (m, 2H), 2.5 (s, IH), 3.7 (d,
6H), 4.0 - 4.1 (br m, IH), 4.15 - 4.25 (br m, IH), 6.75 - 6.8 (m, IH), 6.85 (m, IH), 6.9 - 7.0 (m, IH), 7.65 (s, 1 H), 7.75
(s, 2H) , 9.1 (s, IH) , 9.5 (s, IH) ; MS m/z 335.6 (M+H) , 267.1 (M-
C3H3N2O
Example 107: 1- ( (R) -3- (lH-imidazol-1-yl) -2-methylpropyl) -3- (3, 4- dimethoxyphenyl) -thiourea melting point: 155.0 - 157.5 0C
1H NMR δ 0.9 (d, 3H), 2.3 - 2.4 (m, 2H), 2.5 (s, IH), 3.7 (d,
6H), 4.0 - 4.1 (br m, IH), 4.15 - 4.25 (br m, IH), 6.75 - 6.8 (m, IH) , 6.85 (m, IH) , 6.9 - 7.0 (m, IH) , 7.65 (s, 1 H) , 7.75 (s, 2H) , 9.1 (s, IH) , 9.5 (s, IH) ; MS m/z 335.4 (M+H) , 267.2 (M- C3H3N2O
Example 109: 1- ( (1- ( (lH-lmldazol-1- yl) methyl) cyclopropyl) methyl) -3- (3, 4-dlmethoxy-phenyl) thiourea melting point: 166.5 - 168.5°C
1H NMR δ 0.7 - 0.8 (br m, 2H), 1.85 - 1.9 (m, IH), 2.15 - 2.2 (m, IH), 2.2 - 2.3 (m, IH), 3.4 - 3.5 (m, IH), 3.7 (d, 6H), 4.2 (s, IH), 4.95 (s, IH), 6.75 - 6.8 (br m, IH), 6.85 - 6.9 (br m, IH), 7.0 (s, IH), 7.5 (m, IH), 7.6 (m, IH), 7.7 (s, 0.5H), 7.8 (s, 0.5H), 8.85 (s, 0.5 H), 9.1 (s, 0.5H), 9.35 (s, 0.5H), 9.45 (s, 0.5H); MS m/z 347.2 (M+H), 279.2 (M-C3H3N2'), 137.5 (M-C9H13N4S*)
Example 110: N- (3- (lH-lmldazol-1-yl)propyl) benzo [d] thlazol-2- amlne
1H NMR δ 1.95 - 2.15 (m, 2H), 3.25 - 3. 35 (m, 2H), 4.0 - 4.1 (t, 2H), 6.9 (s, IH), 6.95 - 7.05 (t, IH), 7.15 - 7.2 (m, 2H), 7.35
- 7.4 (d, IH), 7.60 - 7.70 (m, 2H), 8.0 - 8.1 (br s, IH); MS m/z 259.4 (M+H), 191.3 (M-C3H3N2*)
Example 111: N- (3- (lH-lmldazol-1-yl)propyl) -6- chlorobenzo [d] thlazol-2-amine
1H NMR δ 1.95 - 2.15 (m, 2H), 3.25 - 3. 35 (m, 2H), 4.0 - 4.1 (t, 2H), 6.9 (s, IH), 7.1 - 7.2 (d, 2H), 7.3 - 7.4 (d, IH), 7.65 (s, IH), 7.8 (s, IH), 8.2 (s, IH); MS m/z 293.3 (M+H), 225.3 (M- C3H3N2*)
Example 112: N- (3- (lH-lmldazol-1-yl)propyl) -6- methoxybenzo [d] thlazol-2-amine
1H NMR δ 1.9 - 2.05 (m, 2H), 3.2 - 3. 3 (m, 2H), 3.7 (s, 3H), 4.0
- 4.1 (t, 2H), 6.7 - 6.8 (d, IH), 6.9 (s, IH), 7.15 - 7.2 (s, IH), 7.2 - 7.3 (m, 2H), 7.65 (s, IH), 7.8 (s, IH); MS m/z 289.1 (M+H) , 221.4 (M-C3H3N2O
Example 115: (R) -N- (3- (lH-imidazol-1-yl)propyl) -2- phenylpropanethioamide melting point: 82.0 - 82.5°C
1H NMR δ 1.4 - 1.55 (d, 3H), 1.9 - 2.0 (m, 2H), 3.4 - 3.5 (m, 2H), 3.85 - 3.95 (m, 2H), 4.0 - 4.1 (q, IH), 6.8 - 6.9 (s, IH), 7.1 (s, IH), 7.15 - 7.2 (m, IH), 7.2 - 7.3 (m, 2H), 7.35 - 7.4 (m, 2H), 7.55 (s, IH), 10.1 (s, IH); MS m/z 274.4 (M+H), 206.3 (M-C3H3N2')
Example 116: (S) -N- (3- (lH-imidazol-1-yl)propyl) -2- phenylpropanethloamlde melting point: 82.5 - 83.5°C
1H NMR δ 1.4 - 1.55 (d, 3H), 1.9 - 2.0 (m, 2H), 3.4 - 3.5 (m, 2H), 3.85 - 3.95 (m, 2H), 4.0 - 4.1 (q, IH), 6.8 - 6.9 (s, IH), 7.1 (s, IH), 7.15 - 7.2 (m, IH), 7.2 - 7.3 (m, 2H), 7.35 - 7.4 (m, 2H), 7.55 (s, IH), 10.1 (s, IH); MS m/z 274.4 (M+H), 206.3 (M-C3H3N2*)
Example 121: N- (3- (lH-lmldazol-1-yl)propyl) -1- (4- chlorophenyl) cyclobutanecarbo-thloamide melting point: 137.5 - 139.00C 1H NMR δ 1.55 - 1.75 (br m, 2H) , 1.85 - 1.95 (br m, 2H) , 2.4 - 2.5 (br m, 2H) , 2.7 - 2.85 (br m, 2H) , 3.3 - 3.5 (br m, 2H) , 3.8 (m, 2H) , 6.9 (s, IH) , 7.0 (s, IH) , 7.3 (m, 2H) , 7.45 (s, IH) , 7.5 (m, 2H) , 9.6 (t, IH) ; MS m/z 334.3 (M+H) , 266.1 (M-C3H3N2O
Example 122: N- (3- (lH-lmldazol-1-yl) propyl) -1- (4- chlorophenyl ) cycl open tanecarbo-thloaml de melting point: 140.0 - 141.00C 1H NMR δ 1.5 - 1.65 (br m, 4H), 1.8 - 1.9 ( m, 2H), 2.0 - 2.1 (m, 2H), 2.6 (m, 2H), 3.4 - 3.5 (m, 2H), 3.7 - 3.8 (m, 2H), 6.85 (s, IH), 7.0 (s, IH), 7.35 (m, 2H), 7.4 (m, 2H), 7.5 (s, IH), 9.4 (t, IH); MS m/z 348.2 (M+H) , 280.2 (M-C3H3N2O
Example 123: N- (3- (lH-imidazol-1-yl)propyl) -1- (4- methoxyphenyl) cyclohexanecarbo-thioamide melting point: 162.5 - 164.00C
1H NMR δ 1.2 - 1.3 (m, IH), 1.35 - 1.5 (br m, 5H), 1.85 - 2.0 (br m, 4H), 2.4 - 2.6 (br m, 2H), 3.4 - 3.5 (m, 2H), 3.7 (s, 3H), 3.8 (m, 2H), 6.8 (m, 3H), 7.0 (s, IH), 7.3 (m, 2H), 7.5 (s, IH), 9.2 (t, IH); MS m/z 358.3 (M+H), 290.3 (M-C3H3N2O
Example 124: N- (3- (lH-imidazol-1-yl)propyl) -1- (4- methoxyphenyl) cyclopropanecar-bothloamlde melting point:: 129.0 - 129.5°C
1H NMR δ 1.0 - 1.1 (m, 2H), 1.5 - 1.6 (m, 2H), 1.9 - 2.0 (br m, 2H), 3.4 - 3.5 (m, 2H), 3.7 (s, 3H), 3.9 (m, 2H), 6.9 (m, 3H), 7.1 (s, IH), 7.2 - 7.3 (m, 2H), 7.6 (s, IH), 8.9 (br s, IH); MS m/z 316.0 (M+H), 248.4 (M-C3H3N2O
Example 134: 5- (lH-imidazol-1-yl) -N- (3, 4- dimethoxyphenyl)pentanethioamide melting point:: 128.0 - 128.5°C 1H NMR δ 1.65 - 1.70 (m, 2H), 1.75 - 1.80 (m, 2H), 2.7 - 2.75 (m, 2H), 3.7 (s, 3H), 3.75 (s, 3H), 4.0 - 4.05 (t, 2H), 6.9 - 7.0 (m, 2H), 7.2 (s, IH), 7.3 (d, IH), 7.5 (s, IH), 7.75 (s, IH), 11.0 (s, IH); MS m/z 320.2 (M+H), 252.2 (M-C3H3N2O
Example 136: 1- (2- (lH-imidazol-1-yl) ethyl) -3- (3, 4- dlmethoxyphenyl) thiourea melting point: 157.5 - 159.00C 1H NMR δ 3.7 (2 s, 6H), 3.8 (m, 2H), 4.2 (m, 2H), 6.7 (m, IH), 6.85 (m, IH), 6.9 (m, 2H), 7.15 (s, IH), 7.5 (br s, IH), 7.6 (s, IH), 9.5 (s, IH); MS m/z 307.2 (M+H) , 239.1 (M-C3H3N2')

Claims

1. A QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition, selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
2. Use of a QC inhibitor for the treatment and/or prevention of an inflammatory disease or condition selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
3. Use of a QC inhibitor for the preparation of a medicament for treating and/or preventing an inflammatory disease or condition selected from mild cognitive impairment (MCI), restenosis, and pancreatitis.
4. The QC inhibitor or use according to any of claims 1 to 3, wherein the disease is mild cognitive impairment (MCI) .
5. The QC inhibitor or use according to any of claims 1 to 4, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroptrotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
6. The QC inhibitor or use according to any of claims 1 to 3, wherein the disease is selected from restenosis and pancreatitis.
7. The QC inhibitor or use according to any of claims 1 to 3 or 6, wherein the disease is restenosis.
8. The QC-inhibitor or use according to any of claims 1 to 3, 6 or 7, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL-6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors.
9. A Method of treatment and/or prevention of an inflammatory disease or condition, selected from mild cognitive impairment (MCI), restenosis and pancreatitis, wherein an effective amount of a QC inhibitor is administered to a subject in need thereof.
10. The method of treatment and/or prevention according to claim 9, wherein the disease is mild cognitive impairment (MCI) .
11. The method of treatment and/or prevention according to claim
9 or 10, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of nootropic agents, neuroprotectants, antiparkinsonian drugs, amyloid protein deposition inhibitors, beta amyloid synthesis inhibitors, antidepressants, anxiolytic drugs, antipsychotic drugs and anti-multiple sclerosis drugs.
12. The method of treatment and/or prevention according to claim 9, wherein the disease is selected from restenosis and pancreatitis.
13. The method of treatment and/or prevention according to claim 9 or 12, wherein the disease is restenosis.
14. The method of treatment and/or prevention according to any of claim 9 or 12, wherein the disease is pancreatitis.
15. The method of treatment and/or prevention according to any of claims 9, or 12 to 14, wherein the QC inhibitor is administered in combination with a further agent, selected from the group consisting of inhibitors of the angiotensin converting enzyme (ACE); angiotensin II receptor blockers; diuretics; calcium channel blockers (CCB); beta-blockers; platelet aggregation inhibitors; cholesterol absorption modulators; HMG-Co-A reductase inhibitors; high density lipoprotein (HDL) increasing compounds; renin inhibitors; IL- 6 inhibitors; antiinflammatory corticosteroids; antiproliferative agents; nitric oxide donors; inhibitors of extracellular matrix synthesis; growth factor or cytokine signal transduction inhibitors; MCP-I antagonists and tyrosine kinase inhibitors.
16. The use according to any of claims 2 to 8, wherein the disease and/or condition afflict a human being.
17. The method of any of claims 9 to 15, wherein the disease and/or condition afflicts a human being.
18. The QC-inhibitor, use or method according to any one of claims 1 to 17, wherein said QC inhibitor is a compound of formula 1 including pharmaceutically acceptable salts, solvates and stereoisomers thereof:
Figure imgf000140_0002
wherein : A is either: an alkyl chain, alkenyl chain or alkynyl chain;
or A is a group selected from:
Figure imgf000140_0001
wherein :
R6, R7, R8, R9 and R10 are independently H or an alkyl chain, alkenyl chain, alkynyl chain, cycloalkyl, a carbocycle, aryl, heteroaryl, or a heterocycle; n and n1 are independently 1 - 5; m is 1 - 5 ; o is 0 - 4;
and B is a group selected from:
Figure imgf000141_0001
Figure imgf000141_0002
wherein :
D and E independently represent an alkyl chain, alkenyl chain, alkynyl chain, a cycloalkyl, carbocycle, aryl, - alkylaryl, heteroaryl, -alkylheteroaryl, acyl or a heterocycle .
Z is CH or N; X represents CR20R21, O, S, NR19, with the proviso for formulas (VIII) and (IX) that, if Z = CH, X is O or S;
R19 is selected from the group consisting of H, alkyl, cycloalkyl, aryl, heteroaryl, -oxyalkyl, -oxyaryl, carbonyl, amido, hydroxy, NO2, NH2, CN;
R20 and R21 are independently selected from H, alkyl, cycloalkyl, heterocycle, aryl, heteroaryl, -oxyalkyl, - oxyaryl, carbonyl, amido, NO2 , NH2, CN, CF3 ;
X1, X2 and X3 are independently O or S provided that X2 and X3 are not both O;
Y is 0 or S, with the proviso that Y may not by O, when the carbocycle formed by R17 and R18 has 3 members in the ring;
Z is CH or N;
R11, R12, R13 and R14 can be independently selected from H, an alkyl chain, an alkenyl chain, an alkynyl chain, cycloalkyl, carbocycle, aryl, heteroaryl, a heterocycle, halo, alkoxy-, -thioalkyl, carboxyl, carboxylic acid ester, carbonyl, carbamide, carbimide, thiocarbamide or thiocarbonyl, NH2, NO2;
R15 and R16 are independently of each other H or a branched or unbranched alkyl chain, or a branched or unbranched alkenyl chain;
R17 and R18 are independently selected from H or an alkyl chain, alkenyl chain, a alkynyl chain, a carbocycle, aryl, heteroaryl, heteroalkyl, or can be connected to form a carbocycle with up to 6 ring atoms;
n is 0 or 1.
19. The QC-inhibitor, use or method according to any one of claims 1 to 18, wherein said QC inhibitor or a pharmaceutically acceptable salt, solvate or stereoisomer thereof is selected from
a compound of formula 1*:
Figure imgf000143_0001
or a compound of of formula I a ,
Figure imgf000143_0002
wherein R is defined in examples 1 to 53
Figure imgf000143_0003
Figure imgf000144_0001
Figure imgf000145_0001
Figure imgf000146_0001
or a compound of of formula Ib,
Figure imgf000147_0001
wherein R1 and R2 are defined in examples 54 to 95.
Figure imgf000147_0002
Figure imgf000148_0001
Figure imgf000149_0002
or a compound of formula Ic,
Figure imgf000149_0001
wherein R3 is defined in examples 96 to 102
Figure imgf000149_0003
or
a compound of formula Id,
Figure imgf000150_0001
wherein the position on the ring is defined in examples 103 to 105,
or
a compound of formula Ie,
Figure imgf000150_0002
wherein R4 and R5 are defined in examples 106 to 109
Figure imgf000150_0003
or
a compound of formula If,
Figure imgf000151_0001
wherein R6 is defined in examples 110 to 112
Figure imgf000151_0003
or a compound of formula Ig,
Figure imgf000151_0002
wherein R7, R8 and R9 are defined in examples 113 to 132
Figure imgf000151_0004
Figure imgf000152_0001
Figure imgf000153_0003
or a compound of formula Ih,
Figure imgf000153_0001
wherein n is defined in examples 133 to 135.
Figure imgf000153_0004
or a compound of formula Ii,
Figure imgf000153_0002
wherein m is defined in examples 136 and 137
Figure imgf000153_0005
or
a compound selected from examples 138 to 141.
Figure imgf000154_0002
20. The QC-inhibitor, use or method according to any one of claims 1 to 19, wherein said QC inhibitor is 1-(3-(1H- imidazole-1-yl) propyl) -3- (3, 4-dimethoxy-phenyl) thiourea hydrochloride .
21. Diagnostic assay, comprising a QC inhibitor.
22. Diagnostic assay according to claim 21, wherein said QC inhibitor is a compound of formula 1 including pharmaceutically acceptable salts, solvates and stereoisomers thereof:
Figure imgf000154_0001
wherein :
A is either: an alkyl chain, alkenyl chain or alkynyl chain;
or A is a group selected from:
Figure imgf000155_0001
wherein :
R6, R7, R8, R9 and R10 are independently H or an alkyl chain, alkenyl chain, alkynyl chain, cycloalkyl, a carbocycle, aryl, heteroaryl, or a heterocycle; n and n1 are independently 1 - 5; m is 1 - 5 ; o is 0 - 4;
and B is a group selected from:
Figure imgf000156_0001
Figure imgf000156_0002
wherein :
D and E independently represent an alkyl chain, alkenyl chain, alkynyl chain, a cycloalkyl, carbocycle, aryl, - alkylaryl, heteroaryl, -alkylheteroaryl, acyl or a heterocycle . Z i s CH or N ;
X represents CR20R21, O, S, NR19, with the proviso for formulas (VIII) and (IX) that, if Z = CH, X is O or S;
R19 is selected from the group consisting of H, alkyl, cycloalkyl, aryl, heteroaryl, -oxyalkyl, -oxyaryl, carbonyl, amido, hydroxy, NO2, NH2, CN;
R20 and R21 are independently selected from H, alkyl, cycloalkyl, heterocycle, aryl, heteroaryl, -oxyalkyl, - oxyaryl, carbonyl, amido, NO2 , NH2, CN, CF3 ;
X1, X2 and X3 are independently O or S provided that X2 and XJ are not both O;
Y is 0 or S, with the proviso that Y may not by O, when the carbocycle formed by R17 and R18 has 3 members in the ring;
Z is CH or N;
R11, R12, R13 and R14 can be independently selected from H, an alkyl chain, an alkenyl chain, an alkynyl chain, cycloalkyl, carbocycle, aryl, heteroaryl, a heterocycle, halo, alkoxy-, -thioalkyl, carboxyl, carboxylic acid ester, carbonyl, carbamide, carbimide, thiocarbamide or thiocarbonyl, NH2, NO2;
R15 and R16 are independently of each other H or a branched or unbranched alkyl chain, or a branched or unbranched alkenyl chain;
R17 and R18 are independently selected from H or an alkyl chain, alkenyl chain, a alkynyl chain, a carbocycle, aryl, heteroaryl, heteroalkyl, or can be connected to form a carbocycle with up to 6 ring atoms;
n is 0 or 1.
23. Diagnostic assay according to claim 21 or 22, wherein said QC inhibitor or a pharmaceutically acceptable salt, solvate or stereoisomer thereof is selected from
a compound of formula 1*:
Figure imgf000158_0001
or a compound of of formula I a ,
Figure imgf000158_0002
wherein R is defined in examples 1 to 53
Figure imgf000158_0003
Figure imgf000159_0001
Figure imgf000160_0001
Figure imgf000161_0001
or a compound of of formula Ib,
Figure imgf000162_0001
wherein R1 and R2 are defined in examples 54 to 95.
Figure imgf000162_0002
Figure imgf000163_0001
Figure imgf000164_0002
or a compound of formula Ic,
Figure imgf000164_0001
wherein R3 is defined in examples 96 to 102
Figure imgf000164_0003
or a compound of formula Id,
Figure imgf000165_0001
wherein the position on the ring is defined in examples 103 to 105,
or
a compound of formula Ie,
Figure imgf000165_0002
wherein R4 and R5 are defined in examples 106 to 109,
Figure imgf000165_0004
or
a compound of formula If,
Figure imgf000165_0003
wherein R6 is defined in examples 110 to 112
Figure imgf000166_0002
or a compound of formula Ig,
Figure imgf000166_0001
wherein R7, R8 and R9 are defined in examples 113 to 132
Figure imgf000166_0003
Figure imgf000167_0002
or a compound of formula Ih,
Figure imgf000167_0001
wherein n is defined in examples 133 to 135.
Figure imgf000168_0002
or a compound of formula Ii,
Figure imgf000168_0001
wherein m is defined in examples 136 and 137
Figure imgf000168_0003
or a compound selected from examples 138 to 141
Figure imgf000168_0004
Figure imgf000169_0002
24. Diagnostic assay according to any of claims 21 to 23, wherein said QC inhibitor is 1- (3- (lH-imidazole-1- yl) propyl) -3- (3, 4-dimethoxy-phenyl) thiourea hydrochloride.
25. A method of diagnosing any one of the diseases and/or conditions as defined in claim 1, comprising the steps of collecting a sample from a subject who is suspected to be afflicted with said disease and/or condition, contacting said sample with a QC inhibitor, and determining whether or not said subject is afflicted by said disease and/or condition.
26. The method according to claim 26, wherein said subject is a human being.
27. The method according to claim 26 or 27, wherein said QC inhibitor is a compound of formula 1 including pharmaceutically acceptable salts, solvates and stereoisomers thereof:
Figure imgf000169_0001
wherein : A is either: an alkyl chain, alkenyl chain or alkynyl chain;
or A is a group selected from:
Figure imgf000170_0001
wherein :
R6, R7, R8, R9 and R10 are independently H or an alkyl chain, alkenyl chain, alkynyl chain, cycloalkyl, a carbocycle, aryl, heteroaryl, or a heterocycle; n and n1 are independently 1 - 5; m is 1 - 5 ; o is 0 - 4;
and B is a group selected from:
Figure imgf000171_0001
wherein :
D and E independently represent an alkyl chain, alkenyl chain, alkynyl chain, a cycloalkyl, carbocycle, aryl, - alkylaryl, heteroaryl, -alkylheteroaryl, acyl or a heterocycle .
Z is CH or N;
X represents CR20R21, O, S, NR19, with the proviso for formulas (VIII) and (IX) that, if Z = CH, X is O or S;
R19 is selected from the group consisting of H, alkyl, cycloalkyl, aryl, heteroaryl, -oxyalkyl, -oxyaryl, carbonyl, amido, hydroxy, NO2, NH2, CN;
R20 and R21 are independently selected from H, alkyl, cycloalkyl, heterocycle, aryl, heteroaryl, -oxyalkyl, - oxyaryl, carbonyl, amido, NO2 , NH2, CN, CF3 ;
X1, X2 and X3 are independently 0 or S provided that X2 and X3 are not both 0;
Y is 0 or S, with the proviso that Y may not by 0, when the carbocycle formed by R17 and R18 has 3 members in the ring;
Z is CH or N;
R11, R12, R13 and R14 can be independently selected from H, an alkyl chain, an alkenyl chain, an alkynyl chain, cycloalkyl, carbocycle, aryl, heteroaryl, a heterocycle, halo, alkoxy-, -thioalkyl, carboxyl, carboxylic acid ester, carbonyl, carbamide, carbimide, thiocarbamide or thiocarbonyl, NH2, NO2;
R and R are independently of each other H or a branched or unbranched alkyl chain, or a branched or unbranched alkenyl chain;
R17 and R18 are independently selected from H or an alkyl chain, alkenyl chain, a alkynyl chain, a carbocycle, aryl, heteroaryl, heteroalkyl, or can be connected to form a carbocycle with up to 6 ring atoms;
n is 0 or 1.
28. The method according to any of claims 25 to 27, wherein said QC inhibitor or a pharmaceutically acceptable salt, solvate or stereoisomer thereof is selected from
a compound of formula 1*:
Figure imgf000173_0001
or a compound of of formula Ia,
Figure imgf000173_0002
wherein R is defined in examples 1 to 53:
Figure imgf000174_0001
Figure imgf000175_0001
Figure imgf000176_0001
Figure imgf000177_0002
or a compound of of formula Ib,
Figure imgf000177_0001
wherein R1 and R2 are defined in examples 54 to 95
Figure imgf000177_0003
Figure imgf000178_0001
Figure imgf000179_0002
or a compound of formula Ic,
Figure imgf000179_0001
wherein R3 is defined in examples 96 to 102
Figure imgf000179_0003
Figure imgf000180_0003
or
a compound of formula Id,
Figure imgf000180_0001
wherein the position on the ring is defined in examples 103 to 105,
or
a compound of formula Ie,
Figure imgf000180_0002
wherein R4 and R5 are defined in examples 106 to 109,
Figure imgf000180_0004
Figure imgf000181_0003
or a compound of formula If,
Figure imgf000181_0001
wherein R6 is defined in examples 110 to 112
Figure imgf000181_0004
or a compound of formula Ig,
Figure imgf000181_0002
wherein R7, R8 and R9 are defined in examples 113 to 132
Figure imgf000181_0005
Figure imgf000182_0001
Figure imgf000183_0003
or a compound of formula Ih,
Figure imgf000183_0001
wherein n is defined in examples 133 to 135.
Figure imgf000183_0004
or a compound of formula Ii,
Figure imgf000183_0002
wherein m is defined in examples 136 and 137
Figure imgf000183_0005
or
a compound selected from examples 138 to 141.
Figure imgf000184_0001
29. The method according to any of claims 25 to 28, wherein said QC inhibitor is 1- (3- (lH-imidazole-1-yl) propyl) -3- (3, 4- dimethoxy-phenyl) thiourea hydrochloride.
30. The method of any of claims 25 to 29, wherein said sample is a blood sample, a serum sample, a sample of cerebrospinal liquor or a urine sample.
31. Diagnostic kit for carrying out the method of claims 25 to 30 comprising as detection means the diagnostic assay of any of claims 21 to 24 and a determination means.
32. Pharmaceutical composition, comprising the QC inhibitor according to any of claims 1, 4 to 6 or 18 to 20.
PCT/EP2008/052411 2007-03-01 2008-02-28 New use of glutaminyl cyclase inhibitors WO2008104580A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
JP2009551208A JP5930573B2 (en) 2007-03-01 2008-02-28 New use of glutaminyl cyclase inhibitors
EP08717208A EP2117540A1 (en) 2007-03-01 2008-02-28 New use of glutaminyl cyclase inhibitors
CA2679446A CA2679446C (en) 2007-03-01 2008-02-28 New use of glutaminyl cyclase inhibitors
BRPI0808170-0A BRPI0808170A2 (en) 2007-03-01 2008-02-28 USE OF GLUTAMINYL CYCLASE INHIBITORS
KR1020147027487A KR20140133897A (en) 2007-03-01 2008-02-28 New use of glutaminyl cyclase inhibitors
AU2008220785A AU2008220785B2 (en) 2007-03-01 2008-02-28 New use of glutaminyl cyclase inhibitors
EA200901140A EA200901140A1 (en) 2007-03-01 2008-02-28 NEW USE OF GLUTAMINYL CYCLLASE INHIBITORS
NZ579310A NZ579310A (en) 2007-03-01 2008-02-28 Use of glutaminyl cyclase inhibitors for the treatment of mild cognitive impairment and diagnostic purposes thereof
MX2009009234A MX2009009234A (en) 2007-03-01 2008-02-28 New use of glutaminyl cyclase inhibitors.
IL200315A IL200315A (en) 2007-03-01 2009-08-10 Glutaminyl cyclase inhibitors for treatment and diagnosis of mild cognitive impairment, restenosis and pancreatitis

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US89226507P 2007-03-01 2007-03-01
US60/892,265 2007-03-01
US11/685,881 US7732162B2 (en) 2003-05-05 2007-03-14 Inhibitors of glutaminyl cyclase for treating neurodegenerative diseases
US11/685,881 2007-03-14

Publications (1)

Publication Number Publication Date
WO2008104580A1 true WO2008104580A1 (en) 2008-09-04

Family

ID=39345241

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2008/052411 WO2008104580A1 (en) 2007-03-01 2008-02-28 New use of glutaminyl cyclase inhibitors

Country Status (12)

Country Link
EP (2) EP2481408A3 (en)
JP (1) JP5930573B2 (en)
KR (1) KR20090115951A (en)
CN (1) CN101668525A (en)
AU (1) AU2008220785B2 (en)
CA (1) CA2679446C (en)
EA (1) EA200901140A1 (en)
IL (1) IL200315A (en)
MX (1) MX2009009234A (en)
NZ (1) NZ579310A (en)
WO (1) WO2008104580A1 (en)
ZA (1) ZA200905537B (en)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011036047A1 (en) * 2009-09-23 2011-03-31 Aziende Chimiche Riunite Angelini Francesco A.C.R.A.F. S.P.A. Pharmaceutical composition for the treatment of mcp-1 mediated inflammatory diseases
JP2013519891A (en) * 2010-02-18 2013-05-30 プロビオドルグ エージー Method for diagnosing inflammatory diseases by determining pyroglutamate-modified MCP-1 and method for screening for inhibitors of glutaminyl cyclase
WO2019022600A1 (en) * 2017-07-24 2019-01-31 Stichting Het Nederlands Kanker Instituut-Antoni van Leeuwenhoek Ziekenhuis Treating pathological conditions by direct and indirect targeting of sirpa - cd47 interaction
US11834440B2 (en) 2021-06-24 2023-12-05 Insilico Medicine Ip Limited Beta-lactam derivatives for the treatment of diseases

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2049472B1 (en) 2006-06-23 2015-01-21 AbbVie Bahamas Ltd. Cyclopropyl amine derivatives as histamin h3 receptor modulators
US9108948B2 (en) 2006-06-23 2015-08-18 Abbvie Inc. Cyclopropyl amine derivatives
EA201400366A1 (en) * 2007-03-01 2014-08-29 Пробиодруг Аг NEW USE OF GLUTAMINYL CYCLLASE INHIBITORS
US9186353B2 (en) 2009-04-27 2015-11-17 Abbvie Inc. Treatment of osteoarthritis pain
US8853390B2 (en) 2010-09-16 2014-10-07 Abbvie Inc. Processes for preparing 1,2-substituted cyclopropyl derivatives
CN105384691B (en) * 2015-10-26 2018-06-29 深圳大学 A kind of preparation method and application of inhibitors of glutaminyl cyclase
CN105384692B (en) * 2015-10-26 2018-06-29 深圳大学 A kind of inhibitors of glutaminyl cyclase
KR102230832B1 (en) * 2019-06-17 2021-03-24 (주) 메디프론디비티 N-substituted thiourea or urea derivatives and pharmaceutical composition for use in preventing or treating glutaminyl cyclase activity related diseases containing the same as an active ingredient

Citations (408)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0117462A2 (en) 1983-02-28 1984-09-05 American Cyanamid Company N-(2-4-(1H-imidazol-1-yl)alkyl)arylamides
EP0172458A2 (en) 1984-07-31 1986-02-26 Suntory Limited Novel biologically active compound having anti-prolyl endopeptidase activity
JPS6137764B2 (en) 1980-08-14 1986-08-26 Tokyo Shibaura Electric Co
EP0201741A2 (en) 1985-04-16 1986-11-20 Suntory Limited Dipeptide derivatives, processes for preparing them, pharmaceutical composition and use
EP0201742A2 (en) 1985-04-16 1986-11-20 Suntory Limited N-Acylpyrrolidine derivatives, processes for preparing them, pharmaceutical composition and use
EP0201743A2 (en) 1985-04-16 1986-11-20 Suntory Limited Dipeptide derivatives of fatty acids, process for preparing them, pharmaceutical composition and use
EP0224272A1 (en) 1985-11-29 1987-06-03 Suntory Limited Pyrrolidinylamide ester derivative having anti-prolyl endopeptidase activity, its synthesis and use and a pharmaceutical composition containing it
EP0232849A2 (en) 1986-02-04 1987-08-19 Suntory Limited Pyrrolidineamide derivative of acylamino acid, pharmaceutical composition and use
EP0253310A2 (en) 1986-07-11 1988-01-20 E.I. Du Pont De Nemours And Company Angiotensin II receptor blocking imidazoles
EP0268190A1 (en) 1986-11-20 1988-05-25 Ono Pharmaceutical Co., Ltd. Prolinal derivatives
EP0268281A2 (en) 1986-11-18 1988-05-25 Suntory Limited Pyrrolidineamide derivative having anti-prolyl endopeptidase activity, compositions comprising the same, processes for the preparation of the same, and the use of the same for the preparation of a medicament of therapeutic value
EP0275482A2 (en) 1986-12-29 1988-07-27 Ono Pharmaceutical Co., Ltd. Proline derivatives
EP0277588A1 (en) 1987-02-04 1988-08-10 Ono Pharmaceutical Co., Ltd. Prolinal derivatives
EP0280956A1 (en) 1987-02-23 1988-09-07 Ono Pharmaceutical Co., Ltd. Thiazolidine derivatives
JPS6469B2 (en) 1981-05-25 1989-01-05 Hochiki Co
JPS6442465A (en) 1987-08-07 1989-02-14 Wakunaga Pharma Co Ltd N-acylprolylpyrrolidine derivative, production and use thereof
EP0303434A1 (en) 1987-08-08 1989-02-15 Kissei Pharmaceutical Co. Ltd. Thiazolidine compounds
JPS6468396A (en) 1987-09-10 1989-03-14 Yakult Honsha Kk Novel peptide and amnesia alleviating drug comprising said peptide as active ingredient
JPH01143897A (en) 1987-11-30 1989-06-06 Kissei Pharmaceut Co Ltd Thiazolidine derivative
WO1989006242A1 (en) 1987-10-08 1989-07-13 The Mclean Hospital Corporation Antibodies to a4 amyloid peptide
JPH01226880A (en) 1988-03-07 1989-09-11 Kissei Pharmaceut Co Ltd Thiazolidine derivative
JPH01250370A (en) 1987-12-23 1989-10-05 Zeria Pharmaceut Co Ltd Novel amino acid imide derivative, its production and use thereof
EP0345428A1 (en) 1988-04-08 1989-12-13 Ono Pharmaceutical Co., Ltd. Anti-amnesic pyrrolidine derivatives
EP0355793A2 (en) 1988-08-26 1990-02-28 Merrell Pharmaceuticals Inc. Neuropeptide Y agonists and partial agonists
EP0355794A2 (en) 1988-08-26 1990-02-28 Merrell Dow Pharmaceuticals Inc. Neuropeptide Y antagonists
EP0372484A2 (en) 1988-12-08 1990-06-13 Zeria Pharmaceutical Co., Ltd. Condensed benzene derivative
JPH02207070A (en) 1989-02-07 1990-08-16 Zeria Pharmaceut Co Ltd Amide acid imide derivative, drug containing same and intermediate for producing the compound
WO1990012870A1 (en) 1989-04-14 1990-11-01 Research Foundation For Mental Hygiene, Inc. Monoclonal antibody to amyloid peptide
WO1990012871A1 (en) 1989-04-14 1990-11-01 Research Foundation For Mental Hygiene, Inc. Cerebrovascular amyloid protein-specific monoclonal antibody sv17-6e10
JPH02275858A (en) 1988-09-14 1990-11-09 Yoshitomi Pharmaceut Ind Ltd Pyridine compound
WO1990014840A1 (en) 1989-06-06 1990-12-13 California Biotechnology Inc. Recombinant alzheimer's amyloid protein
EP0403159A2 (en) 1989-06-14 1990-12-19 Smithkline Beecham Corporation Imidazolyl-alkenoic acids
US4999349A (en) 1990-03-22 1991-03-12 Bristol-Myers Squibb Co. BU-4164E - A and B, prolyl endopeptidase inhibitors
JPH0331298B2 (en) 1984-09-18 1991-05-02 Sanyo Electric Co
DE3939797A1 (en) 1989-12-01 1991-06-06 Basf Ag NEW PEPTIDES DERIVED FROM NEUROPEPTIDE Y
WO1991010664A1 (en) 1990-01-12 1991-07-25 American Home Products Corporation PYRIDAZINO[4,5-b]INDOLIZINES
JPH0356486B2 (en) 1984-08-22 1991-08-28
EP0443983A1 (en) 1990-02-19 1991-08-28 Ciba-Geigy Ag Acyl compounds
EP0454511A1 (en) 1990-03-20 1991-10-30 Sanofi N-substituted heterocycle derivatives, their preparation, compositions containing them
EP0459136A1 (en) 1990-04-27 1991-12-04 Takeda Chemical Industries, Ltd. Benzimidazole derivatives, their production and use
WO1991018877A1 (en) 1990-06-07 1991-12-12 Zeria Pharmaceutical Co., Ltd. Novel arylalkanoylamine derivative and drug containing the same
US5073549A (en) 1990-03-22 1991-12-17 Bristol-Myers Squibb Company BU-4164E - A and B, prolyl endopeptidase inhibitors and their methods of use
EP0468339A2 (en) 1990-07-27 1992-01-29 Nippon Kayaku Kabushiki Kaisha Alpha-keto-amide derivatives having protease inhibiting activity
EP0468469A2 (en) 1990-07-27 1992-01-29 Japan Tobacco Inc. Proline derivatives
JPH049367B2 (en) 1984-02-08 1992-02-20
US5118811A (en) 1989-04-13 1992-06-02 Japan Tobacco Inc. Amino acid derivatives possessing prolyl endopeptidase-inhibitory activities
EP0503785A1 (en) 1991-02-21 1992-09-16 Sankyo Company Limited 1-Biphenylimidazole derivatives, their preparation and their therapeutic use
WO1992019238A1 (en) 1991-05-01 1992-11-12 Mayo Foundation For Medical Education And Research Huperzine a analogs
WO1992021333A2 (en) 1991-05-24 1992-12-10 Pharmavene, Inc. Treatment of drug withdrawal symptoms and drug craving with type b monoamine oxidase inhibitors
WO1993000361A1 (en) 1991-06-20 1993-01-07 Snow Brand Milk Products Co., Ltd. Novel prolyl endopeptidase inhibitors sna-115 and sna-115t, production thereof, and strain which produces said inhibitors
EP0522314A1 (en) 1991-07-03 1993-01-13 BASF Aktiengesellschaft Thermoplastic moulding composition based on polycarbonates, styrene/acrylanitrile-polymerisates and polyolefins
WO1993003034A1 (en) 1991-07-29 1993-02-18 Warner-Lambert Company Quinazoline derivatives as acetylcholinesterase inhibitors
JPH0515314B2 (en) 1986-09-30 1993-03-01 Kogyo Gijutsuin
US5198458A (en) 1986-02-04 1993-03-30 Suntory Limited Pyrrolidineamide derivatives of acylamino acid and pharmaceutical composition containing the same
JPH0525125B2 (en) 1984-07-16 1993-04-12 Shin Meiwa Ind Co Ltd
EP0539086A2 (en) 1991-10-24 1993-04-28 American Home Products Corporation Condensed pyrimidine derivatives and their use as angiotensine II antagonists
WO1993012139A1 (en) 1991-12-19 1993-06-24 Garvan Institute Of Medical Research A novel molecule which inhibits neuropeptide tyrosine biological function
WO1993013065A1 (en) 1991-12-27 1993-07-08 Japan Tobacco Inc. Proline derivative
EP0556482A2 (en) 1991-12-24 1993-08-25 Snow Brand Milk Products Co., Ltd. Propyl endopeptidase inhibitor
US5254550A (en) 1986-11-20 1993-10-19 Ono Pharmaceutical Co., Ltd. Prolinal derivatives and pharmaceutical compositions thereof
US5262431A (en) 1986-12-29 1993-11-16 Ono Pharmaceutical Co., Ltd. Prolinal derivatives and pharmaceutical compositions thereof
WO1993025534A1 (en) 1992-06-10 1993-12-23 Zeneca Limited 2,5-DIOXO-2,5-DIHYDRO-1H-BENZ[b]AZEPINES AS NMDA RECEPTOR ANTAGONISTS
WO1994000486A1 (en) 1992-06-20 1994-01-06 The Wellcome Foundation Limited Neuropeptide y antagonists
WO1994007890A1 (en) 1992-10-05 1994-04-14 Ube Industries, Ltd. Pyrimidine compound
WO1994009016A1 (en) 1992-10-16 1994-04-28 Sri International 2-piperidinecarboxylic acid derivatives useful as nmda receptor antagonists
WO1994012474A1 (en) 1992-11-20 1994-06-09 Japan Tobacco Inc. Compound with prolyl endopeptidase inhibitor activity and pharmaceutical use thereof
WO1994013641A1 (en) 1992-12-16 1994-06-23 Japan Tobacco Inc. Benzomorphan useful as nmda receptor antagonist
US5328899A (en) 1988-07-15 1994-07-12 The Salk Institute For Biological Studies NPY peptide analogs
WO1994017035A1 (en) 1993-01-20 1994-08-04 Dr. Karl Thomae Gmbh Aminoacid derivates, medicaments containing these compounds and process for preparing the same
WO1994017197A1 (en) 1993-01-25 1994-08-04 Takeda Chemical Industries, Ltd. ANTIBODY AGAINST β-AMYLOID OR DERIVATIVE THEREOF AND USE THEREOF
WO1994019356A1 (en) 1993-02-16 1994-09-01 Merrell Dow Pharmaceuticals Inc. Silylated acetylcholinesterase inhibitors
EP0614911A1 (en) 1993-02-15 1994-09-14 Sanofi Compounds having a sulfonamide and an amidinegroup, process for preparation and pharmaceutical compositions comprising them
WO1994020109A1 (en) 1993-03-03 1994-09-15 Rhone-Poulenc Rorer S.A. Use of 2h-1,2,4-benzothiadiazine 3(4h)-one 1,1 dioxide derivatives as non-competitive nmda receptor antagonists
WO1994020476A1 (en) 1993-03-02 1994-09-15 Fujisawa Pharmaceutical Co., Ltd. Novel heterocyclic compound
EP0618193A1 (en) 1993-03-24 1994-10-05 Adir Et Compagnie Nitrogen containing bicyclic derivatives as prolyl-endopeptidase inhibitors
WO1994029255A1 (en) 1993-06-04 1994-12-22 Merrell Pharmaceuticals Inc. Aromatic acetylcholinesterase inhibitors
WO1995000161A1 (en) 1993-06-18 1995-01-05 University Of Cincinnati Neuropeptide y antagonists and agonists
WO1995001352A1 (en) 1993-06-30 1995-01-12 Zeria Pharmaceutical Co., Ltd. Thiazolidine derivative and medicine containing the same
WO1995002601A1 (en) 1993-07-16 1995-01-26 Rhone-Poulenc Rorer S.A. IMIDAZO[1,2-a]PYRAZINE-4-ONE, PREPARATION THEREOF AND DRUGS CONTAINING SAME
WO1995002602A1 (en) 1993-07-16 1995-01-26 Rhone-Poulenc Rorer S.A. Imidazo(1,2-a)pyrazin-4-one derivatives for use as ampa and nmda receptor antagonists
WO1995012594A1 (en) 1993-11-05 1995-05-11 Rhone-Poulenc Rorer S.A. 7H-IMIDAZO(1,2-a)PYRAZINE-8-ONE NMDA RECEPTOR ANTAGONISTS
WO1995015310A1 (en) 1993-12-02 1995-06-08 Merrell Pharmaceuticals Inc. Prolyl endopeptidase inhibitors
WO1995026350A1 (en) 1994-03-28 1995-10-05 Rhone-Poulenc Rorer S.A. Imidazo(1,2-a)indeno(1,2-e)pyrazine-4-one derivatives and pharmaceutical compositions containing same
WO1995026349A1 (en) 1994-03-28 1995-10-05 Rhone-Poulenc Rorer S.A. INDENO[1,2-e]PYRAZINE-4-ONES, PREPARATION THEREOF AND DRUGS CONTAINING SAME
WO1995026342A1 (en) 1994-03-28 1995-10-05 Rhone-Poulenc Rorer S.A. 5H-INDENO[1,2-b]PYRAZINE-2,3-DIONE DERIVATIVES, PREPARATION THEREOF AND DRUGS CONTAINING SAME
WO1995026352A1 (en) 1994-03-28 1995-10-05 Rhone-Poulenc Rorer S.A. IMIDAZO[1,2-a]PYRAZINE-4-ONE DERIVATIVES, PREPARATION THEREOF AND DRUGS CONTAINING SAME
WO1995031986A1 (en) 1994-05-24 1995-11-30 Astra Aktiebolag Combination product of dichloroacetic acid and an nmda antagonist
WO1996008485A1 (en) 1994-09-13 1996-03-21 Pfizer Limited Quinoxalinedione nmda receptor antagonists
US5506256A (en) 1990-07-27 1996-04-09 Yoshitomi Pharmaceutical Industries, Ltd. Proline derivatives possessing prolyl endopeptidase-inhibitory activity
EP0709373A1 (en) 1993-07-23 1996-05-01 Zaidan Hojin Biseibutsu Kagaku Kenkyu Kai Novel pyrrolidine derivative
WO1996012490A1 (en) 1994-10-20 1996-05-02 Eli Lilly And Company Methods of inhibiting conditions associated with neuropeptide y
WO1996012489A1 (en) 1994-10-20 1996-05-02 Eli Lilly And Company Bicyclic neuropeptide y receptor antagonists
WO1996014318A1 (en) 1994-11-02 1996-05-17 Rhone-Poulenc Rorer S.A. SPIRO[HETEROCYCLE-IMIDAZO[1,2-a]INDENO[1,2-e]PYRAZINE]-4'-ONES, PREPARATION THEREOF AND DRUGS CONTAINING SAME
WO1996020946A1 (en) 1994-12-29 1996-07-11 Research Development Foundation Flavin adenine dinucleotide analogues, their pharmaceutical compositions, and their activity as monoamine oxidase inhibitors
WO1996021655A2 (en) 1995-01-11 1996-07-18 Hoechst Marion Roussel, Inc. Substituted oxazolidine calpain and/or cathepsin b inhibitors
WO1996022305A2 (en) 1995-01-12 1996-07-25 The Wellcome Foundation Limited Modified peptides
WO1996025435A1 (en) 1995-02-14 1996-08-22 Bayer Corporation MONOCLONAL ANTIBODY SPECIFIC FOR βA4 PEPTIDE
US5552411A (en) 1995-05-26 1996-09-03 Warner-Lambert Company Sulfonylquinolines as central nervous system and cardiovascular agents
EP0747378A1 (en) 1995-06-07 1996-12-11 Bristol-Myers Squibb Company Dihydropyridine NPY antagonists
EP0747356A1 (en) 1995-06-07 1996-12-11 Bristol-Myers Squibb Company Dihydropyridine NPY antagonists: piperazine derivatives
EP0747357A2 (en) 1995-06-07 1996-12-11 Bristol-Myers Squibb Company Dihydropyridine NPY antagonists: piperidine derivatives
WO1996040660A1 (en) 1995-06-07 1996-12-19 Pfizer Inc. Certain substituted benzylamine derivatives: a new class of neuropeptide y1 specific ligands
WO1997009308A1 (en) 1995-09-01 1997-03-13 Eli Lilly And Company Indolyl neuropeptide y receptor antagonists
WO1997012615A1 (en) 1995-10-05 1997-04-10 Warner-Lambert Company Benzimidazole derivatives as 15-lo inhibitors
WO1997013754A1 (en) 1995-10-11 1997-04-17 Pelayo Camps Garcia Novel polycyclic aminopyridine compounds as acetylcholinesterase inhibitors, preparation process and use thereof
WO1997019913A1 (en) 1995-11-30 1997-06-05 Dr. Karl Thomae Gmbh Amino acid derivatives, medicaments containing said compounds and methods of producing them
WO1997019911A1 (en) 1995-11-30 1997-06-05 Dr. Karl Thomae Gmbh Amino acid derivatives, pharmaceutical compositions containing these compounds and processes for preparing them
WO1997019914A1 (en) 1995-11-30 1997-06-05 Dr. Karl Thomae Gmbh Amino acid derivatives, medicaments containing said compounds and methods of producing said compounds
WO1997019682A1 (en) 1995-12-01 1997-06-05 Synaptic Pharmaceutical Corporation Aryl sulfonamide and sulfamide derivatives and uses thereof
WO1997020820A1 (en) 1995-12-01 1997-06-12 Novartis Ag Heteroaryl compounds
WO1997020823A2 (en) 1995-12-01 1997-06-12 Novartis Ag 2-amino quinazoline derivatives as npy receptor antagonists
WO1997020822A1 (en) 1995-12-01 1997-06-12 Novartis Ag Quinazolin-2,4-diazirines as npy receptor antagonist
WO1997020821A1 (en) 1995-12-01 1997-06-12 Novartis Ag Heteroaryl derivatives
WO1997023214A1 (en) 1995-12-22 1997-07-03 Warner-Lambert Company 4-substituted piperidine analogs and their use as subtype selective nmda receptor antagonists
WO1997023215A1 (en) 1995-12-22 1997-07-03 Warner-Lambert Company 2-substituted piperidine analogs and their use as subtype-selective nmda receptor antagonists
WO1997023216A1 (en) 1995-12-22 1997-07-03 Warner-Lambert Company 4-substituted piperidine analogs and their use as subtype selective nmda receptor antagonists
WO1997025041A1 (en) 1996-01-09 1997-07-17 Eli Lilly And Company Benzimidzolyl neuropeptide y receptor antagonists
US5663192A (en) 1994-10-20 1997-09-02 Eli Lilly And Company Heterocyclic neuropeptide Y receptor antagonists
WO1997032873A1 (en) 1996-03-09 1997-09-12 Pfizer Research And Development Company, N.V./S.A. Quinoxalinediones
WO1997034843A1 (en) 1996-03-22 1997-09-25 Libbey Glass Inc. Apparatus and method for forming a decorative pattern on glassware having an edge
WO1997038993A1 (en) 1996-04-12 1997-10-23 Hoechst Marion Roussel, Inc. Isatin derivatives as acetylcholinesterase inhibitors and analgesics
WO1997046250A1 (en) 1996-06-04 1997-12-11 Synaptic Pharmaceutical Corporation Methods of modifying feeding behavior, compounds useful in such methods, and dna encoding a hypothalamic atypical neuropeptide y/peptide yy receptor (y5)
WO1998001157A1 (en) 1996-07-05 1998-01-15 The Wwk Trust Compositions for the treatment of peripheral neuropathies containing antidepressants and/or monoamine oxidase inhibitors and/or vitamin b12 and/or precursors or inducers of a neurotransmitter
WO1998003493A1 (en) 1996-07-23 1998-01-29 Neurogen Corporation Certain substituted benzylamine derivatives; a new class of neuropeptide-y1 specific ligands
WO1998003492A1 (en) 1996-07-23 1998-01-29 Neurogen Corporation Certain substituted benzylamine derivatives; a new class of neuropeptide y1 specific ligands
WO1998003494A1 (en) 1996-07-23 1998-01-29 Neurogen Corporation Certain amido- and amino-substituted benzylamine derivatives; a new class of neuropeptite y1 specific ligands
WO1998005337A1 (en) 1996-08-01 1998-02-12 Cocensys, Inc. Use of gaba and nmda receptor ligands for the treatment of migraine headache
WO1998006703A1 (en) 1996-08-14 1998-02-19 Warner-Lambert Company 2-phenyl benzimidazole derivatives as mcp-1 antagonists
WO1998007420A1 (en) 1996-08-23 1998-02-26 Agouron Acquisition Corp. Neuropeptide-y ligands
WO1998010757A2 (en) 1996-09-11 1998-03-19 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services The use of functional n-methyl-d-aspartate antagonists to ameliorate or prevent aminoglycoside-induced ototoxicity
WO1998015647A1 (en) 1996-10-08 1998-04-16 Novartis Ag Modulation of apoptosis
WO1998030243A1 (en) 1997-01-08 1998-07-16 Warner-Lambert Company Acetylcholinesterase inhibitors in combination with muscarinic agonists for the treatment of alzheimer's disease
WO1998040102A1 (en) 1997-03-13 1998-09-17 The Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin Cytoprotective agents comprising monoamine oxidase inhibitors
WO1998044955A1 (en) 1997-04-09 1998-10-15 Mindset Ltd. Recombinant antibodies specific for beta-amyloid ends, dna encoding and methods of use thereof
WO1998046559A1 (en) 1997-04-16 1998-10-22 Arqule, Inc. SYNTHESIS AND USE OF α-KETOAMIDE DERIVATIVES AND ARRAYS
WO1998050075A1 (en) 1997-05-07 1998-11-12 Algos Pharmaceutical Corporation Cox-2 inhibitors in combination with nmda-blockers for treating pain
WO1998050044A1 (en) 1997-05-07 1998-11-12 Algos Pharmaceutical Corporation Composition and method combining an antidepressant with an nmda receptor antagonist, for treating neuropathic pain
US5847155A (en) 1990-06-04 1998-12-08 Pfizer Inc Aromatic pyrrolidine amide prolyl endopeptidase inhibitors
WO1999001416A2 (en) 1997-06-30 1999-01-14 Merz + Co. Gmbh & Co. 1-amino-alkylcyclohexane nmda receptor antagonists
WO1999007351A2 (en) 1997-08-07 1999-02-18 Zeneca Limited Indole derivatives and their use as mcp-1 antagonists
WO1999007413A1 (en) 1997-08-11 1999-02-18 Algos Pharmaceutical Corporation Substance p inhibitors in combination with nmda-blockers for treating pain
WO1999007359A1 (en) 1997-08-08 1999-02-18 Shire International Licensing B.V. Use of cholinesterase inhibitors for treating attention deficit disorders
WO1999013878A1 (en) 1997-09-18 1999-03-25 Astrazeneca Ab A COMBINATION OF A MONOAMINE OXIDASE INHIBITOR AND A h5-HT1B ANTAGONIST OR PARTIAL AGONIST
WO1999015498A1 (en) 1997-09-23 1999-04-01 Astrazeneca Ab New npy antagonists
WO1999027944A1 (en) 1997-12-02 1999-06-10 Neuralab Limited Prevention and treatment of amyloidogenic disease
WO1999045963A1 (en) 1998-03-13 1999-09-16 Algos Pharmaceutical Corporation Analgesic combination comprising nmda receptor antagonists and narcotic analgesics
WO1999046272A1 (en) 1998-03-09 1999-09-16 Fondatech Benelux N.V. Serine peptidase modulators
WO1999046991A1 (en) 1998-03-17 1999-09-23 University Of Maryland Biotechnology Institute Methods for treating hiv-associated dementia
WO1999047131A2 (en) 1998-03-16 1999-09-23 Merck Sharp & Dohme Limited Combination of a gaba-a alpha 5 inverse agonist and an acetylcholinesterase inhibitor
WO1999048891A1 (en) 1998-03-20 1999-09-30 Merck Patent Gmbh 1-(3-heteroarylpropyl- or -prop-2-enyl)-4-benzylpiperidines used as nmda receptor antagonists
WO1999053922A1 (en) 1998-04-21 1999-10-28 Algos Pharmaceutical Corporation Analgesic compositions comprising nmda-antagonists and abt-594
WO1999057119A1 (en) 1998-05-04 1999-11-11 Neotherapeutics, Inc. Novel dopamine-like 9-substituted hypoxanthine and methods of use
WO1999057120A1 (en) 1998-05-04 1999-11-11 Neotherapeutics, Inc. Novel serotonin-like 9-substituted hypoxanthine and methods of use
WO1999060024A1 (en) 1998-05-21 1999-11-25 The University Of Tennessee Research Corporation Methods for amyloid removal using anti-amyloid antibodies
WO1999067228A1 (en) 1998-06-24 1999-12-29 Aventis Pharmaceuticals Products Inc. Fluorophenyl resin compounds
WO1999067279A1 (en) 1998-06-24 1999-12-29 Probiodrug Gesellschaft für Arzneimittelforschung mbH Compounds of unstable dipeptidyl peptidase iv inhibitors
DE19828113A1 (en) 1998-06-24 2000-01-05 Probiodrug Ges Fuer Arzneim Prodrugs of Dipeptidyl Peptidase IV Inhibitors
WO2000000197A1 (en) 1998-06-26 2000-01-06 Warner-Lambert Company 4-benzyl piperidine alkylsulfoxide heterocycles and their use as subtype-selective nmda receptor antagonists
WO2000002549A2 (en) 1998-07-10 2000-01-20 Du Pont Pharmaceuticals Company Composition for and method of treating neurological disorders
WO2000007600A1 (en) 1998-08-07 2000-02-17 R.J. Reynolds Tobacco Company Pharmaceutical compositions for the prevention and treatment of central nervous system disorders
WO2000009483A2 (en) 1998-08-17 2000-02-24 Finetech Ltd. Process and intermediates for production of donepezil and related compounds
WO2000015205A2 (en) 1998-09-11 2000-03-23 Eisai Co., Ltd. Use of acetylcholinesterase inhibitors for the preparation of pharmaceutical compositions for the treatment of functional and/or organic pain syndromes
WO2000023057A2 (en) 1998-10-16 2000-04-27 Janssen Pharmaceutica N.V. Atypical antiphsychotic in combination with acetylcholinesterase inhibitor for improving cognition
WO2000029023A1 (en) 1998-11-12 2000-05-25 Algos Pharmaceutical Corporation Cox-2 inhibitors in combination with nmda-blockers for treating pain
WO2000030674A1 (en) 1998-11-26 2000-06-02 Ferring Bv Neuropeptide y y4 agents in the treatment of reproductive disorders
WO2000030446A1 (en) 1998-11-23 2000-06-02 Bonnie Davis Dosage formulations for acetylcholinesterase inhibitors
WO2000033840A1 (en) 1998-12-11 2000-06-15 Bonnie Davis Use of acetylcholinesterase inhibitors on the modulation of the hypothalamic-pituitary-gonadal axis
WO2000046195A1 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Anti-inflammatory indole derivatives
WO2000046197A1 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Indole derivatives and their use as mcp-1 receptor antagonists
WO2000046199A2 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Indole derivatives as anti-inflammation agents
WO2000046196A1 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Indole derivatives and their use as mcp-1 antagonists
WO2000046198A1 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Anti-inflammatory indole derivatives
US6114336A (en) 1996-10-23 2000-09-05 Sanofi Cosmetic composition containing a neuropeptide Y receptor antagonist
US6121311A (en) 1999-04-28 2000-09-19 Japan Tobacco Inc. Method for treating cocainism
WO2000056711A1 (en) 1999-03-23 2000-09-28 Sumitomo Pharmaceuticals Co., Ltd. Tricyclic indole-2-carboxylic acid compound used as nmda receptor antagonist
WO2000063250A1 (en) 1999-04-15 2000-10-26 Merck Frosst Canada & Co. Antibodies that recognize app cleaved by caspases and methods of use
WO2000068197A1 (en) 1999-05-05 2000-11-16 Ortho-Mcneil Pharmaceutical, Inc. 3a,4,5,9b-TETRAHYDRO-1H-BENZ[e]INDOL-2-YL AMINE-DERIVED NEUROPEPTIDE Y RECEPTORS LIGANDS USEFUL IN THE TREATMENT OF OBESITY AND OTHER DISORDERS
WO2000071144A1 (en) 1999-05-19 2000-11-30 Domer, Inc. Prolyl endopeptidase inhibitor
WO2000072880A2 (en) 1999-05-28 2000-12-07 Neuralab Limited Prevention and treatment of amyloidogenic disease
WO2000077178A1 (en) 1999-06-16 2000-12-21 Boston Biomedical Research Institute IMMUNOLOGICAL CONTROL OF β-AMYLOID LEVELS IN VIVO
WO2001000215A1 (en) 1999-06-25 2001-01-04 Wake Forest University Compositions for treating or preventing neurodegeneration and cognitive decline
WO2001010831A1 (en) 1999-08-06 2001-02-15 Grünenthal GmbH Substituted pyrrolidin-2,3,4-trion-3-oxime derivatives useful as nmda-receptor antagonists
WO2001010833A1 (en) 1999-08-06 2001-02-15 Grünenthal GmbH Substituted 1,5-dihydropyrrol-2-on derivatives as nmda receptor antagonists for the treatment of pain
WO2001012176A2 (en) 1999-08-16 2001-02-22 Sanofi-Synthelabo Use of monoamine oxidase inhibitors for the manufacture of drugs intended for the treatment of obesity
WO2001012598A2 (en) 1999-08-13 2001-02-22 The Trustees Of Columbia University In The City Of New York METHODS OF INHIBITING BINDING OF β-SHEET FIBRIL TO RAGE AND CONSEQUENCES THEREOF
WO2001026656A2 (en) 1999-10-11 2001-04-19 Societe De Conseils De Recherches Et D'applications Scientifiques (S.C.R.A.S.) 5-membered heterocycle derivatives and use thereof as monoamine oxidase inhibitors
WO2001032640A1 (en) 1999-11-01 2001-05-10 Merz Pharmaceuticals Gmbh 1-cyclic amino-alkylcyclohexane compounds, pharmaceutical compositions thereof, and their use as anticonvulsants
WO2001053255A1 (en) 2000-01-24 2001-07-26 Merck Sharp & Dohme Limited Gamma-secretase inhibitors
WO2001057226A1 (en) 2000-02-03 2001-08-09 Millennium Pharmaceuticals, Inc. Humanized anti-ccr2 antibodies and methods of use therefor
WO2001062801A2 (en) 2000-02-24 2001-08-30 Washington University Humanized antibodies that sequester amyloid beta peptide
WO2001066096A2 (en) 2000-03-06 2001-09-13 Immune Network Ltd. Compositions for prevention and treatment of dementia
WO2001066564A2 (en) 2000-03-03 2001-09-13 Merck Sharp & Dohme Limited Gamma-secretase inhibitors
WO2001077144A1 (en) 2000-04-07 2001-10-18 Merck Sharp & Dohme Limited Gamma-secretase inhibitors
WO2001078728A1 (en) 2000-04-13 2001-10-25 Eisai Co., Ltd. Acetylcholinesterase inhibitors containing 1-benzyl- pyridinium salts
WO2001081295A1 (en) 2000-04-26 2001-11-01 Warner-Lambert Company Cyclohexylamine derivative as subtype selective nmda receptor antagonists
WO2001085145A2 (en) 2000-05-09 2001-11-15 Pfizer Products Inc. A pharmaceutical composition and method of treatment of diseases of cognitive dysfunction in a mammal
WO2001092204A1 (en) 2000-06-01 2001-12-06 Warner-Lambert Company Cyclohexylamine derivatives as subtype selective nmda receptor antagonists
WO2001094321A1 (en) 2000-06-06 2001-12-13 Warner-Lambert Company Bicyclic cyclohexylamines and their use as nmda receptor antagonists
WO2001098262A1 (en) 2000-06-23 2001-12-27 Merck Sharp & Dohme Limited Amidine derivatives as selective antagonists of nmda receptors
WO2001098289A1 (en) 2000-06-22 2001-12-27 Pharmos Corporation Novel non-psychotropic cannabinoids
JP3255080B2 (en) 1997-05-28 2002-02-12 日新電機株式会社 Gas insulated switchgear
WO2002021509A1 (en) 2000-09-01 2002-03-14 Snap-On Technologies, Inc. Computer-implemented speech recognition system training
WO2002027418A2 (en) 2000-09-25 2002-04-04 Motorwiz, Inc. Model-based machine diagnostics and prognostics using theory of noise and communications
WO2002032412A2 (en) 2000-10-17 2002-04-25 Pfizer Products Inc. Combination use of acetylcholinesterase inhibitors and gabaa inverse agonists for the treatment of cognitive disorders
WO2002034718A1 (en) 2000-10-24 2002-05-02 Richter Gedeon Vegyeszeti Gyar Rt. Amide derivatives as nmda receptor antagonists
WO2002036555A1 (en) 2000-11-02 2002-05-10 Merck Sharp & Dohme Limited Sulfamides as gamma-secretase inhibitors
WO2002041842A2 (en) 2000-11-03 2002-05-30 Proteotech. Inc. Antibody pti-hs7 for treatment of alzheimer's disease and other amyloidoses and parkinson's disease
WO2002046237A2 (en) 2000-12-06 2002-06-13 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2002046222A2 (en) 2000-12-07 2002-06-13 Mario Chojkier Compositions and methods for diagnosing alzheimer's disease
US6426365B1 (en) 1997-02-12 2002-07-30 Japan Tobacco Inc. CETP activity inhibitors
WO2002060900A2 (en) 2001-01-31 2002-08-08 Telik, Inc. Antagonists of mcp-1 function and methods of use thereof
US6448229B2 (en) 2000-07-06 2002-09-10 Merck Sharp & Dohme Ltd. Gamma secretase inhibitors
WO2002070509A2 (en) 2001-03-01 2002-09-12 Telik, Inc. Antagonists of mcp-1 function and methods of use thereof
WO2002072542A2 (en) 2001-03-08 2002-09-19 Emory University Ph-dependent nmda receptor antagonists
WO2002074240A2 (en) 2001-03-16 2002-09-26 Cornell Research Foundation, Inc. Anti-amyloid antibody based diagnosis and treatment of a neurological disease or disorder
WO2002081463A1 (en) 2001-04-03 2002-10-17 Telik, Inc. Antagonists of mcp-1 function and methods of use thereof
WO2002088307A2 (en) 2001-04-30 2002-11-07 Eli Lilly And Company Humanized antibodies
WO2002088306A2 (en) 2001-04-30 2002-11-07 Eli Lilly And Company Humanized antibodies
WO2002094881A2 (en) 2001-05-18 2002-11-28 Krka Tovarna Zdravil, D.D., Novo Mesto Monoclonal antibody neutralising cathepsin b activity and uses thereof
WO2002096897A1 (en) 2001-05-30 2002-12-05 Neurologic, Inc. PHOSPHINYLMETHYL AND PHOSPHORYLMETHYL SUCCINIC AND GLUTARIC ACID ANALOGS AS β-SECRETASE INHIBITORS
WO2002098849A2 (en) 2001-06-01 2002-12-12 Elan Pharmaceuticals, Inc. Hydroxy alkyl amine derivatives as beta-secretase inhibitors and their use for the treatment of alzheimer’s disease and similar diseases
WO2003010159A1 (en) 2001-07-24 2003-02-06 Richter Gedeon Vegyészeti Gyár Rt. Piperidine derivatives as nmda receptor antagonists
WO2003012141A1 (en) 2001-07-31 2003-02-13 Takeda Chemical Industries, Ltd. Method of screening alzheimer’s disease-associated gene
WO2003014075A2 (en) 2001-08-03 2003-02-20 Schering Corporation Novel gamma secretase inhibitors
WO2003013527A1 (en) 2001-08-03 2003-02-20 Schering Corporation Sulfonamide derivatives as gamma secretase inhibitors
WO2003014162A1 (en) 2001-08-03 2003-02-20 Medical & Biological Laboratories Co., Ltd. ANTIBODY RECOGNIZING GM1 GANGLIOSIDE-BOUND AMYLOID β-PROTEIN AND DNA ENCODING THE ANTIBODY
WO2003016466A2 (en) 2001-08-17 2003-02-27 Eli Lilly And Company ANTI-Aβ ANTIBODIES
WO2003015691A2 (en) 2001-08-17 2003-02-27 Eli Lilly And Company RAPID IMPROVEMENT OF COGNITION IN CONDITIONS RELATED TO A$g(b)
WO2003020289A1 (en) 2001-08-30 2003-03-13 Ortho-Mcneil Pharmaceutical, Inc. Treatment of dementia and memory disorders with anticonvulsants and acetylcholinesterase inhibitors
WO2003037376A1 (en) 2001-11-02 2003-05-08 Kensuke Egashira Preventives and/or remedies for post-transplant arteriosclerosis as rejection of organ transplant
WO2003040183A2 (en) 2001-11-09 2003-05-15 The Genetics Company, Inc Compounds for the diagnosis/prevention/treatment of alzheimer's disease
WO2003039467A2 (en) 2001-11-02 2003-05-15 Diagenics International Corporation Monoclonal antibodies specific for beta-amyloid.
WO2003039454A2 (en) 2001-10-23 2003-05-15 Oklahoma Medical Research Foundation Beta-secretase inhibitors and methods of use
WO2003043987A2 (en) 2001-11-19 2003-05-30 Elan Pharmaceuticals, Inc. (4-phenyl) piperidin-3-yl-phenylcarboxylate derivatives and related compounds as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2003045128A2 (en) 2001-11-21 2003-06-05 New York University SYNTHETIC IMMUNOGENIC BUT NON-DEPOSIT-FORMING POLYPEPTIDES AND PEPTIDES HOMOLOGOUS TO AMYLOID β, PRION PROTEIN, AMYLIN, α-SYNUCLEIN, OR POLYGLUTAMINE REPEATS FOR INDUCTION OF AN IMMUNE RESPONSE THERETO
WO2003048204A1 (en) 2001-12-06 2003-06-12 Takeda Chemical Industries, Ltd. Alzheimer’s disease-associated gene and protein and use thereof
WO2003051374A2 (en) 2001-12-17 2003-06-26 New York State Office Of Mental Health SEQUESTRATION OF Aβ IN THE PERIPHERY IN THE ABSENCE OF IMMUNOMODULATING AGENT AS A THERAPEUTIC APPROACH FOR THE TREATMENT OR PREVENTION OF BETA-AMYLOID RELATED DISEASES
WO2003053368A2 (en) 2001-12-19 2003-07-03 Atherogenics, Inc. Chalcone derivatives and their use to treat diseases
WO2003055514A1 (en) 2001-12-21 2003-07-10 Antigenics Inc. Compositions comprising immunoreactive reagents and saponins, and methods of use thereof
WO2003057204A2 (en) 2002-01-08 2003-07-17 Nordic Bioscience A/S Modulation of iamt (pimt or pcmt) in immune system
WO2003059346A1 (en) 2002-01-18 2003-07-24 The Genetics Company Inc. Beta-secretase inhibitors
WO2003063760A2 (en) 2002-01-31 2003-08-07 Tel Aviv University Future Technology Development L.P. Peptides antibodies directed thereagainst and methods using same for diagnosing and treating amyloid-associated diseases
WO2003066592A1 (en) 2002-02-06 2003-08-14 Schering Corporation Gamma secretase inhibitors
WO2003070760A2 (en) 2002-02-20 2003-08-28 F. Hoffmann-La Roche Ag Anti-amyloid beta antibodies and their use
WO2003074081A1 (en) 2002-02-28 2003-09-12 Mindset Biopharmaceuticals Usa Inc. SPECIFIC ANTIBODIES TO AMYLOID β PEPTIDE, PHARMACEUTICAL COMPOSITIONS AND METHODS OF USE THEREOF
WO2003077858A2 (en) 2002-03-12 2003-09-25 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2003082820A1 (en) 2002-03-29 2003-10-09 Eisai Co., Ltd. (1-indanone)-(1,2,3,6-tetrahydropyridine) derivative
WO2003086310A2 (en) 2002-04-12 2003-10-23 Ramot At Tel Aviv University Ltd. Prevention of brain inflammation as a result of induced autoimmune response
WO2003089460A1 (en) 2002-04-19 2003-10-30 The Governing Council Of The University Of Toronto Immunological methods and compositions for the treatment of alzheimer's disease
WO2003091278A1 (en) 2002-04-24 2003-11-06 Hiroshi Mori Gamma-secretase inhibitors
WO2003091220A1 (en) 2002-04-26 2003-11-06 Schering Corporation Muscarinic antagonists
US6649196B2 (en) 2001-03-12 2003-11-18 Mayo Foundation For Medical Education And Research Methods of reducing β-amyloid polypeptides
WO2003099202A2 (en) 2002-05-17 2003-12-04 Merck & Co., Inc. Beta-secretase inhibitors
WO2003101458A1 (en) 2002-05-31 2003-12-11 H. Lundbeck A/S A combination of an nmda-antagonist and acetylcholine esterase inhibitors for the treatment of alzheimer's disease
WO2003104437A2 (en) 2002-06-11 2003-12-18 Northwestern University Anti-addl antibodies and uses thereof
WO2004000958A1 (en) 2002-06-19 2003-12-31 Surface Specialties, S.A. Semi-gloss powder coating compositions
WO2004009062A2 (en) 2002-07-19 2004-01-29 Khalid Iqbal NMDA RECEPTOR ANTAGONISTS AND THEIR USE IN INHIBITING ABNORMAL HYPERPHOSPHORYLATION OF MICROTUBULE ASSOCIATED PROTEIN tau
US6686449B2 (en) 2000-06-30 2004-02-03 Pharmacia & Upjohn Company Mutant presenilin 1 polypeptides
WO2004013098A1 (en) 2002-08-05 2004-02-12 Bristol-Myers Squibb Company Novel gamma-lactams as beta-secretase inhibitors
WO2004024770A1 (en) 2002-09-12 2004-03-25 Universidad De Zaragoza Polyclonal antibodies, preparation method thereof and use of same
WO2004024090A2 (en) 2002-09-12 2004-03-25 The Regents Of The University Of California Immunogens and corresponding antibodies specific for high molecular weight aggregation intermediates common to amyloids formed from proteins of differing sequence
WO2004024921A1 (en) 2002-09-12 2004-03-25 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute Human antihuman mcp-1 antibody and antibody fragment thereof
US6713276B2 (en) 2000-06-28 2004-03-30 Scios, Inc. Modulation of Aβ levels by β-secretase BACE2
WO2004026851A1 (en) 2002-09-20 2004-04-01 Axys Pharmaceuticals, Inc. 3-(3,5-disubstituted-4-hydroxyphenyl)propionamide derivatives as cathepsin b inhibitors
WO2004029629A1 (en) 2002-09-27 2004-04-08 Janssen Pharmaceutica N.V. N-11 truncated amyloid-beta nomoclonal antibodies, compositions, methods and uses
WO2004028522A1 (en) 2002-09-25 2004-04-08 Innovative Drug Delivery Systems, Inc. Analgesic compositions comprising nmda receptor antagonists and benzalkonium chloride
WO2004031400A2 (en) 2002-10-01 2004-04-15 Northwestern University Amyloid beta-derived diffusible ligands (addls), addl-surrogates, addl-binding molecules, and uses thereof
WO2004031139A1 (en) 2002-10-04 2004-04-15 Merck Sharp & Dohme Limited Cyclohexyl sulphones as gamma-secretase inhibitors
WO2004031137A1 (en) 2002-10-04 2004-04-15 Merck Sharp & Dohme Limited Cyclohexyl sulphone derivatives as gamma-secretase inhibitors
WO2004032868A2 (en) 2002-10-09 2004-04-22 Rinat Neuroscience Corp. Methods of treating alzheimer's disease using antibodies directed against amyloid beta peptide and compositions thereof
WO2004032929A2 (en) 2002-10-09 2004-04-22 Neuropharma, S.A. Dual binding site acetylcholinesterase inhibitors for the treatment of alzheimer’s disease
WO2004037234A2 (en) 2002-10-24 2004-05-06 Merz Pharma Gmbh & Co. Kgaa Combination therapy using 1-aminocyclohexane derivatives and acetylcholinesterase inhibitors
WO2004039773A2 (en) 2002-10-30 2004-05-13 Nordic Bioscience A/S Coumpounds modulating the activity of gapdh and/or iamt
WO2004039371A2 (en) 2002-10-29 2004-05-13 Pharmacia Corporation Compositions of cyclooxygenase-2 selective inhibitors and nmda receptor antagonists for the treatment or prevention of neuropathic pain
WO2004039370A1 (en) 2002-11-01 2004-05-13 Merck Sharp & Dohme Limited Sulfonamides, sulfamates and sulfamides as gamma-secretase inhibitors
WO2004043916A1 (en) 2002-11-12 2004-05-27 Merck & Co., Inc. Phenylcarboxamide beta-secretase inhibitors for the treatment of alzheimer's disease
WO2004044204A2 (en) 2002-11-06 2004-05-27 Institut Pasteur Variable fragments of single-chain camelide antibodies and uses thereof for diagnosing and treating various pathologies
WO2004056727A2 (en) 2002-12-19 2004-07-08 Atherogenics, Inc. Process of making chalcone derivatives
WO2004062625A2 (en) 2003-01-07 2004-07-29 Merck & Co., Inc. Macrocyclic beta-secretase inhibitors for treatment of alzheimer's disease
WO2004067561A1 (en) 2003-01-31 2004-08-12 Abbott Gmbh & Co. Kg Amyloid-$g(b)(1-42) oligomers, derivatives thereof, antibodies for the same, method for production and use therof
WO2004069826A1 (en) 2003-02-04 2004-08-19 F. Hoffmann-La Roche Ag Malonamide derivatives as gamma-secretase inhibitors
WO2004069182A2 (en) 2003-02-01 2004-08-19 Neuralab Limited Active immunization to generate antibodies to soluble a-beta
WO2004071408A2 (en) 2003-02-10 2004-08-26 Applied Molecular Evolution, Inc. Aβ BINDING MOLECULES
WO2004073630A2 (en) 2003-02-18 2004-09-02 Roskamp Research Llc Anti-angiogenic and anti-tumoral properties of beta and gamma secretase inhibitors
WO2004078908A2 (en) 2003-03-06 2004-09-16 Santhera Pharmaceuticals (Schweiz) Gmbh Alpha-keto carbonyl calpain inhibitors
WO2004080419A2 (en) 2003-03-12 2004-09-23 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2004084830A2 (en) 2003-03-21 2004-10-07 Buck Institute Method for treating alzheimer’s dementia
WO2004084884A1 (en) 2003-03-24 2004-10-07 The Chinese University Of Hong Kong Use of tanshinone derivates as cholinesterase inhibitors in treating related diseases
WO2004087158A2 (en) 2003-03-28 2004-10-14 Acadia Pharmaceuticals Inc. Muscarinic m1 receptor agonists for pain management
WO2004089351A2 (en) 2003-04-10 2004-10-21 Cambridge University Technical Services Ltd Treatment of progressive neurological disorders comprising a mao inhibitor (miclobemid) and an acetylcholinesterase inhibitor (tacrin)
WO2004089911A1 (en) 2003-04-10 2004-10-21 Merck Sharp & Dohme Limited Pyrazole derivatives as gamma-secretase inhibitors useful in the treatment of alzheimer’s disease
WO2004092189A1 (en) 2003-04-09 2004-10-28 Wyeth Derivatives of 2-(8,9-dioxo-2,6-diazabicyclo(5.2.0)non-1(7)-en-2-yl)alkyl phosphonic acid and their use as n-methyl-d-aspartate (nmda) recetor antagonists
WO2004098625A2 (en) 2003-05-05 2004-11-18 Probiodrug Ag Medical use of inhibitors of glutaminyl and glutamate cyclases
WO2004098591A2 (en) 2003-05-05 2004-11-18 Probiodrug Ag Inhibitors of glutaminyl cyclase and their use in the treatment of neurological diseases
WO2004098631A1 (en) 2003-05-08 2004-11-18 Universidad De Zaragoza Alzheimer's disease treatment method
WO2004101562A2 (en) 2003-05-13 2004-11-25 Schering Corporation Bridged n-arylsulfonylpiperidines as gamma-secretase inhibitors
WO2004101538A1 (en) 2003-05-16 2004-11-25 Merck Sharp & Dohme Limited Cyclohexyl sulphones as gamma-secretase inhibitors
WO2004108895A2 (en) 2003-05-30 2004-12-16 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2005000193A2 (en) 2003-06-30 2005-01-06 Tel Aviv University Future Technology Development L.P. Peptides antibodies directed thereagainst and methods using same for diagnosing and treating amyloid-associated diseases
WO2005000216A2 (en) 2003-05-27 2005-01-06 Forest Laboratories, Inc. Combination of an nmda receptor antagonist and a selective serotonin reuptake inhibitor for the treatment of depression and other mood disorders
WO2005004803A2 (en) 2003-07-01 2005-01-20 Merck & Co., Inc. Phenylcarboxylate beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005004802A2 (en) 2003-06-30 2005-01-20 Merck & Co., Inc. N-alkyl phenylcarboxamide beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005008250A1 (en) 2003-07-21 2005-01-27 Angiogenetics Sweden Ab Compounds and methods for promoting angiogenesis by using a gamma-secretase inhibitor or inhibiting the gamma-secretase pathway
WO2005007199A1 (en) 2003-07-16 2005-01-27 Rvx Therapeutics, Inc. COMPOUNDS AND METHODS FOR DOWNREGULATING THE EFFECTS OF TGF-β
WO2005007614A1 (en) 2003-07-03 2005-01-27 The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services 6011 Monoamine oxidase inhibitors
WO2005009421A2 (en) 2003-07-28 2005-02-03 Merz Pharma Gmbh & Co. Kgaa The use of 1-amino-alkylcyclohexane compounds in the treatment of pain hypersensitivity
WO2005011599A2 (en) 2003-08-01 2005-02-10 Northwestern University Antibodies specific for toxic amyloid beta protein oligomers
WO2005014553A1 (en) 2003-08-05 2005-02-17 Merck Sharp & Dohme Limited Novel gamma-secretase inhibitors
WO2005018545A2 (en) 2003-08-14 2005-03-03 Merck & Co., Inc. Macrocyclic beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005018424A2 (en) 2003-08-18 2005-03-03 Research Foundation For Mental Hygiene, Inc. Antibodies specific for fibrillar amyloid and a procedure to detect fibrillar amyloid deposits
WO2005023858A1 (en) 2003-09-05 2005-03-17 Cellzome Ag Protein complexes associated with app-processing
WO2005025516A2 (en) 2003-09-12 2005-03-24 The Regents Of The University Of California Monoclonal antibodies specific for conformational epitopes of prefibrillar aggregates
WO2005025616A1 (en) 2003-09-09 2005-03-24 Takeda Pharmaceutical Company Limited Use of antibody
WO2005028440A1 (en) 2003-09-16 2005-03-31 Schering Corporation Novel gamma secretase inhibitors
WO2005027975A1 (en) 2003-09-22 2005-03-31 Pfizer Limited Combinations of alpha-2-delta ligands and acetylcholinesterase inhibitors
WO2005028511A2 (en) 2003-03-28 2005-03-31 Centocor, Inc. Anti-amyloid antibodies, compositions, methods and uses
WO2005030731A1 (en) 2003-09-24 2005-04-07 Merck Sharp & Dohme Limited Gamma-secretase inhibitors
WO2005032471A2 (en) 2003-10-03 2005-04-14 Merck & Co., Inc. Benzylether and benzylamino beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005035522A1 (en) 2003-10-08 2005-04-21 Pfizer Japan, Inc. 1-‘2-(4-hydroxyphenyl)-2-hydroxyethyl!-piperidin-4-ol compounds as nmda receptor antagonists
WO2005039580A1 (en) 2003-10-16 2005-05-06 Boehringer Ingelheim International Gmbh Pharmaceutical composition comprising a monoamine neurotransmitter re-uptake inhibitor and an acetylcholinesterase inhibitor
WO2005040126A1 (en) 2003-10-06 2005-05-06 F. Hoffman-La Roche Ag Substituted dibenzo-azepine and benzo-diazepine derivatives useful as gamma-secretase inhibitors
WO2005044830A1 (en) 2003-11-11 2005-05-19 F. Hoffmann-La Roche Ag Phosphinic acids derivatives, beta-secretase inhibitors for the treatment of alzheimer’s disease
WO2005051914A1 (en) 2003-11-24 2005-06-09 Merck & Co., Inc. Benzylether and benzylamino beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005055996A1 (en) 2003-12-05 2005-06-23 Forest Laboratories, Inc. Memantine for the prevention or reduction of suicidality and for treatment of major depression associated with suicidality
WO2005065195A2 (en) 2003-12-19 2005-07-21 Merck & Co., Inc. Phenylamide and pyridylamide beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005070429A1 (en) 2004-01-22 2005-08-04 Neurosearch A/S Pharmaceutical composition comprising a monoamine neurotransmitter re-uptake inhibitor and an n-methyl-d-aspartate (nmda) receptors antagonist
WO2005072705A1 (en) 2004-01-29 2005-08-11 Neuromolecular, Inc. Combination of a nmda receptor antagonist and a mao-inhibitor or a gadpf-inhibitor for the treatment of central nervous system-related conditions
WO2005075436A2 (en) 2004-02-05 2005-08-18 Probiodrug Ag Novel inhibitors of glutaminyl cyclase
WO2005080435A1 (en) 2004-02-20 2005-09-01 Immuno-Biological Laboratories Co., Ltd. Monoclonal antibody and use thereof
WO2005079789A1 (en) 2004-02-17 2005-09-01 Axonyx, Inc. Combinatorial therapy with an acetylcholinesterase inhibitor and (3ar)-1,3a,8-trimethyl-1,2,3,3a,8,8a-hexahydropyrrolo[2,3-b]indol-5-yl phenylcarbamate
WO2005079756A2 (en) 2004-02-13 2005-09-01 Neuromolecular, Inc. Combination of a nmda receptor antagonist and an anti-depressive drug mao-inhibitor or a gadph-inhibitor for the treatment of psychiatric conditions
WO2005079779A1 (en) 2003-10-22 2005-09-01 Merz Pharma Gmbh & Co. Kgaa THE USE OF 1-AMINOCYCLOHEXANE DERIVATIVES TO MODIFY DEPOSITION OF FIBRILLOGENIC Aß PEPTIDES IN AMYLOIDOPATHIES
WO2005081872A2 (en) 2004-02-20 2005-09-09 Ac Immune Sa Methods and compositions comprising supramolecular constructs
WO2005092009A2 (en) 2004-03-19 2005-10-06 Axonyx, Inc. Acetylcholinesterase inhibitors and n-methyl-d-aspartate antagonists useful in the treatment of cognitive disorders
WO2005097768A2 (en) 2004-04-05 2005-10-20 Schering Corporation Novel gamma secretase inhibitors
WO2005097103A2 (en) 2004-04-01 2005-10-20 Axys Pharmaceuticals, Inc. Diabetes and metabolic syndrome therapy utilizing cathepsin b inhibitors
WO2005103020A1 (en) 2004-04-20 2005-11-03 Merck & Co., Inc. 1,3,5-substituted phenyl derivative compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005102390A2 (en) 2004-04-22 2005-11-03 Pfizer Japan, Inc. Combinations comprising alpha-2-delta ligands and nmda receptor antagonists
WO2005103043A1 (en) 2004-04-20 2005-11-03 Merck & Co., Inc. 2, 4, 6-substituted pyridyl derivative compounds useful as beta-secretase inhibitors for the treatment of alzheimer’s disease
WO2005105133A2 (en) 2004-04-23 2005-11-10 Massachusetts Eye And Ear Infirmary Methods and compositions for preserving the viability of photoreceptor cells
WO2005105998A1 (en) 2004-04-27 2005-11-10 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute HUMAN ANTIAMYLOID β PEPTIDE ANTIBODY AND ANTIBODY FRAGMENT THEREOF
WO2005113484A1 (en) 2004-05-13 2005-12-01 Merck & Co., Inc. Phenyl carboxamide compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005120571A2 (en) 2004-06-07 2005-12-22 Ramot At Tel Aviv University Ltd. Method of passive immunization against disease or disorder characterized by amyloid aggregation with diminished risk of neuroinflammation
WO2005123775A1 (en) 2004-06-21 2005-12-29 Bioarctic Neuroscience Ab Antibodies specific for soluble amyloid beta peptide protofibrils and uses thereof
US6982264B2 (en) 2001-06-27 2006-01-03 Elan Pharmaceuticals, Inc. Substituted alcohols useful in treatment of Alzheimer's disease
WO2006002004A1 (en) 2004-06-15 2006-01-05 Merck & Co., Inc. Pyrrolidin-3-yl compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006004880A2 (en) 2004-06-30 2006-01-12 Schering Corporation Substituted n-arylsulfonylheterocyclic amines as gamma-secretase inhibitors
WO2006008661A2 (en) 2004-07-19 2006-01-26 Neurochem (International) Limited Diagnostic methods of multiple organ amyloidosis
US6992081B2 (en) 2000-03-23 2006-01-31 Elan Pharmaceuticals, Inc. Compounds to treat Alzheimer's disease
WO2006010965A1 (en) 2004-07-29 2006-02-02 Richter Gedeon Vegyészeti Gyár Rt. Indole-2 -carboxamidine derivatives as nmda receptor antagonists
WO2006014478A1 (en) 2004-07-02 2006-02-09 Northwestern University MONOLOCAL ANTIBODIES THAT TARGET PATHOLOGICAL ASSEMBLIES OF AMYLOID β (ABETA)
WO2006014638A2 (en) 2004-07-19 2006-02-09 The General Hospital Corporation ANTIBODIES TO CROSS-LINKED AMYLOID β OLIGOMERS
WO2006014762A1 (en) 2004-07-22 2006-02-09 Schering Corporation Substituted amide beta secretase inhibitors
WO2006014944A1 (en) 2004-07-28 2006-02-09 Schering Corporation Macrocyclic beta-secretase inhibitors
WO2006016644A1 (en) 2004-08-11 2006-02-16 Mitsubishi Chemical Corporation Antibody and utilization of the same
WO2006021413A1 (en) 2004-08-25 2006-03-02 Santhera Pharmaceuticals (Schweiz) Ag Alpha-keto carbonyl calpain inhibitors
WO2006021409A1 (en) 2004-08-25 2006-03-02 Santhera Pharmaceuticals (Schweiz) Ag Alpha-keto carbonyl calpain inhibitors
WO2006026204A2 (en) 2004-08-26 2006-03-09 Bristol-Myers Squibb Company Novel gamma-lactams as beta-secretase inhibitors
WO2006026408A2 (en) 2004-08-27 2006-03-09 Wyeth Research Ireland Limited Production of anti-amyloid beta antibodies
WO2006029850A1 (en) 2004-09-14 2006-03-23 The Genetics Company, Inc. Hydrazone derivatives and their use as beta secretase inhibitors
WO2006034277A1 (en) 2004-09-17 2006-03-30 Comentis, Inc. Bicyclic compounds which inhibit beta-secretase activity and methods of use thereof
WO2006034296A2 (en) 2004-09-17 2006-03-30 Comentis, Inc. Amino-containing compounds which inhibit memapsin 2 beta-secretase activity and methods of use thereof
WO2006036291A2 (en) 2004-07-30 2006-04-06 Rinat Neuroscience Corp. Antibodies directed against amyloid-beta peptide and methods using same
WO2006039470A2 (en) 2004-09-29 2006-04-13 Centocor, Inc. Anti- amyloid antibodies, compositions, methods and uses
US7030239B2 (en) 2000-03-23 2006-04-18 Elan Pharmaceuticals, Inc. Compounds to treat Alzheimer's disease
WO2006039807A1 (en) 2004-10-15 2006-04-20 Biopharmacopae Design International Inc. Methods and therapeutic compositions comprising plant extracts for the treatment of cancer
WO2006042103A2 (en) 2004-10-05 2006-04-20 Axys Pharmaceuticals, Inc. Reversible inhibitors of cathepsin b
WO2006040688A2 (en) 2004-10-12 2006-04-20 Ernir Snorrason Inhibitors of acetylcholinesterase for treating skin diseases
US7034182B2 (en) 2000-06-30 2006-04-25 Elan Pharmaceuticals, Inc. Compounds to treat Alzheimer's disease
WO2006044497A2 (en) 2004-10-13 2006-04-27 Merck & Co., Inc. Spiropiperidine compounds useful as beta-secretase inhibitors for the treatment of alzhermer’s disease
WO2006046644A1 (en) 2004-10-28 2006-05-04 Sanko Junyaku Co., Ltd. Method of examining alzheimer’s disease and diagnostic reagent
WO2006055434A2 (en) 2004-11-17 2006-05-26 Merck & Co., Inc. Macrocyclic tertiary amine beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006055178A2 (en) 2004-10-25 2006-05-26 Merck & Co., Inc. Anti-addl antibodies and uses thereof
WO2006057983A1 (en) 2004-11-23 2006-06-01 Merck & Co., Inc. Macrocyclic aminopyridyl beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006058059A2 (en) 2004-11-23 2006-06-01 Neuromolecular Pharmaceuticals, Inc. Composition comprising a sustained release coating or matrix and an nmda receptor antagonist, method for administration such nmda antagonist to a subject
WO2006057945A2 (en) 2004-11-23 2006-06-01 Merck & Co., Inc. 2,3,4,6-substituted pyridyl derivative compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006058236A2 (en) 2004-11-24 2006-06-01 Neuromolecular Pharmaceuticals, Inc. Composition comprising an nmda receptor antagonist and levodopa and use thereof for treating neurological disease
WO2006058720A2 (en) 2003-11-03 2006-06-08 Probiodrug Ag Novel compounds for the treatment of neurological disorders
WO2006060473A2 (en) 2004-12-03 2006-06-08 Mucosal Therapeutics Llc Methods of treatment of injured or diseased joints with lubricin compositions
WO2006060109A1 (en) 2004-10-29 2006-06-08 Merck & Co., Inc. 2-aminopyridine compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006066089A1 (en) 2004-12-15 2006-06-22 Neuralab Limited Humanized amyloid beta antibodies for use in improving cognition
WO2006066233A1 (en) 2004-12-15 2006-06-22 Neuralab Limited An immunoprecipitation-based assay for predicting in vivo efficacy of beta-amyloid antibodies
WO2006066049A2 (en) 2004-12-15 2006-06-22 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2006066171A1 (en) 2004-12-15 2006-06-22 Neuralab Limited Amyloid βετα antibodies for use in improving cognition
WO2006070394A1 (en) 2004-12-28 2006-07-06 Council Of Scientific And Industrial Research Substituted carbamic acid quinolin-6-yl esters useful as acetylcholinesterase inhibitors
WO2006071274A2 (en) 2004-12-23 2006-07-06 Voyager Pharmaceutical Corporation Leuprolide acetate and acetylcholinesterase inhibitors or nmda receptor antagonists for the treatment of alzheimer’s disease
WO2006074265A2 (en) 2005-01-06 2006-07-13 Merck & Co., Inc. Drug combination therapy and pharmaceutical compositions for treating inflammatory disorders
WO2006078576A2 (en) 2005-01-19 2006-07-27 Merck & Co., Inc. Aminomethyl beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006081171A1 (en) 2005-01-24 2006-08-03 Amgen Inc. Humanized anti-amyloid antibody
WO2006085961A2 (en) 2004-06-30 2006-08-17 Centocor, Inc. Anti-mcp-1 antibodies, compositions, methods and uses
WO2006091988A1 (en) 2005-02-28 2006-08-31 Thomas Christian Lines Composition for treating mental health disorders
WO2006094674A1 (en) 2005-03-07 2006-09-14 Michael Hermanussen Nmda receptor antagonists in the medical intervention of metabolic disorders
WO2006095041A1 (en) 2005-03-09 2006-09-14 Consejo Superior De Investigaciones Científicas Method for the in vitro diagnosis of alzheimer's disease using a monoclonal antibody
WO2006097624A1 (en) 2005-03-17 2006-09-21 Sanofi-Aventis 7-(2-(4-(3-trifluoromethyl-phenyl)-1,2,3,6-tetrahydro-pyrid-1-yl)ethyl) isoquinoline besylate salt, preparation and therapeutic use thereof
WO2006099352A1 (en) 2005-03-10 2006-09-21 Bristol-Myers Squibb Company Novel isophthalates as beta-secretase inhibitors
WO2006103116A1 (en) 2005-04-01 2006-10-05 Biotherapix Molecular Medicines S.L.U. Human antibodies with beta-amyloid peptide-binding capacity and their applications
WO2006116435A2 (en) 2005-04-27 2006-11-02 Novartis Ag Methods of treating atherosclerosis
WO2006118959A2 (en) 2005-04-29 2006-11-09 Rinat Neuroscience Corp. Antibodies directed against amyloid-beta peptide and methods using same
WO2006120104A1 (en) 2005-04-11 2006-11-16 Probiodrug Ag Inhibitors of prolyl endopeptidase
WO2006125202A2 (en) 2005-05-19 2006-11-23 Centocor, Inc. Anti- mcp-1 antibodies, compositions, methods and uses
WO2006137354A1 (en) 2005-06-21 2006-12-28 Medical & Biological Laboratories Co., Ltd. Antibody having inhibitory effect on amyloid fibril formation
WO2007068412A2 (en) 2005-12-12 2007-06-21 Ac Immune Sa A beta 1-42 specific monoclonal antibodies with therapeutic properties
WO2007068411A2 (en) 2005-12-12 2007-06-21 Ac Immune S.A. Therapeutic vaccine
WO2008011348A2 (en) 2006-07-14 2008-01-24 Ac Immune S.A. Humanized antibody against amyloid beta
EP2011349A2 (en) 2006-03-17 2009-01-07 Vodafone Group PLC Improvements in an ehspa architecture
JP4208299B2 (en) 1998-08-19 2009-01-14 東レ株式会社 Polyester film for metal plate lamination molding
JP4211648B2 (en) 2004-03-22 2009-01-21 日本電気株式会社 Software installation method and system
JP4235162B2 (en) 2004-11-18 2009-03-11 日本電信電話株式会社 Image encoding apparatus, image encoding method, image encoding program, and computer-readable recording medium

Family Cites Families (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS62114957A (en) 1985-11-13 1987-05-26 Suntory Ltd Novel pyrrolidine derivative having prolylendopeptidase inhibiting action its production and use thereof
JPH0714878B2 (en) 1985-11-14 1995-02-22 サントリー株式会社 Prolyl endopeptidase inhibitor containing pyrrolidine amide as an active ingredient
JPS63162672A (en) 1986-12-25 1988-07-06 Ono Pharmaceut Co Ltd Novel prolinal derivative, its production and antiamnestic agent containing said derivative
JPH089591B2 (en) 1986-12-29 1996-01-31 小野薬品工業株式会社 Novel prolinal derivative
JP2528343B2 (en) 1987-02-04 1996-08-28 小野薬品工業株式会社 Novel proline derivative
US5100909A (en) * 1988-07-25 1992-03-31 The Upjohn Company Acetylenic imidazoles having central nervous system activity
JPH082791B2 (en) 1989-07-24 1996-01-17 キッセイ薬品工業株式会社 Amnesia treatment
JPH03255080A (en) 1990-03-05 1991-11-13 Yoshitomi Pharmaceut Ind Ltd Benzene compound
JPH04235162A (en) 1990-08-09 1992-08-24 Zeria Pharmaceut Co Ltd Novel succinamide derivative and drug containing the same
JPH04208299A (en) 1990-11-30 1992-07-29 Ajinomoto Co Inc Prolyl endopeptidase-inhibiting peptide
JPH05201970A (en) 1992-01-24 1993-08-10 Japan Tobacco Inc New proline derivative
JP3318622B2 (en) 1992-05-27 2002-08-26 独立行政法人産業技術総合研究所 Prolyl endopeptidase inhibitor
JPH06116284A (en) 1992-10-02 1994-04-26 Yamanouchi Pharmaceut Co Ltd New peptide
JPH06192298A (en) 1992-12-24 1994-07-12 Mitsui Toatsu Chem Inc Novel function peptide
JPH06234693A (en) 1993-02-09 1994-08-23 Snow Brand Milk Prod Co Ltd New isotetracenone-based substance and its production
JPH07267988A (en) 1994-03-31 1995-10-17 Yamanouchi Pharmaceut Co Ltd New peptide
JP3727383B2 (en) 1995-07-31 2005-12-14 月桂冠株式会社 Prolyl endopeptidase inhibitor
JPH09157253A (en) 1995-12-12 1997-06-17 Yamanouchi Pharmaceut Co Ltd New amino acid derivative
AU2764797A (en) * 1996-05-14 1997-12-05 Novo Nordisk A/S Somatostatin agonists and antagonists
JP3880664B2 (en) 1996-09-04 2007-02-14 月桂冠株式会社 Prolyl endopeptidase inhibitory peptide
US6316449B1 (en) 1999-07-08 2001-11-13 Millennium Pharmaceuticals, Inc. Chemokine receptor antagonists
CN1157388C (en) * 2001-05-29 2004-07-14 北京大学 Piperazine dithioformates compounds, their preparation method and application in cancer-resisting medicine
CA2458029A1 (en) * 2001-09-13 2003-03-20 Boehringer Ingelheim Pharmaceuticals, Inc. Methods of treating cytokine mediated diseases
US7067517B2 (en) * 2001-12-14 2006-06-27 Nero Nordisk A/S Use of compounds for decreasing activity of hormone-sensitive lipase
US7732162B2 (en) * 2003-05-05 2010-06-08 Probiodrug Ag Inhibitors of glutaminyl cyclase for treating neurodegenerative diseases
EP1622870A2 (en) * 2003-05-05 2006-02-08 Prosidion Ltd. Glutaminyl based dp iv-inhibitors
JP5707014B2 (en) * 2003-10-15 2015-04-22 プロビオドルグ エージー Use of glutaminyl and glutamate cyclase effectors

Patent Citations (444)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS6137764B2 (en) 1980-08-14 1986-08-26 Tokyo Shibaura Electric Co
JPS6469B2 (en) 1981-05-25 1989-01-05 Hochiki Co
EP0117462A2 (en) 1983-02-28 1984-09-05 American Cyanamid Company N-(2-4-(1H-imidazol-1-yl)alkyl)arylamides
JPH049367B2 (en) 1984-02-08 1992-02-20
JPH0525125B2 (en) 1984-07-16 1993-04-12 Shin Meiwa Ind Co Ltd
US4743616A (en) 1984-07-31 1988-05-10 Suntory Limited Novel biologically active compound having anti-prolyl endopeptidase activity
EP0172458A2 (en) 1984-07-31 1986-02-26 Suntory Limited Novel biologically active compound having anti-prolyl endopeptidase activity
JPH0356486B2 (en) 1984-08-22 1991-08-28
JPH0331298B2 (en) 1984-09-18 1991-05-02 Sanyo Electric Co
EP0201742A2 (en) 1985-04-16 1986-11-20 Suntory Limited N-Acylpyrrolidine derivatives, processes for preparing them, pharmaceutical composition and use
EP0201743A2 (en) 1985-04-16 1986-11-20 Suntory Limited Dipeptide derivatives of fatty acids, process for preparing them, pharmaceutical composition and use
US4873342A (en) 1985-04-16 1989-10-10 Suntory Limited Dipeptide derivative and synthesis and use thereof
US4772587A (en) 1985-04-16 1988-09-20 Suntory Limited Dipeptide derivative of fatty acid
EP0201741A2 (en) 1985-04-16 1986-11-20 Suntory Limited Dipeptide derivatives, processes for preparing them, pharmaceutical composition and use
EP0224272A1 (en) 1985-11-29 1987-06-03 Suntory Limited Pyrrolidinylamide ester derivative having anti-prolyl endopeptidase activity, its synthesis and use and a pharmaceutical composition containing it
US4757083A (en) 1985-11-29 1988-07-12 Suntory Limited Novel pyrrolidinylamide ester derivatives having anti-prolyl endopeptidase activity and synthesis and use thereof
US4826870A (en) 1986-02-04 1989-05-02 Suntory Limited Pyrrolidineamide derivative of acylamino acid and pharmaceutical containing the same
EP0232849A2 (en) 1986-02-04 1987-08-19 Suntory Limited Pyrrolidineamide derivative of acylamino acid, pharmaceutical composition and use
US5198458A (en) 1986-02-04 1993-03-30 Suntory Limited Pyrrolidineamide derivatives of acylamino acid and pharmaceutical composition containing the same
EP0253310A2 (en) 1986-07-11 1988-01-20 E.I. Du Pont De Nemours And Company Angiotensin II receptor blocking imidazoles
JPH0515314B2 (en) 1986-09-30 1993-03-01 Kogyo Gijutsuin
US4810721A (en) 1986-11-18 1989-03-07 Suntory Limited Pyrrolidineamide derivative having anti-prolyl endopeptidase
EP0268281A2 (en) 1986-11-18 1988-05-25 Suntory Limited Pyrrolidineamide derivative having anti-prolyl endopeptidase activity, compositions comprising the same, processes for the preparation of the same, and the use of the same for the preparation of a medicament of therapeutic value
US4956380A (en) 1986-11-20 1990-09-11 Ono Pharmaceutical Co., Ltd. Prolinal compounds useful in treating amnesia
US5100904A (en) 1986-11-20 1992-03-31 Ono Pharmaceutical Co., Ltd. Prolinal compounds which are useful in treating amnesia
US5254550A (en) 1986-11-20 1993-10-19 Ono Pharmaceutical Co., Ltd. Prolinal derivatives and pharmaceutical compositions thereof
EP0268190A1 (en) 1986-11-20 1988-05-25 Ono Pharmaceutical Co., Ltd. Prolinal derivatives
US5340832A (en) 1986-11-20 1994-08-23 Ono Pharmaceutical Co., Ltd. Prolinal derivatives useful for treating amnesia
US5112847A (en) 1986-12-29 1992-05-12 Ono Pharmaceutical Co., Ltd. Prolinal derivatives having inhibitory activity on prolyl endopeptidase
EP0275482A2 (en) 1986-12-29 1988-07-27 Ono Pharmaceutical Co., Ltd. Proline derivatives
US4983624A (en) 1986-12-29 1991-01-08 Ono Pharmaceutical Co., Ltd Novel prolinal derivatives
US5262431A (en) 1986-12-29 1993-11-16 Ono Pharmaceutical Co., Ltd. Prolinal derivatives and pharmaceutical compositions thereof
US4977180A (en) 1987-02-04 1990-12-11 Ono Pharmaceutical Co., Ltd. Novel prolinal derivatives
EP0277588A1 (en) 1987-02-04 1988-08-10 Ono Pharmaceutical Co., Ltd. Prolinal derivatives
US5091406A (en) 1987-02-04 1992-02-25 Ono Pharmaceutical Co., Ltd. Prolinal derivatives
US4857537A (en) 1987-02-23 1989-08-15 Ono Pharmaceutical Co., Ltd. Novel thiazolidine derivatives
EP0280956A1 (en) 1987-02-23 1988-09-07 Ono Pharmaceutical Co., Ltd. Thiazolidine derivatives
EP0461677A1 (en) 1987-02-23 1991-12-18 Ono Pharmaceutical Co., Ltd. Novel thiazolidine derivatives
JPS6442465A (en) 1987-08-07 1989-02-14 Wakunaga Pharma Co Ltd N-acylprolylpyrrolidine derivative, production and use thereof
EP0303434A1 (en) 1987-08-08 1989-02-15 Kissei Pharmaceutical Co. Ltd. Thiazolidine compounds
JPS6468396A (en) 1987-09-10 1989-03-14 Yakult Honsha Kk Novel peptide and amnesia alleviating drug comprising said peptide as active ingredient
WO1989006242A1 (en) 1987-10-08 1989-07-13 The Mclean Hospital Corporation Antibodies to a4 amyloid peptide
JPH01143897A (en) 1987-11-30 1989-06-06 Kissei Pharmaceut Co Ltd Thiazolidine derivative
JPH01250370A (en) 1987-12-23 1989-10-05 Zeria Pharmaceut Co Ltd Novel amino acid imide derivative, its production and use thereof
JPH01226880A (en) 1988-03-07 1989-09-11 Kissei Pharmaceut Co Ltd Thiazolidine derivative
EP0345428A1 (en) 1988-04-08 1989-12-13 Ono Pharmaceutical Co., Ltd. Anti-amnesic pyrrolidine derivatives
US5328899A (en) 1988-07-15 1994-07-12 The Salk Institute For Biological Studies NPY peptide analogs
EP0355793A2 (en) 1988-08-26 1990-02-28 Merrell Pharmaceuticals Inc. Neuropeptide Y agonists and partial agonists
EP0355794A2 (en) 1988-08-26 1990-02-28 Merrell Dow Pharmaceuticals Inc. Neuropeptide Y antagonists
JPH02275858A (en) 1988-09-14 1990-11-09 Yoshitomi Pharmaceut Ind Ltd Pyridine compound
US5028604A (en) 1988-12-08 1991-07-02 Zeria Pharmaceutical Co., Ltd. Condensed benzene derivative
EP0372484A2 (en) 1988-12-08 1990-06-13 Zeria Pharmaceutical Co., Ltd. Condensed benzene derivative
JPH02207070A (en) 1989-02-07 1990-08-16 Zeria Pharmaceut Co Ltd Amide acid imide derivative, drug containing same and intermediate for producing the compound
US5118811A (en) 1989-04-13 1992-06-02 Japan Tobacco Inc. Amino acid derivatives possessing prolyl endopeptidase-inhibitory activities
WO1990012871A1 (en) 1989-04-14 1990-11-01 Research Foundation For Mental Hygiene, Inc. Cerebrovascular amyloid protein-specific monoclonal antibody sv17-6e10
WO1990012870A1 (en) 1989-04-14 1990-11-01 Research Foundation For Mental Hygiene, Inc. Monoclonal antibody to amyloid peptide
WO1990014840A1 (en) 1989-06-06 1990-12-13 California Biotechnology Inc. Recombinant alzheimer's amyloid protein
EP0403159A2 (en) 1989-06-14 1990-12-19 Smithkline Beecham Corporation Imidazolyl-alkenoic acids
DE3939797A1 (en) 1989-12-01 1991-06-06 Basf Ag NEW PEPTIDES DERIVED FROM NEUROPEPTIDE Y
WO1991010664A1 (en) 1990-01-12 1991-07-25 American Home Products Corporation PYRIDAZINO[4,5-b]INDOLIZINES
EP0443983A1 (en) 1990-02-19 1991-08-28 Ciba-Geigy Ag Acyl compounds
EP0454511A1 (en) 1990-03-20 1991-10-30 Sanofi N-substituted heterocycle derivatives, their preparation, compositions containing them
EP0451547A1 (en) 1990-03-22 1991-10-16 Bristol-Myers Squibb Company 1,4,8-Triazacyclotridecane derivatives having prolyl endopeptidase inhibiting activity
US5073549A (en) 1990-03-22 1991-12-17 Bristol-Myers Squibb Company BU-4164E - A and B, prolyl endopeptidase inhibitors and their methods of use
US4999349A (en) 1990-03-22 1991-03-12 Bristol-Myers Squibb Co. BU-4164E - A and B, prolyl endopeptidase inhibitors
EP0459136A1 (en) 1990-04-27 1991-12-04 Takeda Chemical Industries, Ltd. Benzimidazole derivatives, their production and use
US5847155A (en) 1990-06-04 1998-12-08 Pfizer Inc Aromatic pyrrolidine amide prolyl endopeptidase inhibitors
WO1991018877A1 (en) 1990-06-07 1991-12-12 Zeria Pharmaceutical Co., Ltd. Novel arylalkanoylamine derivative and drug containing the same
US5407950A (en) 1990-06-07 1995-04-18 Zeria Pharmaceutical Co., Ltd. Arylalkanoylamine derivative and drug containing the same
EP0468469A2 (en) 1990-07-27 1992-01-29 Japan Tobacco Inc. Proline derivatives
US5221752A (en) 1990-07-27 1993-06-22 Nippon Kayaku Kabushiki Kaisha α-keto amide derivatives
EP0468339A2 (en) 1990-07-27 1992-01-29 Nippon Kayaku Kabushiki Kaisha Alpha-keto-amide derivatives having protease inhibiting activity
US5506256A (en) 1990-07-27 1996-04-09 Yoshitomi Pharmaceutical Industries, Ltd. Proline derivatives possessing prolyl endopeptidase-inhibitory activity
EP0503785A1 (en) 1991-02-21 1992-09-16 Sankyo Company Limited 1-Biphenylimidazole derivatives, their preparation and their therapeutic use
WO1992019238A1 (en) 1991-05-01 1992-11-12 Mayo Foundation For Medical Education And Research Huperzine a analogs
WO1992021333A2 (en) 1991-05-24 1992-12-10 Pharmavene, Inc. Treatment of drug withdrawal symptoms and drug craving with type b monoamine oxidase inhibitors
WO1993000361A1 (en) 1991-06-20 1993-01-07 Snow Brand Milk Products Co., Ltd. Novel prolyl endopeptidase inhibitors sna-115 and sna-115t, production thereof, and strain which produces said inhibitors
EP0522314A1 (en) 1991-07-03 1993-01-13 BASF Aktiengesellschaft Thermoplastic moulding composition based on polycarbonates, styrene/acrylanitrile-polymerisates and polyolefins
WO1993003034A1 (en) 1991-07-29 1993-02-18 Warner-Lambert Company Quinazoline derivatives as acetylcholinesterase inhibitors
EP0539086A2 (en) 1991-10-24 1993-04-28 American Home Products Corporation Condensed pyrimidine derivatives and their use as angiotensine II antagonists
WO1993012139A1 (en) 1991-12-19 1993-06-24 Garvan Institute Of Medical Research A novel molecule which inhibits neuropeptide tyrosine biological function
EP0556482A2 (en) 1991-12-24 1993-08-25 Snow Brand Milk Products Co., Ltd. Propyl endopeptidase inhibitor
WO1993013065A1 (en) 1991-12-27 1993-07-08 Japan Tobacco Inc. Proline derivative
WO1993025534A1 (en) 1992-06-10 1993-12-23 Zeneca Limited 2,5-DIOXO-2,5-DIHYDRO-1H-BENZ[b]AZEPINES AS NMDA RECEPTOR ANTAGONISTS
WO1994000486A1 (en) 1992-06-20 1994-01-06 The Wellcome Foundation Limited Neuropeptide y antagonists
WO1994007890A1 (en) 1992-10-05 1994-04-14 Ube Industries, Ltd. Pyrimidine compound
WO1994009016A1 (en) 1992-10-16 1994-04-28 Sri International 2-piperidinecarboxylic acid derivatives useful as nmda receptor antagonists
WO1994012474A1 (en) 1992-11-20 1994-06-09 Japan Tobacco Inc. Compound with prolyl endopeptidase inhibitor activity and pharmaceutical use thereof
EP0670309A1 (en) 1992-11-20 1995-09-06 Japan Tobacco Inc. Compound with prolyl endopeptidase inhibitor activity and pharmaceutical use thereof
WO1994013641A1 (en) 1992-12-16 1994-06-23 Japan Tobacco Inc. Benzomorphan useful as nmda receptor antagonist
WO1994017035A1 (en) 1993-01-20 1994-08-04 Dr. Karl Thomae Gmbh Aminoacid derivates, medicaments containing these compounds and process for preparing the same
WO1994017197A1 (en) 1993-01-25 1994-08-04 Takeda Chemical Industries, Ltd. ANTIBODY AGAINST β-AMYLOID OR DERIVATIVE THEREOF AND USE THEREOF
EP0614911A1 (en) 1993-02-15 1994-09-14 Sanofi Compounds having a sulfonamide and an amidinegroup, process for preparation and pharmaceutical compositions comprising them
WO1994019356A1 (en) 1993-02-16 1994-09-01 Merrell Dow Pharmaceuticals Inc. Silylated acetylcholinesterase inhibitors
WO1994020476A1 (en) 1993-03-02 1994-09-15 Fujisawa Pharmaceutical Co., Ltd. Novel heterocyclic compound
WO1994020109A1 (en) 1993-03-03 1994-09-15 Rhone-Poulenc Rorer S.A. Use of 2h-1,2,4-benzothiadiazine 3(4h)-one 1,1 dioxide derivatives as non-competitive nmda receptor antagonists
EP0618193A1 (en) 1993-03-24 1994-10-05 Adir Et Compagnie Nitrogen containing bicyclic derivatives as prolyl-endopeptidase inhibitors
WO1994029255A1 (en) 1993-06-04 1994-12-22 Merrell Pharmaceuticals Inc. Aromatic acetylcholinesterase inhibitors
WO1995000161A1 (en) 1993-06-18 1995-01-05 University Of Cincinnati Neuropeptide y antagonists and agonists
WO1995001352A1 (en) 1993-06-30 1995-01-12 Zeria Pharmaceutical Co., Ltd. Thiazolidine derivative and medicine containing the same
WO1995002602A1 (en) 1993-07-16 1995-01-26 Rhone-Poulenc Rorer S.A. Imidazo(1,2-a)pyrazin-4-one derivatives for use as ampa and nmda receptor antagonists
WO1995002601A1 (en) 1993-07-16 1995-01-26 Rhone-Poulenc Rorer S.A. IMIDAZO[1,2-a]PYRAZINE-4-ONE, PREPARATION THEREOF AND DRUGS CONTAINING SAME
EP0709373A1 (en) 1993-07-23 1996-05-01 Zaidan Hojin Biseibutsu Kagaku Kenkyu Kai Novel pyrrolidine derivative
US5965556A (en) 1993-07-23 1999-10-12 Zaidan Hojin Biseibutsu Kagaku Kenkyukai Pyrrolidine derivatives
US5756763A (en) 1993-07-23 1998-05-26 Zaidan Hojin Biseibutsu Kagaku Kenkyukai Pyrrolidine derivatives
WO1995012594A1 (en) 1993-11-05 1995-05-11 Rhone-Poulenc Rorer S.A. 7H-IMIDAZO(1,2-a)PYRAZINE-8-ONE NMDA RECEPTOR ANTAGONISTS
WO1995015310A1 (en) 1993-12-02 1995-06-08 Merrell Pharmaceuticals Inc. Prolyl endopeptidase inhibitors
WO1995026342A1 (en) 1994-03-28 1995-10-05 Rhone-Poulenc Rorer S.A. 5H-INDENO[1,2-b]PYRAZINE-2,3-DIONE DERIVATIVES, PREPARATION THEREOF AND DRUGS CONTAINING SAME
WO1995026352A1 (en) 1994-03-28 1995-10-05 Rhone-Poulenc Rorer S.A. IMIDAZO[1,2-a]PYRAZINE-4-ONE DERIVATIVES, PREPARATION THEREOF AND DRUGS CONTAINING SAME
WO1995026349A1 (en) 1994-03-28 1995-10-05 Rhone-Poulenc Rorer S.A. INDENO[1,2-e]PYRAZINE-4-ONES, PREPARATION THEREOF AND DRUGS CONTAINING SAME
WO1995026350A1 (en) 1994-03-28 1995-10-05 Rhone-Poulenc Rorer S.A. Imidazo(1,2-a)indeno(1,2-e)pyrazine-4-one derivatives and pharmaceutical compositions containing same
WO1995031986A1 (en) 1994-05-24 1995-11-30 Astra Aktiebolag Combination product of dichloroacetic acid and an nmda antagonist
WO1996008485A1 (en) 1994-09-13 1996-03-21 Pfizer Limited Quinoxalinedione nmda receptor antagonists
US5663192A (en) 1994-10-20 1997-09-02 Eli Lilly And Company Heterocyclic neuropeptide Y receptor antagonists
WO1996012489A1 (en) 1994-10-20 1996-05-02 Eli Lilly And Company Bicyclic neuropeptide y receptor antagonists
WO1996012490A1 (en) 1994-10-20 1996-05-02 Eli Lilly And Company Methods of inhibiting conditions associated with neuropeptide y
US5567714A (en) 1994-10-20 1996-10-22 Eli Lilly And Company Methods of treating obesity by inhibiting physiological conditions associated with an excess of neuropeptide Y
WO1996014318A1 (en) 1994-11-02 1996-05-17 Rhone-Poulenc Rorer S.A. SPIRO[HETEROCYCLE-IMIDAZO[1,2-a]INDENO[1,2-e]PYRAZINE]-4'-ONES, PREPARATION THEREOF AND DRUGS CONTAINING SAME
WO1996020946A1 (en) 1994-12-29 1996-07-11 Research Development Foundation Flavin adenine dinucleotide analogues, their pharmaceutical compositions, and their activity as monoamine oxidase inhibitors
WO1996021655A2 (en) 1995-01-11 1996-07-18 Hoechst Marion Roussel, Inc. Substituted oxazolidine calpain and/or cathepsin b inhibitors
WO1996022305A2 (en) 1995-01-12 1996-07-25 The Wellcome Foundation Limited Modified peptides
WO1996025435A1 (en) 1995-02-14 1996-08-22 Bayer Corporation MONOCLONAL ANTIBODY SPECIFIC FOR βA4 PEPTIDE
US5552411A (en) 1995-05-26 1996-09-03 Warner-Lambert Company Sulfonylquinolines as central nervous system and cardiovascular agents
EP0747356A1 (en) 1995-06-07 1996-12-11 Bristol-Myers Squibb Company Dihydropyridine NPY antagonists: piperazine derivatives
EP0747357A2 (en) 1995-06-07 1996-12-11 Bristol-Myers Squibb Company Dihydropyridine NPY antagonists: piperidine derivatives
WO1996040660A1 (en) 1995-06-07 1996-12-19 Pfizer Inc. Certain substituted benzylamine derivatives: a new class of neuropeptide y1 specific ligands
EP0747378A1 (en) 1995-06-07 1996-12-11 Bristol-Myers Squibb Company Dihydropyridine NPY antagonists
WO1997009308A1 (en) 1995-09-01 1997-03-13 Eli Lilly And Company Indolyl neuropeptide y receptor antagonists
WO1997012615A1 (en) 1995-10-05 1997-04-10 Warner-Lambert Company Benzimidazole derivatives as 15-lo inhibitors
WO1997013754A1 (en) 1995-10-11 1997-04-17 Pelayo Camps Garcia Novel polycyclic aminopyridine compounds as acetylcholinesterase inhibitors, preparation process and use thereof
WO1997019913A1 (en) 1995-11-30 1997-06-05 Dr. Karl Thomae Gmbh Amino acid derivatives, medicaments containing said compounds and methods of producing them
WO1997019911A1 (en) 1995-11-30 1997-06-05 Dr. Karl Thomae Gmbh Amino acid derivatives, pharmaceutical compositions containing these compounds and processes for preparing them
WO1997019914A1 (en) 1995-11-30 1997-06-05 Dr. Karl Thomae Gmbh Amino acid derivatives, medicaments containing said compounds and methods of producing said compounds
WO1997019682A1 (en) 1995-12-01 1997-06-05 Synaptic Pharmaceutical Corporation Aryl sulfonamide and sulfamide derivatives and uses thereof
WO1997020820A1 (en) 1995-12-01 1997-06-12 Novartis Ag Heteroaryl compounds
WO1997020822A1 (en) 1995-12-01 1997-06-12 Novartis Ag Quinazolin-2,4-diazirines as npy receptor antagonist
WO1997020821A1 (en) 1995-12-01 1997-06-12 Novartis Ag Heteroaryl derivatives
WO1997020823A2 (en) 1995-12-01 1997-06-12 Novartis Ag 2-amino quinazoline derivatives as npy receptor antagonists
WO1997023214A1 (en) 1995-12-22 1997-07-03 Warner-Lambert Company 4-substituted piperidine analogs and their use as subtype selective nmda receptor antagonists
WO1997023215A1 (en) 1995-12-22 1997-07-03 Warner-Lambert Company 2-substituted piperidine analogs and their use as subtype-selective nmda receptor antagonists
WO1997023216A1 (en) 1995-12-22 1997-07-03 Warner-Lambert Company 4-substituted piperidine analogs and their use as subtype selective nmda receptor antagonists
WO1997025041A1 (en) 1996-01-09 1997-07-17 Eli Lilly And Company Benzimidzolyl neuropeptide y receptor antagonists
WO1997032873A1 (en) 1996-03-09 1997-09-12 Pfizer Research And Development Company, N.V./S.A. Quinoxalinediones
WO1997034843A1 (en) 1996-03-22 1997-09-25 Libbey Glass Inc. Apparatus and method for forming a decorative pattern on glassware having an edge
WO1997038993A1 (en) 1996-04-12 1997-10-23 Hoechst Marion Roussel, Inc. Isatin derivatives as acetylcholinesterase inhibitors and analgesics
WO1997046250A1 (en) 1996-06-04 1997-12-11 Synaptic Pharmaceutical Corporation Methods of modifying feeding behavior, compounds useful in such methods, and dna encoding a hypothalamic atypical neuropeptide y/peptide yy receptor (y5)
WO1998001157A1 (en) 1996-07-05 1998-01-15 The Wwk Trust Compositions for the treatment of peripheral neuropathies containing antidepressants and/or monoamine oxidase inhibitors and/or vitamin b12 and/or precursors or inducers of a neurotransmitter
WO1998003494A1 (en) 1996-07-23 1998-01-29 Neurogen Corporation Certain amido- and amino-substituted benzylamine derivatives; a new class of neuropeptite y1 specific ligands
WO1998003492A1 (en) 1996-07-23 1998-01-29 Neurogen Corporation Certain substituted benzylamine derivatives; a new class of neuropeptide y1 specific ligands
WO1998003493A1 (en) 1996-07-23 1998-01-29 Neurogen Corporation Certain substituted benzylamine derivatives; a new class of neuropeptide-y1 specific ligands
WO1998005337A1 (en) 1996-08-01 1998-02-12 Cocensys, Inc. Use of gaba and nmda receptor ligands for the treatment of migraine headache
WO1998006703A1 (en) 1996-08-14 1998-02-19 Warner-Lambert Company 2-phenyl benzimidazole derivatives as mcp-1 antagonists
WO1998007420A1 (en) 1996-08-23 1998-02-26 Agouron Acquisition Corp. Neuropeptide-y ligands
WO1998010757A2 (en) 1996-09-11 1998-03-19 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services The use of functional n-methyl-d-aspartate antagonists to ameliorate or prevent aminoglycoside-induced ototoxicity
WO1998015647A1 (en) 1996-10-08 1998-04-16 Novartis Ag Modulation of apoptosis
US6114336A (en) 1996-10-23 2000-09-05 Sanofi Cosmetic composition containing a neuropeptide Y receptor antagonist
WO1998030243A1 (en) 1997-01-08 1998-07-16 Warner-Lambert Company Acetylcholinesterase inhibitors in combination with muscarinic agonists for the treatment of alzheimer's disease
US6426365B1 (en) 1997-02-12 2002-07-30 Japan Tobacco Inc. CETP activity inhibitors
WO1998040102A1 (en) 1997-03-13 1998-09-17 The Provost, Fellows And Scholars Of The College Of The Holy And Undivided Trinity Of Queen Elizabeth Near Dublin Cytoprotective agents comprising monoamine oxidase inhibitors
WO1998044955A1 (en) 1997-04-09 1998-10-15 Mindset Ltd. Recombinant antibodies specific for beta-amyloid ends, dna encoding and methods of use thereof
WO1998046559A1 (en) 1997-04-16 1998-10-22 Arqule, Inc. SYNTHESIS AND USE OF α-KETOAMIDE DERIVATIVES AND ARRAYS
WO1998050044A1 (en) 1997-05-07 1998-11-12 Algos Pharmaceutical Corporation Composition and method combining an antidepressant with an nmda receptor antagonist, for treating neuropathic pain
WO1998050075A1 (en) 1997-05-07 1998-11-12 Algos Pharmaceutical Corporation Cox-2 inhibitors in combination with nmda-blockers for treating pain
JP3255080B2 (en) 1997-05-28 2002-02-12 日新電機株式会社 Gas insulated switchgear
WO1999001416A2 (en) 1997-06-30 1999-01-14 Merz + Co. Gmbh & Co. 1-amino-alkylcyclohexane nmda receptor antagonists
WO1999007351A2 (en) 1997-08-07 1999-02-18 Zeneca Limited Indole derivatives and their use as mcp-1 antagonists
WO1999007359A1 (en) 1997-08-08 1999-02-18 Shire International Licensing B.V. Use of cholinesterase inhibitors for treating attention deficit disorders
WO1999007413A1 (en) 1997-08-11 1999-02-18 Algos Pharmaceutical Corporation Substance p inhibitors in combination with nmda-blockers for treating pain
WO1999013878A1 (en) 1997-09-18 1999-03-25 Astrazeneca Ab A COMBINATION OF A MONOAMINE OXIDASE INHIBITOR AND A h5-HT1B ANTAGONIST OR PARTIAL AGONIST
WO1999015498A1 (en) 1997-09-23 1999-04-01 Astrazeneca Ab New npy antagonists
WO1999027944A1 (en) 1997-12-02 1999-06-10 Neuralab Limited Prevention and treatment of amyloidogenic disease
WO1999046272A1 (en) 1998-03-09 1999-09-16 Fondatech Benelux N.V. Serine peptidase modulators
WO1999045963A1 (en) 1998-03-13 1999-09-16 Algos Pharmaceutical Corporation Analgesic combination comprising nmda receptor antagonists and narcotic analgesics
WO1999047131A2 (en) 1998-03-16 1999-09-23 Merck Sharp & Dohme Limited Combination of a gaba-a alpha 5 inverse agonist and an acetylcholinesterase inhibitor
WO1999046991A1 (en) 1998-03-17 1999-09-23 University Of Maryland Biotechnology Institute Methods for treating hiv-associated dementia
WO1999048891A1 (en) 1998-03-20 1999-09-30 Merck Patent Gmbh 1-(3-heteroarylpropyl- or -prop-2-enyl)-4-benzylpiperidines used as nmda receptor antagonists
WO1999053922A1 (en) 1998-04-21 1999-10-28 Algos Pharmaceutical Corporation Analgesic compositions comprising nmda-antagonists and abt-594
WO1999057119A1 (en) 1998-05-04 1999-11-11 Neotherapeutics, Inc. Novel dopamine-like 9-substituted hypoxanthine and methods of use
WO1999057120A1 (en) 1998-05-04 1999-11-11 Neotherapeutics, Inc. Novel serotonin-like 9-substituted hypoxanthine and methods of use
WO1999060024A1 (en) 1998-05-21 1999-11-25 The University Of Tennessee Research Corporation Methods for amyloid removal using anti-amyloid antibodies
DE19828113A1 (en) 1998-06-24 2000-01-05 Probiodrug Ges Fuer Arzneim Prodrugs of Dipeptidyl Peptidase IV Inhibitors
DE19828114A1 (en) 1998-06-24 2000-01-27 Probiodrug Ges Fuer Arzneim Produgs of unstable inhibitors of dipeptidyl peptidase IV
WO1999067228A1 (en) 1998-06-24 1999-12-29 Aventis Pharmaceuticals Products Inc. Fluorophenyl resin compounds
WO1999067279A1 (en) 1998-06-24 1999-12-29 Probiodrug Gesellschaft für Arzneimittelforschung mbH Compounds of unstable dipeptidyl peptidase iv inhibitors
WO2000000197A1 (en) 1998-06-26 2000-01-06 Warner-Lambert Company 4-benzyl piperidine alkylsulfoxide heterocycles and their use as subtype-selective nmda receptor antagonists
WO2000002549A2 (en) 1998-07-10 2000-01-20 Du Pont Pharmaceuticals Company Composition for and method of treating neurological disorders
WO2000007600A1 (en) 1998-08-07 2000-02-17 R.J. Reynolds Tobacco Company Pharmaceutical compositions for the prevention and treatment of central nervous system disorders
WO2000009483A2 (en) 1998-08-17 2000-02-24 Finetech Ltd. Process and intermediates for production of donepezil and related compounds
JP4208299B2 (en) 1998-08-19 2009-01-14 東レ株式会社 Polyester film for metal plate lamination molding
WO2000015205A2 (en) 1998-09-11 2000-03-23 Eisai Co., Ltd. Use of acetylcholinesterase inhibitors for the preparation of pharmaceutical compositions for the treatment of functional and/or organic pain syndromes
WO2000023057A2 (en) 1998-10-16 2000-04-27 Janssen Pharmaceutica N.V. Atypical antiphsychotic in combination with acetylcholinesterase inhibitor for improving cognition
WO2000029023A1 (en) 1998-11-12 2000-05-25 Algos Pharmaceutical Corporation Cox-2 inhibitors in combination with nmda-blockers for treating pain
WO2000030446A1 (en) 1998-11-23 2000-06-02 Bonnie Davis Dosage formulations for acetylcholinesterase inhibitors
WO2000030674A1 (en) 1998-11-26 2000-06-02 Ferring Bv Neuropeptide y y4 agents in the treatment of reproductive disorders
WO2000033840A1 (en) 1998-12-11 2000-06-15 Bonnie Davis Use of acetylcholinesterase inhibitors on the modulation of the hypothalamic-pituitary-gonadal axis
WO2000046195A1 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Anti-inflammatory indole derivatives
WO2000046198A1 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Anti-inflammatory indole derivatives
WO2000046196A1 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Indole derivatives and their use as mcp-1 antagonists
WO2000046199A2 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Indole derivatives as anti-inflammation agents
WO2000046197A1 (en) 1999-02-05 2000-08-10 Astrazeneca Ab Indole derivatives and their use as mcp-1 receptor antagonists
WO2000056711A1 (en) 1999-03-23 2000-09-28 Sumitomo Pharmaceuticals Co., Ltd. Tricyclic indole-2-carboxylic acid compound used as nmda receptor antagonist
WO2000063250A1 (en) 1999-04-15 2000-10-26 Merck Frosst Canada & Co. Antibodies that recognize app cleaved by caspases and methods of use
US6121311A (en) 1999-04-28 2000-09-19 Japan Tobacco Inc. Method for treating cocainism
WO2000068197A1 (en) 1999-05-05 2000-11-16 Ortho-Mcneil Pharmaceutical, Inc. 3a,4,5,9b-TETRAHYDRO-1H-BENZ[e]INDOL-2-YL AMINE-DERIVED NEUROPEPTIDE Y RECEPTORS LIGANDS USEFUL IN THE TREATMENT OF OBESITY AND OTHER DISORDERS
WO2000071144A1 (en) 1999-05-19 2000-11-30 Domer, Inc. Prolyl endopeptidase inhibitor
WO2000072880A2 (en) 1999-05-28 2000-12-07 Neuralab Limited Prevention and treatment of amyloidogenic disease
WO2000077178A1 (en) 1999-06-16 2000-12-21 Boston Biomedical Research Institute IMMUNOLOGICAL CONTROL OF β-AMYLOID LEVELS IN VIVO
WO2001000215A1 (en) 1999-06-25 2001-01-04 Wake Forest University Compositions for treating or preventing neurodegeneration and cognitive decline
WO2001010831A1 (en) 1999-08-06 2001-02-15 Grünenthal GmbH Substituted pyrrolidin-2,3,4-trion-3-oxime derivatives useful as nmda-receptor antagonists
WO2001010833A1 (en) 1999-08-06 2001-02-15 Grünenthal GmbH Substituted 1,5-dihydropyrrol-2-on derivatives as nmda receptor antagonists for the treatment of pain
WO2001012598A2 (en) 1999-08-13 2001-02-22 The Trustees Of Columbia University In The City Of New York METHODS OF INHIBITING BINDING OF β-SHEET FIBRIL TO RAGE AND CONSEQUENCES THEREOF
WO2001012176A2 (en) 1999-08-16 2001-02-22 Sanofi-Synthelabo Use of monoamine oxidase inhibitors for the manufacture of drugs intended for the treatment of obesity
WO2001026656A2 (en) 1999-10-11 2001-04-19 Societe De Conseils De Recherches Et D'applications Scientifiques (S.C.R.A.S.) 5-membered heterocycle derivatives and use thereof as monoamine oxidase inhibitors
WO2001032640A1 (en) 1999-11-01 2001-05-10 Merz Pharmaceuticals Gmbh 1-cyclic amino-alkylcyclohexane compounds, pharmaceutical compositions thereof, and their use as anticonvulsants
WO2001053255A1 (en) 2000-01-24 2001-07-26 Merck Sharp & Dohme Limited Gamma-secretase inhibitors
US6756511B2 (en) 2000-01-24 2004-06-29 Merck Sharp & Dohme Limited Gamma-secretase inhibitors
WO2001057226A1 (en) 2000-02-03 2001-08-09 Millennium Pharmaceuticals, Inc. Humanized anti-ccr2 antibodies and methods of use therefor
WO2001062801A2 (en) 2000-02-24 2001-08-30 Washington University Humanized antibodies that sequester amyloid beta peptide
WO2001066564A2 (en) 2000-03-03 2001-09-13 Merck Sharp & Dohme Limited Gamma-secretase inhibitors
EP1263774A2 (en) 2000-03-03 2002-12-11 MERCK SHARP &amp; DOHME LTD. Gamma-secretase inhibitors
US7049296B2 (en) 2000-03-03 2006-05-23 Merck Sharp & Dohme Ltd. Gamma-secretase inhibitors
WO2001066096A2 (en) 2000-03-06 2001-09-13 Immune Network Ltd. Compositions for prevention and treatment of dementia
US6992081B2 (en) 2000-03-23 2006-01-31 Elan Pharmaceuticals, Inc. Compounds to treat Alzheimer's disease
US7030239B2 (en) 2000-03-23 2006-04-18 Elan Pharmaceuticals, Inc. Compounds to treat Alzheimer's disease
WO2001077144A1 (en) 2000-04-07 2001-10-18 Merck Sharp & Dohme Limited Gamma-secretase inhibitors
US6984626B2 (en) 2000-04-07 2006-01-10 Merck, Sharp & Dohme Ltd. Gamma-secretase inhibitors
WO2001078728A1 (en) 2000-04-13 2001-10-25 Eisai Co., Ltd. Acetylcholinesterase inhibitors containing 1-benzyl- pyridinium salts
WO2001081295A1 (en) 2000-04-26 2001-11-01 Warner-Lambert Company Cyclohexylamine derivative as subtype selective nmda receptor antagonists
WO2001085145A2 (en) 2000-05-09 2001-11-15 Pfizer Products Inc. A pharmaceutical composition and method of treatment of diseases of cognitive dysfunction in a mammal
WO2001092204A1 (en) 2000-06-01 2001-12-06 Warner-Lambert Company Cyclohexylamine derivatives as subtype selective nmda receptor antagonists
WO2001094321A1 (en) 2000-06-06 2001-12-13 Warner-Lambert Company Bicyclic cyclohexylamines and their use as nmda receptor antagonists
WO2001098289A1 (en) 2000-06-22 2001-12-27 Pharmos Corporation Novel non-psychotropic cannabinoids
WO2001098262A1 (en) 2000-06-23 2001-12-27 Merck Sharp & Dohme Limited Amidine derivatives as selective antagonists of nmda receptors
US6713276B2 (en) 2000-06-28 2004-03-30 Scios, Inc. Modulation of Aβ levels by β-secretase BACE2
US6686449B2 (en) 2000-06-30 2004-02-03 Pharmacia & Upjohn Company Mutant presenilin 1 polypeptides
US7034182B2 (en) 2000-06-30 2006-04-25 Elan Pharmaceuticals, Inc. Compounds to treat Alzheimer's disease
US6448229B2 (en) 2000-07-06 2002-09-10 Merck Sharp & Dohme Ltd. Gamma secretase inhibitors
WO2002021509A1 (en) 2000-09-01 2002-03-14 Snap-On Technologies, Inc. Computer-implemented speech recognition system training
WO2002027418A2 (en) 2000-09-25 2002-04-04 Motorwiz, Inc. Model-based machine diagnostics and prognostics using theory of noise and communications
WO2002032412A2 (en) 2000-10-17 2002-04-25 Pfizer Products Inc. Combination use of acetylcholinesterase inhibitors and gabaa inverse agonists for the treatment of cognitive disorders
WO2002034718A1 (en) 2000-10-24 2002-05-02 Richter Gedeon Vegyeszeti Gyar Rt. Amide derivatives as nmda receptor antagonists
WO2002036555A1 (en) 2000-11-02 2002-05-10 Merck Sharp & Dohme Limited Sulfamides as gamma-secretase inhibitors
EP1334085A1 (en) 2000-11-02 2003-08-13 Merck Sharp & Dohme Ltd. Sulfamides as gamma-secretase inhibitors
WO2002041842A2 (en) 2000-11-03 2002-05-30 Proteotech. Inc. Antibody pti-hs7 for treatment of alzheimer's disease and other amyloidoses and parkinson's disease
WO2002046237A2 (en) 2000-12-06 2002-06-13 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2002046222A2 (en) 2000-12-07 2002-06-13 Mario Chojkier Compositions and methods for diagnosing alzheimer's disease
WO2002060900A2 (en) 2001-01-31 2002-08-08 Telik, Inc. Antagonists of mcp-1 function and methods of use thereof
WO2002070509A2 (en) 2001-03-01 2002-09-12 Telik, Inc. Antagonists of mcp-1 function and methods of use thereof
WO2002072542A2 (en) 2001-03-08 2002-09-19 Emory University Ph-dependent nmda receptor antagonists
US6649196B2 (en) 2001-03-12 2003-11-18 Mayo Foundation For Medical Education And Research Methods of reducing β-amyloid polypeptides
WO2002074240A2 (en) 2001-03-16 2002-09-26 Cornell Research Foundation, Inc. Anti-amyloid antibody based diagnosis and treatment of a neurological disease or disorder
WO2002081463A1 (en) 2001-04-03 2002-10-17 Telik, Inc. Antagonists of mcp-1 function and methods of use thereof
WO2002088306A2 (en) 2001-04-30 2002-11-07 Eli Lilly And Company Humanized antibodies
WO2002088307A2 (en) 2001-04-30 2002-11-07 Eli Lilly And Company Humanized antibodies
WO2002094881A2 (en) 2001-05-18 2002-11-28 Krka Tovarna Zdravil, D.D., Novo Mesto Monoclonal antibody neutralising cathepsin b activity and uses thereof
WO2002096897A1 (en) 2001-05-30 2002-12-05 Neurologic, Inc. PHOSPHINYLMETHYL AND PHOSPHORYLMETHYL SUCCINIC AND GLUTARIC ACID ANALOGS AS β-SECRETASE INHIBITORS
US6562783B2 (en) 2001-05-30 2003-05-13 Neurologic, Inc. Phosphinylmethyl and phosphorylmethyl succinic and glutauric acid analogs as β-secretase inhibitors
WO2002098849A2 (en) 2001-06-01 2002-12-12 Elan Pharmaceuticals, Inc. Hydroxy alkyl amine derivatives as beta-secretase inhibitors and their use for the treatment of alzheimer’s disease and similar diseases
US6982264B2 (en) 2001-06-27 2006-01-03 Elan Pharmaceuticals, Inc. Substituted alcohols useful in treatment of Alzheimer's disease
WO2003010159A1 (en) 2001-07-24 2003-02-06 Richter Gedeon Vegyészeti Gyár Rt. Piperidine derivatives as nmda receptor antagonists
WO2003012141A1 (en) 2001-07-31 2003-02-13 Takeda Chemical Industries, Ltd. Method of screening alzheimer’s disease-associated gene
US6683091B2 (en) 2001-08-03 2004-01-27 Schering Corporation Gamma Secretase inhibitors
WO2003014075A2 (en) 2001-08-03 2003-02-20 Schering Corporation Novel gamma secretase inhibitors
WO2003013527A1 (en) 2001-08-03 2003-02-20 Schering Corporation Sulfonamide derivatives as gamma secretase inhibitors
WO2003014162A1 (en) 2001-08-03 2003-02-20 Medical & Biological Laboratories Co., Ltd. ANTIBODY RECOGNIZING GM1 GANGLIOSIDE-BOUND AMYLOID β-PROTEIN AND DNA ENCODING THE ANTIBODY
US7122675B2 (en) 2001-08-03 2006-10-17 Schering Corporation Gamma secretase inhibitors
WO2003015691A2 (en) 2001-08-17 2003-02-27 Eli Lilly And Company RAPID IMPROVEMENT OF COGNITION IN CONDITIONS RELATED TO A$g(b)
WO2003016466A2 (en) 2001-08-17 2003-02-27 Eli Lilly And Company ANTI-Aβ ANTIBODIES
WO2003020289A1 (en) 2001-08-30 2003-03-13 Ortho-Mcneil Pharmaceutical, Inc. Treatment of dementia and memory disorders with anticonvulsants and acetylcholinesterase inhibitors
WO2003039454A2 (en) 2001-10-23 2003-05-15 Oklahoma Medical Research Foundation Beta-secretase inhibitors and methods of use
WO2003037376A1 (en) 2001-11-02 2003-05-08 Kensuke Egashira Preventives and/or remedies for post-transplant arteriosclerosis as rejection of organ transplant
WO2003039467A2 (en) 2001-11-02 2003-05-15 Diagenics International Corporation Monoclonal antibodies specific for beta-amyloid.
WO2003040183A2 (en) 2001-11-09 2003-05-15 The Genetics Company, Inc Compounds for the diagnosis/prevention/treatment of alzheimer's disease
WO2003043987A2 (en) 2001-11-19 2003-05-30 Elan Pharmaceuticals, Inc. (4-phenyl) piperidin-3-yl-phenylcarboxylate derivatives and related compounds as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2003045128A2 (en) 2001-11-21 2003-06-05 New York University SYNTHETIC IMMUNOGENIC BUT NON-DEPOSIT-FORMING POLYPEPTIDES AND PEPTIDES HOMOLOGOUS TO AMYLOID β, PRION PROTEIN, AMYLIN, α-SYNUCLEIN, OR POLYGLUTAMINE REPEATS FOR INDUCTION OF AN IMMUNE RESPONSE THERETO
WO2003048204A1 (en) 2001-12-06 2003-06-12 Takeda Chemical Industries, Ltd. Alzheimer’s disease-associated gene and protein and use thereof
WO2003051374A2 (en) 2001-12-17 2003-06-26 New York State Office Of Mental Health SEQUESTRATION OF Aβ IN THE PERIPHERY IN THE ABSENCE OF IMMUNOMODULATING AGENT AS A THERAPEUTIC APPROACH FOR THE TREATMENT OR PREVENTION OF BETA-AMYLOID RELATED DISEASES
WO2003053368A2 (en) 2001-12-19 2003-07-03 Atherogenics, Inc. Chalcone derivatives and their use to treat diseases
WO2003055514A1 (en) 2001-12-21 2003-07-10 Antigenics Inc. Compositions comprising immunoreactive reagents and saponins, and methods of use thereof
WO2003057204A2 (en) 2002-01-08 2003-07-17 Nordic Bioscience A/S Modulation of iamt (pimt or pcmt) in immune system
WO2003059346A1 (en) 2002-01-18 2003-07-24 The Genetics Company Inc. Beta-secretase inhibitors
WO2003063760A2 (en) 2002-01-31 2003-08-07 Tel Aviv University Future Technology Development L.P. Peptides antibodies directed thereagainst and methods using same for diagnosing and treating amyloid-associated diseases
WO2003066592A1 (en) 2002-02-06 2003-08-14 Schering Corporation Gamma secretase inhibitors
WO2003070760A2 (en) 2002-02-20 2003-08-28 F. Hoffmann-La Roche Ag Anti-amyloid beta antibodies and their use
WO2003074081A1 (en) 2002-02-28 2003-09-12 Mindset Biopharmaceuticals Usa Inc. SPECIFIC ANTIBODIES TO AMYLOID β PEPTIDE, PHARMACEUTICAL COMPOSITIONS AND METHODS OF USE THEREOF
WO2003077858A2 (en) 2002-03-12 2003-09-25 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2003082820A1 (en) 2002-03-29 2003-10-09 Eisai Co., Ltd. (1-indanone)-(1,2,3,6-tetrahydropyridine) derivative
WO2003086310A2 (en) 2002-04-12 2003-10-23 Ramot At Tel Aviv University Ltd. Prevention of brain inflammation as a result of induced autoimmune response
WO2003089460A1 (en) 2002-04-19 2003-10-30 The Governing Council Of The University Of Toronto Immunological methods and compositions for the treatment of alzheimer's disease
WO2003091278A1 (en) 2002-04-24 2003-11-06 Hiroshi Mori Gamma-secretase inhibitors
WO2003091220A1 (en) 2002-04-26 2003-11-06 Schering Corporation Muscarinic antagonists
WO2003099202A2 (en) 2002-05-17 2003-12-04 Merck & Co., Inc. Beta-secretase inhibitors
WO2003101458A1 (en) 2002-05-31 2003-12-11 H. Lundbeck A/S A combination of an nmda-antagonist and acetylcholine esterase inhibitors for the treatment of alzheimer's disease
WO2003104437A2 (en) 2002-06-11 2003-12-18 Northwestern University Anti-addl antibodies and uses thereof
WO2004000958A1 (en) 2002-06-19 2003-12-31 Surface Specialties, S.A. Semi-gloss powder coating compositions
WO2004009062A2 (en) 2002-07-19 2004-01-29 Khalid Iqbal NMDA RECEPTOR ANTAGONISTS AND THEIR USE IN INHIBITING ABNORMAL HYPERPHOSPHORYLATION OF MICROTUBULE ASSOCIATED PROTEIN tau
WO2004013098A1 (en) 2002-08-05 2004-02-12 Bristol-Myers Squibb Company Novel gamma-lactams as beta-secretase inhibitors
WO2004024921A1 (en) 2002-09-12 2004-03-25 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute Human antihuman mcp-1 antibody and antibody fragment thereof
WO2004024770A1 (en) 2002-09-12 2004-03-25 Universidad De Zaragoza Polyclonal antibodies, preparation method thereof and use of same
WO2004024090A2 (en) 2002-09-12 2004-03-25 The Regents Of The University Of California Immunogens and corresponding antibodies specific for high molecular weight aggregation intermediates common to amyloids formed from proteins of differing sequence
WO2004026851A1 (en) 2002-09-20 2004-04-01 Axys Pharmaceuticals, Inc. 3-(3,5-disubstituted-4-hydroxyphenyl)propionamide derivatives as cathepsin b inhibitors
WO2004028522A1 (en) 2002-09-25 2004-04-08 Innovative Drug Delivery Systems, Inc. Analgesic compositions comprising nmda receptor antagonists and benzalkonium chloride
WO2004029629A1 (en) 2002-09-27 2004-04-08 Janssen Pharmaceutica N.V. N-11 truncated amyloid-beta nomoclonal antibodies, compositions, methods and uses
WO2004029630A1 (en) 2002-09-27 2004-04-08 Janssen Pharmaceutica N.V. N-11 truncated amyloid-beta monoclonal antibodies, compositions, methods and uses
WO2004031400A2 (en) 2002-10-01 2004-04-15 Northwestern University Amyloid beta-derived diffusible ligands (addls), addl-surrogates, addl-binding molecules, and uses thereof
US7101895B2 (en) 2002-10-04 2006-09-05 Merck Sharp & Dohme Limited Cyclohexyl sulphone derivatives as gamma-secretase inhibitors
WO2004031137A1 (en) 2002-10-04 2004-04-15 Merck Sharp & Dohme Limited Cyclohexyl sulphone derivatives as gamma-secretase inhibitors
WO2004031139A1 (en) 2002-10-04 2004-04-15 Merck Sharp & Dohme Limited Cyclohexyl sulphones as gamma-secretase inhibitors
US6890956B2 (en) 2002-10-04 2005-05-10 Merck Sharp & Dohme Limited Cyclohexyl sulphones as gamma-secretase inhibitors
WO2004032868A2 (en) 2002-10-09 2004-04-22 Rinat Neuroscience Corp. Methods of treating alzheimer's disease using antibodies directed against amyloid beta peptide and compositions thereof
WO2004032929A2 (en) 2002-10-09 2004-04-22 Neuropharma, S.A. Dual binding site acetylcholinesterase inhibitors for the treatment of alzheimer’s disease
WO2004037234A2 (en) 2002-10-24 2004-05-06 Merz Pharma Gmbh & Co. Kgaa Combination therapy using 1-aminocyclohexane derivatives and acetylcholinesterase inhibitors
WO2004039371A2 (en) 2002-10-29 2004-05-13 Pharmacia Corporation Compositions of cyclooxygenase-2 selective inhibitors and nmda receptor antagonists for the treatment or prevention of neuropathic pain
WO2004039773A2 (en) 2002-10-30 2004-05-13 Nordic Bioscience A/S Coumpounds modulating the activity of gapdh and/or iamt
WO2004039370A1 (en) 2002-11-01 2004-05-13 Merck Sharp & Dohme Limited Sulfonamides, sulfamates and sulfamides as gamma-secretase inhibitors
WO2004044204A2 (en) 2002-11-06 2004-05-27 Institut Pasteur Variable fragments of single-chain camelide antibodies and uses thereof for diagnosing and treating various pathologies
US7109217B2 (en) 2002-11-12 2006-09-19 Merck & Co., Inc. Phenylcarboxamide beta-secretase inhibitors for the treatment of Alzheimer's disease
WO2004043916A1 (en) 2002-11-12 2004-05-27 Merck & Co., Inc. Phenylcarboxamide beta-secretase inhibitors for the treatment of alzheimer's disease
WO2004056727A2 (en) 2002-12-19 2004-07-08 Atherogenics, Inc. Process of making chalcone derivatives
WO2004062625A2 (en) 2003-01-07 2004-07-29 Merck & Co., Inc. Macrocyclic beta-secretase inhibitors for treatment of alzheimer's disease
WO2004067561A1 (en) 2003-01-31 2004-08-12 Abbott Gmbh & Co. Kg Amyloid-$g(b)(1-42) oligomers, derivatives thereof, antibodies for the same, method for production and use therof
WO2004069182A2 (en) 2003-02-01 2004-08-19 Neuralab Limited Active immunization to generate antibodies to soluble a-beta
WO2004069826A1 (en) 2003-02-04 2004-08-19 F. Hoffmann-La Roche Ag Malonamide derivatives as gamma-secretase inhibitors
WO2004071408A2 (en) 2003-02-10 2004-08-26 Applied Molecular Evolution, Inc. Aβ BINDING MOLECULES
WO2004073630A2 (en) 2003-02-18 2004-09-02 Roskamp Research Llc Anti-angiogenic and anti-tumoral properties of beta and gamma secretase inhibitors
WO2004078908A2 (en) 2003-03-06 2004-09-16 Santhera Pharmaceuticals (Schweiz) Gmbh Alpha-keto carbonyl calpain inhibitors
WO2004080419A2 (en) 2003-03-12 2004-09-23 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2004084830A2 (en) 2003-03-21 2004-10-07 Buck Institute Method for treating alzheimer’s dementia
WO2004084884A1 (en) 2003-03-24 2004-10-07 The Chinese University Of Hong Kong Use of tanshinone derivates as cholinesterase inhibitors in treating related diseases
WO2005028511A2 (en) 2003-03-28 2005-03-31 Centocor, Inc. Anti-amyloid antibodies, compositions, methods and uses
WO2004087158A2 (en) 2003-03-28 2004-10-14 Acadia Pharmaceuticals Inc. Muscarinic m1 receptor agonists for pain management
WO2004092189A1 (en) 2003-04-09 2004-10-28 Wyeth Derivatives of 2-(8,9-dioxo-2,6-diazabicyclo(5.2.0)non-1(7)-en-2-yl)alkyl phosphonic acid and their use as n-methyl-d-aspartate (nmda) recetor antagonists
WO2004089351A2 (en) 2003-04-10 2004-10-21 Cambridge University Technical Services Ltd Treatment of progressive neurological disorders comprising a mao inhibitor (miclobemid) and an acetylcholinesterase inhibitor (tacrin)
WO2004089911A1 (en) 2003-04-10 2004-10-21 Merck Sharp & Dohme Limited Pyrazole derivatives as gamma-secretase inhibitors useful in the treatment of alzheimer’s disease
WO2004098591A2 (en) 2003-05-05 2004-11-18 Probiodrug Ag Inhibitors of glutaminyl cyclase and their use in the treatment of neurological diseases
WO2004098625A2 (en) 2003-05-05 2004-11-18 Probiodrug Ag Medical use of inhibitors of glutaminyl and glutamate cyclases
WO2004098631A1 (en) 2003-05-08 2004-11-18 Universidad De Zaragoza Alzheimer's disease treatment method
WO2004101562A2 (en) 2003-05-13 2004-11-25 Schering Corporation Bridged n-arylsulfonylpiperidines as gamma-secretase inhibitors
WO2004101538A1 (en) 2003-05-16 2004-11-25 Merck Sharp & Dohme Limited Cyclohexyl sulphones as gamma-secretase inhibitors
WO2005000216A2 (en) 2003-05-27 2005-01-06 Forest Laboratories, Inc. Combination of an nmda receptor antagonist and a selective serotonin reuptake inhibitor for the treatment of depression and other mood disorders
WO2004108895A2 (en) 2003-05-30 2004-12-16 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2005000193A2 (en) 2003-06-30 2005-01-06 Tel Aviv University Future Technology Development L.P. Peptides antibodies directed thereagainst and methods using same for diagnosing and treating amyloid-associated diseases
WO2005004802A2 (en) 2003-06-30 2005-01-20 Merck & Co., Inc. N-alkyl phenylcarboxamide beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005004803A2 (en) 2003-07-01 2005-01-20 Merck & Co., Inc. Phenylcarboxylate beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005007614A1 (en) 2003-07-03 2005-01-27 The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services 6011 Monoamine oxidase inhibitors
WO2005007199A1 (en) 2003-07-16 2005-01-27 Rvx Therapeutics, Inc. COMPOUNDS AND METHODS FOR DOWNREGULATING THE EFFECTS OF TGF-β
WO2005008250A1 (en) 2003-07-21 2005-01-27 Angiogenetics Sweden Ab Compounds and methods for promoting angiogenesis by using a gamma-secretase inhibitor or inhibiting the gamma-secretase pathway
WO2005009421A2 (en) 2003-07-28 2005-02-03 Merz Pharma Gmbh & Co. Kgaa The use of 1-amino-alkylcyclohexane compounds in the treatment of pain hypersensitivity
WO2005011599A2 (en) 2003-08-01 2005-02-10 Northwestern University Antibodies specific for toxic amyloid beta protein oligomers
WO2005014553A1 (en) 2003-08-05 2005-02-17 Merck Sharp & Dohme Limited Novel gamma-secretase inhibitors
WO2005018545A2 (en) 2003-08-14 2005-03-03 Merck & Co., Inc. Macrocyclic beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005018424A2 (en) 2003-08-18 2005-03-03 Research Foundation For Mental Hygiene, Inc. Antibodies specific for fibrillar amyloid and a procedure to detect fibrillar amyloid deposits
WO2005023858A1 (en) 2003-09-05 2005-03-17 Cellzome Ag Protein complexes associated with app-processing
WO2005025616A1 (en) 2003-09-09 2005-03-24 Takeda Pharmaceutical Company Limited Use of antibody
WO2005025516A2 (en) 2003-09-12 2005-03-24 The Regents Of The University Of California Monoclonal antibodies specific for conformational epitopes of prefibrillar aggregates
WO2005028440A1 (en) 2003-09-16 2005-03-31 Schering Corporation Novel gamma secretase inhibitors
WO2005027975A1 (en) 2003-09-22 2005-03-31 Pfizer Limited Combinations of alpha-2-delta ligands and acetylcholinesterase inhibitors
WO2005030731A1 (en) 2003-09-24 2005-04-07 Merck Sharp & Dohme Limited Gamma-secretase inhibitors
WO2005032471A2 (en) 2003-10-03 2005-04-14 Merck & Co., Inc. Benzylether and benzylamino beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005040126A1 (en) 2003-10-06 2005-05-06 F. Hoffman-La Roche Ag Substituted dibenzo-azepine and benzo-diazepine derivatives useful as gamma-secretase inhibitors
WO2005035522A1 (en) 2003-10-08 2005-04-21 Pfizer Japan, Inc. 1-‘2-(4-hydroxyphenyl)-2-hydroxyethyl!-piperidin-4-ol compounds as nmda receptor antagonists
WO2005039580A1 (en) 2003-10-16 2005-05-06 Boehringer Ingelheim International Gmbh Pharmaceutical composition comprising a monoamine neurotransmitter re-uptake inhibitor and an acetylcholinesterase inhibitor
WO2005079779A1 (en) 2003-10-22 2005-09-01 Merz Pharma Gmbh & Co. Kgaa THE USE OF 1-AMINOCYCLOHEXANE DERIVATIVES TO MODIFY DEPOSITION OF FIBRILLOGENIC Aß PEPTIDES IN AMYLOIDOPATHIES
WO2006058720A2 (en) 2003-11-03 2006-06-08 Probiodrug Ag Novel compounds for the treatment of neurological disorders
WO2005044830A1 (en) 2003-11-11 2005-05-19 F. Hoffmann-La Roche Ag Phosphinic acids derivatives, beta-secretase inhibitors for the treatment of alzheimer’s disease
WO2005051914A1 (en) 2003-11-24 2005-06-09 Merck & Co., Inc. Benzylether and benzylamino beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005055996A1 (en) 2003-12-05 2005-06-23 Forest Laboratories, Inc. Memantine for the prevention or reduction of suicidality and for treatment of major depression associated with suicidality
WO2005065195A2 (en) 2003-12-19 2005-07-21 Merck & Co., Inc. Phenylamide and pyridylamide beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005070429A1 (en) 2004-01-22 2005-08-04 Neurosearch A/S Pharmaceutical composition comprising a monoamine neurotransmitter re-uptake inhibitor and an n-methyl-d-aspartate (nmda) receptors antagonist
WO2005072705A1 (en) 2004-01-29 2005-08-11 Neuromolecular, Inc. Combination of a nmda receptor antagonist and a mao-inhibitor or a gadpf-inhibitor for the treatment of central nervous system-related conditions
WO2005075436A2 (en) 2004-02-05 2005-08-18 Probiodrug Ag Novel inhibitors of glutaminyl cyclase
WO2005079756A2 (en) 2004-02-13 2005-09-01 Neuromolecular, Inc. Combination of a nmda receptor antagonist and an anti-depressive drug mao-inhibitor or a gadph-inhibitor for the treatment of psychiatric conditions
WO2005079789A1 (en) 2004-02-17 2005-09-01 Axonyx, Inc. Combinatorial therapy with an acetylcholinesterase inhibitor and (3ar)-1,3a,8-trimethyl-1,2,3,3a,8,8a-hexahydropyrrolo[2,3-b]indol-5-yl phenylcarbamate
WO2005080435A1 (en) 2004-02-20 2005-09-01 Immuno-Biological Laboratories Co., Ltd. Monoclonal antibody and use thereof
WO2005081872A2 (en) 2004-02-20 2005-09-09 Ac Immune Sa Methods and compositions comprising supramolecular constructs
WO2005092009A2 (en) 2004-03-19 2005-10-06 Axonyx, Inc. Acetylcholinesterase inhibitors and n-methyl-d-aspartate antagonists useful in the treatment of cognitive disorders
JP4211648B2 (en) 2004-03-22 2009-01-21 日本電気株式会社 Software installation method and system
WO2005097103A2 (en) 2004-04-01 2005-10-20 Axys Pharmaceuticals, Inc. Diabetes and metabolic syndrome therapy utilizing cathepsin b inhibitors
WO2005097768A2 (en) 2004-04-05 2005-10-20 Schering Corporation Novel gamma secretase inhibitors
WO2005103043A1 (en) 2004-04-20 2005-11-03 Merck & Co., Inc. 2, 4, 6-substituted pyridyl derivative compounds useful as beta-secretase inhibitors for the treatment of alzheimer’s disease
WO2005103020A1 (en) 2004-04-20 2005-11-03 Merck & Co., Inc. 1,3,5-substituted phenyl derivative compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005102390A2 (en) 2004-04-22 2005-11-03 Pfizer Japan, Inc. Combinations comprising alpha-2-delta ligands and nmda receptor antagonists
WO2005105133A2 (en) 2004-04-23 2005-11-10 Massachusetts Eye And Ear Infirmary Methods and compositions for preserving the viability of photoreceptor cells
WO2005105998A1 (en) 2004-04-27 2005-11-10 Juridical Foundation The Chemo-Sero-Therapeutic Research Institute HUMAN ANTIAMYLOID β PEPTIDE ANTIBODY AND ANTIBODY FRAGMENT THEREOF
WO2005113484A1 (en) 2004-05-13 2005-12-01 Merck & Co., Inc. Phenyl carboxamide compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005120571A2 (en) 2004-06-07 2005-12-22 Ramot At Tel Aviv University Ltd. Method of passive immunization against disease or disorder characterized by amyloid aggregation with diminished risk of neuroinflammation
WO2006002004A1 (en) 2004-06-15 2006-01-05 Merck & Co., Inc. Pyrrolidin-3-yl compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2005123775A1 (en) 2004-06-21 2005-12-29 Bioarctic Neuroscience Ab Antibodies specific for soluble amyloid beta peptide protofibrils and uses thereof
WO2006085961A2 (en) 2004-06-30 2006-08-17 Centocor, Inc. Anti-mcp-1 antibodies, compositions, methods and uses
WO2006004880A2 (en) 2004-06-30 2006-01-12 Schering Corporation Substituted n-arylsulfonylheterocyclic amines as gamma-secretase inhibitors
WO2006014478A1 (en) 2004-07-02 2006-02-09 Northwestern University MONOLOCAL ANTIBODIES THAT TARGET PATHOLOGICAL ASSEMBLIES OF AMYLOID β (ABETA)
WO2006014638A2 (en) 2004-07-19 2006-02-09 The General Hospital Corporation ANTIBODIES TO CROSS-LINKED AMYLOID β OLIGOMERS
WO2006008661A2 (en) 2004-07-19 2006-01-26 Neurochem (International) Limited Diagnostic methods of multiple organ amyloidosis
WO2006014762A1 (en) 2004-07-22 2006-02-09 Schering Corporation Substituted amide beta secretase inhibitors
WO2006014944A1 (en) 2004-07-28 2006-02-09 Schering Corporation Macrocyclic beta-secretase inhibitors
WO2006010965A1 (en) 2004-07-29 2006-02-02 Richter Gedeon Vegyészeti Gyár Rt. Indole-2 -carboxamidine derivatives as nmda receptor antagonists
WO2006036291A2 (en) 2004-07-30 2006-04-06 Rinat Neuroscience Corp. Antibodies directed against amyloid-beta peptide and methods using same
WO2006016644A1 (en) 2004-08-11 2006-02-16 Mitsubishi Chemical Corporation Antibody and utilization of the same
WO2006021413A1 (en) 2004-08-25 2006-03-02 Santhera Pharmaceuticals (Schweiz) Ag Alpha-keto carbonyl calpain inhibitors
WO2006021409A1 (en) 2004-08-25 2006-03-02 Santhera Pharmaceuticals (Schweiz) Ag Alpha-keto carbonyl calpain inhibitors
WO2006026204A2 (en) 2004-08-26 2006-03-09 Bristol-Myers Squibb Company Novel gamma-lactams as beta-secretase inhibitors
WO2006026408A2 (en) 2004-08-27 2006-03-09 Wyeth Research Ireland Limited Production of anti-amyloid beta antibodies
WO2006029850A1 (en) 2004-09-14 2006-03-23 The Genetics Company, Inc. Hydrazone derivatives and their use as beta secretase inhibitors
WO2006034296A2 (en) 2004-09-17 2006-03-30 Comentis, Inc. Amino-containing compounds which inhibit memapsin 2 beta-secretase activity and methods of use thereof
WO2006034277A1 (en) 2004-09-17 2006-03-30 Comentis, Inc. Bicyclic compounds which inhibit beta-secretase activity and methods of use thereof
WO2006039470A2 (en) 2004-09-29 2006-04-13 Centocor, Inc. Anti- amyloid antibodies, compositions, methods and uses
WO2006042103A2 (en) 2004-10-05 2006-04-20 Axys Pharmaceuticals, Inc. Reversible inhibitors of cathepsin b
WO2006040688A2 (en) 2004-10-12 2006-04-20 Ernir Snorrason Inhibitors of acetylcholinesterase for treating skin diseases
WO2006044497A2 (en) 2004-10-13 2006-04-27 Merck & Co., Inc. Spiropiperidine compounds useful as beta-secretase inhibitors for the treatment of alzhermer’s disease
WO2006039807A1 (en) 2004-10-15 2006-04-20 Biopharmacopae Design International Inc. Methods and therapeutic compositions comprising plant extracts for the treatment of cancer
WO2006055178A2 (en) 2004-10-25 2006-05-26 Merck & Co., Inc. Anti-addl antibodies and uses thereof
WO2006046644A1 (en) 2004-10-28 2006-05-04 Sanko Junyaku Co., Ltd. Method of examining alzheimer’s disease and diagnostic reagent
WO2006060109A1 (en) 2004-10-29 2006-06-08 Merck & Co., Inc. 2-aminopyridine compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006055434A2 (en) 2004-11-17 2006-05-26 Merck & Co., Inc. Macrocyclic tertiary amine beta-secretase inhibitors for the treatment of alzheimer's disease
JP4235162B2 (en) 2004-11-18 2009-03-11 日本電信電話株式会社 Image encoding apparatus, image encoding method, image encoding program, and computer-readable recording medium
WO2006058059A2 (en) 2004-11-23 2006-06-01 Neuromolecular Pharmaceuticals, Inc. Composition comprising a sustained release coating or matrix and an nmda receptor antagonist, method for administration such nmda antagonist to a subject
WO2006057945A2 (en) 2004-11-23 2006-06-01 Merck & Co., Inc. 2,3,4,6-substituted pyridyl derivative compounds useful as beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006057983A1 (en) 2004-11-23 2006-06-01 Merck & Co., Inc. Macrocyclic aminopyridyl beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006058236A2 (en) 2004-11-24 2006-06-01 Neuromolecular Pharmaceuticals, Inc. Composition comprising an nmda receptor antagonist and levodopa and use thereof for treating neurological disease
WO2006060473A2 (en) 2004-12-03 2006-06-08 Mucosal Therapeutics Llc Methods of treatment of injured or diseased joints with lubricin compositions
WO2006066233A1 (en) 2004-12-15 2006-06-22 Neuralab Limited An immunoprecipitation-based assay for predicting in vivo efficacy of beta-amyloid antibodies
WO2006066049A2 (en) 2004-12-15 2006-06-22 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2006066171A1 (en) 2004-12-15 2006-06-22 Neuralab Limited Amyloid βετα antibodies for use in improving cognition
WO2006066089A1 (en) 2004-12-15 2006-06-22 Neuralab Limited Humanized amyloid beta antibodies for use in improving cognition
WO2006071274A2 (en) 2004-12-23 2006-07-06 Voyager Pharmaceutical Corporation Leuprolide acetate and acetylcholinesterase inhibitors or nmda receptor antagonists for the treatment of alzheimer’s disease
WO2006070394A1 (en) 2004-12-28 2006-07-06 Council Of Scientific And Industrial Research Substituted carbamic acid quinolin-6-yl esters useful as acetylcholinesterase inhibitors
WO2006074265A2 (en) 2005-01-06 2006-07-13 Merck & Co., Inc. Drug combination therapy and pharmaceutical compositions for treating inflammatory disorders
WO2006078576A2 (en) 2005-01-19 2006-07-27 Merck & Co., Inc. Aminomethyl beta-secretase inhibitors for the treatment of alzheimer's disease
WO2006081171A1 (en) 2005-01-24 2006-08-03 Amgen Inc. Humanized anti-amyloid antibody
WO2006091988A1 (en) 2005-02-28 2006-08-31 Thomas Christian Lines Composition for treating mental health disorders
WO2006094674A1 (en) 2005-03-07 2006-09-14 Michael Hermanussen Nmda receptor antagonists in the medical intervention of metabolic disorders
WO2006095041A1 (en) 2005-03-09 2006-09-14 Consejo Superior De Investigaciones Científicas Method for the in vitro diagnosis of alzheimer's disease using a monoclonal antibody
WO2006099352A1 (en) 2005-03-10 2006-09-21 Bristol-Myers Squibb Company Novel isophthalates as beta-secretase inhibitors
WO2006097624A1 (en) 2005-03-17 2006-09-21 Sanofi-Aventis 7-(2-(4-(3-trifluoromethyl-phenyl)-1,2,3,6-tetrahydro-pyrid-1-yl)ethyl) isoquinoline besylate salt, preparation and therapeutic use thereof
WO2006103116A1 (en) 2005-04-01 2006-10-05 Biotherapix Molecular Medicines S.L.U. Human antibodies with beta-amyloid peptide-binding capacity and their applications
WO2006120104A1 (en) 2005-04-11 2006-11-16 Probiodrug Ag Inhibitors of prolyl endopeptidase
WO2006116435A2 (en) 2005-04-27 2006-11-02 Novartis Ag Methods of treating atherosclerosis
WO2006118959A2 (en) 2005-04-29 2006-11-09 Rinat Neuroscience Corp. Antibodies directed against amyloid-beta peptide and methods using same
WO2006125202A2 (en) 2005-05-19 2006-11-23 Centocor, Inc. Anti- mcp-1 antibodies, compositions, methods and uses
WO2006137354A1 (en) 2005-06-21 2006-12-28 Medical & Biological Laboratories Co., Ltd. Antibody having inhibitory effect on amyloid fibril formation
WO2007068412A2 (en) 2005-12-12 2007-06-21 Ac Immune Sa A beta 1-42 specific monoclonal antibodies with therapeutic properties
WO2007068411A2 (en) 2005-12-12 2007-06-21 Ac Immune S.A. Therapeutic vaccine
EP2011349A2 (en) 2006-03-17 2009-01-07 Vodafone Group PLC Improvements in an ehspa architecture
WO2008011348A2 (en) 2006-07-14 2008-01-24 Ac Immune S.A. Humanized antibody against amyloid beta

Non-Patent Citations (59)

* Cited by examiner, † Cited by third party
Title
"Organic Chemistry", 1973, PLENUM PRESS
BATEMAN, R. C. ET AL., BIOCHEMISTRY, vol. 40, 2001, pages 11246 - 11250
BHATIA, M. ET AL., AM.J PHYSIOL GASTROINTEST.LIVER PHYSIOL, vol. 288, 2005, pages G1259 - G1265
BHATIA, M. ET AL., PANCREATOLOGY., vol. 5, 2005, pages 132 - 144
BOCKERS, T. M. ET AL., J NEUROENDOCRINOL, vol. 7, 1995, pages 445 - 453
BRADFORD, M. M, ANAL BIOCHEM, vol. 72, 1976, pages 248 - 254
BUCHHOLZ ET AL., J MED CHEM., vol. 49, no. 2, 26 January 2006 (2006-01-26), pages 664 - 77
BUCHHOLZ MIRKO ET AL: "The first potent inhibitors for human glutaminyl cyclase: Synthesis and structure-activity relationship", JOURNAL OF MEDICINAL CHEMISTRY, AMERICAN CHEMICAL SOCIETY. WASHINGTON, vol. 49, no. 2, 1 January 2006 (2006-01-01), pages 664 - 677, XP002462493, ISSN: 0022-2623 *
BUCHHOLZ, M. ET AL., J MED CHEM, vol. 49, 2006, pages 664 - 677
BUSBY, W. H. J. ET AL., J BIOL CHEM, vol. 262, 1987, pages 8532 - 8536
CHARO,I.F.; TAUBMAN,M.B., CIRC.RES, vol. 95, 2004, pages 858 - 866
CLERICI,F ET AL., NEUROBIOL.AGING, vol. 27, 2006, pages 1763 - 1768
COLL, B. ET AL., CYTOKINE, vol. 34, 2006, pages 51 - 55
CONSALVO, A. P. ET AL., ANAL BIOCHEM, vol. 175, 1988, pages 131 - 138
CYNIS, H. ET AL., BIOCHIM.BIOPHYS.ACTA, vol. 1764, 2006, pages 1618 - 1625
DAHL, S. W. ET AL., PROTEIN EXPR PURIF, vol. 20, 2000, pages 27 - 36
EL MOUSSAOUI, A. ET AL., CELL MOL LIFE SCI, vol. 58, 2001, pages 556 - 570
FISCHER, W. H.; SPIESS, J., PROC NATL ACAD SCI U S A, vol. 84, 1987, pages 3628 - 3632
GALIMBERTI,D. ET AL., ARCH.NEUROL, vol. 63, 2006, pages 538 - 543
GANELLIN ET AL., J MED CHEM, vol. 38, no. 17, 1995, pages 3342 - 3350
GERARD, C.; ROLLINS, B. J., NAT.IMMUNOL, vol. 2, 2001, pages 108 - 115
GILL, S.C.; VON HIPPEL, P.H., ANAL BIOCHEM, vol. 182, 1989, pages 319 - 326
GOLOLOBOV, M. Y. ET AL., BIOL CHEM, vol. 377, 1996, pages 395 - 398
GONG, J. H. ET AL., J EXP.MED, vol. 186, 1997, pages 131 - 137
GOSLING, J. ET AL., J CLIN.INVEST, vol. 103, 1999, pages 773 - 778
GU, L. ET AL., MOL.CELL, vol. 2, 1998, pages 275 - 281
HEMMERICH, S. ET AL., BIOCHEMISTRY, vol. 38, 1999, pages 13013 - 13025
INOSHIMA, I. ET AL., AM.J PHYSIOL LUNG CELL MOL.PHYSIOL, vol. 286, 2004, pages L1038 - L1044
ISHIZUKA,K. ET AL., PSYCHIATRY CLIN.NEUROSCI., vol. 51, 1997, pages 135 - 138
JANELSINS,M.C. ET AL., J NEUROINFLAMMATION., vol. 2, 2005, pages 23
KATABUCHI, H. ET AL., MED ELECTRON MICROSC., vol. 36, 2003, pages 253 - 262
KITAMOTO, S.; EGASHIRA, K.; TAKESHITA, A., J PHARMACOL SCI., vol. 91, 2003, pages 192 - 196
LI, S. ET AL., J EXP.MED, vol. 202, 2005, pages 617 - 624
LUINI, W. ET AL., CYTOKINE, vol. 6, 1994, pages 28 - 31
MASURE, S. ET AL., J INTERFERON CYTOKINE RES., vol. 15, 1995, pages 955 - 963
MEDA,L. ET AL., J IMMUNOL, vol. 157, 1996, pages 1213 - 1218
MESSER, M., NATURE, vol. 4874, 1963, pages 1299
MOON ET AL., J MED CHEM, vol. 34, 1991, pages 2314 - 2327
OGATA, H. ET AL., J PATHOL., vol. 182, 1997, pages 106 - 114
OHTA, M. ET AL., INT.J ONCOL., vol. 22, 2003, pages 773 - 778
PARK, I. W.; WANG, J. F.; GROOPMAN, J. E., BLOOD, vol. 97, 2001, pages 352 - 358
POHL, T. ET AL., PROC NATL ACAD SCI USA, vol. 88, 1991, pages 10059 - 10063
PROOST, P. ET AL., J IMMUNOL, vol. 160, 1998, pages 4034 - 4041
ROGERS,J.; LUE,L.F., NEUROCHEM.INT., vol. 39, 2001, pages 333 - 340
SAIURA, A. ET AL., ARTERIOSCLER. THROMB. VASC. BIOL., vol. 24, 2004, pages 1886 - 1890
SCHEPERS, A., ARTERIOSCLER THROMB VASE BIOL., vol. 26, 2006, pages 2063 - 2069
See also references of EP2117540A1
SZCZEPANIK,A.M. ET AL., J NEUROIMMUNOL., vol. 113, 2001, pages 49 - 62
T.W. GREENE; P.G.M. WUTS: "Protective Groups in Organic Synthesis", 1991, JOHN WILEY & SONS
UGUCCIONI, M. ET AL., EUR J IMMUNOL, vol. 25, 1995, pages 64 - 68
VAN DAMME, J. ET AL., CHEM IMMUNOL, vol. 72, 1999, pages 42 - 56
VENKATACHALAM ET AL., BIOORGANIC MED CHEM LETT, vol. 11, 2001, pages 523 - 528
WADA, T. ET AL., J AM.SOC.NEPHROL., vol. 15, 2004, pages 940 - 948
WHITE, F. A. ET AL., PROC. NATL. ACAD.SCI.U.S.A, 2005
WRIGHT ET AL., J MED CHEM, vol. 29, 1986, pages 523 - 530
WRIGHT ET AL., J MED CHEM, vol. 30, 1987, pages 2277 - 2283
XIA,M.Q.; HYMAN,B.T, J NEUROVIROL, vol. 5, 1999, pages 32 - 41
YAMAMOTO, M. ET AL., AM.J PATHOL., vol. 166, 2005, pages 1475 - 1485
ZHANG, Y. J. ET AL., J BIOL.CHEM, vol. 269, 1994, pages 15918 - 15924

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011036047A1 (en) * 2009-09-23 2011-03-31 Aziende Chimiche Riunite Angelini Francesco A.C.R.A.F. S.P.A. Pharmaceutical composition for the treatment of mcp-1 mediated inflammatory diseases
CN102573827A (en) * 2009-09-23 2012-07-11 方济各安吉利克化学联合股份有限公司 Pharmaceutical composition for the treatment of MCP-1 mediated inflammatory diseases
EA021485B1 (en) * 2009-09-23 2015-06-30 Ацьенде Кимике Рьюните Анджелини Франческо А.К.Р.А.Ф. С.П.А. Pharmaceutical composition for the treatment of mcp-1 mediated inflammatory diseases
AU2010297405B2 (en) * 2009-09-23 2016-05-26 Aziende Chimiche Riunite Angelini Francesco A.C.R.A.F. S.P.A. Pharmaceutical composition for the treatment of MCP-1 mediated inflammatory diseases
US9492542B2 (en) 2009-09-23 2016-11-15 Aziende Chimiche Riunite Angelini Francesco A.C.R.A.F. S.P.A. Pharmaceutical composition for the treatment of MCP-1 mediated inflammatory diseases
KR101774402B1 (en) * 2009-09-23 2017-09-04 아지엔드 키미쉐 리유나이트 안젤리니 프란체스코 에이.씨.알.에이.에프. 에스.피.에이 Pharmaceutical composition for the treatment of mcp-1 mediated inflammatory diseases
JP2013519891A (en) * 2010-02-18 2013-05-30 プロビオドルグ エージー Method for diagnosing inflammatory diseases by determining pyroglutamate-modified MCP-1 and method for screening for inhibitors of glutaminyl cyclase
WO2019022600A1 (en) * 2017-07-24 2019-01-31 Stichting Het Nederlands Kanker Instituut-Antoni van Leeuwenhoek Ziekenhuis Treating pathological conditions by direct and indirect targeting of sirpa - cd47 interaction
EP3747437A1 (en) * 2017-07-24 2020-12-09 Stichting Het Nederlands Kanker Instituut- Antoni van Leeuwenhoek Ziekenhuis Treating pathological conditions by direct and indirect targeting of sirpa - cd47 interaction
EP3747438A1 (en) * 2017-07-24 2020-12-09 Stichting Het Nederlands Kanker Instituut- Antoni van Leeuwenhoek Ziekenhuis Treating pathological conditions by direct and indirect targeting of sirpa - cd47 interaction
AU2018308191B2 (en) * 2017-07-24 2023-12-21 Scenic Immunology B.V. Treating pathological conditions by direct and indirect targeting of SIRPa - CD47 interaction
US11834440B2 (en) 2021-06-24 2023-12-05 Insilico Medicine Ip Limited Beta-lactam derivatives for the treatment of diseases

Also Published As

Publication number Publication date
CA2679446A1 (en) 2008-09-04
AU2008220785A1 (en) 2008-09-04
EA200901140A1 (en) 2010-04-30
IL200315A0 (en) 2010-04-29
EP2117540A1 (en) 2009-11-18
JP5930573B2 (en) 2016-06-15
AU2008220785B2 (en) 2013-02-21
JP2010520168A (en) 2010-06-10
CA2679446C (en) 2016-05-17
MX2009009234A (en) 2009-12-01
ZA200905537B (en) 2010-10-27
EP2481408A3 (en) 2013-01-09
NZ579310A (en) 2012-03-30
KR20090115951A (en) 2009-11-10
IL200315A (en) 2017-08-31
EP2481408A2 (en) 2012-08-01
CN101668525A (en) 2010-03-10

Similar Documents

Publication Publication Date Title
US8338120B2 (en) Method of treating inflammation with glutaminyl cyclase inhibitors
CA2679446C (en) New use of glutaminyl cyclase inhibitors
AU2018246382C1 (en) Novel inhibitors
EP2118101B1 (en) Imidazo [1,5-a] pyridine derivatives as inhibitors of glutaminyl cyclase
US8809010B2 (en) Method for prophylactic treatment of alzheimer&#39;s disease using inhibitors of glutaminyl cyclase and glutamate cyclases
EP2142513B1 (en) Nitrovinyl-diamine derivatives as glutaminyl cyclase inhibitors
EP2865670B1 (en) Thiourea derivatives as glutaminyl cyclase inhibitors
CA2735795C (en) Novel inhibitors
EP2142515B1 (en) Nitrovinyl-diamine derivatives as glutaminyl cyclase inhibitors
US9181233B2 (en) Inhibitors of glutaminyl cyclase
US20120283259A1 (en) Novel inhibitors
EP2560953B1 (en) Inhibitors of glutaminyl cyclase
US20120184518A1 (en) Methods of treating or preventing an inflammatory disease or condition using glutaminyl cyclase inhibitors
JP2014148508A (en) Novel use of glutaminyl cyclase inhibitor
GB2447017A (en) New use for inhibitors of glutaminyl peptide cyclotransferinase

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200880011673.X

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08717208

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 200315

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2679446

Country of ref document: CA

Ref document number: 579310

Country of ref document: NZ

Ref document number: MX/A/2009/009234

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2008220785

Country of ref document: AU

Ref document number: 2009551208

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 1020097018475

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2008717208

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 200901140

Country of ref document: EA

ENP Entry into the national phase

Ref document number: 2008220785

Country of ref document: AU

Date of ref document: 20080228

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: PI0808170

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20090831

WWE Wipo information: entry into national phase

Ref document number: 1020147027487

Country of ref document: KR