WO2008061192A2 - Stabilized maml peptides and uses thereof - Google Patents
Stabilized maml peptides and uses thereof Download PDFInfo
- Publication number
- WO2008061192A2 WO2008061192A2 PCT/US2007/084838 US2007084838W WO2008061192A2 WO 2008061192 A2 WO2008061192 A2 WO 2008061192A2 US 2007084838 W US2007084838 W US 2007084838W WO 2008061192 A2 WO2008061192 A2 WO 2008061192A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- alkyl
- modified polypeptide
- amino acids
- independently
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CCCNC*C*C(C)C1CC1 Chemical compound CCCNC*C*C(C)C1CC1 0.000 description 3
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- Notch receptors are transmembrane receptors that involved in a variety of important signaling pathways. Mutations in human NOTCH 1 are commonly found in human T cell acute lymphoblastic leukemias (T-ALL) and it is thought that abno ⁇ nalities in Notch signaling are involved in other cancers.
- T-ALL human T cell acute lymphoblastic leukemias
- the Notch signaling pathway is complex.
- an appropriate ligand binds to Notch a proteolytic event occurs which allows a portion of the Notch receptor called ICN to enter the cell nucleus where is interacts with CSL, a transcription factor that binds DNA, and a protein that is a member of the Mastermind-like
- MAML (MAML) family.
- the assembled complex can active transcription of certain genes. It is known that certain fragments of MAML (e.g., within amino acids 13-74 of human MAML-I) can act to interfere with Notch activation of transcription.
- cross-linked polypeptides contain at least two modified amino acids that together form an internal cross-link (also referred to as a tether) that can help to stabilize the alpha-helical secondary structure that is thought to be important for binding of M AML peptides to the Notch transcription complex, a complex that includes ICN and CSL. It is thought that the constrained secondary structure can increase resistance of the polypeptide to proteolytic cleavage. Accordingly, a cross- linked polypeptide described herein can have improved biological activity relative to a corresponding polypeptide that is not cross-linked.
- the cross-linked polypeptides described herein can be used therapeutically, e.g., to treat a variety of cancers in a subject.
- Inhibitors of Notch function may be useful in reducing unwanted immune responses, undesirable angiogenesis, treatment of human T cell acute lymphoblastic leukemias, treatment of mucoepidermoid carcinomas, treatment of breast cancer, treatment of mcdulloblastoma, and treatment of pancreatic cancer, treatment of lung cancer, treatment of ovarian cancer, treatment of atherosclerosis (e.g., heart disease), treatment of melanoma, treatment of colon cancer, and treatment of cancers that exhibit resistance to gamma secretase inhibitors.
- the invention features a modified polypeptide of Formula (I),
- each Ri and R2 are independently H or a Ci to Cio alkyl, alkcnyl, alkynyl, arylalky], cycloalkylalkyl, hctcroarylalkyl, or heterocyclylalkyl;
- Rj is alkyl, alkenyl, alkynyl; [R 4 -K.-R 4 ],,; each of which is substituted with 0-
- R4 is alkyl, alkenyl, or alkynyl
- R 5 is halo, alkyl, OR 6 , N(R 6 ) 2 , SR 6 , SOR 6 , SO 2 R 6 , CO 2 Re, Re, a fluorescent moiety, or a radioisotope;
- K is O, S, SO, SO 2 , CO 1 CO 2 , CONR 6 , or * ⁇ ;
- R 6 is H, alkyl, or a therapeutic agent; n is 3, 4 or 6; x is an integer from 2-10; w and y arc independently an integer from 0-100 ( e.g., 1 , 2 3, 4, 5, 6 or 7); 7.
- each Xaa is independently an amino acid
- the polypeptide comprises at least 8 (e.g., 8, 9, 10, 11, 12, 13 or more) contiguous amino acids of SEQ ID NO: 1, 2, 3, 4, 5, 6 or 7 except that: (a) within the 8 contiguous amino acids of SEQ ID NO:1, 2, 3, 4, 5, 6 or 7 the side chains of at least one pair of amino acids separated by 3, 4 or 6 amino acids is replaced by the linking group R 3 which connects the alpha carbons of the pair of amino acids as depicted in formula 1; and (b) the alpha carbon of the first of the pair of amino acids is substituted with Ri as depicted in formula I and the alpha carbon of the second of the pair of amino acids is substituted with R 2 as depicted in formula I or a pharmaceutically acceptable salt thereof.
- SEQ ID NO: 1 is a sequence created from an alignment of human M ⁇ ML- 1 , 2, and 3, starting at amino acid 19 of MAML-I and extending to amino acid 61.
- SEQ ID NOs:2 - 4 respectively are the amino acid sequences of MAML-1 , 2 and 3 over this same region.
- SEQ ID NOs:5 - 7 respectively are the amino acid sequences of MAML-1 , 2 and 3 over a somewhat larger region.
- Xaa 3 is Ala or Thr
- Xaa 4 is Via or lie; Xaas is Met or VaI;
- Xaaio is Arg, Ala, or GIn
- Xaai3 is GIu or Ala
- Xaa i4 is Leu, VaI or GIy Xaa ⁇ o is Ser, Leu or VaI
- Xaa 2 i is Thr, Scr or Asn
- Xaa 24 is Arg, GIy or Asn
- Xaa 2 7 is GIu or GIn
- Xaa 28 is Ala, Arg or GIn Xaa 29 is VaI, GIy or Ala
- Xaa3o is Ser, Arg or GIn
- Xaa 34 Leu or Ser Xaa 3 s is GIu or Asp
- Xaa 3 9 is GIn GIu or Arg Asp Xaa 42 is Phc, Leu or VaI Xa& ⁇ 3 is ⁇ la, Gin or Scr Xaa ⁇ is His, Leu or Tyr Ser Xaa»7 is Arg or Leu
- SEQ ID NO:1 the following pairs of amino acid can be cross-linked: 2/9, 6/13, 13/17, 17/20, 20/27, 20/24, 35/39, 39/46, and 39/43.
- the corresponding residues in SEQ ID NOs:2-8 can be cross-linked.
- SEQ ID NO:2 (MAML-I ; amino acids 19-62): VMERLRRRIELCRRHHSTCEARYEA VSPERLELEROHTFALHQR
- SEQ ID NO:3 (MAML-2):
- SEQ ID NO:4 (MAML-3):
- SEQ ID NO:5 (MAML-I ; includes predicted domain for binding the transcription complex):
- SEQ ID NO:6 (MAML-2; includes predicted domain for binding the transcription complex):
- SEQ ID NO:7 (MAML-3; includes predicted domain for binding the transcription complex): AVPKHSTVVERLRQRIEGCRRHHVNCENRYQQAQVEQLFXERRDTVSLYQR TLEQRAKKS
- the modified polypeptide binds a complex of ICN and CSL, e.g., ICN and CSL bound to DNA.
- each y is independently an integer between 3 and 15.
- each y is independently an integer between 1 and 15.
- Ri and Ri are each independently H or Ci-C ⁇ alkyl.
- Ri and R 2 are each independently Ci-Cj alkyl.
- At least one of Ri and R 2 arc methyl.
- Ri and R 2 arc both methyl.
- R3 is alkyl (e.g., Cg alkyl) and x is 3.
- R 3 is Ci 1 alkyl and x is 6.
- R 3 is alkenyl (e.g., Cg alkenyl) and x is 3.
- x is 6 and Rj is Cu alkenyl.
- R 3 is a straight chain alkyl, alkenyl, or alkynyl.
- the two alpha, alpha disubstitutcd stereocenters are both in the R configuration or S configuration (e.g., i, i+4 crosslink), or one stcreocentcr is R and the other is S (e.g., i, i+7 cross-link).
- the C and C" disubstituted stereocenters can both be in the R configuration or they can both be in the S configuration, for example when x is 3.
- x 6
- the C disubstituted stereocenter is in the R configuration
- the C" disubstituted stereocenter is in the S configuration.
- the R 3 double bond may be in the E or Z stereochemical configuration.
- R 3 is [R 4 -K-R ⁇ n ; and R 4 is a straight chain alkyl, alkenyl, or alkynyl.
- the polypeptide includes an amino acid sequence which is at least about 60% (70%, 80%, 85%, 90%, 95% or 98%) identical to the amino acid sequence of
- the modified polypeptide comprises at least 8 contiguous amino acids of
- HSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAK AKR (SEQ ID NO:8). except that at least one pair of amino acids within the 8 (e.g., 8, 9, 10, 1 1 , 12, 13 or more) contiguous amino acids are replaced by modified amino acids that can form an internal cross-link.
- the tether can include an alkyl, alkenyl, or alkynyl moiety (e.g., C5, Cs or
- the tethered amino acid can be alpha disubstituted (e.g., C 1 -C3 or methyl).
- [Xaa] y and [Xaa] w are peptides that can independently comprise at least 1 , 2 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 25 or more contiguous amino acids of a MAML polypeptide and
- [Xaa] x is a peptide that can comprise 3 or 6 contiguous amino acids of acids of a MAML peptide.
- the polypeptide can comprise 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50 amino acids of a MAML polypeptide (e.g., human MAML-I , 2 or 3 or a consensus MAML polypeptide).
- the amino acids are contiguous except that one or more pairs of amino acids separated by 3 or 6 amino acids arc replaced by amino acid substitutes that form a cross-link, e.g., via R 3 .
- at least two amino acids can be replaced by tethered amino acids or tethered amino acid substitutes.
- [Xaa] y and [Xaa] y - can each comprise contiguous polypeptide sequences from the same or different MAML peptides.
- the polypeptide comprises an amino acid sequence selected from SEQ ID NOs:8, 9 and 10 wherein: (a) the side chains of amino acids 8 and 12 arc replaced by the linking group R 3 which connects the alpha carbons of amino acids 8 and 12 as depicted in formula 1; and (b) the alpha carbon of amino acid 8 is substituted with Ri as depicted in formula I and the alpha carbon of amino acid 12 is substituted with R 2 as depicted in formula I.
- the invention features cross-linked polypeptides comprising at least 8 (e.g.,
- polypeptide acts as dominant negative inhibitor of Notch.
- the polypeptide also includes a fluorescent moiety or radioisotope.
- Ri and R 2 arc methyl; R 3 is C» alkyl, Ci 1 alkyl, C « alkenyl,
- the polypeptide includes an PEG, tat protein, affinity label, a targeting moiety, and/or a biotin moiety.
- the invention features a method of making a polypeptide of Formula (III), including providing a polypeptide of Formula (II); and
- each R i and R 2 are independently H, alky], alkenyl, alkynyl, arylalkyl, cycloalkylalkyl; heteroarylalkyl; or heterocyclylalkyl; each n is independently an integer from 1-15; x is 2, 3, or 6 w and y are independently an integer from 0-100; z is an integer from 1 -10 (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10); and each Xaa is independently an amino acid;
- the polypeptide binds to a complex of ICN and CSL.
- the catalyst is a ruthenium catalyst.
- the method also includes providing a reducing or oxidizing agent subsequent to the ring closing metathesis.
- the reducing agent is H 2 or the oxidizing agent is osmium tetroxidc
- the invention features a method of treating a subject including administering to the subject any of the compounds described herein. In some instances, the method also includes administering an additional therapeutic agent.
- the invention features a method of treating cancer in a subject including administering to the subject any of the compounds described herein. In some instances, the method also includes administering an additional therapeutic agent.
- the invention features a library of the compounds described herein.
- stable refers to compounds which possess stability sufficient to allow manufacture and which maintains the integrity of the compound for a sufficient period of time to be useful for the purposes detailed herein (e.g., therapeutic administration to a subject or generation of reagents to study or discover a biological pathway cither in vitro or in vivo).
- the compounds of this invention may contain one or more asymmetric centers and thus occur as racemates and racemic mixtures, single enantiomers, individual diastcreomers and diastercomcric mixtures. All such isomeric forms of these compounds are expressly included in the present invention.
- the compounds of this invention may also be represented in multiple tautomeric forms, in such instances, the invention expressly includes all tautomeric forms of the compounds described herein (e.g., alkylation of a ring system may result in alkylation at multiple sites, the invention expressly includes all such reaction products). All such isomeric forms of such compounds are expressly included in the present invention. All crystal forms of the compounds described herein are expressly included in the present invention.
- amino acid refers to a molecule containing both an amino group and a carboxyl group.
- Suitable amino acids include, without limitation, both the D- and L- isomers of the 20 common naturally occurring amino acids found in peptides (e.g., A, R, N, C, D, Q, E, G, H, I, L, K, M, F, P, S, T, W, Y, V (as known by the one letter abbreviations)) as well as the naturally occurring and unnaturally occurring amino acids prepared by organic synthesis or other metabolic routes.
- the tabic below provides the structures of the side chains for each of the 20 common naturally-occurring amino acids. In this table the "-" at right side of each structure is the bond to the alpha carbon.
- non-essential amino acid residue is a residue that can be altered from the wild-type sequence of a polypeptide (without abolishing or substantially altering its activity.
- An "essential” amino acid residue is a residue that, when altered from the wild-type sequence of the polypeptide, results in abolishing or substantially abolishing the polypeptide activity.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- ⁇ when used as part of a molecular structure refers to a single bond or a trans or cis double bond.
- amino acid side chain refers to a moiety attached to the ⁇ -carbon in an amino acids.
- amino acid side chain for alanine is methyl
- amino acid side chain for phenylalanine is phenylmethyl
- amino acid side chain for cysteine is thiomcthyl
- amino acid side chain for aspartate is carboxymcthyl
- amino acid side chain for tyrosine is 4-hydroxyphcnylmethyl, etc.
- Other non- naturally occurring amino acid side chains are also included, for example, those that occur in nature (e.g., an amino acid metabolite) or those that are made synthetically (e.g., an alpha di-substitutcd amino acid).
- polypeptide encompasses two or more naturally occurring or synthetic amino acids linked by a covalcnt bond (e.g., a amide bond).
- Polypeptides as described herein include full length proteins (e.g., fully processed proteins) as well as shorter amino acids sequences (e.g., fragments of naturally occurring proteins or synthetic polypeptide fragments).
- halo refers to any radical of fluorine, chlorine, bromine or iodine.
- alkyl refers to a hydrocarbon chain that may be a straight chain or branched chain, containing the indicated number of carbon atoms. For example, Ci- Cio indicates that the group may have from 1 to 10 (inclusive) carbon atoms in it. In the absence of any numerical designation, “alkyl” is a chain (straight or branched) having 1 to 20 (inclusive) carbon atoms in it.
- alkylene refers to a divalent alkyl (i.e., -R-).
- alkenyl refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon double bonds.
- the alkenyl moiety contains the indicated number of carbon atoms. For example, C 2 -C 10 indicates that the group may have from 2 to 10 (inclusive) carbon atoms in it.
- lower alkenyl refers to a Ci-Cg alkenyl chain. In the absence of any numerical designation, "alkenyl” is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
- alkynyl refers to a hydrocarbon chain that may be a straight chain or branched chain having one or more carbon-carbon triple bonds.
- the alkynyl moiety contains the indicated number of carbon atoms. For example, C 2 -C 1 0 indicates that the group may have from 2 to 10 (inclusive) carbon atoms in it.
- lower alkynyl refers to a C ⁇ -C S alkynyl chain. In the absence of any numerical designation, “alkynyl” is a chain (straight or branched) having 2 to 20 (inclusive) carbon atoms in it.
- aryl refers to a 6-carbon monocyclic or 10-carbon bicyclic aromatic ring system wherein 0, 1, 2, 3, or 4 atoms of each ring may be substituted by a substitucnt. Examples of aryl groups include phenyl, naphthyl and the like.
- arylalkyl or the term “aralkyl” refers to alkyl substituted with an aryl.
- arylalkoxy refers to an alkoxy substituted with aryl.
- cycloalkyl as employed herein includes saturated and partially unsaturated cyclic hydrocarbon groups having 3 to 12 carbons, preferably 3 to 8 carbons, and more preferably 3 to 6 carbons, wherein the cycloalkyl group additionally may be optionally substituted.
- Preferred cycloalkyl groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohcxyl, cyclohcxcnyl, cycloheptyl, and cyclooctyl.
- heteroaryl refers to an aromatic 5-8 membered monocyclic, 8-12 mcmbcrcd bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1 , 2, 3, or 4 atoms of each ring may be substituted by a substituent.
- heteroaryl groups include pyridyl, furyl or furanyl.
- heteroarylalkyl or the term “heteroaralkyl” refers to an alkyl substituted with a heteroaryl.
- heteroarylalkoxy refers to an alkoxy substituted with heteroaryi.
- heterocyclyl refers to a nonaromatic 5-8 membered monocyclic
- 8-12 membered bicyclic, or 11 - 14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1 -9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1 -6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively), wherein 0, 1, 2 or 3 atoms of each ring may be substituted by a substituent.
- hetcrocyclyl groups include piperazinyl, pyrrolidinyl, dioxanyl, morpholinyl, tetrahydrofuranyl, and the like.
- substituted refers to a group “substituted” on an alkyl, cycloalkyl, aryl, hetcrocyclyl, or heteroaryl group at any atom of that group.
- Suitable substituents include, without limitation, halo, hydroxy, mcrcapto, oxo, nitro, haloalkyl, alkyl, alkaryl, aryl, aralkyl, alkoxy, thioalkoxy, aryloxy, amino, alkoxycarbonyl, amido, carboxy, alkancsulfonyl, alkylcarbonyl, and cyano groups.
- FlG 1 depicts MAML polypeptides and locations for modification
- FIG 2 depicts a synthetic strategy for the generation of ⁇ ,odisubstituted non-natural amino acids containing olefinic side chains.
- FIG 3 depicts certain MAML polypeptides used in studies described herein.
- FlG 4 depicts a stapled MAML polypeptide.
- FIG. 5 depicts a CD spectra of a stapled polypeptide.
- FIG 6 depicts stapled MAML polypeptides.
- FIG 7 depicts the results of surface plasmon resonance showing that
- FIG 7 depicts the results of surface plasmon resonance showing that immobilized ICN associates with CSL in a dose-dependent manner.
- FIG. 9 depicts the results of studies examining the binding of immobilized stapled and unstapled SAHNl 1 to ICNl .
- FIG. 10 depicts the results of studies on cellular uptake of SAHNl , SAHN2 and S ⁇ HN6.
- FIG. 1 1 depicts the results of studies on cellular uptake of stapled and unstapled SAHNl .
- FlG. 12 depicts the results of a study showing that stapled SAHN 1 1 reduces expression of the CSL-responsive reporter in a dose-depcndcnt manner.
- FIG. 13 depicts the results of a study showing that T-ALLl cells exposed to either SAHN 11 -FlTC or SAHNl-FITC exhibit reduced HESl expression relative to expression of a housekeeping gene.
- FlG. 14 depicts the results of a study showing that stapled SAHN2 reduces the viability of MOLT4 cells.
- FIG. 15 depicts the results of a study showing that stapled SAHNl, but not unstapled SAHN l , reduces the viability of ALL-SIL cells.
- FIG. 16 depicts the results of a study showing that stapled SAHN 1, but not unstapled SAHNl , reduces the viability of KOPTKl cells.
- FlG. 17 depicts the results of a study showing that stapled SAHN 11 reduces the viability of MOLT4 cells.
- FlG. 18 depicts the results of a study showing that stapled SAHNl 1 reduces the viability of TALLl cells.
- FIG. 19 depicts the results of a study showing that SAHNl , but not SAHN l- D can bind to ICN 1 /CSL in T-ALL cellular lysates.
- FlG. 20 depicts the results of a study showing that SAHNl can compete off ICN l bound to MAML in T-ALL cellular lysates.
- FIG. 21 depicts the results of a study showing that SAHN l -D cannot compete off ICNl bound to MAML in T-ALL cellular lysates
- FIG. 22 depicts the results of a study showing that SAHN 1 and SAHN 1 1 can cause a decrease in transcription from a CSL-responsive reporter in T-ALL cells.
- FIG. 23 depicts the results of a study showing that SAHNl , but not SANNl- D n cause a decrease in transcription from a CSL-responsive endogenous genes in T- ALL cells.
- FlG. 24 depicts the results of a study showing that SAHNl can elicit an apoptotic response in T-ALL cells.
- FIG. 25 depicts the results of a study showing that SAHNl decreases the viability of MOLT4 T-ALL cells.
- the polypeptides include a tether between two non-natural amino acids, which tether significantly enhances the alpha helical secondary structure of the polypeptide.
- a peptide (sometimes referred to as staple) extends across the length of one or two helical turns (i.e., about 3.4 or about 7 amino acids). Accordingly, amino acids positioned at i and i+3; i and i+4; or i and i+7 are ideal candidates for chemical modification and cross-linking.
- a peptide has the sequence ...Xaai, Xaai, Xaa.i, Xa&j, Xaas, Xa& ⁇ , Xaa7, Xaa 8 , Xaa$...
- cross-links between Xaai andXaa ⁇ , or between Xaai and Xaas, or between Xaai andXaag are useful as are cross-links between Xaai and Xaas, or between Xaa? and Xaa6, or between Xaa ⁇ and Xaa9, etc.
- the polypeptides can include more than one crosslink within the polypeptide sequence to cither further stabilize the sequence or facilitate the stabilization of longer polypeptide stretches.
- polypeptides are too long to be readily synthesized in one part, independently synthesized cross-linked peptides can be conjoined by a technique called native chemical ligation (Bang, et al., J. Am. Chem Soc. 126:1377).
- native chemical ligation a technique called native chemical ligation (Bang, et al., J. Am. Chem Soc. 126:1377).
- the novel cross-linked polypeptides are useful, for example, to mimic or study proteins or polypeptides having one or more alpha-helical domains.
- FIG. 2 is a schematic depiction of the preparation of the non-natural amino acid (Fmoc- S5) used in solid phase peptide synthesis (SPPS) of i linked to i+4 peptides (one turn of the alpha helix is stabilized).
- SPPS solid phase peptide synthesis
- i linked to i+7 staple two turns of the helix stabilized
- R8 is synthesized using the same route, except that the starting chiral auxiliary confers the R-alkyl-stcreoisomer.
- 8-iodooctene is used in place of 5- iodopentenc.
- Inhibitors are synthesized on a solid support using solid-phase peptide synthesis (SPPS) on MBHA resin. Non-natural amino acids were synthesized by Moellering for incorporation into the final peptide product.
- REM-Gl to REM-Gl 3, also called SAHNl to SAHN 13, respectively Various internally cross-linked peptides (REM-Gl to REM-Gl 3, also called SAHNl to SAHN 13, respectively) shown in FIG. 3 were produced (X is a modified amino acid forming a cross-link).
- X is a modified amino acid forming a cross-link).
- the underlined portions indicate the extent of each polypeptide, and the remainder of the MAML-I sequence in each case is provided for context.
- FIG. 4 is a schematic drawing and detailed structural depiction of a modified polypeptide having the sequence of REM-Gl (SAHNl). As seen in the circular dichromism spectra of FlG. 5, the modified polypeptide can be 96% alpha helical as compared to 40% when not cross-linked.
- FIG. 6 shows the detailed structure of versions of the modified, internally cross-linked polypeptide REM-Gl 1 (SAHN l 1 ) that include either biotin or FITC labels.
- Biochemical association between stapled peptides and the Notch complex was also investigated using surface plasmon resonance. These studies employed immobilized ICN protein (an anti-GST antibody and a GST-tagged, purified ICN protein comprising the RAM and ANK domains). Other studies employed biotinylatcd stapled peptides and a streptavidin-functionalized sensor surface.
- Immunoprecipitation studies using MOLT4 cell lysates, ALL-SIL cell lysates and KOPTKl cell lysates found that biotin labeled SAHNl can be used to pull down ICN.
- a reverse immunoprecipitation assay using FITC labeled SAHN l found that SAHN l can be used to pull down ICN in MOLT4 cell lysates.
- MOLT4 cells transfccted with a CSL-responsive reporter were used to test whether stapled SAHNl 1 can interfere with Notch-mediated activation of transcription. As can be seen in FIG. 12, stapled SAHNl 1 reduced expression of the CSL-responsive reporter in a dose-dependent manner.
- HESl is Notch responsive gene. As shown in FIG. 13, T-ALLl cells exposed to cither SAHNl 1-FITC or SAHNl -FITC exhibit reduced HESl expression relative to expression of a housekeeping gene (beta-actin).
- stapled SAHN2 reduced the viability of MOLT4 cells.
- stapled SAHNl, but not unstapled SAHNl reduced the viability of ALL-SIL cells.
- stapled SAHNl, but not unstapled SAHNl reduced the viability of KOPTKl cells.
- stapled SAHN 1 1 reduced the viability of M0LT4 cells.
- stapled SAHNl 1 reduced the viability of TALLl cells.
- Immobilized SAHNl was used to measure the apparent Kd for a prc- assembled ICN-CSL complex by surface plasmon resonance.
- the result of this analysis revealed an apparent Kd of 98 nM. (1 DON'T THINK THERE IS ANY NEED TO SHOW SLIDE 8)
- a damaged variant of SAHNl was created by changing the GIu indicated by * in the SAHNl depicted in FIG. 6 to an Arg and changing the Arg indicated by + in the SAIiN l depicted in FIG. 6 to GIu.
- This damaged variant which has the same net charge as SANNl, is referred to as SAHN l-D.
- Immobilized SAHN l-D was used to measure the apparent Kd for a pre- assembled ICN-CSL complex by surface plasmon resonance.
- the result of this analysis revealed an apparent Kd of 1.40 ⁇ M. (I DON'T THINK THERE IS ANY NEED TO SHOW SLIDE 10)
- T-ALL cells harboring a beta-lactamase gene under the control of a CSL responsive promoter was used to study the effect of SAHN l and SAHNl 1 on Notch complex mediated transcription. This study found that both SAHNl and SAHNl 1 decreased transcription and that the decrease was similar in magnitude to that caused by an RNAi directed against Notch and an RNAi directed against lactamase. The results of this analysis are shown in FIG. 22.
- a study in T-ALL cells found that SAHNl, but not SAHNl-D, decrease expression of HES l and HEYl, both Notch-driven genes, in a dose dependent manner. The results of this analysis are show in FIG. 23.
- a study in gamma secretase resistant T-ALL cells found that
- SAHNl is cytotoxic to neoplastic murine lymphocytes derived from transgenic mice harboring the clinically relevant human Notch mutations (a L to P change at position 1601 and a PEST domain mutation).
- hydrocarbon tethers i.e., cross links
- the hydrocarbon tethers i.e., cross links
- a double bond of a hydrocarbon alkenyl tether (e.g., as synthesized using a ruthenium-catalyzed ring closing metathesis (RCM)) can be oxidized (e.g., via epoxidation or dihydroxylation) to provide one of compounds below.
- RCM ruthenium-catalyzed ring closing metathesis
- Either the epoxide moiety or one of the free hydroxyl moieties can be further funclionalized.
- the epoxide can be treated with a nucleophile, which provides additional functionality that can be used, for example, to attach a tag (e.g., a radioisotope or fluorescent tag).
- a tag e.g., a radioisotope or fluorescent tag.
- the tag can be used to help direct the compound to a desired location in the body or track the location of the compound in the body.
- an additional therapeutic agent can be chemically attached to the functionalized tether (e.g., an anti-cancer agent such as rapamycin, vinblastine, taxol, etc.).
- Such derivitization can alternatively be achieved by synthetic manipulation of the amino or carboxy terminus of the polypeptide or via the amino acid side chain.
- Other agents can be attached to the functionalized tether, e.g., an agent that facilitates entry of the polypeptide into cells.
- the tether can include one or more of an ether, thiocthcr, ester, amine, or amide moiety.
- a naturally occurring amino acid side chain can be incorporated into the tether.
- a tether can be coupled with a functional group such as the hydroxyl in serine, the thiol in cysteine, the primary amine in lysine, the acid in aspartate or glutamate, or the amide in asparaginc or glutaminc.
- the length of the tether can be varied. For instance, a shorter length of tether can be used where it is desirable to provide a relatively high degree of constraint on the secondary alpha-helical structure, whereas, in some instances, it is desirable to provide less constraint on the secondary alpha-helical structure, and thus a longer tether may be desired.
- tethers spanning from amino acids i to i+3, i to i+4; and i to i+7 have been described in order to provide a tether that is primarily on a single face of the alpha helix, the tethers can be synthesized to span any combinations of numbers of amino acids.
- alpha disubstituted amino acids are used in the polypeptide to improve the stability of the alpha helical secondary structure.
- alpha disubstituted amino acids are not required, and instances using mono-alpha substituents (e.g., in the tethered amino acids) are also envisioned.
- peptides of this invention can be made by chemical synthesis methods, which are well known to the ordinarily skilled artisan. See, for example, Fields et al., Chapter 3 in Synthetic Peptides: A User's Guide, cd. Grant, W. H. Freeman & Co., New York, N.Y., 1992, p. 77. Hence, peptides can be synthesized using the automated Merrif ⁇ eld techniques of solid phase synthesis with the 0NH 2 protected by either t-Boc or F-moc chemistry using side chain protected amino acids on, tor example, an Applied Biosystcms Peptide Synthesizer Model 430A or 431.
- One manner of making of the peptides described herein is using solid phase peptide synthesis (SPPS).
- SPPS solid phase peptide synthesis
- the C-tcrminal amino acid is attached to a cross-linked polystyrene resin via an acid labile bond with a linker molecule.
- This resin is insoluble in the solvents used for synthesis, making it relatively simple and fast to wash away excess reagents and by-products.
- the N-terminus is protected with the Fmoc group, which is stable in acid, but removable by base. Any side chain functional groups are protected with base stable, acid labile groups. Longer peptides could be made by conjoining individual synthetic peptides using native chemical ligation.
- the longer synthetic peptides can be synthesized by well known recombinant DNA techniques. Such techniques are provided in well-known standard manuals with detailed protocols.
- To construct a gene encoding a peptide of this invention the amino acid sequence is reverse translated to obtain a nucleic acid sequence encoding the amino acid sequence, preferably with codons that are optimum for the organism in which the gene is to be expressed.
- a synthetic gene is made, typically by synthesizing oligonucleotides which encode the peptide and any regulatory elements, if necessary.
- the synthetic gene is inserted in a suitable cloning vector and transfected into a host cell.
- the peptide is then expressed under suitable conditions appropriate for the selected expression system and host.
- the peptide is purified and characterized by standard methods.
- the peptides can be made in a high-throughput, combinatorial fashion, e.g., using a high-throughput multiple channel combinatorial synthesizer available from Advanced Chemtech.
- a high-throughput multiple channel combinatorial synthesizer available from Advanced Chemtech.
- the modified polypeptides one or more conventional peptide bonds replaced by an a different bond that may increase the stability of the polypeptide in the body.
- the polypeptides can be further modified by: acetylation, amidation, biotinylation, cinnamoylation, faraesylation, formylation, myristoylation, palmitoylation, phosphorylation (Ser, Tyr or Thr), stearoylation, succinylation and sulfurylation.
- the polypeptides of the invention may also be conjugated to, for example, polyethylene glycol (PEG); alkyl groups (e.g., C1-C20 straight or branched alkyl groups); fatty acid radicals; and combinations thereof.
- the present invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant (e.g., excessive) Notch activity. This is because the polypeptides are expected to act as dominant negative inhibitors of Notch activity.
- treatment is defined as the application or administration of a therapeutic agent to a patient, or application or administration of a therapeutic agent to an isolated tissue or cell line from a patient, who has a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
- a therapeutic agent includes, but is not limited to, small molecules, peptides, antibodies, ribozymes and antisense oligonucleotides.
- the polypeptides of the invention can be used to treat, prevent, and/or diagnose cancers and neoplastic conditions.
- cancer cancer
- hyperprolifcrativc and neoplastic disease states may be categorized as pathologic, i.e., characterizing or constituting a disease state, or may be categorized as non-pathologic, i.e., a deviation from normal but not associated with a disease state.
- the term is meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathologic type or stage of invasiveness.
- "Pathologic hypcrproliferative" cells occur in disease states characterized by malignant tumor growth. Examples of non-pathologic hypcrproliferative cells include proliferation of cells associated with wound repair.
- Examples of cellular proliferative and/or differentiative disorders include cancer, e.g., carcinoma, sarcoma, or metastatic disorders.
- the compounds i.e., polypeptides
- the polypeptides can act as novel therapeutic agents for controlling breast cancer, T cell cancers and B cell cancer.
- the polypeptides may also be useful for treating mucocpidermoid carcinoma and medulloblastoma.
- proliferative disorders examples include hematopoietic neoplastic disorders.
- hematopoietic neoplastic disorders includes diseases involving hyperplastic/neoplastic cells of hematopoietic origin, e.g., arising from myeloid, lymphoid or erythroid lineages, or precursor cells thereof.
- exemplary disorders include: acute leukemias, e.g., erythroblastic leukemia and acute mcgakaryoblastic leukemia.
- myeloid disorders include, but are not limited to, acute promyeloid leukemia (APML), acute myelogenous leukemia (AML) and chronic myelogenous leukemia (CML) (reviewed in Vaickus, L. (1991) Crit Rev. in Oncol./Hcmotol. 11:267-97); lymphoid malignancies include, but are not limited to acute lymphoblastic leukemia (ALL) which includes B- lineage ALL and T-lincage ALL, chronic lymphocytic leukemia (CLL), prolymphocyte leukemia (PLL), multiple mylenoma, hairy cell leukemia (HLL) and Waldenstrom's inacroglobulinemia (WM).
- ALL acute lymphoblastic leukemia
- ALL chronic lymphocytic leukemia
- PLL prolymphocyte leukemia
- HLL hairy cell leukemia
- W Waldenstrom's inacroglobulinemia
- malignant lymphomas include, but are not limited to non-Hodgkin lymphoma and variants thereof, peripheral T cell lymphomas, adult T cell leukemia/lymphoma (ATL), cutaneous T-cell lymphoma (CTCL), large granular lymphocytic leukemia (LGF), Hodgkin's disease and Reed-Stcrnberg disease.
- proliferative breast disease including, e.g., epithelial hyperplasia, sclerosing adenosis, and small duct papillomas
- tumors e.g., stromal tumors such as fibroadenoma, phyllodes tumor, and sarcomas, and epithelial tumors such as large duct papilloma
- carcinoma of the breast including in situ (noninvasive) carcinoma that includes ductal carcinoma in situ (including Paget 's disease) and lobular carcinoma in situ, and invasive (infiltrating) carcinoma including, but not limited to, invasive ductal carcinoma, invasive lobular carcinoma, medullary carcinoma, colloid (mucinous) carcinoma, tubular carcinoma, and invasive papillary carcinoma, and miscellaneous malignant neoplasms.
- Disorders in the male breast include, but are not limited to, gy
- the compounds of this invention including the compounds of formulae described herein, are defined to include pharmaceutically acceptable derivatives or prodrugs thereof.
- a "pharmaceutically acceptable derivative or prodrug” means any pharmaceutically acceptable salt, ester, salt of an ester, or other derivative of a compound of this invention which, upon administration to a recipient, is capable of providing (directly or indirectly) a compound of this invention.
- Particularly favored derivatives and prodrugs arc those that increase the bioavailability of the compounds of this invention when such compounds arc administered to a mammal (e.g., by allowing an orally administered compound to be more readily absorbed into the blood) or which enhance delivery of the parent compound to a biological compartment (e.g., the brain or lymphatic system) relative to the parent species.
- Preferred prodrugs include derivatives where a group which enhances aqueous solubility or active transport through the gut membrane is appended to the structure of formulae described herein.
- the compounds of this invention may be modified by appending appropriate functionalities to enhance selective biological properties. Such modifications are known in the art and include those which increase biological penetration into a given biological compartment (e.g., blood, lymphatic system, central nervous system), increase oral availability, increase solubility to allow administration by injection, alter metabolism and alter rate of excretion.
- Pharmaceutically acceptable salts of the compounds of this invention include those derived from pharmaceutically acceptable inorganic and organic acids and bases.
- suitable acid salts include acetate, adipate, bcnzoate, benzenesulfonate, butyrate, citrate, digluconate, dodecylsulfate, formate, fumarate, glycolate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodidc, lactate, maleate, malonate, methanesulfonatc, 2-naphthalencsulfonate, nicotinate, nitrate, palmoate, phosphate, picrate, pivalate, propionate, salicylate, succinate, sulfate, tartrate, tosylate and undecanoate.
- Salts derived from appropriate bases include alkali metal (e.g., sodium), alkaline earth metal (e.g., magnesium), ammonium and N-(alkyl) 4 salts.
- alkali metal e.g., sodium
- alkaline earth metal e.g., magnesium
- ammonium e.g., ammonium
- N-(alkyl) 4 salts e.g., ammonium
- This invention also envisions the quaternization of any basic nitrogen-containing groups of the compounds disclosed herein. Water or oil-soluble or dispcrsible products may be obtained by such quatcrnization.
- the compounds of the formulae described herein can, for example, be administered by injection, intravenously, intraarterially, subdermally, intraperitoncally, intramuscularly, or subcutaneously; or orally, buccally, nasally, transmucosally, topically, in an ophthalmic preparation, or by inhalation, with a dosage ranging from about 0.001 to about 100 mg/kg of body weight, or according to the requirements of the particular drug.
- the methods herein contemplate administration of an effective amount of compound or compound composition to achieve the desired or stated effect.
- the pharmaceutical compositions of this invention will be administered from about 1 to about 6 times per day or alternatively, as a continuous infusion. Such administration can be used as a chronic or acute therapy.
- the amount of active ingredient that may be combined with the carrier materials to produce a single dosage form will vary depending upon the host treated and the particular mode of administration.
- a typical preparation will contain from about 5% to about 95% active compound (w/w).
- such preparations contain from about 20% to about 80% active compound.
- a maintenance dose of a compound, composition or combination of this invention may be administered, if necessary. Subsequently, the dosage or frequency of administration, or both, may be reduced, as a function of the symptoms, to a level at which the improved condition is retained. Patients may, however, require intermittent treatment on a long-term basis upon any recurrence of disease symptoms.
- compositions of this invention comprise a compound of the formulae described herein or a pharmaceutically acceptable salt thereof; an additional agent including for example, morphine or codeine; and any pharmaceutically acceptable carrier, adjuvant or vehicle.
- Alternate compositions of this invention comprise a compound of the formulae described herein or a pharmaceutically acceptable salt thereof; and a pharmaceutically acceptable carrier, adjuvant or vehicle.
- the compositions delineated herein include the compounds of the formulae delineated herein, as well as additional therapeutic agents if present, in amounts effective for achieving a modulation of disease or disease symptoms.
- pharmaceutically acceptable carrier or adjuvant refers to a carrier or adjuvant that may be administered to a patient, together with a compound of this invention, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the compound.
- Pharmaceutically acceptable carriers, adjuvants and vehicles that may be used in the pharmaceutical compositions of this invention include, but arc not limited to, ion exchangers, alumina, aluminum stcarate, lecithin, self-emulsifying drug delivery systems (SEDDS) such as d- ⁇ -tocopherol polyethylencglycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens or other similar polymeric delivery matrices, scrum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbatc, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidonc, cellulose-based substances, polyethylene glycol, sodium carboxymcthyl
- Tlic pharmaceutical compositions of this invention may be administered orally, parcntcrally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir, preferably by oral administration or administration by injection.
- the pharmaceutical compositions of this invention may contain any conventional non-toxic pharmaceutically-acceptable carriers, adjuvants or vehicles.
- the pH of the formulation may be adjusted with pharmaceutically acceptable acids, bases or buffers to enhance the stability of the formulated compound or its delivery form.
- parenteral as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrastcrnal, intrathecal, intralesional and intracranial injection or infusion techniques.
- the pharmaceutical compositions may be in the form of a sterile injectable preparation, for example, as a sterile injectable aqueous or oleaginous suspension.
- This suspension may be formulated according to techniques known in the art using suitable dispersing or wetting agents (such as, for example, Twecn 80) and suspending agents.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parentcrally acceptable diluent or solvent, for example, as a solution in 1,3-butancdiol.
- suitable vehicles and solvents that may be employed are mannitol, water, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil may be employed including synthetic mono- or diglycerides.
- Fatty acids, such as oleic acid and its glyccridc derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxycthylated versions.
- These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, or carboxymethyl cellulose or similar dispersing agents which arc commonly used in the formulation of pharmaceutically acceptable dosage forms such as emulsions and or suspensions.
- compositions of this invention may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, emulsions and aqueous suspensions, dispersions and solutions.
- carriers which are commonly used include lactose and corn starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried com starch.
- the active ingredient may be suspended or dissolved in an oily phase is combined with emulsifying and/or suspending agents. Jf desired, certain sweetening and/or flavoring and/or coloring agents may be added.
- compositions of this invention may also be administered in the form of suppositories for rectal administration.
- These compositions can be prepared by mixing a compound of this invention with a suitable non-irritating excipient which is solid at room temperature but liquid at the rectal temperature and therefore will melt in the rectum to release the active components.
- suitable non-irritating excipient include, but are not limited to, cocoa butter, beeswax and polyethylene glycols.
- ITic pharmaceutical compositions of this invention may be administered by nasal aerosol or inhalation.
- Such compositions are prepared according to techniques well-known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other solubilizing or dispersing agents known in the art.
- compositions of this invention comprise a combination of a compound of the formulae described herein and one or more additional therapeutic or prophylactic agents
- both the compound and the additional agent should be present at dosage levels of between about 1 to 100%, and more preferably between about 5 to 95% of the dosage normally administered in a monotherapy regimen.
- the additional agents may be administered separately, as part of a multiple dose regimen, from the compounds of this invention. Alternatively, those agents may be part of a single dosage form, mixed together with the compounds of this invention in a single composition.
- the invention provides methods (also referred to herein as "screening assays") for identifying polypeptides which modulate the activity of one or more Notch complexes.
- the binding affinity of polypeptides to Notch can measured using the methods described herein, for example, by using a titration binding assay.
- Notch complex lacking MAML i.e., a complex of ICN and CSL
- a candidate compound i.e., polypeptide
- binding can be measured using surface plasmon resonance to determine the Kd for binding.
- Candidate compounds could also be screened for biological activity in vivo, for example, by measuring expression of a Notch responsive reporter in a suitable cell, e.g., in MOLT-4 cells.
- Cell permeability screening assays in which fluorescently labeled candidate compounds arc applied to intact cells, which arc then assayed for cellular fluorescence by microscopy or high-throughput cellular fluorescence detection can also be used.
- the assays described herein can be performed with individual candidate compounds or can be performed with a plurality of candidate compounds. Where the assays are performed with a plurality of candidate compounds, the assays can be performed using mixtures of candidate compounds or can be run in parallel reactions with each reaction having a single candidate compound.
- the test compounds or agents can be obtained using any of the numerous approaches in combinatorial library methods known in the art.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Urology & Nephrology (AREA)
- Vascular Medicine (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Low-Molecular Organic Synthesis Reactions Using Catalysts (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2009537371A JP2010510236A (ja) | 2006-11-15 | 2007-11-15 | 安定化させたmamlペプチドおよびその使用法 |
| EP07871487A EP2091552A4 (en) | 2006-11-15 | 2007-11-15 | STABILIZED MAML-PEPTIDES AND ITS USES |
| AU2007319193A AU2007319193A1 (en) | 2006-11-15 | 2007-11-15 | Stabilized MAML peptides and uses thereof |
| CA002669696A CA2669696A1 (en) | 2006-11-15 | 2007-11-15 | Stabilized maml peptides and uses thereof |
| US12/478,504 US9074009B2 (en) | 2006-11-15 | 2009-06-04 | Stabilized MAML peptides and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US85937906P | 2006-11-15 | 2006-11-15 | |
| US60/859,379 | 2006-11-15 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/478,504 Continuation US9074009B2 (en) | 2006-11-15 | 2009-06-04 | Stabilized MAML peptides and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2008061192A2 true WO2008061192A2 (en) | 2008-05-22 |
| WO2008061192A3 WO2008061192A3 (en) | 2008-07-10 |
Family
ID=39402481
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2007/084838 Ceased WO2008061192A2 (en) | 2006-11-15 | 2007-11-15 | Stabilized maml peptides and uses thereof |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US9074009B2 (enExample) |
| EP (3) | EP2091552A4 (enExample) |
| JP (2) | JP2010510236A (enExample) |
| AU (1) | AU2007319193A1 (enExample) |
| CA (1) | CA2669696A1 (enExample) |
| WO (1) | WO2008061192A2 (enExample) |
Cited By (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008121767A3 (en) * | 2007-03-28 | 2009-01-08 | Harvard College | Stitched polypeptides |
| WO2010034034A1 (en) * | 2008-09-22 | 2010-03-25 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| WO2010034029A1 (en) * | 2008-09-22 | 2010-03-25 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US20100298201A1 (en) * | 2008-11-24 | 2010-11-25 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles with improved properties |
| WO2010011313A3 (en) * | 2008-07-23 | 2010-12-09 | President And Fellows Of Harvard College | Ligation of stapled polypeptides |
| EP2118123A4 (en) * | 2007-01-31 | 2011-04-20 | Dana Farber Cancer Inst Inc | STABILIZED P53 PEPTIDES AND ITS USES |
| WO2012174409A1 (en) * | 2011-06-17 | 2012-12-20 | President And Fellows Of Harvard College | Stabilized variant maml peptides and uses thereof |
| WO2014055564A1 (en) | 2012-10-01 | 2014-04-10 | President And Fellows Of Harvard College | Stabilized polypeptide insulin receptor modulators |
| US8859723B2 (en) | 2010-08-13 | 2014-10-14 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| WO2014201370A1 (en) | 2013-06-14 | 2014-12-18 | President And Fellows Of Harvard College | Stabilized polypeptide insulin receptor modulators |
| US8927500B2 (en) | 2012-02-15 | 2015-01-06 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US8957026B2 (en) | 2010-09-22 | 2015-02-17 | President And Fellows Of Harvard College | Beta-catenin targeting peptides and uses thereof |
| US8987414B2 (en) | 2012-02-15 | 2015-03-24 | Aileron Therapeutics, Inc. | Triazole-crosslinked and thioether-crosslinked peptidomimetic macrocycles |
| US9074009B2 (en) | 2006-11-15 | 2015-07-07 | Dana-Farber Cancer Institute, Inc. | Stabilized MAML peptides and uses thereof |
| US9096684B2 (en) | 2011-10-18 | 2015-08-04 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US9163330B2 (en) | 2009-07-13 | 2015-10-20 | President And Fellows Of Harvard College | Bifunctional stapled polypeptides and uses thereof |
| WO2015158810A1 (en) | 2014-04-17 | 2015-10-22 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Polypeptides and uses thereof for reducing cd95-mediated cell motility |
| US9175056B2 (en) | 2006-12-14 | 2015-11-03 | Alleron Therapeutics, Inc. | Bis-sulfhydryl macrocyclization systems |
| US9175047B2 (en) | 2009-01-14 | 2015-11-03 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US9206223B2 (en) | 2008-09-22 | 2015-12-08 | Aileron Therapeutics, Inc. | Methods for preparing purified polypeptide compositions |
| CN105307667A (zh) * | 2013-03-13 | 2016-02-03 | 哈佛大学的校长及成员们 | 钉合且缝合的多肽及其用途 |
| US9487562B2 (en) | 2011-06-17 | 2016-11-08 | President And Fellows Of Harvard College | Stabilized polypeptides as regulators of RAB GTPase function |
| US9493509B2 (en) | 2007-02-23 | 2016-11-15 | Aileron Therapeutics, Inc. | Triazole macrocycle systems |
| US9505801B2 (en) | 1999-05-18 | 2016-11-29 | President And Fellows Of Harvard College | Stabilized compounds having secondary structure motifs |
| US9604919B2 (en) | 2012-11-01 | 2017-03-28 | Aileron Therapeutics, Inc. | Disubstituted amino acids and methods of preparation and use thereof |
| US9617309B2 (en) | 2012-09-26 | 2017-04-11 | President And Fellows Of Harvard College | Proline-locked stapled peptides and uses thereof |
| US9878056B2 (en) | 2012-04-02 | 2018-01-30 | Modernatx, Inc. | Modified polynucleotides for the production of cosmetic proteins and peptides |
| US10023613B2 (en) | 2015-09-10 | 2018-07-17 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles as modulators of MCL-1 |
| US10059741B2 (en) | 2015-07-01 | 2018-08-28 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10253067B2 (en) | 2015-03-20 | 2019-04-09 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and uses thereof |
| US10300109B2 (en) | 2009-09-22 | 2019-05-28 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| WO2019178313A1 (en) * | 2018-03-14 | 2019-09-19 | Dana-Farber Cancer Institute, Inc. | Stabilized peptides for biomarker detection |
| US10471120B2 (en) | 2014-09-24 | 2019-11-12 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and uses thereof |
| US10493167B2 (en) | 2012-04-02 | 2019-12-03 | Modernatx, Inc. | In vivo production of proteins |
| US10533039B2 (en) | 2014-05-21 | 2020-01-14 | President And Fellows Of Harvard College | Ras inhibitory peptides and uses thereof |
| US10905739B2 (en) | 2014-09-24 | 2021-02-02 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and formulations thereof |
| US11034720B2 (en) | 2016-07-17 | 2021-06-15 | University Of Utah Research Foundation | Thiol-yne based peptide stapling and uses thereof |
| US11155577B2 (en) | 2015-06-22 | 2021-10-26 | University Of Utah Research Foundation | Thiol-ene based peptide stapling and uses thereof |
| US11198713B2 (en) | 2017-09-07 | 2021-12-14 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7981998B2 (en) * | 2006-12-14 | 2011-07-19 | Aileron Therapeutics, Inc. | Bis-sulfhydryl macrocyclization systems |
| WO2014138429A2 (en) | 2013-03-06 | 2014-09-12 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and use thereof in regulating hif1alpha |
| CN113039195A (zh) | 2018-08-20 | 2021-06-25 | 弗格制药有限公司 | 肽集合、肽试剂及其使用方法 |
Family Cites Families (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1993019176A1 (en) | 1992-03-23 | 1993-09-30 | Imperial Cancer Research Technology Limited | Leucine zippers |
| US5811515A (en) * | 1995-06-12 | 1998-09-22 | California Institute Of Technology | Synthesis of conformationally restricted amino acids, peptides, and peptidomimetics by catalytic ring closing metathesis |
| DE69738326T2 (de) | 1996-07-12 | 2008-07-03 | Mcgill University, Montreal | Verbindungen und verfahren zur regulierung der zellanlagerung |
| US5851775A (en) | 1997-03-20 | 1998-12-22 | Johns Hopkins University | β-catenin, Tcf-4, and APC interact to prevent cancer |
| FR2775187B1 (fr) * | 1998-02-25 | 2003-02-21 | Novartis Ag | Utilisation de l'epothilone b pour la fabrication d'une preparation pharmaceutique antiproliferative et d'une composition comprenant l'epothilone b comme agent antiproliferatif in vivo |
| US6277824B1 (en) | 1998-07-10 | 2001-08-21 | Adherex Technologies | Compounds and methods for modulating adhesion molecule function |
| US7192713B1 (en) * | 1999-05-18 | 2007-03-20 | President And Fellows Of Harvard College | Stabilized compounds having secondary structure motifs |
| CA2284459C (en) | 1999-10-04 | 2012-12-11 | Neokimia Inc. | Combinatorial synthesis of libraries of macrocyclic compounds useful in drug discovery |
| WO2001053331A2 (en) | 2000-01-24 | 2001-07-26 | Adherex Technologies, Inc. | Peptidomimetic modulators of cell adhesion |
| WO2003004645A1 (en) * | 2001-07-03 | 2003-01-16 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Diagnosis and treatment of cancer involving the notch pathway |
| PT2332968T (pt) | 2003-11-05 | 2016-08-17 | Harvard College | Péptidos alfa-helicoidais adequados para a activação ou inibição da morte celular |
| WO2005118620A2 (en) | 2004-05-27 | 2005-12-15 | New York University | Methods for preparing internally constraied peptides and peptidomimetics |
| DE102004033312A1 (de) * | 2004-07-08 | 2006-01-26 | Boehringer Ingelheim Pharma Gmbh & Co. Kg | Kontinuierliches Metatheseverfahren mit Ruthenium-Katalysatoren |
| CA2576293C (en) | 2004-07-12 | 2016-10-04 | Nicola J. Mabjeesh | Agents capable of downregulating an msf-a-dependent hif-1alpha and use thereof in cancer treatment |
| EP2091552A4 (en) | 2006-11-15 | 2010-01-06 | Dana Farber Cancer Inst Inc | STABILIZED MAML-PEPTIDES AND ITS USES |
| BRPI0720306A2 (pt) | 2006-12-14 | 2014-02-04 | Aileron Therapeutics Inc | Sistemas de macrociclização da bis-sufidrila |
| US7981998B2 (en) | 2006-12-14 | 2011-07-19 | Aileron Therapeutics, Inc. | Bis-sulfhydryl macrocyclization systems |
| CN104086641A (zh) | 2007-02-23 | 2014-10-08 | 爱勒让治疗公司 | 三唑大环系统 |
| EP3159352B1 (en) | 2007-03-28 | 2023-08-02 | President and Fellows of Harvard College | Stitched polypeptides |
| EP2247298B1 (en) | 2007-12-31 | 2016-08-31 | New York University | Control of viral-host membrane fusion with hydrogen bond surrogate-based artificial helices |
| WO2009099677A2 (en) | 2008-02-08 | 2009-08-13 | Aileron Therapeutics, Inc. | Therapeutic peptidomimetic macrocycles |
| EP2310407A4 (en) | 2008-04-08 | 2011-09-14 | Aileron Therapeutics Inc | BIOLOGICALLY ACTIVE PEPTIDOMIMETIC MACROCYCLES |
| US20110144303A1 (en) | 2008-04-08 | 2011-06-16 | Aileron Therapeutics, Inc. | Biologically Active Peptidomimetic Macrocycles |
| JP2012503013A (ja) | 2008-09-18 | 2012-02-02 | ニューヨーク ユニバーシティ | HIF−1αと水素結合代替ヘリックスを有するp300/CBPの間の相互作用の阻害 |
| KR101754799B1 (ko) * | 2010-03-26 | 2017-07-07 | 삼성전자주식회사 | 화소 회로, 이를 포함하는 디스플레이 장치 및 디스플레이 장치의 구동방법 |
-
2007
- 2007-11-15 EP EP07871487A patent/EP2091552A4/en not_active Ceased
- 2007-11-15 JP JP2009537371A patent/JP2010510236A/ja active Pending
- 2007-11-15 EP EP12158552A patent/EP2489360A1/en not_active Withdrawn
- 2007-11-15 AU AU2007319193A patent/AU2007319193A1/en not_active Abandoned
- 2007-11-15 WO PCT/US2007/084838 patent/WO2008061192A2/en not_active Ceased
- 2007-11-15 CA CA002669696A patent/CA2669696A1/en not_active Abandoned
- 2007-11-15 EP EP15171539.8A patent/EP2997973A1/en not_active Withdrawn
-
2009
- 2009-06-04 US US12/478,504 patent/US9074009B2/en not_active Expired - Fee Related
-
2014
- 2014-01-20 JP JP2014007579A patent/JP2014114298A/ja active Pending
Non-Patent Citations (2)
| Title |
|---|
| None |
| See also references of EP2091552A4 |
Cited By (92)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10487110B2 (en) | 1999-05-18 | 2019-11-26 | President And Fellows Of Harvard College | Stabilized compounds having secondary structure motifs |
| US9951099B2 (en) | 1999-05-18 | 2018-04-24 | President And Fellows Of Harvard College | Stabilized compounds having secondary structure motifs |
| US9505801B2 (en) | 1999-05-18 | 2016-11-29 | President And Fellows Of Harvard College | Stabilized compounds having secondary structure motifs |
| US9074009B2 (en) | 2006-11-15 | 2015-07-07 | Dana-Farber Cancer Institute, Inc. | Stabilized MAML peptides and uses thereof |
| US10328117B2 (en) | 2006-12-14 | 2019-06-25 | Aileron Therapeutics, Inc. | Bis-sulfhydryl macrocyclization systems |
| US9675661B2 (en) | 2006-12-14 | 2017-06-13 | Aileron Therapeutics, Inc. | Bis-sulfhydryl macrocyclization systems |
| US9175056B2 (en) | 2006-12-14 | 2015-11-03 | Alleron Therapeutics, Inc. | Bis-sulfhydryl macrocyclization systems |
| US9527896B2 (en) | 2007-01-31 | 2016-12-27 | Dana-Farber Cancer Institute, Inc. | Stabilized p53 peptides and uses thereof |
| EP2118123A4 (en) * | 2007-01-31 | 2011-04-20 | Dana Farber Cancer Inst Inc | STABILIZED P53 PEPTIDES AND ITS USES |
| US8889632B2 (en) | 2007-01-31 | 2014-11-18 | Dana-Farber Cancer Institute, Inc. | Stabilized p53 peptides and uses thereof |
| EP2952522A1 (en) * | 2007-01-31 | 2015-12-09 | Dana-Farber Cancer Institute, Inc. | Stabilized p53 peptides and uses thereof |
| US9957296B2 (en) | 2007-02-23 | 2018-05-01 | Aileron Therapeutics, Inc. | Triazole macrocycle systems |
| US10030049B2 (en) | 2007-02-23 | 2018-07-24 | Aileron Therapeutics, Inc. | Triazole macrocycle systems |
| US9493509B2 (en) | 2007-02-23 | 2016-11-15 | Aileron Therapeutics, Inc. | Triazole macrocycle systems |
| EP2508531A1 (en) * | 2007-03-28 | 2012-10-10 | President and Fellows of Harvard College | Stitched polypeptides |
| US8592377B2 (en) | 2007-03-28 | 2013-11-26 | President And Fellows Of Harvard College | Stitched polypeptides |
| US10301351B2 (en) | 2007-03-28 | 2019-05-28 | President And Fellows Of Harvard College | Stitched polypeptides |
| US9556227B2 (en) | 2007-03-28 | 2017-01-31 | President And Fellows Of Harvard College | Stitched polypeptides |
| WO2008121767A3 (en) * | 2007-03-28 | 2009-01-08 | Harvard College | Stitched polypeptides |
| EP3159352A1 (en) * | 2007-03-28 | 2017-04-26 | President and Fellows of Harvard College | Stitched polypeptides |
| EP2356139A4 (en) * | 2008-07-23 | 2013-01-09 | Harvard College | LIGURE COMBINED POLYPEPTIDES |
| WO2010011313A3 (en) * | 2008-07-23 | 2010-12-09 | President And Fellows Of Harvard College | Ligation of stapled polypeptides |
| US9458189B2 (en) | 2008-07-23 | 2016-10-04 | President And Fellows Of Harvard College | Ligation of stapled polypeptides |
| US9206223B2 (en) | 2008-09-22 | 2015-12-08 | Aileron Therapeutics, Inc. | Methods for preparing purified polypeptide compositions |
| CN102197048A (zh) * | 2008-09-22 | 2011-09-21 | 爱勒让治疗公司 | 拟肽大环化合物 |
| AU2009294877C1 (en) * | 2008-09-22 | 2015-05-07 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| WO2010034034A1 (en) * | 2008-09-22 | 2010-03-25 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| JP2014221801A (ja) * | 2008-09-22 | 2014-11-27 | エルロン・セラピューティクス・インコーポレイテッドAileron Therapeutics,Inc. | ペプチド模倣大環状分子 |
| WO2010034029A1 (en) * | 2008-09-22 | 2010-03-25 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| JP2016190882A (ja) * | 2008-09-22 | 2016-11-10 | エルロン・セラピューティクス・インコーポレイテッドAileron Therapeutics,Inc. | ペプチド模倣大環状分子 |
| AU2009294877B2 (en) * | 2008-09-22 | 2014-11-13 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| CN102482336B (zh) * | 2008-09-22 | 2015-05-06 | 爱勒让治疗公司 | 拟肽大环化合物 |
| US9175045B2 (en) | 2008-09-22 | 2015-11-03 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US8524653B2 (en) | 2008-09-22 | 2013-09-03 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US8399405B2 (en) | 2008-09-22 | 2013-03-19 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| CN102482336A (zh) * | 2008-09-22 | 2012-05-30 | 爱勒让治疗公司 | 拟肽大环化合物 |
| US9394336B2 (en) | 2008-09-22 | 2016-07-19 | Aileron Therapeutics, Inc. | Methods for preparing purified polypeptide compositions |
| JP2012503026A (ja) * | 2008-09-22 | 2012-02-02 | エルロン・セラピューティクス・インコーポレイテッド | ペプチド模倣大環状分子 |
| US9458202B2 (en) | 2008-11-24 | 2016-10-04 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles with improved properties |
| US20100298201A1 (en) * | 2008-11-24 | 2010-11-25 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles with improved properties |
| AU2016216698B2 (en) * | 2008-11-24 | 2018-02-22 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles with improved properties |
| US9175047B2 (en) | 2009-01-14 | 2015-11-03 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10022422B2 (en) | 2009-01-14 | 2018-07-17 | Alleron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US9163330B2 (en) | 2009-07-13 | 2015-10-20 | President And Fellows Of Harvard College | Bifunctional stapled polypeptides and uses thereof |
| US10300109B2 (en) | 2009-09-22 | 2019-05-28 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US9957299B2 (en) | 2010-08-13 | 2018-05-01 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US11008366B2 (en) | 2010-08-13 | 2021-05-18 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10703780B2 (en) | 2010-08-13 | 2020-07-07 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US8859723B2 (en) | 2010-08-13 | 2014-10-14 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US8957026B2 (en) | 2010-09-22 | 2015-02-17 | President And Fellows Of Harvard College | Beta-catenin targeting peptides and uses thereof |
| WO2012174409A1 (en) * | 2011-06-17 | 2012-12-20 | President And Fellows Of Harvard College | Stabilized variant maml peptides and uses thereof |
| US9487562B2 (en) | 2011-06-17 | 2016-11-08 | President And Fellows Of Harvard College | Stabilized polypeptides as regulators of RAB GTPase function |
| US9522947B2 (en) | 2011-10-18 | 2016-12-20 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US9096684B2 (en) | 2011-10-18 | 2015-08-04 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10308699B2 (en) | 2011-10-18 | 2019-06-04 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10227380B2 (en) | 2012-02-15 | 2019-03-12 | Aileron Therapeutics, Inc. | Triazole-crosslinked and thioether-crosslinked peptidomimetic macrocycles |
| US10213477B2 (en) | 2012-02-15 | 2019-02-26 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US8987414B2 (en) | 2012-02-15 | 2015-03-24 | Aileron Therapeutics, Inc. | Triazole-crosslinked and thioether-crosslinked peptidomimetic macrocycles |
| US9505804B2 (en) | 2012-02-15 | 2016-11-29 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10967042B2 (en) | 2012-02-15 | 2021-04-06 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US8927500B2 (en) | 2012-02-15 | 2015-01-06 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US9878056B2 (en) | 2012-04-02 | 2018-01-30 | Modernatx, Inc. | Modified polynucleotides for the production of cosmetic proteins and peptides |
| US10583203B2 (en) | 2012-04-02 | 2020-03-10 | Modernatx, Inc. | In vivo production of proteins |
| US10493167B2 (en) | 2012-04-02 | 2019-12-03 | Modernatx, Inc. | In vivo production of proteins |
| US10501512B2 (en) | 2012-04-02 | 2019-12-10 | Modernatx, Inc. | Modified polynucleotides |
| US9617309B2 (en) | 2012-09-26 | 2017-04-11 | President And Fellows Of Harvard College | Proline-locked stapled peptides and uses thereof |
| WO2014055564A1 (en) | 2012-10-01 | 2014-04-10 | President And Fellows Of Harvard College | Stabilized polypeptide insulin receptor modulators |
| US9604919B2 (en) | 2012-11-01 | 2017-03-28 | Aileron Therapeutics, Inc. | Disubstituted amino acids and methods of preparation and use thereof |
| US10669230B2 (en) | 2012-11-01 | 2020-06-02 | Aileron Therapeutics, Inc. | Disubstituted amino acids and methods of preparation and use thereof |
| US9845287B2 (en) | 2012-11-01 | 2017-12-19 | Aileron Therapeutics, Inc. | Disubstituted amino acids and methods of preparation and use thereof |
| US11332496B2 (en) | 2013-03-13 | 2022-05-17 | President And Fellows Of Harvard College | Stapled and stitched polypeptides and uses thereof |
| CN105307667B (zh) * | 2013-03-13 | 2019-04-19 | 哈佛大学的校长及成员们 | 钉合且缝合的多肽及其用途 |
| EP3391898A3 (en) * | 2013-03-13 | 2019-02-13 | President and Fellows of Harvard College | Stapled and stitched polypeptides and uses thereof |
| US10081654B2 (en) | 2013-03-13 | 2018-09-25 | President And Fellows Of Harvard College | Stapled and stitched polypeptides and uses thereof |
| US12258423B2 (en) | 2013-03-13 | 2025-03-25 | President And Fellows Of Harvard College | Stapled and stitched polypeptides and uses thereof |
| CN105307667A (zh) * | 2013-03-13 | 2016-02-03 | 哈佛大学的校长及成员们 | 钉合且缝合的多肽及其用途 |
| EP2991665A4 (en) * | 2013-03-13 | 2016-11-09 | Harvard College | STACKED AND GRAFTED POLYPEPTIDES AND USES THEREOF |
| WO2014201370A1 (en) | 2013-06-14 | 2014-12-18 | President And Fellows Of Harvard College | Stabilized polypeptide insulin receptor modulators |
| US10227390B2 (en) | 2013-06-14 | 2019-03-12 | President And Fellows Of Harvard College | Stabilized polypeptide insulin receptor modulators |
| WO2015158810A1 (en) | 2014-04-17 | 2015-10-22 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Polypeptides and uses thereof for reducing cd95-mediated cell motility |
| US10533039B2 (en) | 2014-05-21 | 2020-01-14 | President And Fellows Of Harvard College | Ras inhibitory peptides and uses thereof |
| US11377476B2 (en) | 2014-05-21 | 2022-07-05 | President And Fellows Of Harvard College | Ras inhibitory peptides and uses thereof |
| US10471120B2 (en) | 2014-09-24 | 2019-11-12 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and uses thereof |
| US10905739B2 (en) | 2014-09-24 | 2021-02-02 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and formulations thereof |
| US10253067B2 (en) | 2015-03-20 | 2019-04-09 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and uses thereof |
| US11155577B2 (en) | 2015-06-22 | 2021-10-26 | University Of Utah Research Foundation | Thiol-ene based peptide stapling and uses thereof |
| US10059741B2 (en) | 2015-07-01 | 2018-08-28 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10023613B2 (en) | 2015-09-10 | 2018-07-17 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles as modulators of MCL-1 |
| US11034720B2 (en) | 2016-07-17 | 2021-06-15 | University Of Utah Research Foundation | Thiol-yne based peptide stapling and uses thereof |
| US11198713B2 (en) | 2017-09-07 | 2021-12-14 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
| US11834482B2 (en) | 2017-09-07 | 2023-12-05 | Fog Pharmaceuticals, Inc. | Agents modulating beta-catenin functions and methods thereof |
| WO2019178313A1 (en) * | 2018-03-14 | 2019-09-19 | Dana-Farber Cancer Institute, Inc. | Stabilized peptides for biomarker detection |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2091552A4 (en) | 2010-01-06 |
| WO2008061192A3 (en) | 2008-07-10 |
| CA2669696A1 (en) | 2008-05-22 |
| AU2007319193A1 (en) | 2008-05-22 |
| US9074009B2 (en) | 2015-07-07 |
| EP2489360A1 (en) | 2012-08-22 |
| JP2010510236A (ja) | 2010-04-02 |
| EP2091552A2 (en) | 2009-08-26 |
| JP2014114298A (ja) | 2014-06-26 |
| EP2997973A1 (en) | 2016-03-23 |
| US20100081611A1 (en) | 2010-04-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2091552A2 (en) | Stabilized maml peptides and uses thereof | |
| EP2952522B1 (en) | Stabilized p53 peptides and uses thereof | |
| EP2332968B1 (en) | Alpha-helical peptides suitable for activating or inhibiting cell death | |
| AU2011325910B2 (en) | Cancer therapies and diagnostics | |
| US20140256912A1 (en) | Stabilized Variant MAML Peptides and Uses Thereof | |
| CN113543813B (zh) | Cd38特异性的双环肽配体 | |
| BRPI0807578A2 (pt) | macrociclo peptidomimético, composto, kit e métodos para sintetizar um macrociclo peptidomimético | |
| US20240228539A9 (en) | Selective targeting of apoptosis proteins by structurally-stabilized and/or cysteine-reactive noxa peptides | |
| JP2021501201A (ja) | ステープルペプチドの細胞内送達のためのポリペプチド接合体 | |
| AU2014200485A1 (en) | Stabilized maml peptides and uses thereof | |
| AU2013231104B2 (en) | Stabilized p53 peptides and uses thereof | |
| AU2016210709A1 (en) | Stabilized p53 peptides and uses thereof | |
| HK1089191B (en) | Stabilized alpha helical peptides and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 07871487 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2007319193 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2669696 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2009537371 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2007319193 Country of ref document: AU Date of ref document: 20071115 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2007871487 Country of ref document: EP |