WO2007133290A2 - Anti-ox40l antibodies and methods using same - Google Patents

Anti-ox40l antibodies and methods using same Download PDF

Info

Publication number
WO2007133290A2
WO2007133290A2 PCT/US2006/062173 US2006062173W WO2007133290A2 WO 2007133290 A2 WO2007133290 A2 WO 2007133290A2 US 2006062173 W US2006062173 W US 2006062173W WO 2007133290 A2 WO2007133290 A2 WO 2007133290A2
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
ox40l
sequence
hvr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2006/062173
Other languages
English (en)
French (fr)
Other versions
WO2007133290A8 (en
WO2007133290A3 (en
Inventor
Flavius Martin
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genentech Inc
Original Assignee
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2006343459A priority Critical patent/AU2006343459A1/en
Application filed by Genentech Inc filed Critical Genentech Inc
Priority to US12/097,733 priority patent/US7812133B2/en
Priority to EP06851330A priority patent/EP1973949A2/en
Priority to JP2008545995A priority patent/JP2009519718A/ja
Priority to CA002633602A priority patent/CA2633602A1/en
Priority to BRPI0621065-1A priority patent/BRPI0621065A2/pt
Publication of WO2007133290A2 publication Critical patent/WO2007133290A2/en
Publication of WO2007133290A3 publication Critical patent/WO2007133290A3/en
Publication of WO2007133290A8 publication Critical patent/WO2007133290A8/en
Priority to IL191820A priority patent/IL191820A0/en
Anticipated expiration legal-status Critical
Priority to NO20083147A priority patent/NO20083147L/no
Priority to US12/834,748 priority patent/US20100272738A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2875Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/16Otologicals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered

Definitions

  • Patent Docket P2214R1 Electronically filed on 14-DEC-2006
  • the present invention relates generally to the fields of molecular biology. More specifically, the invention concerns anti-OX40L antibodies, and uses of same.
  • OX40L Human OX40 ligand (OX40L), a membrane bound member of the tumor necrosis factor superfamily, is primarily expressed on activated antigen-presenting cells, such as dendritic cells, and to a lesser degree, B cells. See Sugamura, K et al., Nature Reviews Immunology 4:420 (2004); Weinberg AD, Trends Immunol. 23(2):102 (2002).
  • OX40L also known as ACT-4 receptor, TNF4-Human, GP34 and CD134L, binds to the OX40 receptor (OX40), which is also called CD134, ACT-4, CD134 antigen, ACT35 antigen, and TNR4-Human.
  • OX40 is a T-cell activation protein that is expressed following T-cell receptor (TCR) engagement. Engagement of CD40 by activated antigen-presenting cells increases the expression of OX40L. Engagement of OX40 by OX40L is co-stimulatory to effector T cells, and costimulation up-regulates the production of cytokines by T helper 1 and T helper 2 cells. OX40-OX40L interactions are also important for the generation of memory T cells, promoting the survival of effector T cells after antigen priming.
  • TCR T-cell receptor
  • Blocking OX40L in vivo reduced the severity of rheumatoid arthritis, experimental autoimmune disease (EAE), acute graft-verses-host disease (GVHD), inflammatory bowel disease, experimental leishmaniasis and collagen-induced arthritis in animal models.
  • EAE experimental autoimmune disease
  • GVHD acute graft-verses-host disease
  • inflammatory bowel disease inflammatory bowel disease
  • experimental leishmaniasis and collagen-induced arthritis in animal models.
  • Anti-OX40L and antibodies recognizing OX40L are mentioned in, e.g. in WO 95/12673; WO 95/21915; WO 99/15200; Baum, P.R., et al., EMBO J. 13 (1994) 3992-4001; Imura, A., et al., Blood 89 (1997) 2951-2958; Imura, A., et al., J. Exp. Med. 183 (1996) 2185-2195; Kjaergaard, J., et al., J. Immunol. 167 (2001) 6669-6677; Lane, P., J. Exp. Med.
  • OX40L binding agents such as antibodies, and fragments thereof.
  • OX40L presents as an important and advantageous therapeutic target, and the invention provides compositions and methods based on binding OX40L.
  • OX40L binding agents of the invention as described herein, provide important therapeutic and diagnostic agents for use in targeting pathological conditions associated with expression and/or activity of the OX40L-OX40 receptor pathways. Accordingly, the invention provides methods, compositions, kits and articles of manufacture related to OX40L binding.
  • the invention provides an isolated anti-OX40L antibody, wherein a full length IgG form of the antibody specifically binds human OX40L with a binding affinity of about 10 nM or better.
  • binding affinity of a ligand to its receptor can be determined using any of a variety of assays, and expressed in terms of a variety of quantitative values. Accordingly, in one embodiment, the binding affinity is expressed as Kd values and reflects intrinsic binding affinity (e.g., with minimized avidity effects). Generally and preferably, binding affinity is measured in vitro, whether in a cell-free or cell-associated setting. Any of a number of assays known in the art, including those described herein, can be used to obtain binding affinity measurements, including, for example, Biacore, radioimmunoassay (RIA) and ELISA.
  • the invention provides an isolated antibody that binds an OX40 receptor binding region of OX40L.
  • the isolated antibody binds a polypeptide comprising, consisting of or consisting of the human OX40L extracellular domain.
  • the invention provides an isolated anti-OX40L antibody that competes with OX40 receptor for binding of OX40L.
  • the invention provides an isolated anti-OX40L antibody that inhibits, reduces, and/or blocks OX40L activity.
  • the invention provides an anti-OX40L antibody that inhibits, reduces, and/or blocks T cell .proliferation. In one aspect, the invention provides an anti-OX40L antibody that inhibits, reduces, and/or blocks survival of activated T cells.
  • the invention provides an anti-OX40L antibody that inhibits, reduces, and/or blocks secretion of IL-2 from T memory cells.
  • the invention provides an anti-OX40L antibody comprising: at least one, two, three, four, five, and/or six hypervariable region (HVR) sequences selected from the group consisting of: RSSQSIVHGNGNTYLE (SEQ ID NO:1), RSSQSPVHSNGNTYLH (SEQ ID NO:2), RVSNRFS (SEQ ID NO:3), KVSNRFS (SEQ ID NO:4), FQGSHVPYT (SEQ ID NO:5), SQSTHIPWT (SEQ ID NO:6), SYWLN (SEQ ID NO:7), SYWMH (SEQ ID NO: 8), MIDPSDSETHYNQVFKD (SEQ ID NO:9), EIDPSNGRTNYNEKFKS (SEQ ID NO: 10), GRGNFYGGSHAMEY (SEQ ID NO: 11), and ERSPRYFDV (SEQ ID NO: 12).
  • HVR hypervariable region
  • the invention provides an anti-OX40L antibody comprising: at least one, two, three, four, five, and/or six hypervariable region (HVR) sequences selected from the group consisting of: (a) HVR-Ll comprising sequence RSSQSIVHGNGNTYLE (SEQ ID NO: 1) or RSSQSPVHSNGNTYLH (SEQ ID NO:2); (b) HVR-L2 comprising sequence RVSNRFS (SEQ ID NO:3) or KVSNRFS (SEQ ID NO:4); (c) HVR-L3 comprising sequence FQGSHVPYT (SEQ ID NO:5) or SQSTHIPWT (SEQ ID NO:6); (d) HVR-Hl comprising sequence SYWLN (SEQ ID NO:7) or SYWMH (SEQ ID NO:8); (e) HVR-H2 comprising sequence MIDPSDSETHYNQVFKD (SEQ ID NO:9) or EIDPSNGRTNYNEKFKS (SEQ ID NO:
  • an antibody of the invention comprises a light chain variable domain having the sequence:
  • QVQLQQPGAELVRPGASVkLSCKASGYTFTSYWLNWVKQRPGQGLEWIVMIDPSDSETHYNQVFKDKATL TVDKSSSTAYMQLSSLTSEDSAVYYCIRGRGNFYGGSHAMEYWGQGTLLTVSS (SEQ ID NO: 15) or QVQLQQPGAELVKPGTSVKLSCKASGYSFTSYWMHGVRQRPGQGLEWIGEIDPSNGRTNYNEKFKSKATL TVDKSSSTAYIQLSSLTSEDSAVYYCTRERSPRYFDVWGAGTTLTVSS (SEQ ID NO: 16).
  • the invention provides an anti-OX40L antibody comprising: at least one, two, three, four, five, and/or six hypervariable region (HVR) sequences selected from the group consisting of: (a) HVR-Ll comprising sequence RSSQSIVHGNGNTYLE (SEQ ID NO:1) or HVR-Ll comprising sequence RSSQSPVHSNGNTYLH (SEQ ID NO:2); (b) HVR-L2 comprising sequence RVSNRFS (SEQ ID NO:3) or HVR-L2 comprising sequence KVSNRFS (SEQ ID NO:4); (c) HVR-L3 comprising sequence FQGSHVPYT (SEQ ID NO:5) or HVR-L3 comprising sequence SQSTHIPWT (SEQ ID NO:6); (d) HVR-Hl comprising sequence SYWLN (SEQ ID NO:7) or HVR-Hl comprising sequence SYWMH (SEQ ID NO:8); (e) HVR-H2 comprising sequence MIDPS
  • the invention provides an anti-OX40L antibody comprising: at least one, two, three, four, five, and/or six hypervariable region (HVR) sequences selected from the group consisting of: (a) HVR-Ll comprising sequence RSSQSIVHGNGNTYLE (SEQ ID NO:1); (b) HVR-L2 comprising sequence RVSNRFS (SEQ ID NO:3); (c) HVR-L3 comprising sequence FQGSHVPYT (SEQ ID NO:5); (d) HVR-Hl comprising sequence SYWLN (SEQ ID NO:7); (e) HVR-H2 comprising sequence MIDPSDSETHYNQVFKD (SEQ ID NO:9); and (f) HVR-H3 comprising sequence GRGNFYGGSHAMEY (SEQ ID NO: 11).
  • HVR-Ll comprising sequence RSSQSIVHGNGNTYLE
  • RVSNRFS SEQ ID NO:3
  • HVR-L3 comprising sequence FQGSHVPYT
  • an antibody of the invention comprises a light chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of RSSQSIVHGNGNTYLE (SEQ ID NO: 1), RVSNRFS (SEQ ID NO:3), and FQGSHVPYT (SEQ ID NO:5).
  • the antibody comprises light chain HVR-Ll having amino acid sequence RSSQSIVHGNGNTYLE (SEQ ID NO: 1).
  • the antibody comprises light chain HVR-L2 having amino acid sequence RVSNRFS (SEQ ID NO:3).
  • the antibody comprises light chain HVR-L3 having amino acid sequence FQGSHVPYT (SEQ ID NO:5).
  • an antibody of the invention comprises a heavy chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of SYWLN (SEQ ID NO:7), MIDPSDSETHYNQVFKD (SEQ ID NO:9), and GRGNFYGGSHAMEY (SEQ ID NO: 11).
  • the antibody comprises heavy chain HVR-Hl having amino acid sequence SYWLN (SEQ ID NO:7).
  • the antibody comprises heavy chain HVR-H2 having amino acid sequence MIDPSDSETHYNQVFKD (SEQ ID NO:9).
  • the antibody comprises heavy chain HVR-H3 having amino acid sequence GRGNFYGGSHAMEY (SEQ ID NO: 11).
  • an antibody of the invention comprises a heavy chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of SYWLN (SEQ ID NO:7), MIDPSDSETHYNQVFKD (SEQ ID NO:9), and GRGNFYGGSHAMEY (SEQ ID NO:11) and a light chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of RSSQSIVHGNGNTYLE (SEQ ID NO: 1), RVSNRFS (SEQ ID NO:3), and FQGSHVPYT (SEQ ID NO:5).
  • SYWLN SEQ ID NO:7
  • MIDPSDSETHYNQVFKD SEQ ID NO:9
  • GRGNFYGGSHAMEY SEQ ID NO:11
  • a light chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of RSSQSIVHGNGNTYLE (SEQ ID NO: 1), RVSNRFS
  • an antibody of the invention comprises a light chain variable domain having the sequence: DILMTQTPLSLPVSLGDQASISCRSSQSIVHGNGNTYLEWHLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSG TDFTLKINRVEAEDLGVYYCFQGSHVPYTFGGGTKVEIKR (SEQ ID NO: 13).
  • an antibody of the invention comprises a heavy chain variable domain having the sequence: QVQLQQPGAELVRPGASVkLSCKASGYTFTSYWLNWVKQRPGQGLEWIVMIDPSDSETHYNQVFKDKATL TVDKSSSTAYMQLSSLTSEDSAVYYCIRGRGNFYGGSHAMEYWGQGTLLTVSS (SEQ ID NO: 15).
  • an antibody of the invention comprises a light chain variable domain having the sequence:
  • the invention provides an anti-OX40L antibody comprising: at least one, two, three, four, five, and/or six hypervariable region (HVR) sequences selected from the group consisting of: (a) HVR-Ll comprising sequence RSSQSPVHSNGNTYLH (SEQ ID NO:2); (b) HVR-L2 comprising sequence KVSNRFS (SEQ ID NO:4); (c) HVR-L3 comprising sequence SQSTHIPWT (SEQ ID NO:6); (d) HVR-Hl comprising sequence SYWMH (SEQ ID NO:8); (e) HVR-H2 comprising sequence EIDPSNGRTNYNEKFKS (SEQ ID NO:10); and (f) HVR-H3 comprising sequence ERSPRYFDV (SEQ ID NO: 12).
  • HVR-Ll comprising sequence RSSQSPVHSNGNTYLH (SEQ ID NO:2)
  • HVR-L2 comprising sequence KVSNRFS (SEQ ID NO:4)
  • an antibody of the invention comprises a light chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of RSSQSPVHSNGNTYLH (SEQ ID NO:2), KVSNRFS (SEQ ID NO:4), and SQSTHIPWT (SEQ ID NO:6).
  • the antibody comprises light chain HVR-Ll having amino acid sequence RSSQSPVHSNGNTYLH (SEQ ID NO:2).
  • the antibody comprises light chain HVR-L2 having amino acid sequence KVSNRFS (SEQ ID NO:4).
  • the antibody comprises light chain HVR-L3 having amino acid sequence SQSTHIPWT (SEQ ID NO:6).
  • an antibody of the invention comprises a heavy chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of SYWMH (SEQ ID NO: 8), EIDPSNGRTNYNEKFKS (SEQ ID NO:10, and ERSPRYFDV (SEQ ID NO:12).
  • the antibody comprises heavy chain HVR-Hl having amino acid sequence SYWMH (SEQ ID NO:8).
  • the antibody comprises heavy chain HVR-H2 having amino acid sequence EIDPSNGRTNYNEKFKS (SEQ ID NO: 10.
  • the antibody comprises heavy chain HVR-H3 having amino acid sequence ERSPRYFDV (SEQ ID NO: 12).
  • an antibody of the invention comprises a heavy chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of SYWMH (SEQ ID NO: 8), EIDPSNGRTNYNEKFKS (SEQ ID NO: 10, and ERSPRYFDV (SEQ ID NO:12) and a light chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of RSSQSPVHSNGNTYLH (SEQ ID NO:2), KVSNRFS (SEQ ID NO:4), and SQSTHIPWT (SEQ ID NO:6).
  • SYWMH SEQ ID NO: 8
  • EIDPSNGRTNYNEKFKS SEQ ID NO: 10
  • ERSPRYFDV SEQ ID NO:12
  • a light chain comprising at least one, at least two or all three of HVR sequences selected from the group consisting of RSSQSPVHSNGNTYLH (SEQ ID NO:2), KVSNRFS (SEQ ID NO
  • an antibody of the invention comprises a light chain variable domain having the sequence: DIVMTQTPLSLPVSLGDQASMYCRSSQSPVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGS GTDFTLKISRVEAEDLGVYFCSQSTHIPWTFGGGTKVEIKR (SEQ ID NO: 14).
  • an antibody of the invention comprises a heavy chain variable domain having the sequence: QVQLQQPGAELVKPGTSVKLSCKASGYSFTSYWMHGVRQRPGQGLEWIGEIDPSNGRTNYNEKFKSKATL TVDKSSSTAYIQLSSLTSEDSAVYYCTRERSPRYFDVWGAGTTLTVSS (SEQ ID NO:16).
  • an antibody of the invention comprises a light chain variable domain having the sequence:
  • DIVMTQTPLSLPVSLGDQASMYCRSSQSPVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGS GTDFTLKISRVEAEDLGVYFCSQSTHIPWTFGGGTKVEIKR (SEQ ID NO: 14); and comprises a heavy chain variable domain having the sequence:
  • the amino acid position/boundary delineating a hypervariable region of an antibody can vary, depending on the context and the various definitions known in the art (as described below). Some positions within a variable domain may be viewed as hybrid hypervariable positions in that these positions can be deemed to be within a hypervariable region under one set of criteria while being deemed to be outside a hypervariable region under a different set of criteria. One or more of these positions can also be found in extended hypervariable regions (as further defined below).
  • the antibody is a monoclonal antibody. In some embodiments, the antibody is a polyclonal antibody.
  • the antibody is selected from the group consisting of a chimeric antibody, an affinity matured antibody, a humanized antibody, and a human antibody.
  • the antibody is an antibody fragment.
  • the antibody is a Fab, Fab', Fab'-SH, F(ab') 2 , or scFv.
  • the antibody is a chimeric antibody, for example, an antibody comprising antigen binding sequences from a non-human donor grafted to a heterologous non-human, human or humanized sequence (e.g., framework and/or constant domain sequences).
  • the non-human donor is a mouse.
  • an antigen binding sequence is synthetic, e.g.
  • a chimeric antibody of the invention has murine V regions and human C region.
  • the murine light chain V region is fused to a human kappa light chain.
  • the murine heavy chain V region is fused to a human IgGl C region.
  • Humanized antibodies of the invention include those that have amino acid substitutions in the FR and affinity maturation variants with changes in the grafted CDRs.
  • the substituted amino acids in the CDR or FR are not limited to those present in the donor or recipient antibody.
  • the antibodies of the invention further comprise changes in amino acid residues in the Fc region that lead to improved effector function including enhanced CDC and/or ADCC function and B-cell killing.
  • Other antibodies of the invention include those having specific changes that improve stability.
  • the antibodies of the invention comprise changes in amino acid residues in the Fc region that lead to decreased effector function, e.g. decreased CDC and/or ADCC function and/or decreased B-cell killing.
  • the antibodies of the invention are characterized by decreased binding (such as absence of binding) to human complement factor CIq and/or human Fc receptor on natural killer (NK) cells. In some embodiments, the antibodies of the invention are characterized by decreased binding (such as the absence of binding) to human Fc ⁇ RI, Fc ⁇ RIIA, and/or Fc ⁇ RIIIA.
  • the antibodies of the invention is of the IgG class (eg, IgGl or IgG4) and comprises at least one mutation in E233, L234, G236, D265, D270, N297, E318, K320, K322, A327, A330, P331 and/or P329 (numbering according to the EU index). In some embodiments, the antibodies comprise the mutation L234A/L235A or D265A/N297A.
  • the invention provides anti-OX40L polypeptides comprising any of the antigen binding sequences provided herein, wherein the anti-OX40L polypeptides specifically bind to OX40L.
  • the invention provides an immunoconjugate (interchangeably termed "antibody drug conjugate” or "ADC") comprising any of the anti-OX40L antibodies disclosed herein conjugated to an agent, such as a drug.
  • ADC antibody drug conjugate
  • the antibodies of the invention bind (in some embodiments, specifically bind) OX40L, and in some embodiments, may modulate one or more aspects of OX40L-associated effects, including but not limited to OX40L activation, OX40L downstream molecular signaling, OX40 receptor activation, OX40 receptor downstream molecular signaling, disruption of OX40 receptor binding to OX40L, OX40L multimerization, and/or disruption of any biologically relevant OX40L and/or OX40 receptor biological pathway, and/or treatment and/or prevention of an immune disorder (such as asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, graft verses host disease (GVHD), and/or systemic lupus erythematosus); and/or treatment or prevention of a disorder associated with OX40L expression and/or activity (such as increased OX40L expression and/or activity).
  • an immune disorder such as asthma, atopic dermatitis, allergic
  • the antibody of the invention specifically binds to OX40L. In some embodiments, the antibody specifically binds to an OX40 receptor binding region of OX40L. In some embodiments, the isolated antibody binds a polypeptide comprising, consisting of or consisting essentially of the human OX40L extracellular domain. In some embodiments, the antibody specifically binds OX40L with a Kd of about InM or stronger. In some embodiments, the antibody specifically binds OX40L with a Kd of about 1OnM or stronger. In some embodiments, the antibody of the invention reduces, inhibits, and/or blocks OX40L activity in vivo and/or in vitro. In some embodiments, the antibody competes with Ox40L for binding with OX40 receptor (reduces and/or blocks OX40 receptor binding to OX40L).
  • the invention provides use of an antibody of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as an immune disorder.
  • a disorder such as an immune disorder.
  • the disorder is an autoimmune disorder.
  • the disorder is asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, GVHD, and/or systemic lupus erythematosus.
  • the disorder is a disease associated with virus, bacteria or other infectious agent, for example virus- induced imunopathology, eg, pathology induced by infection with influenze or RSV or related viruses, e.g., in the lung. See generally US2005/0069548 Al.
  • the disorder is arthritis (acute and chronic, rheumatoid arthritis including juvenile-onset rheumatoid arthritis and stages such as rheumatoid synovitis, gout or gouty arthritis, acute immunological arthritis, chronic inflammatory arthritis, degenerative arthritis, type II collagen- induced arthritis, infectious arthritis, Lyme arthritis, proliferative arthritis, psoriatic arthritis, Still's disease, vertebral arthritis, osteoarthritis, arthritis chronica progrediente, arthritis deformans, polyarthritis chronica primaria, reactive arthritis, menopausal arthritis, estrogen-depletion arthritis, and ankylosing spondylitis/rheumatoid spondylitis), autoimmune lymphoproliferative disease, inflammatory hyperproliferative skin diseases, psoriasis such as plaque psoriasis, gutatte psoriasis, pustular psoriasis, and psoriasis of the
  • autoimmune rheumatologic disorders such as, for example, rheumatoid arthritis, Sjogren's syndrome, scleroderma, lupus such as SLE and lupus nephritis, polymyositis/dermatomyositis, cryoglobulinemia, anti-phospholipid antibody syndrome, and psoriatic arthritis
  • autoimmune gastrointestinal and liver disorders such as, for example, inflammatory bowel diseases (e.g., ulcerative colitis and Crohn's disease), autoimmune gastritis and pernicious anemia, autoimmune hepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, and celiac disease
  • vasculitis such as, for example, ANCA-associated vasculitis, including Churg-Strauss vasculitis, Wegener's granulomatosis, and polyarteriitis
  • GVHD GVHD
  • autoimmune endocrine disorders such as, for example, diabetic -related autoimmune diseases such as insulin-dependent diabetes mellitus (IDDM), Addison's disease, and autoimmune thyroid disease (e.g., Graves' disease and thyroiditis)).
  • IDDM insulin-dependent diabetes mellitus
  • Addison's disease e.g., Graves' disease and thyroiditis
  • the invention provides compositions comprising one or more antibodies of the invention and a carrier.
  • the carrier is pharmaceutically acceptable.
  • the invention provides nucleic acids encoding an anti-OX40L antibody of the invention.
  • the invention provides vectors comprising a nucleic acid of the invention. In one aspect, the invention provides compositions comprising one or more nucleic acid of the invention and a carrier. In one embodiment, the carrier is pharmaceutically acceptable.
  • the invention provides host cells comprising a nucleic acid or a vector of the invention.
  • a vector can be of any type, for example a recombinant vector such as an expression vector. Any of a variety of host cells can be used.
  • a host cell is a prokaryotic cell, for example, E. coli.
  • a host cell is a eukaryotic cell, for example a mammalian cell such as Chinese Hamster Ovary (CHO) cell.
  • the invention provides methods of making an antibody of the invention.
  • the invention provides methods of making an anti-OX40L antibody (which, as defined herein includes full length and fragments thereof), said method comprising expressing in a suitable host cell a recombinant vector of the invention encoding said antibody, and recovering said antibody.
  • the invention provides an article of manufacture comprising a container; and a composition contained within the container, wherein the composition comprises one or more anti-OX40L antibodies of the invention.
  • the composition comprises a nucleic acid of the invention.
  • a composition comprising an antibody further comprises a carrier, which in some embodiments is pharmaceutically acceptable.
  • an article of manufacture of the invention further comprises instructions for administering the composition (for e.g., the antibody) to a subject (such as instructions for any of the methods described herein).
  • the invention provides a kit comprising a first container comprising a composition comprising one or more anti-OX40L antibodies of the invention; and a second container comprising a buffer.
  • the buffer is pharmaceutically acceptable.
  • a composition comprising an antibody further comprises a carrier, which in some embodiments is pharmaceutically acceptable.
  • a kit further comprises instructions for administering the composition (for e.g., the antibody) to a subject.
  • the invention provides use of an anti-OX40L antibody of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as an immune disorder.
  • a disorder such as an immune disorder.
  • the disorder is an autoimmune disorder.
  • the disorder is asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, GVHD, and/or systemic lupus erythematosus.
  • the invention provides use of a nucleic acid of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as an immune disorder.
  • a disorder such as an immune disorder.
  • the disorder is an autoimmune disorder.
  • the disorder is asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, GVHD, and/or systemic lupus erythematosus.
  • the invention provides use of an expression vector of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as an immune disorder.
  • a disorder such as an immune disorder.
  • the disorder is an autoimmune disorder.
  • the disorder is asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, GVHD and/or systemic lupus erythematosus.
  • the invention provides use of a host cell of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as an immune disorder.
  • a disorder such as an immune disorder.
  • the disorder is an autoimmune disorder.
  • the disorder is asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, GVHD and/or systemic lupus erythematosus.
  • the invention provides use of an article of manufacture of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as an immune disorder.
  • a disorder such as an immune disorder.
  • the disorder is an autoimmune disorder.
  • the disorder is asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, GVHD and/or systemic lupus erythematosus.
  • the invention provides use of a kit of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as an immune disorder.
  • a disorder such as an immune disorder.
  • the disorder is an autoimmune disorder.
  • the disorder is asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, GVDH and/or systemic lupus erythematosus.
  • the invention provides methods and compositions useful for modulating disease states associated with expression and/or activity of OX40L, such as increased expression and/or activity or undesired expression and/or activity.
  • Methods of the invention can be used to affect any suitable pathological state. Exemplary disorders are described herein, and include immune disorders.
  • Methods of the invention can further comprise additional treatment steps.
  • the invention provides methods comprising administration of an effective amount of an anti-OX40L antibody in combination with an effective amount of another therapeutic agent.
  • a method further comprises a step wherein a targeted cell and/or tissue is exposed to steroid treatment.
  • the anti-OX40L antibody can be administered serially or in combination with the other therapeutic agent that is effective for those purposes, either in the same composition or as separate compositions.
  • the administration of the anti-OX40L antibody and the other therapeutic agent can be done simultaneously, e.g., as a single composition or as two or more distinct compositions, using the same or different administration routes. Alternatively, or additionally, the administration can be done sequentially, in any order.
  • the steps can be performed as a combination of both sequentially and simultaneously, in any order.
  • intervals ranging from minutes to days, to weeks to months can be present between the administrations of the two or more compositions.
  • the other therapeutic agent may be administered first, followed by the anti-OX40L antibody.
  • simultaneous administration or administration of the anti-OX40L antibody first is also contemplated.
  • intervals ranging from minutes to days, to weeks to months can be present between the administrations of the two or more compositions.
  • the invention provides methods for detection of OX40L, the methods comprising detecting OX40L-anti-OX40L antibody complex in the sample.
  • detection includes qualitative and/or quantitative detection (measuring levels) with or without reference to a control.
  • the invention provides methods for diagnosing a disorder associated with OX40L expression and/or activity, the methods comprising detecting OX40L-anti-OX40L antibody complex in a biological sample from a patient having or suspected of having the disorder.
  • the OX40L expression is increased expression or abnormal expression.
  • the disorder is an immune disorder
  • the invention provides any of the anti-OX40L antibodies described herein, wherein the anti-OX40L antibody comprises a detectable label.
  • the invention provides a complex of any of the anti-OX40L antibodies described herein and OX40L.
  • the complex is in vivo or in vitro.
  • the anti-OX40L antibody is detectably labeled.
  • FIGURES IA and IB depict the amino acid sequences of mouse anti-human OX40L monoclonal antibody 8E12 variable regions.
  • A 8E12 light chain variable region (SEQ ID NO: 13).
  • B 8E12 heavy chain variable region (SEQ ID NO: 15). Amino acids are numbered according to Kabat.
  • FIGURES 2A and 2B depict the amino acid sequences of mouse anti-human OX40L monoclonal antibody 13G5 variable regions.
  • A 13G5 light chain variable region (SEQ ID NO: 14).
  • B 13G5 heavy chain variable region (SEQ ID NO: 16). Amino acids are numbered according to Kabat.
  • FIGURE 3 graphically depicts that administration of anti-OX40L monoclonal antibodies 8El 2 and 13G5 competitively inhibited binding of human OX40 receptor to human OX40L.
  • FIGURE 4 graphically depicts that administration of anti-OX40L monoclonal antibodies 8E12 and 13G5 inhibited T-cell proliferation in a cell-based assay.
  • FIGURE 5 graphically depicts that administration of anti-OX40L monoclonal antibodies 8E12 and 13G5 inhibited IL-2 production by T memory cells.
  • FIGURE 6 graphically depicts that administration of anti-OX40L monoclonal antibodies 8E12 and 13G5 inhibited survival of activated T cells.
  • the invention herein provides anti-OX40L antibodies, which are useful for, e.g., treatment or prevention of disease states associated with expression and/or activity of OX40L, such as increased expression and/or activity or undesired expression and/or activity.
  • the antibodies of the invention are used to treat an immune disorder (such as asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, GVHD and/or systemic lupus erythematosus).
  • the anti-OX40L antibodies of the invention find utility as reagents for detection and/or isolation of OX40L, such as detention of OX40L in various tissues and cell type.
  • the invention further provides methods of making anti-OX40L antibodies, polynucleotides encoding anti- OX40L antibodies, and cells comprising polynucleotides encoding anti-OX40L antibodies.
  • an "isolated" antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain.
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
  • an "isolated" nucleic acid molecule is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the natural source of the antibody nucleic acid.
  • An isolated nucleic acid molecule is other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from the nucleic acid molecule as it exists in natural cells.
  • an isolated nucleic acid molecule includes a nucleic acid molecule contained in cells that ordinarily express the antibody where, for example, the nucleic acid molecule is in a chromosomal location different from that of natural cells.
  • variable domain residue numbering as in Kabat or “amino acid position numbering as in Kabat”, and variations thereof, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
  • a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc according to Kabat) after heavy chain FR residue 82.
  • the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
  • Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein. Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer. A variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative embodiments are described in the following.
  • the "Kd" or "Kd value” according to this invention is measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of an antibody of interest and its antigen as described by the following assay that measures solution binding affinity of Fabs for antigen by equilibrating Fab with a minimal concentration of ( 125 I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (Chen, et al., (1999) J. MoI Biol 293:865-881).
  • RIA radiolabeled antigen binding assay
  • microtiter plates (Dynex) are coated overnight with 5 ug/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
  • a non-adsorbant plate (Nunc #269620) 100 pM or 26 pM [ 125 I]-antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of an anti-VEGF antibody, Fab- 12, in Presta et al., (1997) Cancer Res. 57:4593-4599).
  • the Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., 65 hours) to insure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed and the plate washed eight times with 0.1% Tween-20 in PBS. When the plates have dried, 150 ul/well of scintillant (MicroScint-20; Packard) is added, and the plates are counted on a Topcount gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays.
  • a longer period e.g., 65 hours
  • the Kd or Kd value is measured by using surface plasmon resonance assays using a BIAcoreTM-2000 or a BIAcoreTM-3000 (BIAcore, Inc., Piscataway, NJ) at 25C with immobilized antigen CM5 chips at ⁇ 10 response units (RU).
  • CM5 carboxymethylated dextran biosensor chips
  • EDC N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride
  • NHS N-hydroxysuccinimide
  • Antigen is diluted with 1OmM sodium acetate, pH 4.8, into 5ug/ml ( ⁇ 0.2uM) before injection at a flow rate of 5ul/minute to achieve approximately 10 response units (RU) of coupled protein.
  • IM ethanolamine is injected to block unreacted groups.
  • two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% Tween 20 (PBST) at 25°C at a flow rate of approximately 25ul/min.
  • association rates (k on ) and dissociation rates (k off ) are calculated using a simple one-to- one Langmuir binding model (BIAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram.
  • the equilibrium dissociation constant (Kd) is calculated as the ratio k off /k on . See, e.g., Chen, Y., et al., (1999) J. MoI Biol 293:865-881.
  • CM5 chips ⁇ 10 response units (RU).
  • CM5 carboxymethylated dextran biosensor chips
  • EDC N-ethyl-N'- (3- dimethylaminopropyl)-carbodiimide hydrochloride
  • NHS N-hydroxysuccinimide
  • Antigen is diluted with 1OmM sodium acetate, pH 4.8, into 5ug/ml ( ⁇ 0.2uM) before injection at a flow rate of 5ul/minute to achieve approximately 10 response units (RU) of coupled protein.
  • IM ethanolamine is injected to block unreacted groups.
  • two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05% Tween 20 (PBST) at 25°C at a flow rate of approximately 25ul/min.
  • association rates (k on ) and dissociation rates (k off ) are calculated using a simple one-to- one Langmuir binding model (BIAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram.
  • the equilibrium dissociation constant (Kd) was calculated as the ratio k off /k on . See, e.g., Chen, Y., et al., (1999) J. MoI Biol 293:865-881.
  • vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
  • plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • phage vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • viral vector is capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • vectors e.g., non-episomal mammalian vectors
  • vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • Such vectors are referred to herein as "recombinant expression vectors” (or simply, “recombinant vectors”).
  • expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
  • plasmid and “vector” may be used interchangeably as the plasmid is the most commonly used form of vector.
  • Polynucleotide or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
  • the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase, or by a synthetic reaction.
  • a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure may be imparted before or after assembly of the polymer.
  • the sequence of nucleotides may be interrupted by non-nucleotide components.
  • a polynucleotide may be further modified after synthesis, such as by conjugation with a label.
  • Other types of modifications include, for example, "caps", substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, ply-L-lysine, etc.), those with intercalators (e.g., acridine, psoralen, etc.), those containing chelators (e.g., metals
  • any of the hydroxyl groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid or semi-solid supports.
  • the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
  • Other hydroxyls may also be derivatized to standard protecting groups.
  • Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-O-methyl-, 2'-O- allyl, 2'-fluoro- or 2'-azido-ribose, carbocyclic sugar analogs, alpha- anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and a basic nucleoside analogs such as methyl riboside.
  • One or more phosphodiester linkages may be replaced by alternative linking groups.
  • linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(O)S("thioate"), P(S)S ("dithioate"), "(O)NR 2 ("amidate"), P(O)R, P(O)OR', CO or CH 2 ("formacetal"), in which each R or R' is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-O-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical.
  • Oligonucleotide generally refers to short, generally single stranded, generally synthetic polynucleotides that are generally, but not necessarily, less than about 200 nucleotides in length.
  • oligonucleotide and “polynucleotide” are not mutually exclusive. The description above for polynucleotides is equally and fully applicable to oligonucleotides.
  • OX40 ligand refers, unless specifically or contextually indicated otherwise, to any native or variant (whether native or synthetic) OX40L polypeptide.
  • native sequence specifically encompasses naturally occurring truncated or secreted forms (e.g., an extracellular domain sequence), naturally occurring variant forms (e.g., alternatively spliced forms) and naturally- occurring allelic variants.
  • wild type OX40L generally refers to a polypeptide comprising the amino acid sequence of a naturally occurring OX40L protein.
  • wild type OX40L sequence generally refers to an amino acid sequence found in a naturally occurring OX40L.
  • OX40 receptor refers, unless specifically or contextually indicated otherwise, to any native or variant (whether native or synthetic) OX40 polypeptide.
  • native sequence specifically encompasses naturally occurring truncated or secreted forms (e.g., an extracellular domain sequence), naturally occurring variant forms (e.g., alternatively spliced forms) and naturally-occurring allelic variants.
  • wild type OX40 generally refers to a polypeptide comprising the amino acid sequence of a naturally occurring OX40 protein.
  • wild type OX40 sequence generally refers to an amino acid sequence found in a naturally occurring OX40.
  • antibody and “immunoglobulin” are used interchangeably in the broadest sense and include monoclonal antibodies (for e.g., full length or intact monoclonal antibodies), polyclonal antibodies, multivalent antibodies, multispecific antibodies (e.g., bispecific antibodies so long as they exhibit the desired biological activity) and may also include certain antibody fragments (as described in greater detail herein).
  • An antibody can be human, humanized and/or affinity matured.
  • variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity-determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework (FR).
  • CDRs complementarity-determining regions
  • FR framework
  • the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a ⁇ -sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
  • the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al. , Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)).
  • the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment, whose name reflects its ability to crystallize readily.
  • Pepsin treatment yields an F(ab') 2 fragment that has two antigen-combining sites and is still capable of cross- linking antigen.
  • Fv is the minimum antibody fragment which contains a complete antigen-recognition and -binding site. In a two-chain Fv species, this region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association.
  • one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a "dimeric" structure analogous to that in a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. Collectively, the six CDRs confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
  • the Fab fragment also contains the constant domain of the light chain and the first constant domain (CHl) of the heavy chain.
  • Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHl domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • the "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (K) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains.
  • immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgA 1 , and IgA 2 .
  • the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
  • Antibody fragments comprise only a portion of an intact antibody, wherein the portion preferably retains at least one, preferably most or all, of the functions normally associated with that portion when present in an intact antibody.
  • antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • an antibody fragment comprises an antigen binding site of the intact antibody and thus retains the ability to bind antigen.
  • an antibody fragment for example one that comprises the Fc region, retains at least one of the biological functions normally associated with the Fc region when present in an intact antibody, such as FcRn binding, antibody half life modulation, ADCC function and complement binding.
  • an antibody fragment is a monovalent antibody that has an in vivo half life substantially similar to an intact antibody.
  • such an antibody fragment may comprise on antigen binding arm linked to an Fc sequence capable of conferring in vivo stability to the fragment.
  • hypervariable region when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
  • antibodies comprise six hypervariable regions; three in the VH (Hl, H2, H3), and three in the VL (Ll, L2, L3).
  • a number of hypervariable region delineations are in use and are encompassed herein.
  • the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
  • Chothia refers instead to the location of the structural loops (Chothia and Lesk J. MoI. Biol. 196:901-917 (1987)).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software.
  • the "contact" hypervariable regions are based on an analysis of the available complex crystal structures.
  • Hypervariable regions may comprise "extended hypervariable regions” as follows: 24-36 (Ll), 46-56 (L2) and 89-97 (L3) in the VL and 26-35 (Hl), 47-66 or 49-66 or 50 to 66 (H2) and 93-101 or 93-102 (H3) in the VH.
  • the variable domain residues are numbered according to Kabat et al., supra for each of these definitions. "Framework" or "FR" residues are those variable domain residues other than the hypervariable region residues as herein defined.
  • Humanized forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • “Chimeric” antibodies have a portion of the heavy and/or light chain identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851-6855 (1984)).
  • Humanized antibody as used herein is a subset of chimeric antibodies.
  • Single-chain Fv or “scFv” antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
  • the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
  • an “antigen” is a predetermined antigen to which an antibody can selectively bind.
  • the target antigen may be polypeptide, carbohydrate, nucleic acid, lipid, hapten or other naturally occurring or synthetic compound.
  • the target antigen is a polypeptide.
  • the term "diabodies” refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH - VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen- binding sites.
  • Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al, Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
  • a “human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non- human antigen-binding residues.
  • An "affinity matured” antibody is one with one or more alterations in one or more CDRs thereof which result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s).
  • Preferred affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
  • Affinity matured antibodies are produced by procedures known in the art. Marks et al.
  • Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype.
  • antibody effector functions include: CIq binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B cell receptor); and B cell activation.
  • Antibody-dependent cell-mediated cytotoxicity refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g. Natural Killer (NK) cells, neutrophils, and macrophages) enable these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell with cytotoxins.
  • cytotoxic cells e.g. Natural Killer (NK) cells, neutrophils, and macrophages
  • the antibodies “arm” the cytotoxic cells and are absolutely required for such killing.
  • the primary cells for mediating ADCC NK cells, express Fc ⁇ RIII only, whereas monocytes express Fc ⁇ RI, Fc ⁇ RII and Fc ⁇ RIII.
  • FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991).
  • an in vitro ADCC assay such as that described in US Patent No. 5,500,362 or 5,821,337 or Presta U.S. Patent No. 6,737,056 may be performed.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
  • Human effector cells are leukocytes which express one or more FcRs and perform effector functions. Preferably, the cells express at least Fc ⁇ RIII and perform ADCC effector function. Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils; with PBMCs and NK cells being preferred.
  • PBMC peripheral blood mononuclear cells
  • NK natural killer cells
  • monocytes cytotoxic T cells and neutrophils
  • the effector cells may be isolated from a native source, e.g. from blood.
  • Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
  • the preferred FcR is a native sequence human FcR.
  • a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • Fc ⁇ RII receptors include Fc ⁇ RIIA (an “activating receptor”) and Fc ⁇ RIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor Fc ⁇ RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
  • Inhibiting receptor Fc ⁇ RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain, (see review M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)).
  • FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); Capel et al, Immunomethods 4:25-34 (1994); and de Haas et al, J. Lab. Clin. Med. 126:330-41 (1995).
  • FcR FcR
  • the term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al, J. Immunol. 117:587 (1976) and Kim et al, J. Immunol. 24:249 (1994)) and regulates homeostasis of immunoglobulins.
  • WO00/42072 (Presta) describes antibody variants with improved or diminished binding to FcRs. The content of that patent publication is specifically incorporated herein by reference. See, also, Shields et al J. Biol. Chem. 9(2): 6591-6604 (2001).
  • Binding to human FcRn in vivo and serum half life of human FcRn high affinity binding polypeptides can be assayed, e.g., in transgenic mice or transfected human cell lines expressing human FcRn, or in primates administered with the Fc variant polypeptides.
  • “Complement dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C 1 q) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
  • a CDC assay e.g. as described in Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996), may be performed.
  • Polypeptide variants with altered Fc region amino acid sequences and increased or decreased CIq binding capability are described in US patent No. 6,194,551Bl and WO99/51642. The contents of those patent publications are specifically incorporated herein by reference. See, also, Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
  • blocking antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds.
  • Preferred blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
  • a “disorder” or “disease” is any condition that would benefit from treatment with a substance/molecule or method of the invention. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
  • disorders to be treated herein include asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, and systemic lupus erythematosus.
  • autoimmune disease herein is a disease or disorder arising from and directed against an individual's own tissues or organs or a co-segregate or manifestation thereof or resulting condition therefrom.
  • a number of clinical and laboratory markers may exist, including, but not limited to, hypergammaglobulinemia, high levels of autoantibodies, antigen- antibody complex deposits in tissues, benefit from corticosteroid or immunosuppressive treatments, and lymphoid cell aggregates in affected tissues.
  • treatment refers to clinical intervention in an attempt to alter the natural course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • antibodies of the invention are used to delay development of a disease or disorder.
  • mammals include, but are not limited to, farm animals (such as cows), sport animals, pets (such as cats, dogs and horses), primates, mice and rats.
  • "Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses, cats, cows, etc.
  • the mammal is human.
  • An "effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
  • a “therapeutically effective amount” of a substance/molecule of the invention, agonist or antagonist may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule, agonist or antagonist to elicit a desired response in the individual.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the substance/molecule, agonist or antagonist are outweighed by the therapeutically beneficial effects.
  • a “prophylactically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
  • cytotoxic agent refers to a substance that inhibits or prevents the function of cells and/or causes destruction of cells.
  • the term is intended to include radioactive isotopes (e.g., At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 and radioactive isotopes of Lu), chemotherapeutic agents e.g.
  • methotrexate adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents, enzymes and fragments thereof such as nucleolytic enzymes, antibiotics, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof, and the various antitumor or anticancer agents disclosed below. Other cytotoxic agents are described below.
  • a tumoricidal agent causes destruction of tumor cells.
  • chemotherapeutic agent is a chemical compound useful in the treatment of cancer.
  • examples of chemotherapeutic agents include alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARINOL®); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topote
  • calicheamicin especially calicheamicin gammall and calicheamicin omegall
  • dynemicin including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophore s), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L- norleucine, ADRIAMYCIN® doxorubicin (including morpholino-doxorubicin, cyan
  • VELBAN® platinum; etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine (ONCOVIN®); oxaliplatin; leucovovin; vinorelbine (NAVELBINE®); novantrone; edatrexate; daunomycin; aminopterin; ibandronate; topoisomerase inhibitor RFS 2000; difluorometlhylornithine (DMFO); retinoids such as retinoic acid; capecitabine (XELOD A®); pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin (ELOXATINTM) combined with 5 -FU
  • anti-hormonal agents that act to regulate, reduce, block, or inhibit the effects of hormones that can promote the growth of cancer, and are often in the form of systemic, or whole -body treatment. They may be hormones themselves.
  • SERMs selective estrogen receptor modulators
  • tamoxifen including NOLVADEX® tamoxifen
  • EVISTA® raloxifene droloxifene
  • 4-hydroxytamoxifen trioxifene, keoxifene, LYl 17018, onapristone, and FARESTON® toremifene
  • anti-progesterones anti-progesterones
  • estrogen receptor down-regulators ETDs
  • agents that function to suppress or shut down the ovaries for example, leutinizing hormone -releasing hormone (LHRH) agonists such as LUPRON® and ELIGARD® leuprolide acetate, goserelin acetate, buserelin a
  • LHRH leutinizing
  • chemotherapeutic agents includes bisphosphonates such as clodronate (for example, BONEFOS® or OSTAC®), DIDROCAL® etidronate, NE-58095, ZOMETA® zoledronic acid/zoledronate, FOSAMAX® alendronate, AREDIA® pamidronate, SKELID® tiludronate, or ACTONEL® risedronate; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in abherant cell proliferation, such as, for example, PKC-alpha, Raf, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE® vaccine and gene therapy vaccines, for example, ALLOVECTIN® vaccine, LEUVECTIN® vaccine, and VAXID® vaccine; LURTOTECAN
  • a “growth inhibitory agent” when used herein refers to a compound or composition which inhibits growth of a cell (such as a cell expressing OX40L) either in vitro or in vivo.
  • the growth inhibitory agent may be one which significantly reduces the percentage of cells (such as a cell expressing OX40L) in S phase.
  • growth inhibitory agents include agents that block cell cycle progression (at a place other than S phase), such as agents that induce Gl arrest and M-phase arrest.
  • Classical M-phase blockers include the vincas (vincristine and vinblastine), taxanes, and topoisomerase II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin.
  • DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
  • DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
  • DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C.
  • Docetaxel (TAXOTERE®, Rhone-Poulenc Rorer), derived from the European yew, is a semisynthetic analogue of paclitaxel (TAXOL®, Bristol-Myers Squibb). Paclitaxel and docetaxel promote the assembly of microtubules from tubulin dimers and stabilize microtubules by preventing depolymerization, which results in the inhibition of mitosis in cells.
  • Doxorubicin is an anthracycline antibiotic.
  • the full chemical name of doxorubicin is (8S-cis)-10-[(3- amino-2,3,6-trideoxy- ⁇ -L-lyxo-hexapyranosyl)oxy]-7,8,9, 10-tetrahydro-6,8, 11 -trihydroxy-8-(hydroxyacetyl)- 1 - methoxy- 5,12 -naphthacenedione .
  • Fc region-comprising polypeptide refers to a polypeptide, such as an antibody or immunoadhesin (see definitions below), which comprises an Fc region.
  • the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during purification of the polypeptide or by recombinant engineering the nucleic acid encoding the polypeptide.
  • a composition comprising a polypeptide having an Fc region according to this invention can comprise polypeptides with K447, with all K447 removed, or a mixture of polypeptides with and without the K447 residue.
  • compositions of the invention and methods of making same
  • compositions including pharmaceutical compositions, comprising an anti- OX40L antibody; and polynucleotides comprising sequences encoding an anti-OX40L antibody.
  • compositions comprise one or more antibodies that bind to OX40L, and/or one or more polynucleotides comprising sequences encoding one or more antibodies that bind to OX40L.
  • suitable carriers such as pharmaceutically acceptable excipients including buffers, which are well known in the art.
  • the invention also encompasses isolated antibody and polynucleotide embodiments.
  • the invention also encompasses substantially pure antibody and polynucleotide embodiments.
  • the anti-OX40L antibodies of the invention are preferably monoclonal. Also encompassed within the scope of the invention are Fab, Fab', Fab'-SH and F(ab') 2 fragments of the anti-OX40L antibodies provided herein. These antibody fragments can be created by traditional means, such as enzymatic digestion, or may be generated by recombinant techniques. Such antibody fragments may be chimeric or humanized. These fragments are useful for the diagnostic and therapeutic purposes set forth below.
  • Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Thus, the modifier "monoclonal" indicates the character of the antibody as not being a mixture of discrete antibodies.
  • the anti-OX40L monoclonal antibodies of the invention can be made using the hybridoma method first described by Kohler et ah, Nature, 256:495 (1975), or may be made by recombinant DNA methods (U.S. Patent No. 4,816,567).
  • a mouse or other appropriate host animal such as a hamster
  • Antibodies to OX40L generally are raised in animals by multiple subcutaneous (sc) or intraperitoneal (ip) injections of OX40L and an adjuvant.
  • OX40L may be prepared using methods well-known in the art, some of which are further described herein. For example, recombinant production of OX40L is described below.
  • animals are immunized with a derivative of OX40L that contains the extracellular domain (ECD) of OX40L fused to the Fc portion of an immunoglobulin heavy chain.
  • animals are immunized with an OX40L-IgGl fusion protein.
  • Animals ordinarily are immunized against immunogenic conjugates or derivatives of OX40L with monophosphoryl lipid A (MPL)/trehalose dicrynomycolate (TDM) (Ribi Immunochem. Research, Inc., Hamilton, MT) and the solution is injected intradermally at multiple sites. Two weeks later the animals are boosted.
  • MPL monophosphoryl lipid A
  • TDM trehalose dicrynomycolate
  • lymphocytes may be immunized in vitro. Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press, 1986)).
  • a suitable fusing agent such as polyethylene glycol
  • the hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
  • the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
  • HAT medium hypoxanthine, aminopterin, and thymidine
  • Preferred myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium.
  • preferred myeloma cell lines are murine myeloma lines, such as those derived from MOPC-21 and MPC-11 mouse tumors available from the SaIk Institute Cell Distribution Center, San Diego, California USA, and SP-2 or X63-Ag8-653 cells available from the American Type Culture Collection, Rockville, Maryland USA.
  • Human myeloma and mouse- human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol, 133:3001 (1984); Brodeur et al, Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).
  • Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against OX40L.
  • the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme- linked immunoadsorbent assay (ELISA).
  • RIA radioimmunoassay
  • ELISA enzyme- linked immunoadsorbent assay
  • the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson e ⁇ ⁇ /., Anal. Biochem., 107:220 (1980).
  • the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press, 1986)).
  • Suitable culture media for this purpose include, for example, D-MEM or RPMI- 1640 medium.
  • the hybridoma cells may be grown in vivo as ascites tumors in an animal.
  • the monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A- Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • the anti-OX40L antibodies of the invention can be made by using combinatorial libraries to screen for synthetic antibody clones with the desired activity or activities.
  • synthetic antibody clones are selected by screening phage libraries containing phage that display various fragments of antibody variable region (Fv) fused to phage coat protein. Such phage libraries are panned by affinity chromatography against the desired antigen. Clones expressing Fv fragments capable of binding to the desired antigen are adsorbed to the antigen and thus separated from the non-binding clones in the library. The binding clones are then eluted from the antigen, and can be further enriched by additional cycles of antigen adsorption/elution.
  • Fv antibody variable region
  • any of the anti-OX40L antibodies of the invention can be obtained by designing a suitable antigen screening procedure to select for the phage clone of interest followed by construction of a full length anti-OX40L antibody clone using the Fv sequences from the phage clone of interest and suitable constant region (Fc) sequences described in Kabat et al , Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3.
  • Fc constant region
  • the antigen-binding domain of an antibody is formed from two variable (V) regions of about 110 amino acids, one each from the light (VL) and heavy (VH) chains, that both present three hypervariable loops or complementarity-determining regions (CDRs).
  • V variable
  • VH variable
  • CDRs complementarity-determining regions
  • Variable domains can be displayed functionally on phage, either as single-chain Fv (scFv) fragments, in which VH and VL are covalently linked through a short, flexible peptide, or as Fab fragments, in which they are each fused to a constant domain and interact non-covalently, as described in Winter et al, Ann. Rev. Immunol, 12: 433-455 (1994).
  • scFv encoding phage clones and Fab encoding phage clones are collectively referred to as "Fv phage clones" or "Fv clones”.
  • Repertoires of VH and VL genes can be separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be searched for antigen-binding clones as described in Winter et al, Ann. Rev. Immunol, 12: 433-455 (1994).
  • Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
  • the naive repertoire can be cloned to provide a single source of human antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al , EMBO J, 12: 725-734 (1993).
  • naive libraries can also be made synthetically by cloning the unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro as described by Hoogenboom and Winter, J. MoI Biol, 227: 381-388 (1992).
  • Filamentous phage is used to display antibody fragments by fusion to the minor coat protein pill.
  • the antibody fragments can be displayed as single chain Fv fragments, in which VH and VL domains are connected on the same polypeptide chain by a flexible polypeptide spacer, e.g. as described by Marks et al, J. MoI Biol, 222: 581-597 (1991), or as Fab fragments, in which one chain is fused to pill and the other is secreted into the bacterial host cell periplasm where assembly of a Fab-coat protein structure which becomes displayed on the phage surface by displacing some of the wild type coat proteins, e.g. as described in Hoogenboom et al, Nucl Acids Res., 19: 4133- 4137 (1991).
  • nucleic acids encoding antibody gene fragments are obtained from immune cells harvested from humans or animals. If a library biased in favor of anti-OX40L clones is desired, the subject is immunized with OX40L to generate an antibody response, and spleen cells and/or circulating B cells other peripheral blood lymphocytes (PBLs) are recovered for library construction.
  • a human antibody gene fragment library biased in favor of anti-human OX40L clones is obtained by generating an anti-human OX40L antibody response in transgenic mice carrying a functional human immunoglobulin gene array (and lacking a functional endogenous antibody production system) such that OX40L immunization gives rise to B cells producing human antibodies against OX40L. The generation of human antibody-producing transgenic mice is described below.
  • Additional enrichment for anti-OX40L reactive cell populations can be obtained by using a suitable screening procedure to isolate B cells expressing OX40L-specific membrane bound antibody, e.g., by cell separation with OX40L affinity chromatography or adsorption of cells to fluorochrome -labeled OX40L followed by flow- activated cell sorting (FACS).
  • a suitable screening procedure to isolate B cells expressing OX40L-specific membrane bound antibody, e.g., by cell separation with OX40L affinity chromatography or adsorption of cells to fluorochrome -labeled OX40L followed by flow- activated cell sorting (FACS).
  • FACS flow- activated cell sorting
  • spleen cells and/or B cells or other PBLs from an unimmunized donor provides a better representation of the possible antibody repertoire, and also permits the construction of an antibody library using any animal (human or non-human) species in which OX40L is not antigenic.
  • stem cells are harvested from the subject to provide nucleic acids encoding unrearranged antibody gene segments.
  • the immune cells of interest can be obtained from a variety of animal species, such as human, mouse, rat, lagomorpha, luprine, canine, feline, porcine, bovine, equine, and avian species, etc.
  • Nucleic acid encoding antibody variable gene segments are recovered from the cells of interest and amplified.
  • the desired DNA can be obtained by isolating genomic DNA or mRNA from lymphocytes followed by polymerase chain reaction (PCR) with primers matching the 5' and 3' ends of rearranged VH and VL genes as described in Orlandi et al., Proc. Natl. Acad. Sci. (USA), 86: 3833-3837 (1989), thereby making diverse V gene repertoires for expression.
  • the V genes can be amplified from cDNA and genomic DNA, with back primers at the 5' end of the exon encoding the mature V-domain and forward primers based within the J-segment as described in Orlandi et al (1989) and in Ward et al, Nature, 341: 544-546 (1989).
  • back primers can also be based in the leader exon as described in Jones et al., Biotechnol, 9: 88-89 (1991), and forward primers within the constant region as described in Sastry et al, Proc. Natl. Acad. Sci. (USA), 86: 5728-5732 (1989).
  • degeneracy can be incorporated in the primers as described in Orlandi et al. (1989) or Sastry et al. (1989).
  • the library diversity is maximized by using PCR primers targeted to each V-gene family in order to amplify all available VH and VL arrangements present in the immune cell nucleic acid sample, e.g. as described in the method of Marks et al, J. MoI Biol, 222: 581-597 (1991) or as described in the method of Orum et al, Nucleic Acids Res., 21: 4491-4498 (1993).
  • rare restriction sites can be introduced within the PCR primer as a tag at one end as described in Orlandi et al (1989), or by further PCR amplification with a tagged primer as described in Clackson et al, Nature, 352: 624-628 (1991).
  • Repertoires of synthetically rearranged V genes can be derived in vitro from V gene segments.
  • Most of the human VH-gene segments have been cloned and sequenced (reported in Tomlinson et al, J. MoI Biol, 227: 776-798 (1992)), and mapped (reported in Matsuda et al, Nature Genet., 3: 88-94 (1993); these cloned segments (including all the major conformations of the Hl and H2 loop) can be used to generate diverse VH gene repertoires with PCR primers encoding H3 loops of diverse sequence and length as described in Hoogenboom and Winter, J. MoI Biol, 227: 381-388 (1992).
  • VH repertoires can also be made with all the sequence diversity focused in a long H3 loop of a single length as described in Barbas et al, Proc. Natl. Acad. Sci. USA, 89: 4457-4461 (1992).
  • Human VK and V ⁇ segments have been cloned and sequenced (reported in Williams and Winter, Eur. J. Immunol, 23: 1456-1461
  • V-gene repertoires based on a range of VH and VL folds, and L3 and H3 lengths, will encode antibodies of considerable structural diversity.
  • germline V-gene segments can be rearranged in vitro according to the methods of Hoogenboom and Winter, J. MoI Biol, 227: 381-388 (1992).
  • Repertoires of antibody fragments can be constructed by combining VH and VL gene repertoires together in several ways.
  • Each repertoire can be created in different vectors, and the vectors recombined in vitro, e.g., as described in Hogrefe et al, Gene, 128: 119-126 (1993), or in vivo by combinatorial infection, e.g., the loxP system described in Waterhouse et al, Nucl Acids Res., 21: 2265-2266 (1993).
  • the in vivo recombination approach exploits the two-chain nature of Fab fragments to overcome the limit on library size imposed by E. coli transformation efficiency.
  • Naive VH and VL repertoires are cloned separately, one into a phagemid and the other into a phage vector.
  • the two libraries are then combined by phage infection of phagemid-containing bacteria so that each cell contains a different combination and the library size is limited only by the number of cells present (about 10 12 clones).
  • Both vectors contain in vivo recombination signals so that the VH and VL genes are recombined onto a single replicon and are co-packaged into phage virions.
  • These huge libraries provide large numbers of diverse antibodies of good affinity (Ka "1 of about 10 ⁇ 8 M).
  • the repertoires may be cloned sequentially into the same vector, e.g. as described in Barbas et al, Proc. Natl. Acad. ScL USA, 88: 7978-7982 (1991), or assembled together by PCR and then cloned, e.g. as described in Clackson et al., Nature, 352: 624-628 (1991).
  • PCR assembly can also be used to join VH and VL DNAs with DNA encoding a flexible peptide spacer to form single chain Fv (scFv) repertoires.
  • in cell PCR assembly is used to combine VH and VL genes within lymphocytes by PCR and then clone repertoires of linked genes as described in Embleton et al., Nucl. Acids Res., 20: 3831-3837 (1992).
  • the antibodies produced by naive libraries can be of moderate affinity (K 11 "1 of about 10 6 to 10 7 M “1 ), but affinity maturation can also be mimicked in vitro by constructing and reselecting from secondary libraries as described in Winter et al. (1994), supra.
  • mutation can be introduced at random in vitro by using error-prone polymerase (reported in Leung et al., Technique, 1: 11-15 (1989)) in the method of Hawkins et al., J. MoL Biol., 226: 889-896 (1992) or in the method of Gram et al., Proc. Natl. Acad. Sci USA, 89: 3576-3580 (1992).
  • affinity maturation can be performed by randomly mutating one or more CDRs, e.g. using PCR with primers carrying random sequence spanning the CDR of interest, in selected individual Fv clones and screening for higher affinity clones.
  • WO 9607754 published 14 March 1996) described a method for inducing mutagenesis in a complementarity determining region of an immunoglobulin light chain to create a library of light chain genes.
  • Another effective approach is to recombine the VH or VL domains selected by phage display with repertoires of naturally occurring V domain variants obtained from unimmunized donors and screen for higher affinity in several rounds of chain reshuffling as described in Marks et al. , BiotechnoL, 10: 779-783 (1992). This technique allows the production of antibodies and antibody fragments with affinities in the 10 "9 M range.
  • Nucleic acid sequence encoding the OX40L can be designed using the amino acid sequence of the desired region of OX40L, e.g. the extracellular domain. Alternatively, the cDNA sequence (or fragments thereof) may be used. Additional OX40L sequences are further disclosed in, e.g., SwissProt Accession Number P23510. DNAs encoding OX40L can be prepared by a variety of methods known in the art. These methods include, but are not limited to, chemical synthesis by any of the methods described in Engels et al., Agnew. Chem. Int. Ed. Engl., 28: 716- 734 (1989), such as the triester, phosphite, phosphoramidite and H-phosphonate methods.
  • codons preferred by the expression host cell are used in the design of the OX40L-encoding DNA.
  • DNA encoding OX40L can be isolated from a genomic or cDNA library. Following construction of the DNA molecule encoding OX40L, the DNA molecule is operably linked to an expression control sequence in an expression vector, such as a plasmid, wherein the control sequence is recognized by a host cell transformed with the vector.
  • plasmid vectors contain replication and control sequences which are derived from species compatible with the host cell. The vector ordinarily carries a replication site, as well as sequences which encode proteins that are capable of providing phenotypic selection in transformed cells.
  • Suitable vectors for expression in prokaryotic and eukaryotic host cells are known in the art and some are further described herein.
  • Eukaryotic organisms such as yeasts, or cells derived from multicellular organisms, such as mammals, may be used.
  • the DNA encoding OX40L is operably linked to a secretory leader sequence resulting in secretion of the expression product by the host cell into the culture medium.
  • secretory leader sequences include stll, ecotin, lamB, herpes GD, lpp, alkaline phosphatase, invertase, and alpha factor.
  • Host cells are transfected and preferably transformed with the above-described expression or cloning vectors of this invention and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • Transfection refers to the taking up of an expression vector by a host cell whether or not any coding sequences are in fact expressed. Numerous methods of transfection are known to the ordinarily skilled artisan, for example, CaPC> 4 precipitation and electroporation. Successful transfection is generally recognized when any indication of the operation of this vector occurs within the host cell. Methods for transfection are well known in the art, and some are further described herein.
  • Transformation means introducing DNA into an organism so that the DNA is replicable, either as an extrachromosomal element or by chromosomal integrant. Depending on the host cell used, transformation is done using standard techniques appropriate to such cells. Methods for transformation are well known in the art, and some are further described herein.
  • Prokaryotic host cells used to produce OX40L can be cultured as described generally in Sambrook et al , supra.
  • the mammalian host cells used to produce OX40L can be cultured in a variety of media, which is well known in the art and some of which is described herein.
  • the host cells referred to in this disclosure encompass cells in in vitro culture as well as cells that are within a host animal.
  • OX40L Purification of OX40L may be accomplished using art-recognized methods.
  • the purified OX40L can be attached to a suitable matrix such as agarose beads, acrylamide beads, glass beads, cellulose, various acrylic copolymers, hydroxyl methacrylate gels, polyacrylic and polymethacrylic copolymers, nylon, neutral and ionic carriers, and the like, for use in the affinity chromatographic separation of phage display clones.
  • a suitable matrix such as agarose beads, acrylamide beads, glass beads, cellulose, various acrylic copolymers, hydroxyl methacrylate gels, polyacrylic and polymethacrylic copolymers, nylon, neutral and ionic carriers, and the like.
  • Attachment of the OX40L protein to the matrix can be accomplished by the methods described in Methods in Enzymology, vol. 44 (1976).
  • a commonly employed technique for attaching protein ligands to polysaccharide matrices, e.g. agarose, dextran or cellulose involves activation of the carrier with cyanogen halides and subsequent
  • OX40L can be used to coat the wells of adsorption plates, expressed on host cells affixed to adsorption plates or used in cell sorting, or conjugated to biotin for capture with streptavidin-coated beads, or used in any other art-known method for panning phage display libraries.
  • the phage library samples are contacted with immobilized OX40L under conditions suitable for binding of at least a portion of the phage particles with the adsorbent. Normally, the conditions, including pH, ionic strength, temperature and the like are selected to mimic physiological conditions.
  • the phages bound to the solid phase are washed and then eluted by acid, e.g. as described in Barbas et al., Proc. Natl. Acad. Sci USA, 88: 7978-7982 (1991), or by alkali, e.g. as described in Marks et al, J. MoI. Biol, 222: 581-597 (1991), or by OX40L antigen competition, e.g.
  • Phages can be enriched 20-1, 000-fold in a single round of selection. Moreover, the enriched phages can be grown in bacterial culture and subjected to further rounds of selection.
  • the efficiency of selection depends on many factors, including the kinetics of dissociation during washing, and whether multiple antibody fragments on a single phage can simultaneously engage with antigen.
  • Antibodies with fast dissociation kinetics (and weak binding affinities) can be retained by use of short washes, multivalent phage display and high coating density of antigen in solid phase. The high density not only stabilizes the phage through multivalent interactions, but favors rebinding of phage that has dissociated.
  • phage antibodies of different affinities can be selected between phage antibodies of different affinities, even with affinities that differ slightly, for OX40L.
  • random mutation of a selected antibody e.g. as performed in some of the affinity maturation techniques described above
  • OX40L Rare high affinity phage could be competed out.
  • phages can be incubated with excess biotinylated OX40L, but with the biotinylated OX40L at a concentration of lower molarity than the target molar affinity constant for OX40L.
  • the high affinity-binding phages can then be captured by streptavidin-coated paramagnetic beads.
  • streptavidin-coated paramagnetic beads Such "equilibrium capture” allows the antibodies to be selected according to their affinities of binding, with sensitivity that permits isolation of mutant clones with as little as two-fold higher affinity from a great excess of phages with lower affinity.
  • Conditions used in washing phages bound to a solid phase can also be manipulated to discriminate on the basis of dissociation kinetics.
  • Anti-OX40L clones may be activity selected.
  • the invention provides anti-OX40L antibodies that block the binding between an OX40 receptor and OX40L, but do not block the binding between an and a second protein.
  • Fv clones corresponding to such anti-OX40L antibodies can be selected by (1) isolating anti- OX40L clones from a phage library as described above, and optionally amplifying the isolated population of phage clones by growing up the population in a suitable bacterial host; (2) selecting OX40L and a second protein against which blocking and non-blocking activity, respectively, is desired; (3) adsorbing the anti-OX40L phage clones to immobilized OX40L; (4) using an excess of the second protein to elute any undesired clones that recognize OX40L- binding determinants which overlap or are shared with the binding determinants of the second protein; and (5) eluting the clones which remain adsorbed following step (4)
  • DNA encoding the hybridoma-derived monoclonal antibodies or phage display Fv clones of the invention is readily isolated and sequenced using conventional procedures (e.g. by using oligonucleotide primers designed to specifically amplify the heavy and light chain coding regions of interest from hybridoma or phage DNA template).
  • the DNA can be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of the desired monoclonal antibodies in the recombinant host cells.
  • host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of the desired monoclonal antibodies in the recombinant host cells.
  • DNA encoding the Fv clones of the invention can be combined with known DNA sequences encoding heavy chain and/or light chain constant regions (e.g. the appropriate DNA sequences can be obtained from Kabat et al, supra) to form clones encoding full or partial length heavy and/or light chains.
  • constant regions of any isotype can be used for this purpose, including IgG, IgM, IgA, IgD, and IgE constant regions, and that such constant regions can be obtained from any human or animal species.
  • a Fv clone derived from the variable domain DNA of one animal (such as human) species and then fused to constant region DNA of another animal species to form coding sequence(s) for "hybrid", full length heavy chain and/or light chain is included in the definition of "chimeric” and "hybrid” antibody as used herein.
  • a Fv clone derived from human variable DNA is fused to human constant region DNA to form coding sequence(s) for all human, full or partial length heavy and/or light chains.
  • DNA encoding anti-OX40L antibody derived from a hybridoma of the invention can also be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of homologous murine sequences derived from the hybridoma clone (e.g. as in the method of Morrison et al, Proc.
  • DNA encoding a hybridoma or Fv clone-derived antibody or fragment can be further modified by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
  • chimeric or “hybrid” antibodies are prepared that have the binding specificity of the Fv clone or hybridoma clone-derived antibodies of the invention.
  • the present invention encompasses antibody fragments. In certain circumstances there are advantages of using antibody fragments, rather than whole antibodies. The smaller size of the fragments allows for rapid clearance, and may lead to improved access to solid tumors.
  • F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
  • Fab and F(ab') 2 fragment with increased in vivo half-life comprising a salvage receptor binding epitope residues are described in U.S. Pat. No. 5,869,046.
  • Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
  • the antibody of choice is a single chain Fv fragment (scFv). See WO 93/16185; U.S. Pat. Nos. 5,571,894; and 5,587,458.
  • Fv and sFv are the only species with intact combining sites that are devoid of constant regions; thus, they are suitable for reduced nonspecific binding during in vivo use.
  • sFv fusion proteins may be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an sFv. See Antibody Engineering, ed. Borrebaeck, supra.
  • the antibody fragment may also be a "linear antibody", e.g., as described in U.S. Pat. No. 5,641,870 for example. Such linear antibody fragments may be monospecific or bispecific.
  • the present invention encompasses humanized antibodies.
  • a humanized antibody can have one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import” variable domain.
  • Humanization can be essentially performed following the method of Winter and co-workers (Jones et al (1986) Nature 321:522-525; Riechmann et al (1988) Nature 332:323-327; Verhoeyen et al (1988) Science 239:1534-1536), by substituting hypervariable region sequences for the corresponding sequences of a human antibody.
  • humanized antibodies are chimeric antibodies (U.S. Patent No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
  • humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
  • the choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity. According to the so-called "best- fit" method, the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
  • the human sequence which is closest to that of the rodent is then accepted as the human framework for the humanized antibody (Sims et al (1993) J. Immunol. 151:2296; Chothia et al. (1987) J. MoI. Biol. 196:901.
  • Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies (Carter et al. (1992) Proc. Natl. Acad. ScL USA, 89:4285; Presta e ⁇ ⁇ /. (1993) J. Immunol, 151:2623.
  • humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three- dimensional models of the parental and humanized sequences.
  • Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
  • Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen.
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
  • the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
  • Human antibodies Human anti-OX40L antibodies of the invention can be constructed by combining Fv clone variable domain sequence(s) selected from human-derived phage display libraries with known human constant domain sequences(s) as described above. Alternatively, human monoclonal anti-OX40L antibodies of the invention can be made by the hybridoma method.
  • transgenic animals e.g. mice
  • transgenic animals e.g. mice
  • JH antibody heavy-chain joining region
  • transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge.
  • Jakobovits et al Proc. Natl. Acad. Sci USA, 90: 2551 (1993); Jakobovits et al, Nature, 362: 255 (1993); Bruggermann et al, Year in Immunol, 7: 33 (1993).
  • Gene shuffling can also be used to derive human antibodies from non-human, e.g. rodent, antibodies, where the human antibody has similar affinities and specificities to the starting non-human antibody.
  • this method which is also called “epitope imprinting"
  • either the heavy or light chain variable region of a non-human antibody fragment obtained by phage display techniques as described above is replaced with a repertoire of human V domain genes, creating a population of non-human chain/human chain scFv or Fab chimeras.
  • Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for OX40L and the other is for any other antigen. Exemplary bispecific antibodies may bind to two different epitopes of the OX40L protein. Bispecific antibodies may also be used to localize cytotoxic agents to cells which express OX40L. These antibodies possess an OX40L-binding arm and an arm which binds the cytotoxic agent (e.g. saporin, anti-interferon- ⁇ , vinca alkaloid, ricin A chain, methotrexate or radioactive isotope hapten).
  • cytotoxic agent e.g. saporin, anti-interferon- ⁇ , vinca alkaloid, ricin A chain, methotrexate or radioactive isotope hapten.
  • Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab') 2 bispecific antibodies). Methods for making bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy chain-light chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature, 305: 537 (1983)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of 10 different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule, which is usually done by affinity chromatography steps, is rather cumbersome, and the product yields are low.
  • antibody variable domains with the desired binding specificities are fused to immunoglobulin constant domain sequences.
  • the fusion preferably is with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CHl), containing the site necessary for light chain binding, present in at least one of the fusions.
  • DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are co-transfected into a suitable host organism. This provides for great flexibility in adjusting the mutual proportions of the three polypeptide fragments in embodiments when unequal ratios of the three polypeptide chains used in the construction provide the optimum yields. It is, however, possible to insert the coding sequences for two or all three polypeptide chains in one expression vector when the expression of at least two polypeptide chains in equal ratios results in high yields or when the ratios are of no particular significance.
  • the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain- light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation. This approach is disclosed in WO 94/04690. For further details of generating bispecific antibodies see, for example, Suresh et ah, Methods in Enzymology, 121:210 (1986).
  • the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture.
  • the preferred interface comprises at least a part of the C H 3 domain of an antibody constant domain.
  • one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan).
  • Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
  • Bispecific antibodies include cross-linked or "heteroconjugate" antibodies.
  • one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin.
  • Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (US Patent No. 4,676,980), and for treatment of HIV infection (WO 91/00360, WO 92/00373, and EP 03089).
  • Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in US Patent No. 4,676,980, along with a number of cross-linking techniques.
  • bispecific antibodies can be prepared using chemical linkage.
  • Brennan et ah, Science, 229: 81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab') 2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
  • the Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
  • One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody.
  • the bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
  • bispecific antibodies have been produced using leucine zippers.
  • the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion.
  • the antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers.
  • the fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites.
  • VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites.
  • sFv single-chain Fv
  • Antibodies with more than two valencies are contemplated.
  • trispecific antibodies can be prepared. TuVi et al. J. Immunol. 147: 60 (1991). Multivalent Antibodies
  • a multivalent antibody may be internalized (and/or catabolized) faster than a bivalent antibody by a cell expressing an antigen to which the antibodies bind.
  • the antibodies of the present invention can be multivalent antibodies (which are other than of the IgM class) with three or more antigen binding sites (e.g. tetravalent antibodies), which can be readily produced by recombinant expression of nucleic acid encoding the polypeptide chains of the antibody.
  • the multivalent antibody can comprise a dimerization domain and three or more antigen binding sites.
  • the preferred dimerization domain comprises (or consists of) an Fc region or a hinge region. In this scenario, the antibody will comprise an Fc region and three or more antigen binding sites amino-terminal to the Fe region.
  • the preferred multivalent antibody herein comprises (or consists of) three to about eight, but preferably four, antigen binding sites.
  • the multivalent antibody comprises at least one polypeptide chain (and preferably two polypeptide chains), wherein the polypeptide chain(s) comprise two or more variable domains.
  • the polypeptide chain(s) may comprise VDl-(Xl)n -VD2-(X2)n -Fc, wherein VDl is a first variable domain, VD2 is a second variable domain, Fc is one polypeptide chain of an Fc region, Xl and X2 represent an amino acid or polypeptide, and n is 0 or 1.
  • the polypeptide chain(s) may comprise: VH-CHl -flexible linker- VH-CHl- Fc region chain; or VH-CHl -VH-CHl -Fc region chain.
  • the multivalent antibody herein preferably further comprises at least two (and preferably four) light chain variable domain polypeptides.
  • the multivalent antibody herein may, for instance, comprise from about two to about eight light chain variable domain polypeptides.
  • the light chain variable domain polypeptides contemplated here comprise a light chain variable domain and, optionally, further comprise a CL domain.
  • amino acid sequence modification(s) of the antibodies described herein are contemplated.
  • Amino acid sequence variants of the antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics.
  • the amino acid alterations may be introduced in the subject antibody amino acid sequence at the time that sequence is made.
  • a useful method for identification of certain residues or regions of the antibody that are preferred locations for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244:1081-1085.
  • a residue or group of target residues are identified (e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with antigen.
  • Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to a cytotoxic polypeptide.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
  • Another type of amino acid variant of the antibody alters the original glycosylation pattern of the antibody. Such altering includes deleting one or more carbohydrate moieties found in the antibody, and/or adding one or more glycosylation sites that are not present in the antibody.
  • N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
  • the tripeptide sequences asparagine -X- serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
  • O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5 -hydroxy Iy sine may also be used.
  • glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites).
  • the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
  • the carbohydrate attached thereto may be altered.
  • antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 (Presta, L.). See also US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd).
  • Antibodies with a bisecting N-acetylglucosamine (GIcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in WO 2003/011878, Jean-Mairet et al. and US Patent No. 6,602,684, Umana et al.
  • Antibodies with at least one galactose residue in the oligosaccharide attached to an Fc region of the antibody are reported in WO 1997/30087, Patel et al. See, also, WO 1998/58964 (Raju, S.) and WO 1999/22764 (Raju, S.) concerning antibodies with altered carbohydrate attached to the Fc region thereof. See also US 2005/0123546 (Umana et al.) on antigen-binding molecules with modified glycosylation.
  • the preferred glycosylation variant herein comprises an Fc region, wherein a carbohydrate structure attached to the Fc region lacks fucose.
  • Such variants have improved ADCC function.
  • the Fc region further comprises one or more amino acid substitutions therein which further improve ADCC, for example, substitutions at positions 298, 333, and/or 334 of the Fc region (Eu numbering of residues).
  • cell lines producing defucosylated antibodies include Lecl3 CHO cells deficient in protein fucosylation (Ripka et al Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 Al,
  • Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
  • Naturally occurring residues are divided into groups based on common side-chain properties:
  • hydrophobic norleucine, met, ala, val, leu, ile
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody). Generally, the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated.
  • a convenient way for generating such substitutional variants involves affinity maturation using phage display.
  • hypervariable region sites e.g. 6-7 sites
  • the antibodies thus generated are displayed from filamentous phage particles as fusions to the gene III product of M13 packaged within each particle.
  • the phage-displayed variants are then screened for their biological activity (e.g. binding affinity) as herein disclosed.
  • alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
  • the panel of variants is subjected to screening as described herein and antibodies with superior properties in one or more relevant assays may be selected for further development.
  • Nucleic acid molecules encoding amino acid sequence variants of the antibody are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of the antibody.
  • the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions including that of a hinge cysteine.
  • an antibody used in methods of the invention may comprise one or more alterations as compared to the wild type counterpart antibody, e.g. in the Fc region.
  • the antibodies of the present invention can be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the antibody are water soluble polymers.
  • water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide copolymers, polyoxyethylated polyols (e.g., g
  • Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody may vary, and if more than one polymers are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc. Screening for antibodies with desired properties
  • the antibodies of the present invention can be characterized for their physical/chemical properties and biological functions by various assays known in the art.
  • antibodies are characterized for any one or more of binding to OX40L, reduction or blocking of OX40L activation, reduction or blocking of OX40L downstream molecular signaling, reduction or blocking of OX40 receptor activation, reduction or blocking of OX40 receptor downstream molecular signaling, reduction or blocking of OX40 binding to OX40L and/or OX40L multimerization, and/or treatment and/or prevention of an immune disorder (e.g., asthma, allergic rhinitis, atopic dermatitis, multiple sclerosis, GVHF, or systemic lupus erythematosus); and/or treatment and/or prevention of a disorder associated with OX40L expression and/or activity (such as increased OX40L expression and/or activity).
  • an immune disorder e.g., asthma, allergic rhinitis, atopic dermatitis, multiple sclerosis, GVHF, or systemic lupus erythematosus
  • the purified antibodies can be further characterized by a series of assays including, but not limited to, N- terminal sequencing, amino acid analysis, non-denaturing size exclusion high pressure liquid chromatography (HPLC), mass spectrometry, ion exchange chromatography and papain digestion.
  • assays including, but not limited to, N- terminal sequencing, amino acid analysis, non-denaturing size exclusion high pressure liquid chromatography (HPLC), mass spectrometry, ion exchange chromatography and papain digestion.
  • the antibodies produced herein are analyzed for their biological activity.
  • the antibodies of the present invention are tested for their antigen binding activity.
  • the antigen binding assays that are known in the art and can be used herein include without limitation any direct or competitive binding assays using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, fluorescent immunoassays, and protein A immunoassays. Illustrative antigen binding assay are provided below in the Examples section.
  • the invention provides anti-OX40L monoclonal antibodies that compete with antibody 8E12 and/or 13G5 antibody for binding to OX40L.
  • Such competitor antibodies include antibodies that recognize an OX40L epitope that is the same as or overlaps with the OX40L epitope recognized by antibody 8El 2 and/or 13G5.
  • Such competitor antibodies can be obtained by screening anti-OX40L hybridoma supernatants for binding to immobilized OX40L in competition with labeled 8E12 and/or 13G5 antibody.
  • a hybridoma supernatant containing competitor antibody will reduce the amount of bound, labeled antibody detected in the subject competition binding mixture as compared to the amount of bound, labeled antibody detected in a control binding mixture containing irrelevant (or no) antibody.
  • Any of the competition binding assays described herein are suitable for use in the foregoing procedure.
  • Anti-OX40L antibodies of the invention possessing the properties described herein can be obtained by screening anti-OX40L hybridoma clones for the desired properties by any convenient method. For example, if an anti-OX40L monoclonal antibody that blocks or does not block the binding of OX40 receptor to OX40L is desired, the candidate antibody can be tested in a binding competition assay, such as a competitive binding ELISA, wherein plate wells are coated with OX40L, and a solution of antibody in an excess of OX40 receptor is layered onto the coated plates, and bound antibody is detected enzymatically, e.g.
  • HRP- conjugated anti-Ig antibody or biotinylated anti-Ig antibody e.g. by developing plates with streptavidin-HRP and/or hydrogen peroxide and detecting the HRP color reaction by spectrophotometry at 490 nm with an ELISA plate reader.
  • the candidate antibody can be testing an assay that detects OX40L pathway signaling or OX40 pathway signalling, such as an NFKB signaling assay.
  • an assay that detects OX40L pathway signaling or OX40 pathway signalling, such as an NFKB signaling assay.
  • OX40L pathway signaling or OX40 pathway signalling such as an NFKB signaling assay.
  • NFKB signaling assay is known in the art.
  • Other functional assays to determine the inhibitory capacity of anti-OX40L antibodies are known in the art, some of which are exemplified herein.
  • the present invention contemplates altered antibodies that possess some but not all effector functions, which make it a desired candidate for many applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
  • the Fc activities of the produced immunoglobulin are measured to ensure that only the desired properties are maintained.
  • In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
  • Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks Fc ⁇ R binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
  • NK cells express Fc ⁇ RIII only, whereas monocytes express Fc ⁇ RI, Fc ⁇ RII and Fc ⁇ RIII.
  • FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of
  • ADCC activity of a molecule of interest is described in US Patent No. 5,500,362 or 5,821,337.
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK Natural Killer
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
  • CIq binding assays may also be carried out to confirm that the antibody is unable to bind CIq and hence lacks CDC activity.
  • a CDC assay e.g. as described in Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996), may be performed.
  • FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art.
  • theinvention provides altered antibodies that possess increased effector functions and/or increased half-life.
  • the nucleic acid encoding it is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression.
  • DNA encoding the antibody is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • Many vectors are available. The choice of vector depends in part on the host cell to be used. Generally, preferred host cells are of either prokaryotic or eukaryotic (generally mammalian) origin.
  • constant regions of any isotype can be used for this purpose, including IgG, IgM, IgA, IgD, and IgE constant regions, and that such constant regions can be obtained from any human or animal species.
  • Generating antibodies using prokaryotic host cells i. Vector Construction
  • Polynucleotide sequences encoding polypeptide components of the antibody of the invention can be obtained using standard recombinant techniques. Desired polynucleotide sequences may be isolated and sequenced from antibody producing cells such as hybridoma cells. Alternatively, polynucleotides can be synthesized using nucleotide synthesizer or PCR techniques. Once obtained, sequences encoding the polypeptides are inserted into a recombinant vector capable of replicating and expressing heterologous polynucleotides in prokaryotic hosts. Many vectors that are available and known in the art can be used for the purpose of the present invention.
  • Selection of an appropriate vector will depend mainly on the size of the nucleic acids to be inserted into the vector and the particular host cell to be transformed with the vector.
  • Each vector contains various components, depending on its function (amplification or expression of heterologous polynucleotide, or both) and its compatibility with the particular host cell in which it resides.
  • the vector components generally include, but are not limited to: an origin of replication, a selection marker gene, a promoter, a ribosome binding site (RBS), a signal sequence, the heterologous nucleic acid insert and a transcription termination sequence.
  • plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell are used in connection with these hosts.
  • the vector ordinarily carries a replication site, as well as marking sequences which are capable of providing phenotypic selection in transformed cells.
  • E. coli is typically transformed using pBR322, a plasmid derived from an E. coli species.
  • pBR322 contains genes encoding ampicillin (Amp) and tetracycline (Tet) resistance and thus provides easy means for identifying transformed cells.
  • pBR322 its derivatives, or other microbial plasmids or bacteriophage may also contain, or be modified to contain, promoters which can be used by the microbial organism for expression of endogenous proteins. Examples of pBR322 derivatives used for expression of particular antibodies are described in detail in Carter et al., U.S. Patent No. 5,648,237.
  • phage vectors containing replicon and control sequences that are compatible with the host microorganism can be used as transforming vectors in connection with these hosts.
  • bacteriophage such as ⁇ GEM.TM.-l 1 may be utilized in making a recombinant vector which can be used to transform susceptible host cells such as E. coli LE392.
  • the expression vector of the invention may comprise two or more promoter-cistron pairs, encoding each of the polypeptide components.
  • a promoter is an untranslated regulatory sequence located upstream (5 T ) to a cistron that modulates its expression.
  • Prokaryotic promoters typically fall into two classes, inducible and constitutive. Inducible promoter is a promoter that initiates increased levels of transcription of the cistron under its control in response to changes in the culture condition, e.g. the presence or absence of a nutrient or a change in temperature.
  • Inducible promoter is a promoter that initiates increased levels of transcription of the cistron under its control in response to changes in the culture condition, e.g. the presence or absence of a nutrient or a change in temperature.
  • a large number of promoters recognized by a variety of potential host cells are well known.
  • the selected promoter can be operably linked to cistron DNA encoding the light or heavy chain by removing the promoter from the source DNA via restriction enzyme digestion and inserting the isolated promoter sequence into the vector of the invention.
  • Both the native promoter sequence and many heterologous promoters may be used to direct amplification and/or expression of the target genes.
  • heterologous promoters are utilized, as they generally permit greater transcription and higher yields of expressed target gene as compared to the native target polypeptide promoter.
  • Promoters suitable for use with prokaryotic hosts include the PhoA promoter, the ⁇ -galactamase and lactose promoter systems, a tryptophan (trp) promoter system and hybrid promoters such as the tac or the trc promoter.
  • trp tryptophan
  • other promoters that are functional in bacteria such as other known bacterial or phage promoters
  • Their nucleotide sequences have been published, thereby enabling a skilled worker operably to ligate them to cistrons encoding the target light and heavy chains (Siebenlist et al. (1980) Cell 20: 269) using linkers or adaptors to supply any required restriction sites.
  • each cistron within the recombinant vector comprises a secretion signal sequence component that directs translocation of the expressed polypeptides across a membrane.
  • the signal sequence may be a component of the vector, or it may be a part of the target polypeptide DNA that is inserted into the vector.
  • the signal sequence selected for the purpose of this invention should be one that is recognized and processed (i.e. cleaved by a signal peptidase) by the host cell.
  • the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group consisting of the alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II (STII) leaders, LamB, PhoE, PeIB, OmpA and MBP.
  • STII heat-stable enterotoxin II
  • LamB, PhoE, PeIB, OmpA and MBP are STII signal sequences or variants thereof.
  • the production of the immunoglobulins according to the invention can occur in the cytoplasm of the host cell, and therefore does not require the presence of secretion signal sequences within each cistron.
  • immunoglobulin light and heavy chains are expressed, folded and assembled to form functional immunoglobulins within the cytoplasm.
  • Certain host strains e.g., the E. coli trxB- strains
  • Prokaryotic host cells suitable for expressing antibodies of the invention include Archaebacteria and
  • Eubacteria such as Gram-negative or Gram-positive organisms.
  • useful bacteria include Escherichia (e.g., E. coli), Bacilli (e.g., B. subtilis), Enterobacteria, Pseudomonas species (e.g., P. aeruginosa), Salmonella typhimurium, Serratia marcescans, Klebsiella, Proteus, Shigella, Rhizobia, Vitreoscilla, or Paracoccus.
  • gram-negative cells are used.
  • E. coli cells are used as hosts for the invention. Examples of E. coli strains include strain W3110 (Bachmann, Cellular and Molecular Biology, vol.
  • strain 33D3 having genotype W3110 ⁇ fhuA ( ⁇ tonA) ptr3 lac Iq lacL8 ⁇ ompT ⁇ (nmpc-fepE) degP41 kanR (U.S. Pat. No. 5,639,635).
  • Other strains and derivatives thereof, such as E. coli 294 (ATCC 31,446), E. coli B, E. coli ⁇ 1776 (ATCC 31,537) and E. coli RV308(ATCC 31,608) are also suitable. These examples are illustrative rather than limiting.
  • Transformation means introducing DNA into the prokaryotic host so that the DNA is replicable, either as an extrachromosomal element or by chromosomal integrant.
  • transformation is done using standard techniques appropriate to such cells.
  • the calcium treatment employing calcium chloride is generally used for bacterial cells that contain substantial cell-wall barriers.
  • Another method for transformation employs polyethylene glycol/DMSO.
  • Yet another technique used is electroporation.
  • Prokaryotic cells used to produce the polypeptides of the invention are grown in media known in the art and suitable for culture of the selected host cells.
  • suitable media include luria broth (LB) plus necessary nutrient supplements.
  • the media also contains a selection agent, chosen based on the construction of the expression vector, to selectively permit growth of prokaryotic cells containing the expression vector. For example, ampicillin is added to media for growth of cells expressing ampicillin resistant gene.
  • any necessary supplements besides carbon, nitrogen, and inorganic phosphate sources may also be included at appropriate concentrations introduced alone or as a mixture with another supplement or medium such as a complex nitrogen source.
  • the culture medium may contain one or more reducing agents selected from the group consisting of glutathione, cysteine, cystamine, thioglycollate, dithioerythritol and dithiothreitol.
  • the prokaryotic host cells are cultured at suitable temperatures.
  • the preferred temperature ranges from about 20 0 C to about 39°C, more preferably from about 25°C to about 37°C, even more preferably at about 30 0 C.
  • the pH of the medium may be any pH ranging from about 5 to about 9, depending mainly on the host organism.
  • the pH is preferably from about 6.8 to about 7.4, and more preferably about 7.0.
  • an inducible promoter is used in the expression vector of the invention, protein expression is induced under conditions suitable for the activation of the promoter.
  • PhoA promoters are used for controlling transcription of the polypeptides.
  • the transformed host cells are cultured in a phosphate- limiting medium for induction.
  • the phosphate-limiting medium is the C.R.A.P medium (see, e.g., Simmons et al., J. Immunol. Methods (2002), 263: 133-147).
  • inducers may be used, according to the vector construct employed, as is known in the art.
  • the expressed polypeptides of the present invention are secreted into and recovered from the periplasm of the host cells.
  • Protein recovery typically involves disrupting the microorganism, generally by such means as osmotic shock, sonication or lysis. Once cells are disrupted, cell debris or whole cells may be removed by centrifugation or filtration. The proteins may be further purified, for example, by affinity resin chromatography. Alternatively, proteins can be transported into the culture media and isolated therein. Cells may be removed from the culture and the culture supernatant being filtered and concentrated for further purification of the proteins produced. The expressed polypeptides can be further isolated and identified using commonly known methods such as polyacrylamide gel electrophoresis (PAGE) and Western blot assay.
  • PAGE polyacrylamide gel electrophoresis
  • antibody production is conducted in large quantity by a fermentation process.
  • Large-scale fed-batch fermentation procedures are available for production of recombinant proteins.
  • Large- scale fermentations have at least 1000 liters of capacity, preferably about 1,000 to 100,000 liters of capacity. These fermentors use agitator impellers to distribute oxygen and nutrients, especially glucose (the preferred carbon/energy source).
  • Small scale fermentation refers generally to fermentation in a fermentor that is no more than approximately 100 liters in volumetric capacity, and can range from about 1 liter to about 100 liters.
  • induction of protein expression is typically initiated after the cells have been grown under suitable conditions to a desired density, e.g., an OD550 of about 180-220, at which stage the cells are in the early stationary phase.
  • a desired density e.g., an OD550 of about 180-220
  • inducers may be used, according to the vector construct employed, as is known in the art and described above. Cells may be grown for shorter periods prior to induction. Cells are usually induced for about 12-50 hours, although longer or shorter induction time may be used.
  • various fermentation conditions can be modified.
  • additional vectors overexpressing chaperone proteins such as Dsb proteins (DsbA, DsbB, DsbC, DsbD and or DsbG) or FkpA (a peptidylprolyl cis,trans-isomerase with chaperone activity) can be used to co-transform the host prokaryotic cells.
  • the chaperone proteins have been demonstrated to facilitate the proper folding and solubility of heterologous proteins produced in bacterial host cells. Chen et al.
  • certain host strains deficient for proteolytic enzymes can be used for the present invention.
  • host cell strains may be modified to effect genetic mutation(s) in the genes encoding known bacterial proteases such as Protease III, OmpT, DegP, Tsp, Protease I, Protease Mi, Protease V, Protease VI and combinations thereof.
  • E. coli protease-deficient strains are available and described in, for example, JoIy et al. (1998), supra; Georgiou et al., U.S. Patent No. 5,264,365; Georgiou et al., U.S. Patent No. 5,508,192; Hara et al., Microbial Drug Resistance, 2:63- 72 (1996).
  • E. coli strains deficient for proteolytic enzymes and transformed with plasmids overexpressing one or more chaperone proteins are used as host cells in the expression system of the invention.
  • Standard protein purification methods known in the art can be employed.
  • the following procedures are exemplary of suitable purification procedures: fractionation on immunoaffinity or ion-exchange columns, ethanol precipitation, reverse phase HPLC, chromatography on silica or on a cation-exchange resin such as DEAE, chromatofocusing, SDS-PAGE, ammonium sulfate precipitation, and gel filtration using, for example, Sephadex G- 75.
  • Protein A immobilized on a solid phase is used for immunoaffinity purification of the full length antibody products of the invention.
  • Protein A is a 4IkD cell wall protein from Staphylococcus aureas which binds with a high affinity to the Fc region of antibodies. Lindmark et al (1983) J. Immunol. Meth. 62:1-13.
  • the solid phase to which Protein A is immobilized is preferably a column comprising a glass or silica surface, more preferably a controlled pore glass column or a silicic acid column. In some applications, the column has been coated with a reagent, such as glycerol, in an attempt to prevent nonspecific adherence of contaminants.
  • the preparation derived from the cell culture as described above is applied onto the Protein A immobilized solid phase to allow specific binding of the antibody of interest to Protein A.
  • the solid phase is then washed to remove contaminants non-specifically bound to the solid phase.
  • the antibody of interest is recovered from the solid phase by elution.
  • the vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
  • a vector for use in a eukaryotic host cell may also contain a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide of interest.
  • the heterologous signal sequence selected preferably is one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell.
  • mammalian signal sequences as well as viral secretory leaders, for example, the herpes simplex gD signal are available.
  • the DNA for such precursor region is ligated in reading frame to DNA encoding the antibody.
  • an origin of replication component is not needed for mammalian expression vectors.
  • the SV40 origin may typically be used only because it contains the early promoter. (Hi) Selection gene component
  • Selection genes may contain a selection gene, also termed a selectable marker.
  • Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, where relevant, or (c) supply critical nutrients not available from complex media.
  • One example of a selection scheme utilizes a drug to arrest growth of a host cell. Those cells that are successfully transformed with a heterologous gene produce a protein conferring drug resistance and thus survive the selection regimen. Examples of such dominant selection use the drugs neomycin, mycophenolic acid and hygromycin.
  • Suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up the antibody nucleic acid, such as DHFR, thymidine kinase, metallothionein-I and -II, preferably primate metallothionein genes, adenosine deaminase, ornithine decarboxylase, etc.
  • cells transformed with the DHFR selection gene are first identified by culturing all of the transformants in a culture medium that contains methotrexate (Mtx), a competitive antagonist of DHFR.
  • Mtx methotrexate
  • An appropriate host cell when wild-type DHFR is employed is the Chinese hamster ovary (CHO) cell line deficient in DHFR activity (e.g., ATCC CRL-9096).
  • host cells particularly wild-type hosts that contain endogenous DHFR transformed or co- transformed with DNA sequences encoding an antibody, wild-type DHFR protein, and another selectable marker such as aminoglycoside 3 '-phosphotransferase (APH) can be selected by cell growth in medium containing a selection agent for the selectable marker such as an aminoglycosidic antibiotic, e.g., kanamycin, neomycin, or G418. See U.S. Patent No. 4,965,199.
  • APH aminoglycoside 3 '-phosphotransferase
  • Promoter component Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the antibody polypeptide nucleic acid.
  • Promoter sequences are known for eukaryotes. Virtually alleukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide. At the 3' end of most eukaryotic genes is an AATAAA sequence that may be the signal for addition of the poly A tail to the 3' end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.
  • Antibody polypeptide transcription from vectors in mammalian host cells is controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, from heat-shock promoters, provided such promoters are compatible with the host cell systems.
  • viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), from hetero
  • the early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication.
  • the immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII E restriction fragment.
  • a system for expressing DNA in mammalian hosts using the bovine papilloma virus as a vector is disclosed in U.S. Patent No. 4,419,446. A modification of this system is described in U.S. Patent No. 4,601,978.
  • the Rous Sarcoma Virus long terminal repeat can be used as the promoter.
  • Enhancer element component Transcription of DNA encoding the antibody polypeptide of this invention by higher eukaryotes is often increased by inserting an enhancer sequence into the vector.
  • enhancer sequences are now known from mammalian genes (globin, elastase, albumin, ⁇ -fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
  • the enhancer may be spliced into the vector at a position 5' or 3' to the antibody polypeptide - encoding sequence, but is preferably located at a site 5' from the promoter.
  • Transcription termination component Expression vectors used in eukaryotic host cells will typically also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding an antibody.
  • One useful transcription termination component is the bovine growth hormone polyadenylation region. See WO94/11026 and the expression vector disclosed therein.
  • Suitable host cells for cloning or expressing the DNA in the vectors herein include higher eukaryote cells described herein, including vertebrate host cells. Propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CVl line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)) ; baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cehV-DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci.
  • COS-7 monkey kidney CVl line transformed by SV40
  • human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)
  • mice Sertoli cells TM4, Mather, Biol. Reprod. 23:243-251 (1980)
  • monkey kidney cells CVl ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N. Y. Acad. Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
  • Host cells are transformed with the above -described expression or cloning vectors for antibody production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • the host cells used to produce an antibody of this invention may be cultured in a variety of media.
  • Commercially available media such as Ham's FlO (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPMI- 1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing the host cells.
  • U.S. Patent Re. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCINTM drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
  • the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan. (ix) Purification of antibody
  • the antibody can be produced intracellularly, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
  • a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
  • the antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being the preferred purification technique.
  • affinity chromatography is the preferred purification technique.
  • the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody.
  • Protein A can be used to purify antibodies that are based on human ⁇ l, ⁇ 2, or ⁇ 4 heavy chains (Lindmark et al., J. Immunol. Meth. 62:1-13 (1983)).
  • Protein G is recommended for all mouse isotypes and for human ⁇ 3 (Guss et al., EMBO J. 5:15671575 (1986)).
  • the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available.
  • Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
  • the antibody comprises a CH3 domain
  • the Bakerbond ABXTMresin J. T. Baker, Phillipsburg, NJ is useful for purification.
  • the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g., from about 0-0.25M salt).
  • Immunoconjugates such as fractionation on an ion-exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin SEPHAROSETM chromatography on an anion or cation exchange resin (such as a polyaspartic acid column), chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available depending on the antibody to be recovered.
  • the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5-4.5, preferably performed at low salt concentrations (e.g., from about 0-0.25M salt).
  • the invention also provides immunoconjugates (interchangeably termed "antibody-drug conjugates” or "ADC”), comprising any of the anti-OX40L antibodies described herein conjugated to a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
  • ADC antibody-drug conjugates
  • Toxins used in antibody-toxin conjugates include bacterial toxins such as diphtheria toxin, plant toxins such as ricin, small molecule toxins such as geldanamycin (Mandler et al (2000) Jour, of the Nat. Cancer Inst. 92(19):1573-1581; Mandler et al (2000) Bioorganic & Med. Chem. Letters 10:1025-1028; Mandler et al (2002) Bioconjugate Chem. 13:786-791), maytansinoids (EP 1391213; Liu et al., (1996) Proc. Natl. Acad. Sci. USA 93:8618-8623), and calicheamicin (Lode et al (1998) Cancer Res.
  • bacterial toxins such as diphtheria toxin
  • plant toxins such as ricin
  • small molecule toxins such as geldanamycin
  • maytansinoids EP 1391213; Liu et al., (1996)
  • the toxins may effect their cytotoxic and cytostatic effects by mechanisms including tubulin binding, DNA binding, or topoisomerase inhibition. Some cytotoxic drugs tend to be inactive or less active when conjugated to large antibodies or protein receptor ligands.
  • ZEVALIN® is an antibody-radioisotope conjugate composed of a murine IgGl kappa monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes and 111 In or 90 Y radioisotope bound by a thiourea linker-chelator (Wiseman et al (2000) Eur. Jour. Nucl. Med. 27(7):766-77; Wiseman et al (2002) Blood 99(12):4336-42; Witzig et al (2002) J. Clin. Oncol.
  • ZEVALIN has activity against B-cell non-Hodgkin's Lymphoma (NHL), administration results in severe and prolonged cytopenias in most patients.
  • MYLOTARGTM (gemtuzumab ozogamicin, Wyeth Pharmaceuticals), an antibody drug conjugate composed of a hu CD33 antibody linked to calicheamicin, was approved in 2000 for the treatment of acute myeloid leukemia by injection (Drugs of the Future (2000) 25(7):686; US Patent Nos. 4970198; 5079233; 5585089; 5606040; 5693762; 5739116; 5767285; 5773001).
  • Cantuzumab mertansine (Immunogen, Inc.), an antibody drug conjugate composed of the huC242 antibody linked via the disulfide linker SPP to the maytansinoid drug moiety, DMl, is advancing into Phase II trials for the treatment of cancers that express CanAg, such as colon, pancreatic, gastric, and others.
  • MLN- 2704 (Millennium Pharm., BZL Biologies, Immunogen Inc.)
  • PSMA prostate specific membrane antigen
  • auristatin peptides auristatin E (AE) and monomethylauristatin (MMAE), synthetic analogs of dolastatin, were conjugated to chimeric monoclonal antibodies cBR96 (specific to Lewis Y on carcinomas) and cAClO (specific to CD30 on hematological malignancies) (Doronina et al (2003) Nature Biotechnology 21(7):778-784) and are under therapeutic development.
  • Chemotherapeutic agents useful in the generation of immunoconjugates are described herein (eg., above).
  • Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • diphtheria A chain nonbinding active fragments of diphtheria toxin
  • exotoxin A chain from Pseudomonas aeruginosa
  • ricin A chain abrin A chain
  • modeccin A chain alpha-
  • radionuclides are available for the production of radioconjugated antibodies. Examples include 212 Bi, 131 I, 131 In, 90 Y, and 186 Re.
  • Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6- diisocyanate), and bis-active fluorine compounds (such as l,5-difluoro-2,4-dinitrobenzene).
  • SPDP N-succinimidy
  • a ricin immunotoxin can be prepared as described in Vitetta et al., Science, 238: 1098 (1987).
  • Carbon- 14-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026.
  • Conjugates of an antibody and one or more small molecule toxins such as a calicheamicin, maytansinoids, dolastatins, aurostatins, a trichothecene, and CC1065, and the derivatives of these toxins that have toxin activity, are also contemplated herein. i. Maytansine and maytansinoids
  • the immunoconjugate comprises an antibody (full length or fragments) of the invention conjugated to one or more maytansinoid molecules.
  • Maytansinoids are mitototic inhibitors which act by inhibiting tubulin polymerization. Maytansine was first isolated from the east African shrub Maytenus serrata (U.S. Patent No. 3,896,111). Subsequently, it was discovered that certain microbes also produce maytansinoids, such as maytansinol and C-3 maytansinol esters (U.S. Patent No. 4,151,042). Synthetic maytansinol and derivatives and analogues thereof are disclosed, for example, in U.S. Patent Nos.
  • Maytansinoid drug moieties are attractive drug moieties in antibody drug conjugates because they are: (i) relatively accessible to prepare by fermentation or chemical modification, derivatization of fermentation products, (ii) amenable to derivatization with functional groups suitable for conjugation through the non-disulfide linkers to antibodies, (iii) stable in plasma, and (iv) effective against a variety of tumor cell lines.
  • Immunoconjugates containing maytansinoids, methods of making same, and their therapeutic use are disclosed, for example, in U.S. Patent Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235 Bl, the disclosures of which are hereby expressly incorporated by reference.
  • the conjugate was found to be highly cytotoxic towards cultured colon cancer cells, and showed antitumor activity in an in vivo tumor growth assay.
  • the drug conjugate achieved a degree of cytotoxicity similar to the free maytansinoid drug, which could be increased by increasing the number of maytansinoid molecules per antibody molecule.
  • the A7- maytansinoid conjugate showed low systemic cytotoxicity in mice.
  • Antibody-maytansinoid conjugates are prepared by chemically linking an antibody to a maytansinoid molecule without significantly diminishing the biological activity of either the antibody or the maytansinoid molecule. See, e.g., U.S. Patent No. 5,208,020 (the disclosure of which is hereby expressly incorporated by reference). An average of 3-4 maytansinoid molecules conjugated per antibody molecule has shown efficacy in enhancing cytotoxicity of target cells without negatively affecting the function or solubility of the antibody, although even one molecule of toxin/antibody would be expected to enhance cytotoxicity over the use of naked antibody. Maytansinoids are well known in the art and can be synthesized by known techniques or isolated from natural sources.
  • Suitable maytansinoids are disclosed, for example, in U.S. Patent No. 5,208,020 and in the other patents and nonpatent publications referred to hereinabove.
  • Preferred maytansinoids are maytansinol and maytansinol analogues modified in the aromatic ring or at other positions of the maytansinol molecule, such as various maytansinol esters.
  • There are many linking groups known in the art for making antibody-maytansinoid conjugates including, for example, those disclosed in U.S. Patent No. 5,208,020 or EP Patent 0 425 235 Bl, Chari et al., Cancer Research 52:127-131 (1992), and U.S. Patent Application No.
  • Antibody-maytansinoid conjugates comprising the linker component SMCC may be prepared as disclosed in U.S. Patent Application No. 10/960,602, filed Oct. 8, 2004.
  • the linking groups include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups, or esterase labile groups, as disclosed in the above-identified patents, disulfide and thioether groups being preferred. Additional linking groups are described and exemplified herein.
  • Conjugates of the antibody and maytansinoid may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p- diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such
  • Particularly preferred coupling agents include N- succinimidyl-3-(2-pyridyldithio) propionate (SPDP) (Carlsson et al., Biochem. J. 173:723-737 (1978)) and N- succinimidyl-4-(2-pyridylthio)pentanoate (SPP) to provide for a disulfide linkage.
  • SPDP N- succinimidyl-3-(2-pyridyldithio) propionate
  • SPP N- succinimidyl-4-(2-pyridylthio)pentanoate
  • the linker may be attached to the maytansinoid molecule at various positions, depending on the type of the link.
  • an ester linkage may be formed by reaction with a hydroxyl group using conventional coupling techniques. The reaction may occur at the C-3 position having a hydroxyl group, the C- 14 position modified with hydroxymethyl, the C- 15 position modified with a hydroxyl group, and the C-20 position having a hydroxyl group.
  • the linkage is formed at the C-3 position of maytansinol or a maytansinol analogue, ii. Auristatins and dolastatins
  • the immunoconjugate comprises an antibody of the invention conjugated to dolastatins or dolostatin peptidic analogs and derivatives, the auristatins (US Patent Nos. 5635483; 5780588).
  • Dolastatins and auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis, and nuclear and cellular division (Woyke et al (2001) Antimicrob. Agents and Chemother. 45(12):3580-3584) and have anticancer (US 5663149) and antifungal activity (Pettit et al (1998) Antimicrob. Agents Chemother. 42:2961-2965).
  • the dolastatin or auristatin drug moiety may be attached to the antibody through the N (amino) terminus or the C (carboxyl) terminus of the peptidic drug moiety (WO 02/088172).
  • Exemplary auristatin embodiments include the N-terminus linked monomethylauristatin drug moieties DE and DF, disclosed in "Monomethylvaline Compounds Capable of Conjugation to Ligands", US Ser. No. 10/983,340, filed Nov. 5, 2004, the disclosure of which is expressly incorporated by reference in its entirety.
  • peptide-based drug moieties can be prepared by forming a peptide bond between two or more amino acids and/or peptide fragments.
  • Such peptide bonds can be prepared, for example, according to the liquid phase synthesis method (see E. Schroder and K. L ⁇ bke, "The Peptides", volume 1, pp 76-136, 1965, Academic Press) that is well known in the field of peptide chemistry.
  • the auristatin/dolastatin drug moieties may be prepared according to the methods of: US 5635483; US 5780588; Pettit et al (1989) J. Am. Chem. Soc.
  • the immunoconjugate comprises an antibody of the invention conjugated to one or more calicheamicin molecules.
  • the calicheamicin family of antibiotics are capable of producing double-stranded DNA breaks at sub-picomolar concentrations.
  • Structural analogues of calicheamicin which may be used include, but are not limited to, ⁇ /, (X 2 1 , (X 3 1 , N-acetyl- ⁇ PSAG and ⁇ (Hinman et al., Cancer Research 53:3336-3342 (1993), Lode et al., Cancer
  • Another anti-tumor drug that the antibody can be conjugated is QFA which is an antifolate.
  • QFA an antifolate.
  • calicheamicin and QFA have intracellular sites of action and do not readily cross the plasma membrane. Therefore, cellular uptake of these agents through antibody mediated internalization greatly enhances their cytotoxic effects. iv. Other cytotoxic agents
  • Enzymatically active toxins and fragments thereof which can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, WO 93/21232 published October 28, 1993.
  • the present invention further contemplates an immunoconjugate formed between an antibody and a compound with nucleolytic activity (e.g., a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase).
  • a compound with nucleolytic activity e.g., a ribonuclease or a DNA endonuclease such as a deoxyribonuclease; DNase.
  • the antibody may comprise a highly radioactive atom.
  • radioactive isotopes are available for the production of radioconjugated antibodies. Examples include At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu.
  • the conjugate When used for detection, it may comprise a radioactive atom for scintigraphic studies, for example tc 99m or I 123 , or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine- 123 again, iodine-131, indium-111, fluorine-19, carbon-13, nitrogen-15, oxygen-17, gadolinium, manganese or iron.
  • NMR nuclear magnetic resonance
  • mri nuclear magnetic resonance
  • the radio- or other labels may be incorporated in the conjugate in known ways.
  • the peptide may be biosynthesized or may be synthesized by chemical amino acid synthesis using suitable amino acid precursors involving, for example, fluorine-19 in place of hydrogen.
  • Labels such as tc 99m or I 123 , Re 186 , Re 188 and In 111 can be attached via a cysteine residue in the peptide.
  • Yttrium-90 can be attached via a lysine residue.
  • the IODOGEN method (Fraker et al (1978) Biochem. Biophys. Res. Commun. 80: 49-57 can be used to incorporate iodine-123. "Monoclonal Antibodies in Immunoscintigraphy" (Chatal, CRC Press 1989) describes other methods in detail.
  • Conjugates of the antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N- maleimidomethyl) cyclohexane-1-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCl), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives
  • SPDP N-succinimidyl-3-(2-pyridyldithio) propionate
  • SMCC succinimidyl-4-(N- maleimidomethyl) cyclohexane
  • a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238:1098 (1987).
  • Carbon- 14-labeled l-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026.
  • the linker may be a "cleavable linker" facilitating release of the cytotoxic drug in the cell.
  • a "cleavable linker” facilitating release of the cytotoxic drug in the cell.
  • an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide - containing linker (Chari et al., Cancer Research 52:127-131 (1992); U.S. Patent No. 5,208,020) may be used.
  • the compounds of the invention expressly contemplate, but are not limited to, ADC prepared with cross- linker reagents: BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo-KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4-vinylsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., Rockford, IL., U.S.A). See pages 467-498, 2003-2004 Applications Handbook and Catalog. v. Preparation of antibody drug conjugates
  • an antibody (Ab) is conjugated to one or more drug moieties (D), e.g. about 1 to about 20 drug moieties per antibody, through a linker (L).
  • the ADC of Formula I may be prepared by several routes, employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1) reaction of a nucleophilic group of an antibody with a bivalent linker reagent, to form Ab-L, via a covalent bond, followed by reaction with a drug moiety D; and (2) reaction of a nucleophilic group of a drug moiety with a bivalent linker reagent, to form D-L, via a covalent bond, followed by reaction with the nucleophilic group of an antibody. Additional methods for preparing ADC are described herein.
  • the linker may be composed of one or more linker components.
  • exemplary linker components include 6- maleimidocaproyl ("MC"), maleimidopropanoyl ("MP”), valine-citrulline (“val-cit”), alanine-phenylalanine (“ala- phe”), p-aminobenzyloxycarbonyl (“PAB”), N-Succinimidyl 4-(2-pyridylthio) pentanoate (“SPP”), N-Succinimidyl 4-(N-maleimidomethyl) cyclohexane- 1 carboxylate (“SMCC), and N-Succinimidyl (4-iodo-acetyl) aminobenzoate (“SIAB”).
  • MC 6- maleimidocaproyl
  • MP maleimidopropanoyl
  • val-cit valine-citrulline
  • alanine-phenylalanine ala- phe
  • PAB
  • the linker may comprise amino acid residues.
  • Exemplary amino acid linker components include a dipeptide, a tripeptide, a tetrapeptide or a pentapeptide.
  • Exemplary dipeptides include: valine- citrulline (vc or val-cit), alanine-phenylalanine (af or ala-phe).
  • Exemplary tripeptides include: glycine -valine - citrulline (gly-val-cit) and glycine-glycine-glycine (gly-gly-gly).
  • Amino acid residues which comprise an amino acid linker component include those occurring naturally, as well as minor amino acids and non-naturally occurring amino acid analogs, such as citrulline.
  • Amino acid linker components can be designed and optimized in their selectivity for enzymatic cleavage by a particular enzymes, for example, a tumor-associated protease, cathepsin B, C and D, or a plasmin protease.
  • Nucleophilic groups on antibodies include, but are not limited to: (i) N-terminal amine groups, (ii) side chain amine groups, e.g. lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated.
  • Amine, thiol, and hydroxyl groups are nucleophilic and capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents including: (i) active esters such as NHS esters, HOBt esters, haloformates, and acid halides; (ii) alkyl and benzyl halides such as haloacetamides; (iii) aldehydes, ketones, carboxyl, and maleimide groups. Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges. Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol).
  • a reducing agent such as DTT (dithiothreitol).
  • Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles.
  • Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol.
  • Reactive thiol groups may be introduced into the antibody (or fragment thereof) by introducing one, two, three, four, or more cysteine residues (e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues).
  • Antibody drug conjugates of the invention may also be produced by modification of the antibody to introduce electrophilic moieties, which can react with nucleophilic substituents on the linker reagent or drug.
  • the sugars of glycosylated antibodies may be oxidized, e.g. with periodate oxidizing reagents, to form aldehyde or ketone groups which may react with the amine group of linker reagents or drug moieties.
  • the resulting imine Schiff base groups may form a stable linkage, or may be reduced, e.g. by borohydride reagents to form stable amine linkages.
  • reaction of the carbohydrate portion of a glycosylated antibody with either glactose oxidase or sodium meta-periodate may yield carbonyl (aldehyde and ketone) groups in the protein that can react with appropriate groups on the drug (Hermanson, Bioconjugate Techniques).
  • proteins containing N-terminal serine or threonine residues can react with sodium meta-periodate, resulting in production of an aldehyde in place of the first amino acid (Geoghegan & Stroh, (1992) Bioconjugate Chem. 3: 138-146; US 5362852).
  • aldehyde can be reacted with a drug moiety or linker nucleophile.
  • nucleophilic groups on a drug moiety include, but are not limited to: amine, thiol, hydroxyl, hydrazide, oxime, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide groups capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents including: (i) active esters such as NHS esters, HOBt esters, haloformates, and acid halides; (ii) alkyl and benzyl halides such as haloacetamides; (iii) aldehydes, ketones, carboxyl, and maleimide groups.
  • a fusion protein comprising the antibody and cytotoxic agent may be made, e.g., by recombinant techniques or peptide synthesis.
  • the length of DNA may comprise respective regions encoding the two portions of the conjugate either adjacent one another or separated by a region encoding a linker peptide which does not destroy the desired properties of the conjugate.
  • the antibody may be conjugated to a "receptor” (such streptavidin) for utilization in tumor pre-targeting wherein the antibody -receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand” (e.g., avidin) which is conjugated to a cytotoxic agent (e.g., a radionucleotide).
  • a "ligand” e.g., avidin
  • cytotoxic agent e.g., a radionucleotide.
  • Pharmaceutical Formulations comprising an antibody of the invention are prepared for storage by mixing the antibody having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (Remington: The Science and Practice of Pharmacy 20th edition (2000)), in the form of aqueous solutions, lyophilized or other dried formulations.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, histidine and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, hist
  • the formulation herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
  • the active ingredients may also be entrapped in microcapsule prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly- (methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • the formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the immunoglobulin of the invention, which matrices are in the form of shaped articles, e.g., films, or microcapsule. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No.
  • copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-gly colic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-gly colic acid copolymer and leuprolide acetate), and poly-D-(-)-3- hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
  • encapsulated immunoglobulins When encapsulated immunoglobulins remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37°C, resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S-S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions. Uses
  • An antibody of the present invention may be used in, for example, in vitro, ex vivo and in vivo therapeutic methods.
  • the invention provides methods for treating or preventing an immune disorder, the methods comprising administering an effective amount of an anti-OX40L antibody to a subject in need of such treatment.
  • the immune disorder is an immune disorder.
  • the disorder is an autoimmune disorder.
  • the disorder is asthma, atopic dermatitis, allergic rhinitis, inflammatory bowel disease, multiple sclerosis, GVHD, and/or systemic lupus erythematosus.
  • the disorder is a disease associated with virus, bacteria or other infectious agent. See US2005/0069548 Al.
  • the antibodies of the invention can bind antigen from other species. Accordingly, the antibodies of the invention can be used to bind specific antigen activity, e.g., in a cell culture containing the antigen, in human subjects or in other mammalian subjects having the antigen with which an antibody of the invention cross-reacts (e.g. chimpanzee, baboon, marmoset, cynomolgus and rhesus, pig or mouse). In one embodiment, the antibody of the invention can be used for inhibiting antigen activities by contacting the antibody with the antigen such that antigen activity is inhibited.
  • the antigen is a human protein molecule.
  • an antibody of the invention can be used in a method for binding an antigen in a subject suffering from a disorder associated with increased antigen expression and/or activity, comprising administering to the subject an antibody of the invention such that the antigen in the subject is bound.
  • the antigen is a human protein molecule and the subject is a human subject.
  • the subject can be a mammal expressing the antigen with which an antibody of the invention binds.
  • the subject can be a mammal into which the antigen has been introduced (e.g., by administration of the antigen or by expression of an antigen transgene).
  • An antibody of the invention can be administered to a human subject for therapeutic purposes.
  • an antibody of the invention can be administered to a non-human mammal expressing an antigen with which the immunoglobulin cross-reacts (e.g., a primate, pig or mouse) for veterinary purposes or as an animal model of human disease. Regarding the latter, such animal models may be useful for evaluating the therapeutic efficacy of antibodies of the invention (e.g., testing of dosages and time courses of administration).
  • the antibodies of the invention can be used to treat, inhibit, delay progression of, prevent/delay recurrence of, ameliorate, or prevent diseases, disorders or conditions associated with expression and/or activity of one or more antigen molecules.
  • an immunoconjugate comprising an antibody conjugated with one or more cytotoxic agent(s) is administered to the patient.
  • the immunoconjugate and/or antigen to which it is bound is/are internalized by the cell, resulting in increased therapeutic efficacy of the immunoconjugate in killing the target cell to which it binds.
  • the cytotoxic agent targets or interferes with nucleic acid in the target cell.
  • the cytotoxic agent targets or interferes with microtubule polymerization.
  • cytotoxic agents include any of the chemotherapeutic agents noted herein (such as a maytansinoid, auristatin, dolastatin, or a calicheamicin), a radioactive isotope, or a ribonuclease or a DNA endonuclease.
  • chemotherapeutic agents such as a maytansinoid, auristatin, dolastatin, or a calicheamicin
  • a radioactive isotope such as a maytansinoid, auristatin, dolastatin, or a calicheamicin
  • a radioactive isotope such as a ribonuclease or a DNA endonuclease.
  • Antibodies of the invention can be used either alone or in combination with other compositions in a therapy.
  • an antibody of the invention may be co-administered with another antibody, steroids (such as inhalable, systemic or cutaneous steroids), chemotherapeutic agent(s) (including cocktails of chemotherapeutic agents), other cytotoxic agent(s), anti- angiogenic agent(s), cytokines, and/or growth inhibitory agent(s).
  • steroids such as inhalable, systemic or cutaneous steroids
  • chemotherapeutic agent(s) including cocktails of chemotherapeutic agents
  • other cytotoxic agent(s) including anti- angiogenic agent(s), cytokines, and/or growth inhibitory agent(s).
  • combined therapies noted above include combined administration (where the two or more agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody of the invention can occur prior to, and/or following, administration of the adjunct therapy or therapies.
  • the effective amounts of therapeutic agents administered in combination with an anti-EphB4 antibody will be at the physician's or veterinarian's discretion.
  • Dosage administration and adjustment is done to achieve maximal management of the conditions to be treated.
  • the dose will additionally depend on such factors as the type of therapeutic agent to be used and the specific patient being treated.
  • the combination of the inhibitors potentiates the efficacy of a single inhibitor.
  • the term "potentiate" refers to an improvement in the efficacy of a therapeutic agent at its common or approved dose.
  • the antibody of the invention (and adjunct therapeutic agent) is/are administered by any suitable means, including parenteral, subcutaneous, intraperitoneal, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
  • Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • the antibody is suitably administered by pulse infusion, particularly with declining doses of the antibody.
  • Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
  • the antibody composition of the invention will be formulated, dosed, and administered in a fashion consistent with good medical practice.
  • Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
  • the antibody need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question.
  • the effective amount of such other agents depends on the amount of antibodies of the invention present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as used hereinbefore or about from 1 to 99% of the heretofore employed dosages.
  • One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of disease symptoms occurs.
  • One exemplary dosage of the antibody would be in the range from about 0.05mg/kg to about 10mg/kg.
  • one or more doses of about 0.5mg/kg, 2.0mg/kg, 4.0mg/kg or 10mg/kg (or any combination thereof) may be administered to the patient.
  • Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the patient receives from about two to about twenty, e.g. about six doses of the antibody).
  • An initial higher loading dose, followed by one or more lower doses may be administered.
  • An exemplary dosing regimen comprises administering an initial loading dose of about 4 mg/kg, followed by a weekly maintenance dose of about 2 mg/kg of the antibody.
  • other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
  • the anti-OX40L antibodies of the invention are useful in assays detecting OX40L expression (such as diagnostic or prognostic assays) in specific cells or tissues wherein the antibodies are labeled as described below and/or are immobilized on an insoluble matrix.
  • the invention provides methods for detection of OX40L, the methods comprising detecting OX40L-anti-OX40L antibody complex in the sample.
  • detection includes qualitative and/or quantitative detection (measuring levels) with or without reference to a control.
  • the invention provides methods for diagnosing a disorder associated with OX40L expression and/or activity, the methods comprising detecting OX40L-anti-OX40L antibody complex in a biological sample from a patient having or suspected of having the disorder.
  • the OX40L expression is increased expression or abnormal (undesired) expression.
  • the invention provides any of the anti-OX40L antibodies described herein, wherein the anti-OX40L antibody comprises a detectable label.
  • the invention provides a complex of any of the anti-OX40L antibodies described herein and OX40L.
  • the complex is in vivo or in vitro.
  • the complex comprises a cancer cell.
  • the anti-OX40L antibody is detectably labeled.
  • Anti-OX40L antibodies can be used for the detection of OX40L in any one of a number of well known detection assay methods.
  • a biological sample may be assayed for OX40L by obtaining the sample from a desired source, admixing the sample with anti-OX40L antibody to allow the antibody to form antibody/ OX40L complex with any OX40L present in the mixture, and detecting any antibody/ OX40L complex present in the mixture.
  • the biological sample may be prepared for assay by methods known in the art which are suitable for the particular sample.
  • the methods of admixing the sample with antibodies and the methods of detecting antibody/ OX40L complex are chosen according to the type of assay used. Such assays include immunohistochemistry, competitive and sandwich assays, and steric inhibition assays.
  • Analytical methods for OX40L all use one or more of the following reagents: labeled OX40L analogue, immobilized OX40L analogue, labeled anti-OX40L antibody, immobilized anti-OX40L antibody and steric conjugates.
  • the labeled reagents also are known as "tracers.”
  • the label used is any detectable functionality that does not interfere with the binding of OX40L and anti- OX40L antibody.
  • Numerous labels are known for use in immunoassay, examples including moieties that may be detected directly, such as fluorochrome, chemiluminescent, and radioactive labels, as well as moieties, such as enzymes, that must be reacted or derivatized to be detected. Examples of such labels include:
  • the label used is any detectable functionality that does not interfere with the binding of OX40L and anti-OX40L antibody.
  • Numerous labels are known for use in immunoassay, examples including moieties that may be detected directly, such as fluorochrome, chemiluminescent, and radioactive labels, as well as moieties, such as enzymes, that must be reacted or derivatized to be detected.
  • radioisotopes 32 P, 14 C, 125 1, 3 H, and 131 I examples include the radioisotopes 32 P, 14 C, 125 1, 3 H, and 131 I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Pat. No.
  • luciferin 2,3- dihydrophthalazinediones
  • horseradish peroxidase HRP
  • alkaline phosphatase alkaline phosphatase
  • ⁇ -galactosidase glucoamylase
  • lysozyme saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase
  • heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like.
  • coupling agents such as dialdehydes, carbodiimides, dimaleimides, bis-imidates, bis-diazotized benzidine, and the like may be used to tag the antibodies with the above-described fluorescent, chemiluminescent, and enzyme labels. See, for example, U.S. Pat. Nos. 3,940,475 (fluorimetry) and 3,645,090 (enzymes); Hunter et al, Nature, 144: 945 (1962); David et al, Biochemistry, 13: 1014-1021 (1974); Pain et al, J. Immunol Methods, 40: 219-230 (1981); and Nygren, J.
  • Preferred labels herein are enzymes such as horseradish peroxidase and alkaline phosphatase.
  • the conjugation of such label, including the enzymes, to the antibody is a standard manipulative procedure for one of ordinary skill in immunoassay techniques. See, for example, O'Sullivan et al, "Methods for the Preparation of Enzyme-antibody Conjugates for Use in Enzyme Immunoassay," in Methods in Enzymology, ed. JJ. Langone and H. Van Vunakis, Vol. 73 (Academic Press, New York, New York, 1981), pp. 147-166. Immobilization of reagents is required for certain assay methods. Immobilization entails separating the anti-
  • OX40L antibody from any OX40L that remains free in solution. This conventionally is accomplished by either insolubilizing the anti-OX40L antibody or OX40L analogue before the assay procedure, as by adsorption to a water- insoluble matrix or surface (Bennich et al ., U.S. 3,720,760), by covalent coupling (for example, using glutaraldehyde cross-linking), or by insolubilizing the anti-OX40L antibody or OX40L analogue afterward, e.g., by immunoprecipitation.
  • insolubilizing the anti-OX40L antibody or OX40L analogue before the assay procedure as by adsorption to a water- insoluble matrix or surface (Bennich et al ., U.S. 3,720,760), by covalent coupling (for example, using glutaraldehyde cross-linking), or by insolubilizing the anti-OX40L antibody or OX
  • Immunohistochemistry techniques utilize an antibody to probe and visualize cellular antigens in situ, generally by chromogenic or fluorescent methods.
  • tissue or cell sample from a mammal (typically a human patient) may be used.
  • the sample can be obtained by a variety of procedures known in the art including, but not limited to surgical excision, aspiration or biopsy.
  • the tissue may be fresh or frozen.
  • the sample is fixed and embedded in paraffin or the like.
  • the tissue sample may be fixed ⁇ i.e.
  • fixative is determined by the purpose for which the sample is to be histologically stained or otherwise analyzed.
  • length of fixation depends upon the size of the tissue sample and the fixative used.
  • IHC may be performed in combination with additional techniques such as morphological staining and/or fluorescence in-situ hybridization.
  • Two general methods of IHC are available; direct and indirect assays.
  • binding of antibody to the target antigen e.g., OX40L
  • This direct assay uses a labeled reagent, such as a fluorescent tag or an enzyme-labeled primary antibody, which can be visualized without further antibody interaction.
  • a labeled primary antibody binds to the antigen and then a labeled secondary antibody binds to the primary antibody.
  • a chromogenic or fluorogenic substrate is added to provide visualization of the antigen. Signal amplification occurs because several secondary antibodies may react with different epitopes on the primary antibody.
  • the primary and/or secondary antibody used for immunohistochemistry typically will be labeled with a detectable moiety.
  • Numerous labels are available which can be generally grouped into the following categories: Aside from the sample preparation procedures discussed above, further treatment of the tissue section prior to, during or following IHC may be desired, For example, epitope retrieval methods, such as heating the tissue sample in citrate buffer may be carried out (see, e.g., Leong et al. Appl Immunohistochem. 4(3):201 (1996)).
  • the tissue section is exposed to primary antibody for a sufficient period of time and under suitable conditions such that the primary antibody binds to the target protein antigen in the tissue sample.
  • Appropriate conditions for achieving this can be determined by routine experimentation.
  • the extent of binding of antibody to the sample is determined by using any one of the detectable labels discussed above.
  • the label is an enzymatic label (e.g. HRPO) which catalyzes a chemical alteration of the chromogenic substrate such as 3,3'-diaminobenzidine chromogen.
  • the enzymatic label is conjugated to antibody which binds specifically to the primary antibody (e.g. the primary antibody is rabbit polyclonal antibody and secondary antibody is goat anti-rabbit antibody).
  • Specimens thus prepared may be mounted and coverslipped. Slide evaluation is then determined, e.g. using a microscope, and staining intensity criteria, routinely used in the art, may be employed.
  • test sample OX40L is inversely proportional to the amount of bound tracer as measured by the amount of marker substance.
  • Dose-response curves with known amounts of OX40L are prepared and compared with the test results to quantitatively determine the amount of OX40L present in the test sample. These assays are called ELISA systems when enzymes are used as the detectable markers.
  • a conjugate of an enzyme with the OX40L is prepared and used such that when anti-OX40L antibody binds to the OX40L the presence of the anti-OX40L antibody modifies the enzyme activity.
  • the OX40L or its immunologically active fragments are conjugated with a bifunctional organic bridge to an enzyme such as peroxidase. Conjugates are selected for use with anti-OX40L antibody so that binding of the anti-OX40L antibody inhibits or potentiates the enzyme activity of the label. This method per se is widely practiced under the name of EMIT.
  • Steric conjugates are used in steric hindrance methods for homogeneous assay. These conjugates are synthesized by covalently linking a low-molecular-weight hapten to a small OX40L fragment so that antibody to hapten is substantially unable to bind the conjugate at the same time as anti-OX40L antibody. Under this assay procedure the OX40L present in the test sample will bind anti-OX40L antibody, thereby allowing anti-hapten to bind the conjugate, resulting in a change in the character of the conjugate hapten, e.g., a change in fluorescence when the hapten is a fluorophore.
  • Sandwich assays particularly are useful for the determination of OX40L or anti-OX40L antibodies.
  • an immobilized anti-OX40L antibody is used to adsorb test sample OX40L, the test sample is removed as by washing, the bound OX40L is used to adsorb a second, labeled anti-OX40L antibody and bound material is then separated from residual tracer. The amount of bound tracer is directly proportional to test sample OX40L.
  • sandwich assays the test sample is not separated before adding the labeled anti- OX40L.
  • a sequential sandwich assay using an anti-OX40L monoclonal antibody as one antibody and a polyclonal anti-OX40L antibody as the other is useful in testing samples for OX40L.
  • an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above comprises a container and a label or package insert on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition which is by itself or when combined with another composition(s) effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • At least one active agent in the composition is an antibody of the invention.
  • the label or package insert indicates that the composition is used for treating the condition of choice, such as asthman.
  • the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises an antibody of the invention; and (b) a second container with a composition contained therein.
  • the article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the first and second antibody compositions can be used to treat a particular condition, e.g. asthma.
  • the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically - acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as bac
  • Example 1 Preparation of anti-OX40L mouse monoclonal antibodies 8E12 and 13G5 Antibodies to the extracellular sequence of human OX40L were prepared as follows. Five Balb/c mice (Charles River Laboratories, Wilmington, DE) were hyperimmunized with recombinant human OX40L-flag polypeptide (human OX40 ligand extracellular domain fused to the flag peptide and expressed from CHO cells, Genentech, Inc., South San Francisco, CA), in Ribi adjuvant (Ribi Immunochem Research, Inc., Hamilton, MO).
  • mice demonstrating high anti-OX40L antibody titers were fused with mouse myeloma cells (pul.Anan.22.4, Genentech, Inc., South San Francisco, CA). After several days, the supernatants were harvested and screened for antibody production by direct enzyme-linked immunosorbent assay (ELISA).
  • IgG from the growth conditioned media of positive clones was purified by Protein A affinity chromatography (Pharmacia fast protein liquid chromatography (Pharmacia, Uppsala, Sweden). The purified antibody preparations were sterile filtered (0.2- ⁇ m pore size; Nalgene, Rochester NY) and stored at 4°C in phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • Flow cytometry based assays were performed with the growth- conditioned media of ELISA positive clones to screen for monoclonal antibodies that compete with recombinant OX40R-Fc (human OX40 receptor fused to the Fc fragment of IgGi expressed from CHO cells, Genentech, Inc.) for binding to human OX40L expressed on CHO cells.
  • OX40R-Fc human OX40 receptor fused to the Fc fragment of IgGi expressed from CHO cells, Genentech, Inc.
  • CHO-OX40L cells were pre -incubated with OX40R-Fc followed by the addition of the growth-conditioned media. After incubating, the cells were washed in phosphate buffer saline and then stained with phycoertherin-conjugated anti-murine IgG to detect the amount of bound murine anti-human OX40L monoclonal antibodies. The mean fluorescence index (MFI) was determined.
  • the variable light (VL) and variable heavy (VH) domains were amplified using RT-PCR with degenerate primers to heavy and light chain as follows.
  • the forward primers were specific for the N-terminal amino acid sequence of the VL and VH region.
  • the LC and HC reverse primers were designed to anneal to a region in the constant light (CL) and constant heavy domain 1 (CHl), respectively, which are highly conserved across species.
  • Amplified VL and VH regions were cloned into mammalian expression vectors, and the polynucleotide sequence of the inserts was determined using routine sequencing methods.
  • the 8E12 VL and VH amino acid sequences are shown in Figures 1.
  • the 13G5 VL and VH amino acid sequences are shown in Figures 3.
  • Example 2 ELISA analysis of Mab 8E12 and 13G5 binding to OX40L protein
  • the assay was carried out similarly as above, except that ELISA plates were coated with 0.5ug/ml human OX40-IgG, a mixture of human OX40-Flag and serial dilutions of antibodies were incubated on the plates, and bound human OX40-Flag was detected using anti-Flag-bio antibody followed by streptavidin-HRP.
  • Anti-OX40L Mabs 8E12 and 13G5 bound human OX40L with an approximate EC50 of 1.9nM and 0.46 nM, respectively.
  • CHO cells expressing full-length human OX40L were grown in 50:50 F12/DMEM medium supplemented with 2 mM L-glutamine, 100 units/ml penicillin, 100 ug/ml streptomycin (supplemented medium), and 5% FBS (Gibco BRL Life Technologies, Gaithersburg, MD) (growth medium) in a humidified 5% CO 2 incubator at 37°C.
  • Binding kinetics of mouse anti-OX40L antibodies to human OX40L were measured by surface plasmon resonance using Pharmacia BIAcore ® 3000 (BIAcore AB, Uppsala, Sweden) at room temperature (Karlsson et ah, 1994; Morton & Myszka, 1998).
  • Anti-Flag antibody (anti-FlagM2, Sigma, St. Louis, MO) was immobilized to the sensor chip (CM5) through primary amine groups. A high flow rate was used in order to minimize mass transport effects.
  • the carboxymethylated sensor chip surface matrix was activated by injecting 20 ul of a mixture of 0.025 M N- hydroxysuccinimide and 0.1 M N-ethyl-N'(dimethylaminopropyl) carbodiimide at 5 ul/min. 7 ul of 50 ug/ml anti-Flag in 10 mM sodium acetate, pH 4.5, were injected at 5 ul/min twice. After coupling, unoccupied sites on the chip were blocked by injecting 20 ul of IM ethanolamine, pH 8.5.
  • the running buffer was PBS containing 0.05% polysorbate 20.
  • a flow cell which had anti-Flag antibody immobilized but did not receive OX40L-Flag, was used as a reference cell.
  • Data were analyzed using a 1 : 1 binding model using global fitting.
  • the association and dissociation rate constants were fitted simultaneously (BIAevaluation software).
  • the apparent on-rate constants were 2.6xlO 6 and 4.8xlO 5 (I/Ms) for 8E12 and 13G5 IgG antibodies, respectively.
  • Anti-OX40L antibodies 8E12 and 13G5 recognized different binding determinants on OX40L Scatchard binding experiments were performed to determine if anti-OX40L mAbs 8E12 andl3G5 compete with eachother for binding similar or overlapping epitopes on CHO cells expressing human OX40L, and to determine the binding affinity of the antibodies. 50 ug of anti-OX40L murine monoclonal antibodies 8E12 andl3G5 were iodinated using a standard lactoperoxidase method.
  • Antibodies 8E12 andl3G5 were serially diluted 1:4 in media buffer (Dubeccos F12:DMEM, 1% bovine serum albumin, 0.05% sodium azide and 25 mM Hepes buffer pH 7.2) starting at an initial concentration of 200 nM. Two sets of dilution series (50 uL) were performed in duplicate in a 96 microwell plate. Wells from each set of dilutions received 50 uL of either iodinated 8E12 or 13G5 (0.25 nM final concentration). The plate was mixed and then the entire mixture was transferred to a 96 well tissue culture plate containing 30,000 OX40L-expressing CHO cells per well which had been plated out the previous day.
  • media buffer Dubeccos F12:DMEM, 1% bovine serum albumin, 0.05% sodium azide and 25 mM Hepes buffer pH 7.2
  • the plates were covered and incubated overnight at 4°C. The next day the wells (containing cells) were aspirated and washed twice with media buffer. 200 uL of IN NaOH was added to each well to lyse the cells, shaken for 10 minute, and then transferred to a 96 well microtube. Each tube was counted in a Wallac gamma scintillation counter. The counts bound along with antibody concentrations were entered in the Scatchard analysis program New Ligand to plot the bound versus bound/free and to determine the binding affinity and receptor concentration. For competition experiments, the data was collected and plotted using Kaleidagraph. Curves were drawn using a 4-parameter fit.
  • Mab 8E12 bound human OX40L with a Kd of 0.92 nM.
  • Mab 13G5 bound human OX40L with a Kd of 1.09 nM. 8E12 and 13G5 did not compete with each other for binding OX40L expressed on CHO cells, indicating that anti-OX40L monoclonal antibodies 8E12 and 13G5 recognized different human OX40L binding determinates.
  • Example 5 Anti-OX40L antibodies inhibited the interaction of human OX40L and human OX40 Competitive binding experiments were performed to determine if anti-OX40L mAbs 8E12 andl3G5 competed with iodinated OX40-Fc (extracellular domain of OX40 receptor fused to Fc domain) for binding to OX40L expressed on CHO cells. 50 ug of OX40L-Fc ligand was iodinated using a standard lactoperoxidase method.
  • Antibodies 8E12 and 13G5 were serially diluted 1:4 in media buffer (Dubeccos F12:DMEM, 1% bovine serum albumin, 0.05% sodium azide and 25 mM Hepes buffer pH 7.2) starting at an initial concentration of 200 nM. Dilutions (50 uL) were performed in duplicate in a 96 microwell plate. Each well received 50 uL of iodinated OX40L-Fc (0.25 nM final concentration), was mixed and then the entire mixture was transferred to a 96 well tissue culture plate containing 30,000 OX40L-expressing CHO cells per well, which had been plated out the previous day. The plates were covered and incubated overnight at 4°C.
  • media buffer Dubeccos F12:DMEM, 1% bovine serum albumin, 0.05% sodium azide and 25 mM Hepes buffer pH 7.2
  • Example 6 Treatment with anti-OX40L antibodies inhibited T cell proliferation in a cell-based assay Mixed Lymphocyte Reaction (MLR) assays were performed to determine whether blockade of OX40L- OX40 interaction by anti-OX40L mabs inhibited T cell proliferation.
  • MLR Mixed Lymphocyte Reaction
  • This cell-based experiment assays the ability of anti-OX40L antibodies to inhibit OX40L signaling. Briefly, plasmacytoid dendritic cells (pDCs) were isolated from human blood using BDCA-4 MACS beads according to the manufacturer's instructions (Miltenyi Biotec).
  • Cells were set up at 1 x 10 6 cell/ml in media containing RPMI/10% fetal bovine serum/2mM L-glutamine, and stimulated for 3 days with 2.5 ug/ml soluble human CD40L protein (R & D Systems) and 10 ng/ml human IL-3 protein (R & D Systems) in order to activate the pDCs.
  • Activated (pDC) were then washed thrice with phosphate buffered saline/3% fetal bovine serum, then co-cultured with CD45RA+ na ⁇ ve T cells that were isolated from human blood using MACS beads according to manufacturer's instructions (Miltenyi Biotec). Co-culture was set up at a pDC:T cell ratio of
  • IL-2 production by T memory cells was assessed to determine whether blockade of OX40L-OX40 interaction by anti-OX40L mabs inhibited IL-2 production.
  • This experiment tests the ability of anti-OX40L antibodies to inhibit OX40L signaling.
  • CD45RO+ memory T cells were isolated from human blood using MACS beads according to manufacturer's instructions (Miltenyi Biotec). Cells were set up at 1 x 10 6 c/ml in media containing RPMI/10% fetal bovine serum/2mM L-glutamine, and stimulated with 1 ug/ml anti-CD3 antibody (BD Pharmingen) and 1OnM soluble human OX40L protein (R & D Systems) for 16 hours.
  • Anti-OX40L antibodies or control mlgGl antibody were added at indicated concentrations. Levels of IL-2 in the supernatants were measured using an ELISA kit as per manufacturer's instructions (R & D Systems).
  • Example 8 Treatment with anti-OX40L antibodies inhibited survival of activated T cells Survival of activated T cells was assessed to determine whether blockade of OX40L-OX40 interaction by anti-OX40L mabs inhibited survival.
  • This cell-based experiment assays the ability of anti-OX40L antibodies to inhibit OX40L signaling. Briefly, plasmacytoid dendritic cells (pDCs) were isolated from human blood using BDCA- 4 MACS beads according to manufacturer's instructions (Miltenyi Biotec).
  • Cells were set up at 1 x 10 6 cell/ml in media containing RPMI/10% fetal bovine serum/2mM L-glutamine and stimulated with 2.5 ug/ml soluble human CD40L protein (R & D Systems) and 10 ng/ml human IL-3 protein (R & D Systems) for 3 days.
  • CD123+BDCA2- activated pDCs were then FACS sorted and co-cultured with activated T cells.
  • T cells were isolated by negative selection from human blood using MACS beads according to manufacturer's instructions (Miltenyi Biotec) and activated for 3 days with 0.1 ug/ml anti-CD3/l ug/ml anti-CD28 (BD Pharmingen).
  • Co-culture was set up at a pDC:T cell ratio of 1:50, with 1 x 10 6 T cells per ml of a 6-well plate in the presence of the indicated reagents (at 1 nM or 10 nM concentrations). Cell numbers were assayed over time by trypan blue exclusion.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Veterinary Medicine (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Pulmonology (AREA)
  • Dermatology (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Transplantation (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2006/062173 2005-12-16 2006-12-15 Anti-ox40l antibodies and methods using same Ceased WO2007133290A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
BRPI0621065-1A BRPI0621065A2 (pt) 2005-12-16 2006-12-15 anticorpo anti-ox40l, anticorpos isolados, polinucleotìdeo, vetor, célula hospedeira, método para fabricar um anticorpo anti-ox40l, método para tratar ou previnir uma disfunção imune, composição e uso de um anticorpo anti-ox40l
US12/097,733 US7812133B2 (en) 2005-12-16 2006-12-15 Anti-OX40L antibodies and methods using same
EP06851330A EP1973949A2 (en) 2005-12-16 2006-12-15 Anti-ox40l antibodies and methods using same
JP2008545995A JP2009519718A (ja) 2005-12-16 2006-12-15 抗ox40l抗体とその使用方法
CA002633602A CA2633602A1 (en) 2005-12-16 2006-12-15 Anti-ox40l antibodies and methods using same
AU2006343459A AU2006343459A1 (en) 2005-12-16 2006-12-15 Anti-OX40L antibodies and methods using same
IL191820A IL191820A0 (en) 2005-12-16 2008-05-29 Anti-ox40l antibodies and methods using same
NO20083147A NO20083147L (no) 2005-12-16 2008-07-15 Anti-OX40L-antistoffer og fremgangsmater for anvendelse av disse
US12/834,748 US20100272738A1 (en) 2005-12-16 2010-07-12 Anti-ox40l antibodies and methods using same

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US75137705P 2005-12-16 2005-12-16
US60/751,377 2005-12-16

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US12/834,748 Continuation US20100272738A1 (en) 2005-12-16 2010-07-12 Anti-ox40l antibodies and methods using same

Publications (3)

Publication Number Publication Date
WO2007133290A2 true WO2007133290A2 (en) 2007-11-22
WO2007133290A3 WO2007133290A3 (en) 2008-01-10
WO2007133290A8 WO2007133290A8 (en) 2008-03-27

Family

ID=38616368

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2006/062173 Ceased WO2007133290A2 (en) 2005-12-16 2006-12-15 Anti-ox40l antibodies and methods using same

Country Status (18)

Country Link
US (2) US7812133B2 (https=)
EP (1) EP1973949A2 (https=)
JP (1) JP2009519718A (https=)
KR (1) KR20080080639A (https=)
CN (1) CN101374865A (https=)
AR (1) AR057253A1 (https=)
AU (1) AU2006343459A1 (https=)
BR (1) BRPI0621065A2 (https=)
CA (1) CA2633602A1 (https=)
CR (1) CR10069A (https=)
EC (1) ECSP088543A (https=)
IL (1) IL191820A0 (https=)
MA (1) MA30153B1 (https=)
NO (1) NO20083147L (https=)
RU (1) RU2426744C2 (https=)
TW (1) TW200732349A (https=)
WO (1) WO2007133290A2 (https=)
ZA (1) ZA200804868B (https=)

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009141239A1 (en) * 2008-05-20 2009-11-26 F. Hoffmann-La Roche Ag A pharmaceutical formulation comprising an antibody against ox40l, uses thereof
WO2011073180A1 (en) 2009-12-14 2011-06-23 Ablynx N.V. Single variable domain antibodies against ox40l, constructs and therapeutic use
US9139653B1 (en) 2015-04-30 2015-09-22 Kymab Limited Anti-human OX40L antibodies and methods of treatment
WO2016022468A1 (en) * 2014-08-04 2016-02-11 Baylor Research Institute Antagonistic anti-ox40l antibodies and methods of their use
US9434785B1 (en) 2015-04-30 2016-09-06 Kymab Limited Anti-human OX40L antibodies and methods of treating graft versus host disease with the same
WO2016139482A1 (en) * 2015-03-03 2016-09-09 Kymab Limited Antibodies, uses & methods
US9512229B2 (en) 2015-03-03 2016-12-06 Kymab Limited Synergistic combinations of OX40L antibodies for the treatment of GVHD
US9587030B2 (en) 2014-03-04 2017-03-07 Kymab Limited Anti-hOX40L antibodies, uses, and methods
US9657059B2 (en) 2013-09-09 2017-05-23 Canimguide Therapeutics Ab Immune system modulators
US10604576B2 (en) 2016-06-20 2020-03-31 Kymab Limited Antibodies and immunocytokines
US10881709B2 (en) 2015-03-06 2021-01-05 Canimguide Therapeutics Ab Immune system modulators and compositions
US11136406B2 (en) 2011-04-21 2021-10-05 Bristol-Myers Squibb Company Methods of treating immune diseases by administering antibody polypeptides that antagonize CD40
WO2022029447A1 (en) * 2020-08-07 2022-02-10 Petmedix Ltd Therapeutic antibodies
US11440960B2 (en) 2017-06-20 2022-09-13 Kymab Limited TIGIT antibodies, encoding nucleic acids and methods of using said antibodies in vivo
WO2023017252A1 (en) * 2021-08-10 2023-02-16 Kymab Limited Treatment of atopic dermatitis
US11629189B2 (en) 2017-12-19 2023-04-18 Kymab Limited Bispecific antibody for ICOS and PD-L1
WO2023152486A1 (en) * 2022-02-09 2023-08-17 Petmedix Ltd Therapeutic antibodies
US11779604B2 (en) 2016-11-03 2023-10-10 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses and methods
US11858996B2 (en) 2016-08-09 2024-01-02 Kymab Limited Anti-ICOS antibodies
US12209128B2 (en) 2016-06-20 2025-01-28 Kymab Limited Anti-PD-L1 antibodies
WO2025090570A1 (en) * 2023-10-23 2025-05-01 Abcellera Biologics Inc. Anti-ox40l antibodies and methods of use
US12404330B2 (en) 2017-12-19 2025-09-02 Kymab Limited Antibodies to ICOS
USRE50880E1 (en) 2022-08-01 2026-05-05 Kymab Limited Anti-human OX40L antibodies and methods of treatment

Families Citing this family (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7291331B1 (en) 2002-09-11 2007-11-06 La Jolla Institute For Allergy And Immunology Methods of treating OX40 medicated recall immune responses
EP2041756B1 (en) 2006-07-14 2015-05-13 FEI Company A multi-source plasma focused ion beam system
KR20100014588A (ko) * 2007-02-27 2010-02-10 제넨테크, 인크. 길항제 ox40 항체 및 염증성 및 자가면역 질환의 치료에서의 이의 용도
US20090309617A1 (en) * 2007-08-24 2009-12-17 Ye Fang Biosensor antibody functional mapping
US8518405B2 (en) * 2009-10-08 2013-08-27 The University Of North Carolina At Charlotte Tumor specific antibodies and uses therefor
WO2012015696A1 (en) * 2010-07-26 2012-02-02 Baylor Research Institute Thymic stromal lymphopoietin (tslp) and ox40 ligand in cancer
CA2809089C (en) 2010-08-23 2018-12-18 Board Of Regents, The University Of Texas System Anti-ox40 antibodies and methods of using the same
US9845362B2 (en) 2010-10-08 2017-12-19 The University Of North Carolina At Charlotte Compositions comprising chimeric antigen receptors, T cells comprising the same, and methods of using the same
AR083847A1 (es) * 2010-11-15 2013-03-27 Novartis Ag Variantes de fc (fragmento constante) silenciosas de los anticuerpos anti-cd40
CA2845810C (en) * 2011-08-23 2017-03-28 Board Of Regents, The University Of Texas System Anti-ox40 antibodies and methods of using the same
JP2017165652A (ja) * 2014-06-30 2017-09-21 国立大学法人東北大学 新規抗ヒトox40リガンド抗体、及びこれを含む抗インフルエンザ薬
US11554181B2 (en) 2014-09-05 2023-01-17 The University Of North Carolina At Charlotte Tumor specific antibody conjugates and uses therefor
SG11201708804WA (en) 2015-05-07 2017-11-29 Agenus Inc Anti-ox40 antibodies and methods of use thereof
CN108883173B (zh) 2015-12-02 2022-09-06 阿吉纳斯公司 抗体和其使用方法
DE102016105069A1 (de) 2016-03-18 2017-09-21 Eberhard Karls Universität Tübingen Medizinische Fakultät Antivirale Immuntherapie durch Membranrezeptorligation
AU2016402264B2 (en) * 2016-04-15 2024-08-22 Pontificia Universidad Católica De Chile Pharmaceutical composition for reducing the symptoms and disease of the respiratory infection caused by human metapneumovirus (HMPV), which comprises at least one agent that neutralises the function of the TSLP and/or TSLPR and/or OX40L and/or CD177 molecules, and a pharmaceutically acceptable excipient, and the use thereof
MA46770A (fr) 2016-11-09 2019-09-18 Agenus Inc Anticorps anti-ox40, anticorps anti-gitr, et leurs procédés d'utilisation
US12605469B2 (en) 2017-10-02 2026-04-21 The University Of North Carolina At Charlotte Tumor specific antibody conjugates and uses therefor
EP3713958A4 (en) 2017-11-24 2021-11-03 Eucure (Beijing) Biopharma Co., Ltd ANTI-OX40 ANTIBODIES AND USES THEREOF
CN114437228B (zh) * 2020-10-30 2024-02-06 中国科学院生物物理研究所 一种il-2与抗体亚单位构成的双功能融合蛋白
TWI905133B (zh) * 2020-12-09 2025-11-21 南韓商怡諾安有限公司 抗-OX40L抗體、抗OX40L和抗-TNFα雙特異性抗體及其用途
WO2022123293A1 (ko) * 2020-12-09 2022-06-16 에이치케이이노엔 주식회사 항 OX40L 항체, 항 OX40L 및 항 TNFα 이중 특이성 항체 및 이들의 용도
TW202540204A (zh) * 2024-01-26 2025-10-16 西班牙商阿爾米雷爾有限公司 雙特異性分子及使用其的治療方法

Family Cites Families (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5457035A (en) 1993-07-23 1995-10-10 Immunex Corporation Cytokine which is a ligand for OX40
US5821332A (en) 1993-11-03 1998-10-13 The Board Of Trustees Of The Leland Stanford Junior University Receptor on the surface of activated CD4+ T-cells: ACT-4
US6242566B1 (en) 1994-02-10 2001-06-05 Board Of Trustees Of The Leland Stanford Junior University Ligand (ACT-4-L) to a receptor on the surface of activated CD4+ T-cells
JP3914342B2 (ja) 1997-09-25 2007-05-16 武田薬品工業株式会社 gp34結合阻害物を有効成分として含有する医薬組成物
JP2003535592A (ja) * 2000-06-06 2003-12-02 アイデック ファーマスーティカルズ コーポレイション ヒトgp39に対する非アゴニスト抗体、含有する組成物、およびその治療的使用
FR2822846B1 (fr) 2001-04-03 2004-01-23 Technopharm Procede de preparation et de selection d'anticorps
GB0123276D0 (en) 2001-09-27 2001-11-21 Imp College Innovations Ltd Uses of agents that bind immune-system components
JP3926596B2 (ja) 2001-09-28 2007-06-06 独立行政法人科学技術振興機構 Ox40l遺伝子を導入した自己免疫疾患モデル非ヒト哺乳動物
WO2003059245A2 (en) * 2001-12-18 2003-07-24 J & J Research Pty Ltd Method of treating asthma
IL164376A0 (en) 2002-04-03 2005-12-18 Applied Research Systems Ox4or binding agents, their preparation and pharmaceutical compositions containing them
JP2006508056A (ja) 2002-08-28 2006-03-09 イミュネックス・コーポレーション 心臓血管疾患を治療するための組成物および方法
US7291331B1 (en) 2002-09-11 2007-11-06 La Jolla Institute For Allergy And Immunology Methods of treating OX40 medicated recall immune responses
WO2005094879A2 (en) 2004-03-23 2005-10-13 Amgen, Inc. Monoclonal antibodies specific for human ox40l (cd 134l)
JP2006081061A (ja) 2004-09-13 2006-03-23 Alpine Electronics Inc 音声出力装置及び音声/映像出力装置
TWI380996B (zh) 2004-09-17 2013-01-01 Hoffmann La Roche 抗ox40l抗體
KR20100014588A (ko) 2007-02-27 2010-02-10 제넨테크, 인크. 길항제 ox40 항체 및 염증성 및 자가면역 질환의 치료에서의 이의 용도

Cited By (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009141239A1 (en) * 2008-05-20 2009-11-26 F. Hoffmann-La Roche Ag A pharmaceutical formulation comprising an antibody against ox40l, uses thereof
WO2011073180A1 (en) 2009-12-14 2011-06-23 Ablynx N.V. Single variable domain antibodies against ox40l, constructs and therapeutic use
US8962807B2 (en) 2009-12-14 2015-02-24 Ablynx N.V. Single variable domain antibodies against OX40L, constructs and therapeutic use
US10822425B2 (en) 2009-12-14 2020-11-03 Ablynx N.V. Single variable domain antibodies against OX40L, constructs and therapeutic use
EP3309176A1 (en) 2009-12-14 2018-04-18 Ablynx N.V. Immunoglobulin single variable domain antibodies against ox40l, constructs and therapeutic use
EP2513145B1 (en) * 2009-12-14 2018-01-24 Ablynx N.V. Single variable domain antibodies against ox40l, constructs and therapeutic use
US9834611B2 (en) 2009-12-14 2017-12-05 Ablynx N.V. Single variable domain antibodies against OX40L, constructs and therapeutic use
US11136406B2 (en) 2011-04-21 2021-10-05 Bristol-Myers Squibb Company Methods of treating immune diseases by administering antibody polypeptides that antagonize CD40
AU2014317884B2 (en) * 2013-09-09 2017-09-07 Canimguide Therapeutics Ab Immune system modulators
US10301356B2 (en) 2013-09-09 2019-05-28 Canimguide Therapeutics Ab Immune system modulators
US9657059B2 (en) 2013-09-09 2017-05-23 Canimguide Therapeutics Ab Immune system modulators
US10669342B2 (en) 2014-03-04 2020-06-02 Kymab Limited Anti-OX40L antibodies and methods of treating graft versus host disease
EP3590539A1 (en) * 2014-03-04 2020-01-08 Kymab Limited Antibodies, uses & methods
US9587030B2 (en) 2014-03-04 2017-03-07 Kymab Limited Anti-hOX40L antibodies, uses, and methods
IL304772B2 (en) * 2014-03-04 2025-10-01 Kymab Ltd Antibodies, uses and methods
IL304772B1 (en) * 2014-03-04 2025-06-01 Kymab Ltd Antibodies, uses and methods
US11773175B2 (en) 2014-03-04 2023-10-03 Kymab Limited Antibodies, uses and methods
US11753479B2 (en) 2014-03-04 2023-09-12 Kymab Limited Nucleic acids encoding anti-OX40L antibodies
US11396550B2 (en) 2014-03-04 2022-07-26 Kymab Limited Methods of treating comprising administering anti-OX40L antibodies
EP3113797B1 (en) * 2014-03-04 2022-05-04 Kymab Limited Antibodies, uses&methods
US10654935B2 (en) 2014-03-04 2020-05-19 Kymab Limited Methods of treating SLE with anti-OX40L antibodies
US10570208B2 (en) 2014-08-04 2020-02-25 Baylor Research Institute Antagonistic anti-OX40L antibodies and methods of their use
AU2015301338B2 (en) * 2014-08-04 2021-03-25 Baylor Research Institute Antagonistic anti-OX40L antibodies and methods of their use
US10167339B2 (en) 2014-08-04 2019-01-01 Baylor Research Institute Antagonistic anti-OX40L antibodies and methods of their use
CN107074951B (zh) * 2014-08-04 2021-08-03 贝勒研究院 拮抗性抗-ox40l抗体及其使用方法
WO2016022468A1 (en) * 2014-08-04 2016-02-11 Baylor Research Institute Antagonistic anti-ox40l antibodies and methods of their use
AU2015301338C1 (en) * 2014-08-04 2021-07-22 Baylor Research Institute Antagonistic anti-OX40L antibodies and methods of their use
CN107074951A (zh) * 2014-08-04 2017-08-18 贝勒研究院 拮抗性抗‑ox40l抗体及其使用方法
EP3194445A4 (en) * 2014-08-04 2018-05-23 Baylor Research Institute Antagonistic anti-ox40l antibodies and methods of their use
EP4137157A1 (en) * 2015-03-03 2023-02-22 Kymab Limited Antibodies, uses and methods
WO2016139482A1 (en) * 2015-03-03 2016-09-09 Kymab Limited Antibodies, uses & methods
US9868789B2 (en) 2015-03-03 2018-01-16 Kymab Limited Synergistic combinations of OX40L antibodies for the treatment of GvHD
US9868790B2 (en) 2015-03-03 2018-01-16 Kymab Limited Synergistic combinations of OX40L antibodies for the treatment of GvHD
US9512229B2 (en) 2015-03-03 2016-12-06 Kymab Limited Synergistic combinations of OX40L antibodies for the treatment of GVHD
CN114504652A (zh) * 2015-03-03 2022-05-17 科马布有限公司 抗体、用途和方法
US10881709B2 (en) 2015-03-06 2021-01-05 Canimguide Therapeutics Ab Immune system modulators and compositions
US9139653B1 (en) 2015-04-30 2015-09-22 Kymab Limited Anti-human OX40L antibodies and methods of treatment
US9234043B1 (en) 2015-04-30 2016-01-12 Kymab Limited Anti-human OX40L antibodies
US9434785B1 (en) 2015-04-30 2016-09-06 Kymab Limited Anti-human OX40L antibodies and methods of treating graft versus host disease with the same
US12209128B2 (en) 2016-06-20 2025-01-28 Kymab Limited Anti-PD-L1 antibodies
US11965026B2 (en) 2016-06-20 2024-04-23 Kymab Limited Anti-PD-L1 and IL-2 cytokines
US10604576B2 (en) 2016-06-20 2020-03-31 Kymab Limited Antibodies and immunocytokines
US11858996B2 (en) 2016-08-09 2024-01-02 Kymab Limited Anti-ICOS antibodies
US11779604B2 (en) 2016-11-03 2023-10-10 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses and methods
US11440960B2 (en) 2017-06-20 2022-09-13 Kymab Limited TIGIT antibodies, encoding nucleic acids and methods of using said antibodies in vivo
US11629189B2 (en) 2017-12-19 2023-04-18 Kymab Limited Bispecific antibody for ICOS and PD-L1
US12404330B2 (en) 2017-12-19 2025-09-02 Kymab Limited Antibodies to ICOS
WO2022029447A1 (en) * 2020-08-07 2022-02-10 Petmedix Ltd Therapeutic antibodies
WO2023017252A1 (en) * 2021-08-10 2023-02-16 Kymab Limited Treatment of atopic dermatitis
WO2023152486A1 (en) * 2022-02-09 2023-08-17 Petmedix Ltd Therapeutic antibodies
USRE50880E1 (en) 2022-08-01 2026-05-05 Kymab Limited Anti-human OX40L antibodies and methods of treatment
WO2025090570A1 (en) * 2023-10-23 2025-05-01 Abcellera Biologics Inc. Anti-ox40l antibodies and methods of use

Also Published As

Publication number Publication date
KR20080080639A (ko) 2008-09-04
RU2008129111A (ru) 2010-01-27
IL191820A0 (en) 2008-12-29
TW200732349A (en) 2007-09-01
WO2007133290A8 (en) 2008-03-27
US7812133B2 (en) 2010-10-12
BRPI0621065A2 (pt) 2011-11-29
AR057253A1 (es) 2007-11-21
AU2006343459A1 (en) 2007-11-22
RU2426744C2 (ru) 2011-08-20
US20090053230A1 (en) 2009-02-26
MA30153B1 (fr) 2009-01-02
CN101374865A (zh) 2009-02-25
WO2007133290A3 (en) 2008-01-10
CA2633602A1 (en) 2007-11-22
JP2009519718A (ja) 2009-05-21
NO20083147L (no) 2008-09-16
CR10069A (es) 2008-10-10
US20100272738A1 (en) 2010-10-28
EP1973949A2 (en) 2008-10-01
ECSP088543A (es) 2008-07-30
ZA200804868B (en) 2009-10-28

Similar Documents

Publication Publication Date Title
US7812133B2 (en) Anti-OX40L antibodies and methods using same
EP2446904B1 (en) Anti-CD22 antibodies, their immunoconjugates and uses thereof
AU2006210837B2 (en) Anti-EphB2 antibodies and methods using same
AU2007248444B2 (en) Anti-EphB4 antibodies and methods using same
AU2007226522B2 (en) Antibodies to EGFL7 and methods for their use
CA2638865A1 (en) Methods and compositions for targeting relt
AU2013200383B2 (en) Anti-EphB4 antibodies and methods using same
MX2008007220A (es) Anticuerpos anti-ox40l y metodos que los utilizan
AU2011202920B2 (en) Antibodies and immunoconjugates and uses therefor
AU2016213811A1 (en) Anti-EphB4 antibodies and methods using same
AU2012202825A1 (en) Antibodies to EGFL7 and methods for their use

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 06851330

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 2006343459

Country of ref document: AU

Ref document number: 4580/DELNP/2008

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 191820

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 568716

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: MX/a/2008/007220

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 08059829

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: CR2008-010069

Country of ref document: CR

WWE Wipo information: entry into national phase

Ref document number: 2633602

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2008061001

Country of ref document: EG

WWE Wipo information: entry into national phase

Ref document number: 12008501442

Country of ref document: PH

Ref document number: 2008545995

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2006343459

Country of ref document: AU

Date of ref document: 20061215

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2006851330

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 1020087017186

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2008129111

Country of ref document: RU

WWE Wipo information: entry into national phase

Ref document number: 200680052972.9

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 12097733

Country of ref document: US

ENP Entry into the national phase

Ref document number: PI0621065

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20080617