WO2005072412A2 - Anti-viral therapeutics - Google Patents
Anti-viral therapeutics Download PDFInfo
- Publication number
- WO2005072412A2 WO2005072412A2 PCT/US2005/002897 US2005002897W WO2005072412A2 WO 2005072412 A2 WO2005072412 A2 WO 2005072412A2 US 2005002897 W US2005002897 W US 2005002897W WO 2005072412 A2 WO2005072412 A2 WO 2005072412A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- alkyl
- aminocarbonyl
- cιo
- amino
- dialkyl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC1=C(C(*(*)C(*)=C)=O)C(*)=C(*)*1 Chemical compound CC1=C(C(*(*)C(*)=C)=O)C(*)=C(*)*1 0.000 description 3
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/38—Heterocyclic compounds having sulfur as a ring hetero atom
- A61K31/381—Heterocyclic compounds having sulfur as a ring hetero atom having five-membered rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
- A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
- A61K31/5375—1,4-Oxazines, e.g. morpholine
- A61K31/5377—1,4-Oxazines, e.g. morpholine not condensed and containing further heterocyclic rings, e.g. timolol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
Definitions
- the Sir2 protein is a deacetylase which uses NAD as a cofactor (Imai et al, 2000;
- SIRT1 deacetylates the HIV Tat protein and is required for Tat-mediated Transactivation of the HIV Promoter.
- the invention relates to substituted heterocyclic compounds, compositions comprising the compounds, and methods of using the compounds and compound compositions.
- the compounds and compositions comprising them are useful for treating viral infection or viral disease or viral infection or viral disease symptoms, including AIDS.
- the compounds can modulate SIRT1 activity.
- SIRT1 deacetylates the HIV Tat protein and is required for Tat- mediated transactivation of the HIV promoter.
- this invention relates to a method for treating or preventing a viral disorder, e.g., an infection or disease, in a subject, e.g., AIDS.
- the method includes administering to the subject an effective amount of a compound having a formula (I):
- R 1 is H, halo, C ⁇ -C> 0 alkyl, d-C 6 haloalkyl, C 6 -C ⁇ 0 aryl, C 5 -C ⁇ 0 heteroaryl, C 7 -C ⁇ aralkyl, C 7 -C ⁇ 2 heteroaralkyl, C 3 -C 8 heterocyclyl, C 2 -C ⁇ 2 alkenyl, C 2 -C ⁇ 2 alkynyl, C5-C10 cycloalkenyl, C 5 -C ⁇ o heterocycloalkenyl; or when taken together with R 2 and the carbon to which it is attached, forms C 5 -C ⁇ 0 cycloalkenyl, C 5 -C ⁇ o heterocycloalkenyl, C 6 -C ⁇ 0 aryl, or C 6 -C ⁇ 0 heteroaryl; each of which can be optionally substituted with 1-5 R ; R 2 is H, halo, C 1 - 0 alkyl,
- R 1 and R 2 taken together, with the carbons to which they are attached, form C 5 -C ⁇ 0 cycloalkenyl, C 5 -C ⁇ 0 heterocycloalkenyl, C 6 -C ⁇ o aryl, or C 6 -C ⁇ o heteroaryl.
- R and R taken together, with the carbons to which they are attached, form C 5 -C 10 cycloalkenyl.
- R and R taken together, with the carbons to which they are attached, form C 5 -C 10 cycloalkenyl, optionally substituted with 1 or 2 C ⁇ -C 6 alkyl.
- R 1 and R 2 taken together form a C 5 -C 7 cycloalkenyl ring substituted with C ⁇ -C 6 alkyl
- R is C 6 -C ⁇ 0 aryl, C 5 -C ⁇ o heteroaryl, C 7 -C ⁇ 2 aralkyl, C 7 -C ⁇ 2 heteroaralkyl, C 3 -C 8 heterocyclyl, C 5 -C 10 cycloalkenyl, or Cs-Qo heterocycloalkenyl.
- R is C 6 -C ⁇ 0 aryl.
- R is H, halo, C 1 -C 10 alkyl, or C ⁇ -C 6 haloalkyl.
- R is carboxy, cyano, aminocarbonyl, C ⁇ -C 6 alkyl aminocarbonyl, C ⁇ -C 6 dialkyl aminocarbonyl, C 1 -C 10 alkoxycarbonyl, Ci-C 10 alkylthioylcarbonyl, hydrazinocarbonyl, C ⁇ -C 6 alkylhydrazinocarbonyl, C ⁇ -C 6 dialkyl hydrazinocarbonyl, or hydroxyaminocarbonyl.
- R is aminocarbonyl, C ⁇ -C 6 alkyl aminocarbonyl, C ⁇ -C 6 dialkyl aminocarbonyl, hydrazinocarbonyl, C ⁇ -C 6 alkyl hydrazinocarbonyl, C ⁇ -C 6 dialkyl hydrazinocarbonyl, or hydroxyaminocarbonyl.
- R 3 is aminocarbonyl, C ⁇ -C 6 alkyl aminocarbonyl, or C ⁇ -C 6 dialkyl aminocarbonyl.
- R is H, thioalkoxy or thioaryloxy.
- R 4 is nitro, amino, C ⁇ -C 6 alkyl amino, C ⁇ -C 6 dialkyl amino, or amido.
- R 4 is amino or alteratively amido.
- R 4 is aminocarbonylalkyl.
- the amino of the aminocarbonylalkyl is substituted, for example, with aryl, arylalkyl, alkyl, etc.
- the substituent can be further substituted, for example, with halo, hydroxy, or alkoxy.
- R is aminocarbonyl, C ⁇ -C 6 alkyl aminocarbonyl, or C ⁇ -C 6 dialkyl aminocarbonyl; and R 4 is amino, C ⁇ -C 6 alkyl amino C ⁇ -C 6 dialkyl amino or amido.
- X is S. In certain embodiments X is NR .
- R is H, C ⁇ -C 6 alkyl or C 7 -C ⁇ o arylalkyl.
- R 1 is C 6 -C ⁇ o aryl, C 5 -C 10 heteroaryl, C 7 -C ⁇ 2 aralkyl, C 7 -C ⁇ 2 heteroaralkyl, C 3 -C 8 heterocyclyl, C 5 -C 10 cycloalkenyl, or Cs-Cio heterocycloalkenyl; or when taken together with R 2 and the carbon to which it is attached, forms C 5 -C 10 cycloalkenyl;
- R 2 is H, halo, C1-C1 0 alkyl, C ⁇ -C 6 haloalkyl; or when taken together with R 1 and the carbon to which it is attached, forms C 5 -C 10 cycloalkenyl;
- R 3 is aminocarbonyl, C ⁇ -C 6 alkyl aminocarbonyl, C ⁇ -C 6 dialkyl aminocarbonyl, hydr
- R 1 and R 2 taken together with the carbons to which they are attached, form C 5 -C ⁇ 0 cycloalkenyl;
- R 3 is aminocarbonyl, C
- R 4 is amino, C]-C 6 alkyl amino, C ⁇ -C 6 dialkyl amino, or amido;
- X is S.
- this invention relates to a method for treating or preventing a disorder in a subject, e.g., a disorder described herein.
- the method includes administering to the subject an effective amount of a compound having a formula (II):
- R 11 is H, halo, hydroxy, -Cio alkyl, C C 6 haloalkyl, -Cio alkoxy, C ⁇ -C 6 haloalkoxy, C 6 -C ⁇ o aryl, C 5 -C ⁇ o heteroaryl, C -C ⁇ 2 aralkyl, C 7 -C ⁇ 2 heteroaralkyl, C 3 -C 8 cycloalkyl, C -C 8 heterocyclyl, C 2 -C ⁇ 2 alkenyl, C 2 -C ⁇ 2 alkynyl, C 5 -C ⁇ o cycloalkenyl, C 5 -C ⁇ 0 heterocycloalkenyl, carboxy, carboxylate, cyano, nitro, amino, C]-C 6 alkyl amino, C ⁇ -C 6 dialkyl amino, mercapto, thioalkoxy, thioaryloxy, thioheteroaryloxy, SO 3 (R
- Z is NR 16 .
- R 16 is C ⁇ -C ⁇ 0 alkyl, C 6 -C ⁇ 0 aryl, Cs- o heteroaryl, C 7 -C ⁇ 2 aralkyl, or C 7 -C12 heteroaralkyl, substituted with one or more halo, alkyl, or alkoxy.
- R 1 ' is mercapto, thioalkoxy, thioaryloxy, thioheteroaryloxy, SO 3 (R 13 ), sulfate, S(O)N(R 13 ) 2 , S(O) 2 N(R 13 ) 2 .
- R 11 is thioalkoxy, thioaryloxy, thioheteroaryloxy.
- R 1 ' is thioalkoxy, thioaryloxy, thioheteroaryloxy; substituted with one or more acyl, amido aminocarbonyl, C ⁇ -C 6 alkyl aminocarbonyl, C ⁇ -C 6 dialkyl aminocarbonyl, C 1 -C 10 alkoxycarbonyl, C1-C 10 thioalkoxycarbonyl, hydrazinocarbonyl, C ⁇ -C 6 alkyl hydrazinocarbonyl, C ⁇ -C 6 dialkyl hydrazinocarbonyl, hydroxyaminocarbonyl, or alkoxyaminocarbonyl .
- R 1 ' is thioalkoxy substituted with one or more amido, aminocarbonyl, C ⁇ -C 6 alkyl aminocarbonyl, or C ⁇ -C 6 dialkyl aminocarbonyl.
- R 11 is thioalkoxy substituted with aminocarbonyl.
- R 12 is C ⁇ -C ⁇ 0 alkyl, C 6 -C ⁇ o aryl, C5-C10 heteroaryl, C 7 -C ⁇ 2 aralkyl, C 7 -C] 2 heteroaralkyl, C 3 -C 8 heterocyclyl, C 2 -C] 2 alkenyl, C 2 -C ⁇ 2 alkynyl, C 5 -C 10 cycloalkenyl,
- R 12 is C1-C10 alkyl, C 6 -C ⁇ o aryl, C 5 -C ⁇ 0 heteroaryl, C 7 -C ⁇ 2 aralkyl, or C 7 -C12 heteroaralkyl.
- R 12 is C1- 0 alkyl substituted with one or more halo, hydroxy, C 1 -C 10 alkyl, C ⁇ -C haloalkyl, C 1 -C 10 alkoxy, C 6 -C ⁇ 0 aryloxy, or C 5 -C1 0 heteroaryloxy.
- R 12 is C1-C 10 alkyl substituted with aryloxy.
- each Y is N.
- R 11 is thioalkoxy, thioaryloxy, thioheteroaryloxy; substituted with one or more acyl, amido aminocarbonyl, C ⁇ -C 6 alkyl aminocarbonyl, C ⁇ -C 6 dialkyl aminocarbonyl, C 1 -C 10 alkoxycarbonyl, C ⁇ -C ⁇ 0 thioalkoxycarbonyl, hydrazinocarbonyl, C ⁇ -C 6 alkyl hydrazinocarbonyl, C ⁇ -C 6 dialkyl hydrazinocarbonyl, hydroxyaminocarbonyl, or alkoxyaminocarbonyl;
- R 12 is C1-C1 0 alkyl substituted with one or more halo, hydroxy, C 1 -C 10 alkyl, C ⁇ -C 6 haloalkyl, CpCio alkoxy, C ⁇ -Cio aryloxy, or C 5 -C
- R .21 is halo, C ⁇ -C 10 alkyl, C ⁇ -C 6 haloalkyl, C 3 -C 8 cycloalkyl, C 3 -C 8 heterocyclyl, C 2 -C ⁇ 2 alkenyl, C 2 -C ⁇ 2 alkynyl, C 5 -C ⁇ o cycloalkenyl, C 5 -C ⁇ 0 heterocycloalkenyl, C 6 -C ⁇ 0 aryl, C 5 -C 10 heteroaryl, C 7 -C1 2 aralkyl, C 7 -C ⁇ 2 heteroaralkyl; or when taken together with R and the carbon to which it is attached, forms C 5 -C 10 cycloalkenyl, C 5 -C ⁇ 0 heterocycloalkenyl, C 6 -C ⁇ 0 aryl, or C 5 -
- Cio heteroaryl each of which can be optionally substituted with 1-5 R 25.
- R 22 is halo, C1-C10 alkyl, C ⁇ -C 6 haloalkyl, C 3 -C 8 cycloalkyl, C 3 -C 8 heterocyclyl, C 2 -C ⁇ 2 alkenyl, C -C ⁇ 2 alkynyl, C5-C10 cycloalkenyl, C 5 -C ⁇ 0 heterocycloalkenyl, C 6 -C ⁇ o aryl, C5-C1 0 heteroaryl, C 7 -C ⁇ 2 aralkyl, C 7 -C ⁇ 2 heteroaralkyl; or when taken together with R and the carbon to which it is attached, forms C 5 -C 10 cycloalkenyl, C 5 -C 10 heterocycloalkenyl, C 6 -C ⁇ 0 aryl, or C 5 - C 10 heteroaryl; each of which is optionally substituted with 1-5 R
- R 21 and R 22 together with the carbons to which they are attached, form C 5 -C ⁇ o cycloalkenyl, C 5 -C ⁇ 0 heterocycloalkenyl, G 6 -C ⁇ 0 aryl, or C 5 -C ⁇ 0 heteroaryl. In certain embodiments R 21 and R 22 , together with the carbons to which they are attached, form C 5 -C1 0 cycloalkenyl.
- R 23 is hydroxy, C ⁇ -C ⁇ 0 alkyl, C 6 -C ⁇ o aryl, C 5 -C ⁇ 0 heteroaryl, C 7 - C ⁇ 2 aralkyl, C -C ⁇ 2 heteroaralkyl, C -C 8 cycloalkyl, C 3 -C 8 heterocyclyl, C 2 -C ⁇ 2 alkenyl, C 2 -C ⁇ 2 alkynyl, C 5 -C 10 cycloalkenyl, C 5 -C ⁇ 0 heterocycloalkenyl, amino, C ⁇ -C 6 alkyl amino, C ⁇ -C 6 dialkyl amino, or acyl.
- R 23 is C 3 -C 8 cycloalkyl, C 5 -C 8 heterocyclyl, C 5 -C ⁇ 0 cycloalkenyl, or C 5 -C ⁇ 0 heterocycloalkenyl.
- R 24 is halo, hydroxy, C 1 -C 10 alkyl, C ⁇ -C 6 haloalkyl, C
- R 24 is -C 10 alkyl, thioalkoxy, thioaryloxy, or thioheteroaryloxy. In certain embodiments R 24 is C 1 -C 10 alkyl, thioalkoxy; and R 27 is carboxy, carboxylate, cyano, nitro, amino, C ⁇ -C 6 alkyl amino, C ⁇ -C 6 dialkyl amino, SO 3 H, sulfate, S(O)N(R 28 ) 2 ,
- R 4 is C 1 -C 10 alkyl or thioalkoxy; substituted with carboxy, carboxylate, amidyl, or aminocarbonyl.
- Q is S.
- P is N.
- R 21 and R 22 together with the carbons to which they are attached, form C 5 -C ⁇ o cycloalkenyl, Cs-Cio heterocycloalkenyl, C ⁇ -Cio aryl, or C5-C10 heteroaryl;
- R 23 is hydroxy, Ci-Cio alkyl, C 6 -C ⁇ o aryl, C 5 -C ⁇ o heteroaryl, C 7 -C ⁇ 2 aralkyl, C 7 -C ⁇ 2 heteroaralkyl, C 3 -C 8 cycloalkyl, C 3 -C 8 heterocyclyl, C 2 -C ⁇ 2 alkenyl, C 2 -C ⁇ 2 alkynyl, C 5 -C10 cycloalkenyl, C 5 -C ⁇ o heterocycloalkenyl, amino, C ⁇ -C 6 alkyl amino, C ⁇ -C 6 dialkyl amino, or acyl
- R 21 and R 22 together with the carbons to which they are attached, form C 5 -C 10 cycloalkenyl, or C 5 -C ⁇ o heterocycloalkenyl;
- R 23 is Ci-Cio alkyl, C 7 -C ⁇ 2 aralkyl, C7-C 12 heteroaralkyl, C 3 -C 8 cycloalkyl, C 3 - heterocyclyl, C 2 -C ⁇ 2 alkenyl, C -C ⁇ 2 alkynyl, C 5 -C ⁇ 0 cycloalkenyl, C 5 -C ⁇ o heterocycloalkenyl, amino, C ⁇ -C 6 alkyl amino, or C ⁇ -C 6 dialkyl amino;
- R 24 is Ci-Cio alkyl, thioalkoxy, thioaryloxy, or thioheteroaryloxy;
- R , 27 is carboxy, carboxylate, SO 3 H, sulfate, S(O)N(
- R 41 is H, halo, hydroxy, C ⁇ -C 10 alkyl, -C 6 haloalkyl, C 1 -C 10 alkoxy, C ⁇ -C 6 haloalkoxy, C 6 -C ⁇ o aryl, C 5 -C ⁇ o heteroaryl, C 7 -C 12 aralkyl, C -C ⁇ 2 heteroaralkyl, C 3 -C 8 cycloalkyl, C 3 -C 8 heterocyclyl, C 2 -C ⁇ 2 alkenyl, C 2 -C ⁇ 2 alkynyl, C 5 -C ⁇ 0 cycloalkenyl, Cs-Cio heterocycloalkenyl, carboxy, carboxylate, amino, C ⁇ -C 6 alkyl amino, C ⁇ -C 6 dialkyl amino, acyl, aminocarbonyl, Ci- C 6 alkyl aminocarbonyl, C ⁇ -C 6 dialkyl aminocarbonyl, C1-C10 al
- R 46 is H, C1-C1 0 alkyl, C 6 -C ⁇ 0 aryl, C 5 -C ⁇ o heteroaryl, C 7 -C ⁇ 2 aralkyl, C 7 -C ⁇ 2 heteroaralkyl, C 2 -C ⁇ 2 alkenyl, C 2 -C ⁇ 2
- R 42 and R 43 together with the carbons to which they are attached, form C ⁇ -Cio aryl, or C 6 -C ⁇ 0 heteroaryl. In certain embodiments R 42 and R 43 , together with the carbons to which they are attached, form phenyl. In certain embodiments R 42 and R 43 , together with the carbons to which they are attached, form phenyl; and are substituted with halo or Ci-Cio alkyl.
- R is C ⁇ -C ⁇ 0 alkyl; and R 44 is H, halo, C 6 -C
- M is O.
- R 41 is C 1 -C 10 alkyl
- R 44 is acyl, amino, C ⁇ -C 6 alkyl amino, C ⁇ -C 6 dialkyl amino, amido, aminocarbonyl, C ⁇ -C 6 alkyl aminocarbonyl, C ⁇ -C 6 dialkyl aminocarbonyl, carboxy, or C1-C10 alkoxycarbonyl
- R 42 and R 43 together with the carbons to which they are attached, form C 6 -C ⁇ o aryl, or C 6 -C ⁇ o heteroaryl
- M is O.
- a compound described herein reduces the activity of a FOXO transcription factor such as FoxOl or FoxO3.
- the amount can be effective to ameliorate at least one symptom of the viral disorder.
- the disease or disorder can be a retroviral disorder, e.g., a lentiviral disorder, e.g., an HlN-mediated disorder such as AIDS.
- SIRT1 deacetylates the HIV Tat protein and is required for Tat-mediated transactivation of the H1N promoter.
- the method can further include administering a molecule of the invention in combination with an additional anti-viral treatment.
- a molecule of the invention can be administered in combination with an anti-viral agent, e.g., a protease inhibitor, e.g., a HIV protease inhibitor, a fusion inhibitor, an integrase inhibitor, or a reverse transcriptase inhibitor, (e.g., a nucleotide analog, e.g., AZT, or a non-nucleoside reverse transcriptase inhibitor).
- the method can include administering the compound more than once, e.g., repeatedly administering the compound.
- the compound can be administered in one or more boluses or continuously.
- the compound can be administered from without (e.g., by injection, ingestion, inhalation, etc), or from within, e.g., by an implanted device.
- the method can include a regimen that includes increasing or decreasing dosages of the compound.
- the amount can be effective to increase acetylation of a sirtuin substrate in at least some cells of the subject.
- Administered "in combination with”, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated.
- the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap. This is sometimes referred to herein as “simultaneous" or “concurrent delivery.” In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment.
- delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other.
- the effect of the two treatments can be partially additive, wholly additive, or greater than additive.
- the delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
- a molecule of the invention is administered after another (first) anti-viral treatment has been administered to the patient but the first treatment did not achieve an optimal outcome or is no longer achieving an optimal outcome, e.g., the virus has become resistant to the first treatment.
- the method can include administering the compound locally.
- the amount can be effective to increase acetylation of a sirtuin substrate (e.g., a viral sirtuin substrate such as tat or a tat-like transactivator, or a cellular sirtuin substrate that participates in the viral lifecycle) in at least some cells of the subject.
- a sirtuin substrate e.g., a viral sirtuin substrate such as tat or a tat-like transactivator, or a cellular sirtuin substrate that participates in the viral lifecycle
- the subject can be a mammal, e.g., a human.
- the method further can include identifying a subject in need of such treatment, e.g., by evaluating sirtuin activity in a cell of the subject, evaluating nucleotide identity in a nucleic acid of the subject that encodes a sirtuin, evaluating the subject for a virus (e.g., HIV) or a virally infected cell or neoplastic cells whose growth properties are altered by a viral infection, evaluating the genetic composition or expression of genes in a cell of the subject, e.g., a virally infected cell.
- a virus e.g., HIV
- a virally infected cell or neoplastic cells whose growth properties are altered by a viral infection
- evaluating the genetic composition or expression of genes in a cell of the subject e.g., a virally infected cell.
- the method further can include identifying a subject in need of such treatment, e.g., by evaluating by parameter such as sirtuin activity, HIV level, the level or a selected T cell or other cell surface marker, the presence of an additional infectious agents (e.g., TB) in the subject, determining if the value determined for the parameter has a predetermined relationship with a reference value, e.g., the subjects T cell count is below a threshold level, and administering the treatment to the patient.
- the method can further include monitoring the subject, e.g., imaging the subject, evaluating viral load or virally infected cells in the subject, evaluating sirtuin activity in a cell of the subject, or evaluating the subject for side effects, e.g., renal function.
- this invention relates to a method for treating or preventing a viral infection or disease or infection or disease symptoms, including AIDS in a subject.
- the method includes administering to the subject an effective amount of a compound depicted in Table 1, Table 2, or Table 3.
- the compound can preferentially inhibit SIRTl relative to a non-SIRTl sirtuin, e.g., at least a 1.5, 2, 5, or 10 fold preference.
- the compound may preferentially inhibit another target, e.g., another sirtuin.
- the compound can have a K, for SIRTl that is less than 500, 100, 50, or 40 nM.
- this invention relates to a method for evaluating a plurality of compounds, the method includes: a) providing library of compound that comprises a plurality of compounds, each having a formula of a compound described herein; and b) for each of a plurality of compounds from the library, and doing one or more of: i) contacting the compound to a sirtuin test protein that comprises a functional deactylase domain of a sirtuin; ii) evaluating interaction between the compound and the sirtuin test protein in the presence of the compound; and iii) evaluating ability of the compound to modulate a virus, e.g., a retro virus, e.g., a lentivirus, e.g., HIV, e.g., in a cell.
- a virus e.g., a retro virus, e.g., a lentivirus, e.g., HIV, e.g., in a cell.
- evaluating the interaction between the compound and the sirtuin test protein includes evaluating enzymatic activity of the sirtuin test protein. In one embodiment, evaluating the interaction between the compound and the sirtuin test protein includes evaluating a binding interaction between the compound and the sirtuin test protein. The method can further include selecting, based on results of the evaluating, a compound that modulates deacetylase activity for a substrate.
- the substrate can be an acetylated lysine amino acid, an acetylated substrate or an acetylated peptide thereof.
- the method may also further include selecting, based on results of the evaluating, a compound that modulates sirtuin deacetylase activity of a substrate.
- the method may also further include selecting, based on results of the evaluating, a compound that modulates the sirtuin.
- this invention relates to a conjugate that includes: a targeting agent and a compound, wherein the targeting agent and the compound are covalently linked, and the compound has a formula described herein.
- the targeting agent can be an antibody, e.g., specific for a cell surface protein of a virally infected cell, e.g., a viral receptor
- this invention relates to a kit which includes: a compound described herein, and instructions for use for treating a viral disease, viral infection, or viral disorder described herein.
- the kit may further include a printed material comprising a rendering of the structure of the name of the compound.
- this invention relates to a method of analyzing or designing structures, the method includes: providing a computer-generated image or structure (preferably a three dimensional image or structure) for a compound described herein, e.g., a compound of formula I, formula II or formula III, providing a computer-generated image or structure (preferably a three dimensional image or structure) for a second compound, e.g., another compound described herein, (e.g., a compound of formula I, formula II or formula III, NAD) or a target, e.g., a sirtuin (e.g., a human sirtuin, e.g., SIRTl, SIRT2, SIRT3, SIRT4, SIRT5, SIRT6, or SIRT7) or an off- target molecule, e.g., a sirtuin other than SIRTl, e.g., SIRT2 or SIRT3, or non-sirtuin histone deacetylase; and comparing the structure of a compound
- the structure is further evaluated in vitro, in vivo, or in silico with target or off-target molecule.
- this invention relates to a database, which includes: information about or identifying the structure, information about activity of the structure, e.g., in vitro, in vivo or in silico, e.g., at least 5, 10, 50, or 100 records.
- this invention relates to a database, which includes a plurality of records, each record having: a) information about or identifying a compound that has a structure described herein, e.g., a structure of formula I, formula II or formula III; and b) information about a parameter of a patient, the parameter relating to a viral disorder or a patient parameter, e.g., viral load, white blood cell count, weight, etc.
- this invention relates to a method of evaluating a compound, the method includes: providing a first compound that has a structure of a formula described herein, or a data record having information about the structure; providing a second compound that has a structure of a formula described herein or not having a formula described herein, or a data record having information about the structure; evaluating a first compound and the second compound, e.g., in vivo, in vitro, or in silico; and comparing the ability of a second compound to interact, e.g., inhibit a sirtuin, e.g., SIRTl, with a first compound, thereby evaluating ability of the second compound to interact with SIRTl .
- a sirtuin e.g., SIRTl
- the invention relates to a composition
- a composition comprising a compound of any of the formulae herein, and a pharmaceutically acceptable carrier.
- the composition may contain an additional therapeutic agent (for example one, two, three, or more additional agents), e.g., an anti-viral agent, e.g., a protease inhibitor, e.g., a HIV protease inhibitor, a fusion inhibitor, an integrase inhibitor, and/or a reverse transcriptase inhibitor, (e.g., a nucleotide analog, e.g., AZT, or a non-nucleoside reverse transcriptase inhibitor).
- an anti-viral agent e.g., a protease inhibitor, e.g., a HIV protease inhibitor, a fusion inhibitor, an integrase inhibitor, and/or a reverse transcriptase inhibitor, (e.g., a nucleotide analog, e.g.,
- the method includes administering a SIRTl antagonist described herein, e.g., having a structure of formula (I).
- the invention includes a method for treating or preventing a tat or tat mediated disease or disorder.
- the method includes administering a compound described herein, e.g., a compound of formula (I).
- the method includes administering a SIRTl antagonist in combination with one or more therapeutic agents, e.g., a therapeutic agent or agent for treating a viral disorder, e.g., a viral disorder described herein.
- the additional agents may be administered in a single composition with the SIRTl antagonist or may be administered separately, for example in separate formulations such as separate pills.
- the agents can be administered at the same time, or at different times.
- additional agents include a protease inhibitor, e.g., a HIV protease inhibitor, a fusion inhibitor, an integrase inhibitor, or a reverse transcriptase inhibitor, (e.g., a nucleotide analog, e.g., AZT, or a non-nucleoside reverse transcriptase inhibitor).
- SIRTl antagonist and the therapeutic agents can be administered simultaneously or sequentially. Also within the scope of this invention is a packaged product.
- the packaged product includes a container, one of the aforementioned compounds in the container, and a legend (e.g., a label or insert) associated with the container and indicating administration of the compound for treating a viral disease, a viral disorder, or viral infection described herein.
- the subject can be a mammal, preferably a human.
- the subject can also be a non-human subject, e.g., an animal model.
- the method can further include identifying a subject. Identifying a subject in need of such treatment can be in the judgment of a subject or a health care professional and can be subjective (e.g., opinion) or objective (e.g., measurable by a test or diagnostic method).
- mammal includes organisms, which include mice, rats, cows, sheep, pigs, rabbits, goats, and horses, monkeys, dogs, cats, and preferably humans.
- treating or “treated” refers to administering a compound described herein to a subject with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect a disease, e.g., an infection, the symptoms of the disease or the predisposition toward the disease.
- An effective amount of the compound described above may range from about 0.1 mg/Kg to about 500 mg/Kg, alternatively from about 1 to about 50 mg/Kg. Effective doses will also vary depending on route of administration, as well as the possibility of co-usage with other agents.
- halo refers to any radical of fluorine, chlorine, bromine or iodine.
- alkyl refers to a hydrocarbon chain that may be a straight chain or branched chain, containing the indicated number of carbon atoms. For example, C ⁇ -Cj 2 alkyl indicates that the group may have from 1 to 12 (inclusive) carbon atoms in it.
- haloalkyl refers to an alkyl in which one or more hydrogen atoms are replaced by halo, and includes alkyl moieties in which all hydrogens have been replaced by halo (e.g., perfluoroalkyl).
- arylalkyl or “aralkyl” refer to an alkyl moiety in which an alkyl hydrogen atom is replaced by an aryl group.
- Aralkyl includes groups in which more than one hydrogen atom has been replaced by an aryl group. Examples of “arylalkyl” or “aralkyl” include benzyl, 2-phenylethyl, 3- phenylpropyl, 9-fluorenyl, benzhydryl, and trityl groups.
- alkylene refers to a divalent alkyl, e.g., -CH 2 -, -CH 2 CH 2 -, and -CH 2 CH 2 CH 2 -.
- alkenyl refers to a straight or branched hydrocarbon chain containing 2-12 carbon atoms and having one or more double bonds.
- alkenyl groups include, but are not limited to, allyl, propenyl, 2-butenyl, 3-hexenyl and 3-octenyl groups.
- One of the double bond carbons may optionally be the point of attachment of the alkenyl substituent.
- alkynyl refers to a straight or branched hydrocarbon chain containing 2-12 carbon atoms and characterized in having one or more triple bonds. Examples of alkynyl groups include, but are not limited to, ethynyl, propargyl, and 3-hexynyl.
- alkylamino and dialkylamino refer to -NH(alkyl) and -NH(alkyl) 2 radicals respectively.
- aralkylamino refers to a -NH(aralkyl) radical.
- alkylaminoalkyl refers to a (alkyl)NH-alkyl- radical; the term dialkylaminoalkyl refers to a (alkyl) 2 N-alkyl- radical.
- alkoxy refers to an -O-alkyl radical.
- mercapto refers to an SH radical.
- thioalkoxy refers to an -S-alkyl radical.
- thioaryloxy refers to an -S-aryl radical.
- aryl refers to an aromatic monocyclic, bicyclic, or tricyclic hydrocarbon ring system, wherein any ring atom capable of substitution can be substituted (e.g., by one or more substituents). Examples of aryl moieties include, but are not limited to, phenyl, naphthyl, and anthracenyl.
- cycloalkyl as employed herein includes saturated cyclic, bicyclic, tricyclic,or polycyclic hydrocarbon groups having 3 to 12 carbons.
- ring atom can be substituted (e.g., by one or more substituents).
- the cycloalkyl groups can contain fused rings. Fused rings are rings that share a common carbon atom. Examples of cycloalkyl moieties include, but are not limited to, cyclopropyl, cyclohexyl, methylcyclohexyl, adamantyl, and norbornyl.
- heterocyclyl refers to a nonaromatic 3-10 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively).
- the heteroatom may optionally be the point of attachment of the heterocyclyl substituent. Any ring atom can be substituted (e.g., by one or more substituents).
- heterocyclyl groups can contain fused rings. Fused rings are rings that share a common carbon atom.
- heterocyclyl include, but are not limited to, tetrahydrofuranyl, tetrahydropyranyl, piperidinyl, mo ⁇ holino, pyrrolinyl, pyrimidinyl, quinolinyl, and pyrrolidinyl.
- cycloalkenyl refers to partially unsaturated, nonaromatic, cyclic, bicyclic, tricyclic, or polycyclic hydrocarbon groups having 5 to 12 carbons, preferably 5 to 8 carbons.
- the unsaturated carbon may optionally be the point of attachment of the cycloalkenyl substituent. Any ring atom can be substituted (e.g., by one or more substituents).
- the cycloalkenyl groups can contain fused rings. Fused rings are rings that share a common carbon atom. Examples of cycloalkenyl moieties include, but are not limited to, cyclohexenyl, cyclohexadienyl, or norbornenyl.
- heterocycloalkenyl refers to a partially saturated, nonaromatic 5-10 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively).
- the unsaturated carbon or the heteroatom may optionally be the point of attachment of the heterocycloalkenyl substituent.
- heterocycloalkenyl groups can contain fused rings. Fused rings are rings that share a common carbon atom. Examples of heterocycloalkenyl include but are not limited to tetrahydropyridyl and dihydropyranyl.
- heteroaryl refers to an aromatic 5-8 membered monocyclic, 8-12 membered bicyclic, or 11-14 membered tricyclic ring system having 1-3 heteroatoms if monocyclic, 1-6 heteroatoms if bicyclic, or 1-9 heteroatoms if tricyclic, said heteroatoms selected from O, N, or S (e.g., carbon atoms and 1-3, 1-6, or 1-9 heteroatoms of N, O, or S if monocyclic, bicyclic, or tricyclic, respectively). Any ring atom can be substituted (e.g., by one or more substituents).
- oxo refers to an oxygen atom, which forms a carbonyl when attached to carbon, an N-oxide when attached to nitrogen, and a sulfoxide or sulfone when attached to sulfur.
- acyl refers to an alkylcarbonyl, cycloalkylcarbonyl, arylcarbonyl, heterocyclylcarbonyl, or heteroarylcarbonyl substituent, any of which may be further substituted (e.g., by one or more substituents).
- aminocarbonyl alkoxycarbonyl
- hydrazinocarbonyl hydroxyaminocarbonyl refer to the radicals -C(O)NH 2 , -C(O)O(alkyl), -C(O)NH 2 NH 2 , and - C(O)NH 2 NH 2 , respectively.
- substituted refers to a group “substituted” on an alkyl, cycloalkyl, alkenyl, alkynyl, heterocyclyl, heterocycloalkenyl, cycloalkenyl, aryl, or heteroaryl group at any atom of that group. Any atom can be substituted.
- Suitable substituents include, without limitation, alkyl (e.g., CI, C2, C3, C4, C5, C6, C7, C8, C9, CIO, CI 1, C12 straight or branched chain alkyl), cycloalkyl, haloalkyl (e.g., perfluoroalkyl such as CF 3 ), aryl, heteroaryl, aralkyl, heteroaralkyl, heterocyclyl, alkenyl, alkynyl, cycloalkenyl, heterocycloalkenyl, alkoxy, haloalkoxy (e.g., perfluoroalkoxy such as OCF 3 ), halo, hydroxy, carboxy, carboxylate, cyano, nitro, amino, alkyl amino, SO 3 H, sulfate, phosphate, methylenedioxy (-O-CH 2 -O- wherein oxygens are attached to vicinal atoms), ethylenedioxy, oxo
- the substituents on a group are independently any one single, or any subset of the aforementioned substituents.
- a substituent may itself be substituted with any one of the above substituents.
- a "retroviral disorder” refers to a disorder caused at least in part by a retrovirus.
- the retrovirus can be integrated in a cell, e.g., as a latent or newly integrated virus.
- latent virus in one example, a subject having the disorder may not have a detectable viral load. In another example, the subject has a detectable, e.g., substantial, viral load.
- a "lentiviral disorder” refers to a disorder caused at least in part by a lentivirus.
- Lentiviruses typically are infectious viruses that have 4 main genes coding for the virion proteins in the order: 5' ' -gag-pro-pol-env-3' . There may be additional genes depending on the virus (e.g., for HIV-1: vif, vpr, vpu, tat, rev, nef) whose products are involved in regulation of synthesis and processing virus RNA and other replicative functions.
- the LRT is about 600nt long, of which the U3 region is 450, the R sequence 100 and the U5 region some 70 nt long.
- Exemplary Lentiviruses include primate lentiviruses (e.g., SIV, HIV-1, HIV-2), equine lentiviruses (e.g., equine infectious anemia virus), bovine lentiviruses (e.g., bovine immunodeficiency virus), feline lentiviruses (e.g., feline immunodeficiency virus (Petuluma)), and ovine/caprine lentiviruses (e.g., arthritis encephalitis virus; 61.0.6.4.002 visna/maedi virus (strain 1514)).
- the retrovirus is in the form of infectious particles.
- a subject having the disorder may have a detectable (e.g., a significant) viral load.
- An exemplary "retroviral disorder” is an HIV-related disorder.
- An “HIV-related disorder” refers to any disorder caused at least in part by an HIV-related retrovirus, including HlN-1, HIV-2, FLV, HTLV-1, HTLV-2, and SIV. See, e.g., Coffin (1992) Curr Top Microbiol Immunol.
- Such disorders include AIDS and AIDS-related complex (ARC), and a variety of disorders that arise as a consequence of HIV infection, e.g., Kaposi's sarcoma, non-Hodgkin's lymphomas, central nervous system non-Hodgkin's lymphomas, and rare tumors (e.g., intracranial tumors such as glioblastomas, anaplastic astrocytomas, and subependymomas), opportunistic infections (e.g., Histoplasmosis, CMV (Cytomegalovirus), Cryptosporidiosis, Cryptococcal Meningitis, Dementia and Central Nervous System Problems, Hepatitis and HIV, Hepatitis C and HIV, HPV, KS (Kaposi's Sarcoma), Lymphoma, MAC (Mycobacterium Avium Complex), Molluscum, PCP (Pneumocystis Carinii Pneumonia), PML (Pro
- a "viral neoplastic disorder” is a disease or disorder characterized by cells that have the capacity for autonomous growth or replication due to a virus, e.g., a viral infection. As a result the cells are in an abnormal state or condition characterized by proliferative cell growth.
- Methods and compositions disclosed herein can be used to treat any viral disorder which is dependent on the state of acetylation of a protein, e.g., a viral or cellular protein involved in propagation of the virus, e.g., a viral transcription factor.
- Exemplary viral disorders include retroviral and lentiviral disorders.
- Exemplary compounds that can be used have a general formula (I), (II), (III), or (IV) and contain a substituted cyclic (e.g., pentacyclic or hexacyclic) or polycyclic core containing one or more oxygen, nitrogen, or sulfur atoms as a constituent atom of the ring(s).
- a substituted cyclic e.g., pentacyclic or hexacyclic
- polycyclic core containing one or more oxygen, nitrogen, or sulfur atoms as a constituent atom of the ring(s).
- formula (III) Any ring carbon atom can be substituted.
- the cyclic or polycyclic core may be partially or fully saturated, i.e. one or two double bonds respectively.
- a preferred subset of compounds of formula (I) includes those having a ring that is fused to the pentacyclic core, e.g., R 1 and R 2 , together with the carbons to which they are attached, and/or R 3 and R 4 , together with the carbons to which they are attached, form C 5 -Q 0 cycloalkenyl (e.g., C5, C6, or C7), C 5 -C ⁇ 0 heterocycloalkenyl (e.g., C5, C6, or C7), C 6 -C ⁇ 0 aryl (e.g., C6, C8 or CIO), or C 6 -C ⁇ o heteroaryl (e.g., C5 or C6).
- Fused ring combinations may include without limitation one or more of the following:
- Each of these fused ring systems may be optionally substituted with substitutents, which may include without limitation halo, hydroxy, C ⁇ -C ⁇ 0 alkyl
- C1,C2,C3,C4,C5,C6, C,-C 6 dialkyl aminocarbonyl (C1,C2,C3,C4,C5,C6,), C C ⁇ 0 alkoxycarbonyl (C1,C2,C3,C4,C5,C6,C7,C8,C9,C10), Ci-Cio thioalkoxycarbonyl (C1,C2,C3,C4,C5,C6,C7,C8,C9,C10), hydrazinocarbonyl, C ⁇ -C 6 alkyl hydrazinocarbonyl (C1,C2,C3,C4,C5,C6,), C ⁇ -C 6 dialkyl hydrazinocarbonyl (C1,C2,C3,C4,C5,C6,), hydroxyaminocarbonyl, etc.
- Preferred substituents include C
- Another preferred subset of compounds of formula (I) includes those where R 1 and R 2 are C ⁇ -C 6 alkyl (e.g., wherein R 1 and R 2 are both CH 3 ).
- R 3 is a substituted or unsubstitued aminocarbonyl and R 4 is an amido substituted with a substituent.
- X is S.
- a preferred subset of compounds of formula (II) includes those having a triazole core (i.e., wherein X is NR 16 and both Ys are N).
- Another preferred subset of compounds include those where R 1 ' is a substituted thioalkoxy. Where R 11 is thioalkoxy, preferred substituents include aminocarbonyl.
- An example of a preferred subset is provided below.
- R 12 is aryl, arylalkyl, heteroaryl, heteroarylalkyl, and alky substituted with heteroaryloxy or aryloxy. Each aryl and heteroaryl is optionally substituted. Still another subset of preferred embodiments include those wherein X is NR 7 and R 7 is aryl, heteroaryl, arylalkyl or heteroarylalkyl, each is which is optionally substituted.
- a preferred subset of compounds of formula (III) includes those having one of the following polycyclic cores:
- polycyclic core can be substituted with one or more suitable substituents.
- a preferred subset of compounds of formula (IV) includes those having the following polycyclic core:
- polycyclic core can be substituted with one or more suitable substituents.
- suitable substituents include butyl
- the compounds described herein, or precursors thereof can be purchased commercially, for example from Asinex, Moscow, Russia; Bionet, Camelford, England; ChemDiv, SanDiego, CA; Comgenex, Budapest, Hungary; Enamine, Kiev, Ukraine; IF Lab, Ukraine; Interbioscreen, Moscow, Russia; Maybridge, Tintagel, UK; Specs, The Netherlands; Timtec, Newark, DE; Vitas-M Lab, Moscow, Russia.
- the compounds described herein can be synthesized by conventional methods. As can be appreciated by the skilled artisan, methods of synthesizing the compounds of the formulae herein will be evident to those of ordinary skill in the art. Additionally, the various synthetic steps may be performed in an alternate sequence or order to give the desired compounds. Synthetic chemistry transformations and protecting group methodologies
- the compounds of this invention may contain one or more asymmetric centers and thus occur as racemates and racemic mixtures, single enantiomers, individual diastereomers and diastereomeric mixtures. All such isomeric forms of these compounds are expressly included in the present invention.
- the compounds of this invention may also contain linkages (e.g., carbon- carbon bonds) wherein bond rotation is restricted about that particular linkage, e.g. restriction resulting from the presence of a ring or double bond. Accordingly, all cis/trans and E/Z isomers are expressly included in the present invention.
- the compounds of this invention may also be represented in multiple tautomeric forms, in such instances, the invention expressly includes all tautomeric forms of the compounds described herein, even though only a single tautomeric form may be represented (e.g., alkylation of a ring system may result in alkylation at multiple sites, the invention expressly includes all such reaction products). All such isomeric forms of such compounds are expressly included in the present invention. All crystal forms of the compounds described herein are expressly included in the present invention.
- the compounds of this invention include the compounds themselves, as well as their salts and their prodrugs, if applicable.
- a salt for example, can be formed between an anion and a positively charged substituent (e.g., amino) on a compound described herein.
- Suitable anions include chloride, bromide, iodide, sulfate, nitrate, phosphate, citrate, methanesulfonate, trifluoroacetate, and acetate.
- a salt can also be formed between a cation and a negatively charged substituent (e.g., carboxylate) on a compound described herein.
- Suitable cations include sodium ion, potassium ion, magnesium ion, calcium ion, and an ammonium cation such as tetramethylammonium ion.
- prodrugs include esters and other pharmaceutically acceptable derivatives, which, upon administration to a subject, are capable of providing active compounds.
- the compounds of this invention may be modified by appending appropriate functionalities to enhance selected biological properties, e.g., targeting to a particular tissue.
- modifications are known in the art and include those which increase biological penetration into a given biological compartment (e.g., blood, lymphatic system, central nervous system), increase oral availability, increase solubility to allow administration by injection, alter metabolism and alter rate of excretion.
- the compounds described herein may be used as platforms or scaffolds that may be utilized in combinatorial chemistry techniques for preparation of derivatives and/or chemical libraries of compounds. Such derivatives and libraries of compounds have biological activity and are useful for identifying and designing compounds possessing a particular activity.
- Combinatorial techniques suitable for utilizing the compounds described herein are known in the art as exemplified by Obrecht, D.
- one embodiment relates to a method of using the compounds described herein for generating derivatives or chemical libraries comprising: 1) providing a body comprising a plurality of wells; 2) providing one or more compounds identified by methods described herein in each well; 3) providing an additional one or more chemicals in each well; 4) isolating the resulting one or more products from each well.
- An alternate embodiment relates to a method of using the compounds described herein for generating derivatives or chemical libraries comprising: 1) providing one or more compounds described herein attached to a solid support; 2) treating the one or more compounds identified by methods described herein attached to a solid support with one or more additional chemicals; 3) isolating the resulting one or more products from the solid support.
- tags or identifier or labeling moieties may be attached to and/or detached from the compounds described herein or their derivatives, to facilitate tracking, identification or isolation of the desired products or their intermediates.
- moieties are known in the art.
- the chemicals used in the aforementioned methods may include, for example, solvents, reagents, catalysts, protecting group and deprotecting group reagents and the like. Examples of such chemicals are those that appear in the various synthetic and protecting group chemistry texts and treatises referenced herein.
- Sirtuins are members of the Silent Information Regulator (SIR) family of genes. Sirtuins are proteins that include a SIR2 domain as defined as amino acids sequences that are scored as hits in the Pfam family "SIR2" - PF02146. This family is referenced in the INTERPRO database as INTERPRO description (entry IPR003000).
- SIR Silent Information Regulator
- the amino acid sequence of the protein can be searched against the Pfam database of HMMs (e.g., the Pfam database, release 9) using the default parameters (http://www.sanger.ac.uk/Software/Pfam/HMM_search).
- the SIR2 domain is indexed in Pfam as PF02146 and in INTERPRO as INTERPRO description (entry IPR003000).
- the hmmsf program which is available as part of the HMMER package of search programs, is a family specific default program for MILPAT0063 and a score of 15 is the default threshold score for determining a hit.
- the threshold score for determining a hit can be lowered (e.g., to 8 bits).
- a description of the Pfam database can be found in "The Pfam Protein Families
- SIR2 S. cerevisiae SIR2
- silencing HM loci that contain information specifying yeast mating type, telomere position effects and cell aging (Guarente, 1999; Kaeberlein et al,
- the yeast Sir2 protein belongs to a family of histone deacetylases (reviewed in Guarente, 2000; Shore, 2000).
- the Sir2 protein is a deacetylase which can use NAD as a cofactor (Imai et al, 2000; Moazed, 2001; Smith et al, 2000; Tanner et al, 2000; Tanny and Moazed, 2001).
- NAD NAD
- Sir2 is relatively insensitive to histone deacetylase inhibitors like trichostatin A (TSA) (Imai et al, 2000; Landry et al, 2000a; Smith et al, 2000).
- Mammalian Sir2 homologs such as SIRTl
- exemplary mammalian sirtuins include SIRTl, SIRT2, and SIRT3, e.g., human SIRTl, SIRT2, and SIRT3.
- a compound described herein may inhibit one or more activities of a mammalian sirtuin, e.g., SIRTl, SIRT2, or SIRT3, e.g., with a K of less than 500, 200, 100, 50, or 40 nM.
- the compound may inhibit deacetylase activity, e.g., with respect to a natural or artificial substrate, e.g., a substrate described herein, e.g., as follows.
- Natural substrates for SIRTl include histones and p53.
- SIRTl proteins bind to a number of other proteins, referred to as "SIRTl binding partners.”
- SIRTl binds to p53 and plays a role in the p53 pathway, e.g., K370, K371 , K372, K381, and or K382 of p53 or a peptide that include one or more of these lysines.
- the peptide can be between 5 and 15 amino acids in length.
- SIRTl proteins can also deacetylate histones.
- SIRTl can deacetylate lysines 9 or 14 of histone H3 or small peptides that include one or more of these lysines. Histone deacetylation alters local chromatin structure and consequently can regulate the transcription of a gene in that vicinity.
- Many of the SIRTl binding partners are transcription factors, e.g., proteins that recognize specific DNA sites. Interaction between SIRTl and SIRTl binding partners can deliver SIRTl to specific regions of a genome and can result in a local manifestation of substrates, e.g., histones and transcription factors localized to the specific region.
- Natural substrates for SIRT2 include tubulin, e.g., alpha-tubulin. See, e.g., North et al.
- Exemplary substrates include a peptide that includes lysine 40 of alpha-tubulin. Still other exemplary sirtuin substrates include cytochrome c and acetylated peptides thereof, and HIV tat and acetylated peptides thereof.
- the terms "SIRTl protein” and "SIRTl polypeptide” are used interchangeably herein and refer a polypeptide that is at least 25% identical to the 250 amino acid conserved SIRTl catalytic domain, amino acid residues 258 to 451 of SEQ ID NO:l.
- SEQ ID NO: l depicts the amino acid sequence of human SIRTl.
- a SIRTl polypeptide can be at least 30, 40, 50, 60, 70, 80, 85, 90, 95, 99% homologous to SEQ ID NO: 1 or to the amino acid sequence between amino acid residues 258 and 451 of SEQ ID NO: 1.
- the SIRTl polypeptide can be a fragment, e.g., a fragment of SIRTl capable of one or more of: deacetylating a substrate in the presence of NAD and/or a NAD analog and capable of binding a target protein, e.g., a transcription factor.
- Such functions can be evaluated, e.g., by the methods described herein.
- the SIRTl polypeptide can be a "full length” SIRTl polypeptide.
- full length refers to a polypeptide that has at least the length of a naturally-occurring SIRTl polypeptide (or other protein described herein).
- a "full length” SIRTl polypeptide or a fragment thereof can also include other sequences, e.g., a purification tag., or other attached compounds, e.g., an attached fluorophore, or cofactor.
- SIRTl polypeptides can also include sequences or variants that include one or more substitutions, e.g., between one and ten substitutions, with respect to a naturally occurring Sir2 family member.
- SIRTl activity refers to one or more activity of SIRTl, e.g., deacetylation of a substrate (e.g., an amino acid, a peptide, or a protein), e.g., transcription factors (e.g., p53) or histone proteins, (e.g., in the presence of a cofactor such as NAD and/or an NAD analog) and binding to a target, e.g., a target protein, e.g., a transcription factor.
- a substrate e.g., an amino acid, a peptide, or a protein
- transcription factors e.g., p53
- histone proteins e.g., in the presence of a cofactor such as NAD and/or an NAD analog
- a "biologically active portion" or a "functional domain" of a protein includes a fragment of a protein of interest which participates in an interaction, e.g., an intramolecular or an inter-molecular interaction, e.g., a binding or catalytic interaction.
- An inter- molecular interaction can be a specific binding interaction or an enzymatic interaction (e.g., the interaction can be transient and a covalent bond is formed or broken).
- An inter-molecular interaction can be between the protein and another protein, between the protein and another compound, or between a first molecule and a second molecule of the protein (e.g., a dimerization interaction).
- Biologically active portions/functional domains of a protein include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequence of the protein which include fewer amino acids than the full length, natural protein, and exhibit at least one activity of the natural protein.
- Biological active portions/functional domains can be identified by a variety of techniques including truncation analysis, site-directed mutagenesis, and proteolysis. Mutants or proteolytic fragments can be assayed for activity by an appropriate biochemical or biological (e.g., genetic) assay.
- a functional domain is independently folded.
- biologically active portions comprise a domain or motif with at least one activity of a protein, e.g., SIRTl.
- An exemplary domain is the SIRTl core catalytic domain.
- a biologically active portion/functional domain of a protein can be a polypeptide which is, for example, 10, 25, 50, 100, 200 or more amino acids in length.
- Biologically active portions/functional domain of a protein can be used as targets for developing agents which modulate SIRTl.
- SIR3_HUMAN NAD-dependent deacetylase sirtuin 3 mitochondrial precursor (EC 3.5.1.-) (SIR2-like protein 3) (hSIRT3) - Homo sapiens (Human) .
- SIR5_HUMAN NAD-dependent deacetylase sirtuin 5 (EC 3.5.1.-) (SIR2-like protein 5) - Homo sapiens (Human) .
- SIR6_HUMAN NAD-dependent deacetylase sirtuin 6 (EC 3.5.1.-) (SIR2-like protein 6) - Homo sapiens (Human).
- SIR2-like protein 6 (SIR2-like protein 6) - Homo sapiens (Human).
- MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKV ELARLV QSSSWFHTGAGISTASG IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTWGTMGLKATGRLCTVAKARGLRACRGE LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK EESPTRINGSIPAGPKQEPCAQH
- Exemplary compounds described herein may inhibit activity of SIRTl or a functional domain thereof by at least 10, 20, 25, 30, 50, 80, or 90%, with respect to a natural or artificial substrate described herein.
- the compounds may have a Ki of less than 500, 200, 100, or 50 nM.
- a compound described herein may also modulate a complex between a sirtuin and a transcription factor, e.g., increase or decrease complex formation, deformation, and/or stability.
- Exemplary sirtuin-TF complexes include Sir2-PCAF, SIR2-MyoD, Sir2-PCAF-MyoD, and Sir2- p53.
- a compound described herein may also modulate expression of a Sir2 regulated gene, e.g., a gene described in Table 1 of Fulco et al. (2003) Mol Cell 12:51-62.
- interaction with, e.g., binding of, SIRTl can be assayed in vitro.
- the reaction mixture can include a SIRTl co-factor such as NAD and/or a NAD analog.
- the reaction mixture can include a SIRTl binding partner, e.g., a transcription factor, e.g., a viral transcription factor (e.g., tat), p53 or a transcription factor other than p53, and compounds can be screened, e.g., in an in vitro assay, to evaluate the ability of a test compound to modulate interaction between SIRTl and a SIRTl binding partner, e.g., a transcription factor.
- This type of assay can be accomplished, for example, by coupling one of the components, with a radioisotope or enzymatic label such that binding of the labeled component to the other can be determined by detecting the labeled compound in a complex.
- a component can be labeled with 125 ⁇ ; 35 ⁇ 5 14 or 3 ⁇ either directly or indirectly, and the radioisotope detected by direct counting of radioemmission or by scintillation counting.
- a component can be enzymatically labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product.
- Competition assays can also be used to evaluate a physical interaction between a test compound and a target.
- Cell-free assays involve preparing a reaction mixture of the target protein (e.g., SIRTl) and the test compound under conditions and for a time sufficient to allow the two components to interact and bind, thus forming a complex that can be removed and/or detected.
- the interaction between two molecules can also be detected, e.g., using a fluorescence assay in which at least one molecule is fluorescently labeled.
- a fluorescence assay in which at least one molecule is fluorescently labeled.
- FET or FRET for fluorescence resonance energy transfer see, for example, Lakowicz et al, U.S. Patent No.
- a fluorophore label on the first, 'donor' molecule is selected such that its emitted fluorescent energy will be absorbed by a fluorescent label on a second, 'acceptor' molecule, which in turn is able to fluoresce due to the absorbed energy.
- the 'donor' protein molecule may simply utilize the natural fluorescent energy of tryptophan residues. Labels are chosen that emit different wavelengths of light, such that the 'acceptor' molecule label may be differentiated from that of the 'donor'.
- the spatial relationship between the molecules can be assessed.
- the fluorescent emission of the 'acceptor' molecule label in the assay should be maximal.
- a FET binding event can be conveniently measured through standard fluorometric detection means well known in the art (e.g., using a fluorimeter).
- fluorescence assay is fluorescence polarization (FP).
- FP fluorescence polarization
- determining the ability of the SIRTl protein to bind to a target molecule can be accomplished using real-time Biomolecular Interaction Analysis (BIA) (see, e.g., Sjolander, S. and Urbaniczky, C. (1991) Anal. Chem. 63:2338-2345 and Szabo et al. (1995) Curr. Opin. Struct.
- BIOA Biomolecular Interaction Analysis
- SIRTl is anchored onto a solid phase.
- the SIRTl/test compound complexes anchored on the solid phase can be detected at the end of the reaction, e.g., the binding reaction.
- SIRTl can be anchored onto a solid surface, and the test compound, (which is not anchored), can be labeled, either directly or indirectly, with detectable labels discussed herein. It may be desirable to immobilize either the SIRTl or an anti-SIRTl antibody to facilitate separation of complex ed from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Binding of a test compound to a SIRTl protein, or interaction of a SIRTl protein with a second component in the presence and absence of a candidate compound, can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and micro-centrifuge tubes.
- a fusion protein can be provided which adds a domain that allows one or both of the proteins to be bound to a matrix.
- glutathione-S-transferase/SIRTl fusion proteins or glutathione-S-transferase/target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, MO) or glutathione derivatized microtiter plates, which are then combined with the test compound or the test compound and either the non- adsorbed target protein or SIRTl protein, and the mixture incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH).
- the beads or microtiter plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described above.
- the complexes can be dissociated from the matrix, and the level of SIRTl binding or activity determined using standard techniques.
- Other techniques for immobilizing either a SIRTl protein or a target molecule on matrices include using conjugation of biotin and streptavidin.
- Biotinylated SIRTl protein or target molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques known in the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, IL), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical).
- biotinylation kit Pierce Chemicals, Rockford, IL
- streptavidin-coated 96 well plates Piereptavidin-coated 96 well plates
- the non-immobilized component is added to the coated surface containing the anchored component. After the reaction is complete, unreacted components are removed (e.g., by washing) under conditions such that any complexes formed will remain immobilized on the solid surface.
- the detection of complexes anchored on the solid surface can be accomplished in a number of ways.
- the detection of label immobilized on the surface indicates that complexes were formed.
- an indirect label can be used to detect complexes anchored on the surface, e.g., using a labeled antibody specific for the immobilized component (the antibody, in turn, can be directly labeled or indirectly labeled with, e.g., a labeled anti-Ig antibody).
- this assay is performed utilizing antibodies reactive with a SIRTl protein or target molecules but which do not interfere with binding of the SIRTl protein to its target molecule.
- Such antibodies can be derivatized to the wells of the plate, and unbound target or the SIRTl protein trapped in the wells by antibody conjugation.
- Methods for detecting such complexes include immunodetection of complexes using antibodies reactive with the SIRTl protein or target molecule, as well as enzyme-linked assays which rely on detecting an enzymatic activity associated with the SIRTl protein or target molecule.
- cell free assays can be conducted in a liquid phase.
- the reaction products are separated from unreacted components, by any of a number of standard techniques, including but not limited to: differential centrifugation (see, for example, Rivas, G., and Minton, A.P., (1993) Trends Biochem Sci 18:284-7); chromatography (gel filtration chromatography, ion-exchange chromatography); electrophoresis (see, e.g., Ausubel, F. et al, eds. Current Protocols in Molecular Biology 1999, J. Wiley: New York.); and immunoprecipitation (see, for example, Ausubel, F. et al, eds. (1999) Current Protocols in Molecular Biology, J. Wiley: New York).
- Such resins and chromatographic techniques are known to one skilled in the art (see, e.g., Heegaard, N.H., (1998) J Mol Recognit 11: 141-8;
- fluorescence energy transfer may also be conveniently utilized, as described herein, to detect binding without further purification of the complex from solution.
- the assay includes contacting the SIRTl protein or biologically active portion thereof with a known compound which binds a SIRTl to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with a SIRTl protein, wherein determining the ability of the test compound to interact with the SIRTl protein includes determining the ability of the test compound to preferentially bind to the SIRTl or biologically active portion thereof, or to modulate the activity of a target molecule, as compared to the known compound.
- An exemplary assay method includes a 1536 well format of the SirTl enzymatic assay that is based on the commercial "Fluor-de-Lys" assay principle by Biomol, which is fluorogenic (www.biomol.com/store/Product_Data_PDFs/ak500.pdf).
- deacetylation of the e- amino function of a lysyl residue is coupled to a fluorogenic "development step that is dependent on the unblocked e-amino functionality and generates fluorescent aminomethylcoumarin.
- Fluorescence can be read on a commercial macroscopic reader.
- a compound or library of compounds described herein can also be evaluated using model systems for a disease or disorder, or other known models of a disease or disorder described herein.
- Structure-Activity Relationships and Structure-Based Design It is also possible to use structure-activity relationships (SAR) and structure-based design principles to produce a compound that interact with a sirtuin, e.g., antagonizes or agonizes a sirtuin.
- SARs provide information about the activity of related compounds in at least one relevant assay. Correlations are made between structural features of a compound of interest and an activity.
- Structure-based design can include determining a structural model of the physical interaction of a functional domain of a sirtuin and a compound. The structural model can indicate how the compound can be engineered, e.g., to improve interaction or reduce unfavorable interactions.
- the compound's interaction with the sirtuin can be identified, e.g., by solution of a crystal structure, NMR, or computer-based modeling, e.g., docking methods. See, e.g., Ewing et al. J Comput Aided Mol Des. 2001 May;15(5):411-28. Both the SAR and the structure-based design approach, as well as other methods, can be used to identify a pharmacophore.
- a pharmacophore is defined as a distinct three dimensional (3D) arrangement of chemical groups. The selection of such groups may be favorable for biological activity.
- each active compound must contain a distinct arrangement of chemical groups which enable this interaction to occur.
- the chemical groups commonly termed descriptor centers, can be represented by (a) an atom or group of atoms; (b) pseudo-atoms, for example a center of a ring, or the center of mass of a molecule; (c) vectors, for example atomic pairs, electron lone pair directions, or the normal to a plane.
- a pharmacophore can be used to search a database of chemical compound, e.g., for those having a structure compatible with the pharmacophore. See, for example, U.S. 6,343,257 ; Y. C. Martin, 3D Database Searching in Drug Design, J. Med. Chem. 35, 2145(1992); and A. C. Good and J. S. Mason, Three Dimensional Structure Database Searches, Reviews in Comp. Chem. 7, 67(1996). Database search queries are based not only on chemical property information but also on precise geometric information. Computer-based approaches can use database searching to find matching templates; Y. C. Martin, Database searching in drug design, J. Medicinal Chemistry, vol.
- Software for these searches can be used to analyze databases of potential drug compounds indexed by their significant chemical and geometric structure (e.g., the Standard Drugs File (Derwent Publications Ltd., London, England), the Bielstein database (Bielstein Information, Frankfurt, Germany or Chicago), and the Chemical Registry database (CAS, Columbus, Ohio)).
- a compound that matches the pharmocophore it can be tested for activity in vitro, in vivo, or in silico, e.g., for binding to a sirtuin or domain thereof.
- a compound that is an agonist or a candidate agonist e.g., a compound described in Nature.
- 2003 Sep 11;425(6954):191-196 can be modified to identify an antagonist, e.g., using the method described herein.
- a library of related compounds can be prepared and the library can be screened in an assay described herein.
- Pharmaceutically acceptable salts of the compounds of this invention include those derived from pharmaceutically acceptable inorganic and organic acids and bases.
- Suitable acid salts include acetate, adipate, alginate, aspartate, benzoate, benzenesulfonate, bisulfate, butyrate, citrate, camphorate, camphorsulfonate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptanoate, glycolate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, 2-hydroxyethanesulfonate, lactate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, palmoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, salicylate, succinate, sulfate, tartrate, thiocyanate
- Salts derived from appropriate bases include alkali metal (e.g., sodium), alkaline earth metal (e.g., magnesium), ammonium and N-(alkyl) 4 salts.
- alkali metal e.g., sodium
- alkaline earth metal e.g., magnesium
- ammonium e.g., ammonium
- N-(alkyl) 4 salts e.g., ammonium
- This invention also envisions the quatemization of any basic nitrogen-containing groups of the compounds disclosed herein. Water or oil-soluble or dispersible products may be obtained by such quatemization.
- Salt forms of the compounds of any of the formulae herein can be amino acid salts of carboxy groups (e.g. L-arginine, -lysine, -histidine salts).
- the compounds of the formulae described herein can, for example, be administered by injection, intravenously, intraarterially, subdermally, intraperitoneally, intramuscularly, or subcutaneously; or orally, buccally, nasally, transmucosally, topically, in an ophthalmic preparation, or by inhalation, with a dosage ranging from about 0.5 to about 100 mg/kg of body weight, alternatively dosages between 1 mg and 1000 mg/dose, every 4 to 120 hours, or according to the requirements of the particular drug.
- the methods herein contemplate administration of an effective amount of compound or compound composition to achieve the desired or stated effect.
- the pharmaceutical compositions of this invention will be administered from about 1 to about 6 times per day or alternatively, as a continuous infusion.
- Such administration can be used as a chronic or acute therapy.
- the amount of active ingredient that may be combined with the carrier materials to produce a single dosage form will vary depending upon the host treated and the particular mode of administration.
- a typical preparation will contain from about 5% to about 95% active compound (w/w).
- such preparations contain from about 20% to about 80% active compound.
- the compounds can be administered alone, or in combination with on or more additional therapeutic agents, e.g., a protease inhibitor, e.g., a H1N protease inhibitor, a fusion inhibitor, an integrase inhibitor, or a reverse transcriptase inhibitor, (e.g., a nucleotide analog, e.g., AZT, or a non-nucleoside reverse transcriptase inhibitor).
- a protease inhibitor e.g., a H1N protease inhibitor, a fusion inhibitor, an integrase inhibitor, or a reverse transcriptase inhibitor, (e.g., a nucleotide analog, e.g., AZT, or a non-nucleoside reverse transcriptase inhibitor).
- a reverse transcriptase inhibitor e.g., a nucleotide analog, e.g., AZT, or a non-nucleoside reverse transcript
- the compound and agent (or agents) can be administered at the same time, or at different times. In some instances, the compound and agent (or agents) have the same course of therapy, and in other times, the courses are either skewed or sequential. Lower or higher doses than those recited above may be required. Specific dosage and treatment regimens for any particular patient will depend upon a variety of factors, including the activity of the specific compound employed, the age, body weight, general health status, sex, diet, time of administration, rate of excretion, drug combination, the severity and course of the disease, condition or symptoms, the patient's disposition to the disease, condition or symptoms, and the j udgment of the treating physician.
- a maintenance dose of a compound, composition or combination of this invention may be administered, if necessary. Subsequently, the dosage or frequency of administration, or both, may be reduced, as a function of the symptoms, to a level at which the improved condition is retained when the symptoms have been alleviated to the desired level. Patients may, however, require intermittent treatment on a long- term basis upon any recurrence of disease symptoms.
- the compositions delineated herein include the compounds of the formulae delineated herein, as well as additional therapeutic agents if present, in amounts effective for achieving a modulation of disease or disease symptoms, including those described herein.
- pharmaceutically acceptable carrier or adjuvant refers to a carrier or adjuvant that may be administered to a patient, together with a compound of this invention, and which does not destroy the pharmacological activity thereof and is nontoxic when administered in doses sufficient to deliver a therapeutic amount of the compound.
- Pharmaceutically acceptable carriers, adjuvants and vehicles that may be used in the pharmaceutical compositions of this invention include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, self-emulsifying drug delivery systems (SEDDS) such as d- ⁇ -tocopherol polyethyleneglycol 1000 succinate, surfactants used in pharmaceutical dosage forms such as Tweens or other similar polymeric delivery matrices, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene
- Cyclodextrins such as ⁇ -, ⁇ -, and ⁇ -cyclodextrin, or chemically modified derivatives such as hydroxyalkylcyclodextrins, including 2- and 3-hydroxypropyl- ⁇ -cyclodextrins, or other solubilized derivatives may also be advantageously used to enhance delivery of compounds of the formulae described herein.
- the pharmaceutical compositions of this invention may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir, preferably by oral administration or administration by injection.
- the pharmaceutical compositions of this invention may contain any conventional non-toxic pharmaceutically-acceptable carriers, adjuvants or vehicles.
- the pH of the formulation may be adjusted with pharmaceutically acceptable acids, bases or buffers to enhance the stability of the formulated compound or its delivery form.
- parenteral as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrastemal, intrathecal, intralesional and intracranial injection or infusion techniques.
- the pharmaceutical compositions may be in the form of a sterile injectable preparation, for example, as a sterile injectable aqueous or oleaginous suspension. This suspension may be formulated according to techniques known in the art using suitable dispersing or wetting agents
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non- toxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol.
- a non- toxic parenterally acceptable diluent or solvent for example, as a solution in 1,3-butanediol.
- acceptable vehicles and solvents that may be employed are mannitol, water, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this pu ⁇ ose, any bland fixed oil may be employed including synthetic mono- or diglycerides.
- Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
- These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, or carboxymethyl cellulose or similar dispersing agents which are commonly used in the formulation of pharmaceutically acceptable dosage forms such as emulsions and or suspensions.
- Other commonly used surfactants such as Tweens or Spans and/or other similar emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the pu ⁇ oses of formulation.
- compositions of this invention may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, emulsions and aqueous suspensions, dispersions and solutions.
- carriers which are commonly used include lactose and com starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried com starch.
- aqueous suspensions and/or emulsions are administered orally, the active ingredient may be suspended or dissolved in an oily phase is combined with emulsifying and/or suspending agents. If desired, certain sweetening and/or flavoring and/or coloring agents may be added.
- compositions of this invention may also be administered in the form of suppositories for rectal administration.
- These compositions can be prepared by mixing a compound of this invention with a suitable non-irritating excipient which is solid at room temperature but liquid at the rectal temperature and therefore will melt in the rectum to release the active components.
- suitable non-irritating excipient include, but are not limited to, cocoa butter, beeswax and polyethylene glycols.
- Topical administration of the pharmaceutical compositions of this invention is useful when the desired treatment involves areas or organs readily accessible by topical application.
- the pharmaceutical composition should be formulated with a suitable ointment containing the active components suspended or dissolved in a carrier.
- Carriers for topical administration of the compounds of this invention include, but are not limited to, mineral oil, liquid petroleum, white petroleum, propylene glycol, polyoxyethylene polyoxypropylene compound, emulsifying wax and water.
- the pharmaceutical composition can be formulated with a suitable lotion or cream containing the active compound suspended or dissolved in a carrier with suitable emulsifying agents.
- suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- the pharmaceutical compositions of this invention may also be topically applied to the lower intestinal tract by rectal suppository formulation or in a suitable enema formulation.
- compositions of this invention may be administered by nasal aerosol or inhalation.
- Such compositions are prepared according to techniques well-known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, abso ⁇ tion promoters to enhance bioavailability, fluorocarbons, and/or other solubilizing or dispersing agents known in the art.
- a composition having the compound of the formulae herein and an additional agent e.g., a therapeutic agent
- implantable devices and related technology are known in the art and are useful as delivery systems where a continuous, or timed-release delivery of compounds or compositions delineated herein is desired.
- the implantable device delivery system is useful for targeting specific points of compound or composition delivery (e.g., localized sites, organs). Negrin et al., Biomaterials, 22(6):563 (2001). Timed-release technology involving alternate delivery methods can also be used in this invention. For example, timed-release formulations based on polymer technologies, sustained- release techniques and encapsulation techniques (e.g., polymeric, liposomal) can also be used for delivery of the compounds and compositions delineated herein. Also within the invention is a patch to deliver active chemotherapeutic combinations herein.
- a patch includes a material layer (e.g., polymeric, cloth, gauze, bandage) and the compound of the formulae herein as delineated herein.
- the patch can additionally include an adhesive to hold the patch in place on a subject.
- An adhesive is a composition, including those of either natural or synthetic origin, that when contacted with the skin of a subject, temporarily adheres to the skin. It can be water resistant. The adhesive can be placed on the patch to hold it in contact with the skin of the subject for an extended period of time.
- the adhesive can be made of a tackiness, or adhesive strength, such that it holds the device in place subject to incidental contact, however, upon an affirmative act (e.g., ripping, peeling, or other intentional removal) the adhesive gives way to the external pressure placed on the device or the adhesive itself, and allows for breaking of the adhesion contact.
- the adhesive can be pressure sensitive, that is, it can allow for positioning of the adhesive (and the device to be adhered to the skin) against the skin by the application of pressure (e.g., pushing, rubbing,) on the adhesive or device.
- compositions of this invention comprise a combination of a compound of the formulae described herein and one or more additional therapeutic or prophylactic agents
- both the compound and the additional agent should be present at dosage levels of between about 1 to 100%, and more preferably between about 5 to 95% of the dosage normally administered in a monotherapy regimen.
- the additional agents may be administered separately, as part of a multiple dose regimen, from the compounds of this invention. Alternatively, those agents may be part of a single dosage form, mixed together with the compounds of this invention in a single composition.
- the compounds of the invention can be used in the treatment of a viral disease or disorder
- the disease or disorder can be a retroviral disorder, e.g., an HlV-mediated disorder such as AIDS because SIRTl deacetylates the HIV Tat protein and is required for Tat- mediated Transactivation of the HIV Promoter.
- the compounds of the invention can also be used to treat a Tat-mediated or Tat-related disorder.
- a compound described herein can be formulated with one or more other anti-viral agents.
- the compound is administered in conjunction with (e.g., concurrently with) one or more anti-viral agents, e.g., as separate formulations.
- anti-viral agents include drugs for treating AIDS such as: oSmithKline, L- 756,423 by Merck, MOZENAVIR (DMP-450) by Triangle Pharmaceuticals, TIPRANAVIR® by Boehringer Ingelheim and TMC114 by Tibotec Virco.
- the invention includes, inter alia, methods for modulating activity of a virus.
- the compounds of the invention can be used to modulate the acetylation state of a viral factor.
- HIV tat An exemplary viral factor that is a substrate for sirtuins is HIV tat
- An exemplary amino acid sequence of HIV-1 tat is as follows: MEPVDPNLEPWNHPGSQPTTACSNCYCKVCCWHCQLCFMTKGLSISYGRKKRK RRRGTPHGSEDHQNLISKQPSSQPRGDPTGPKEQKKKVESKAEADPFD (SEQ ID NO:8) MGIPLQEQENSLEFSSERSSSTSEEGANTRGLDNQGEEILSQLYRPLEACRNKCYC KKCCYHCQLCFLKKGLGICYDHSI ⁇ KRSSKJIAXVTAPTASNDLSTRARDGQPAKKQKKE VETTRTTDPGLGRSDTSTS (SEQ ID NO:9).
- Kits A compound described herein described herein can be provided in a kit.
- the kit includes (a) a compound described herein, e.g., a composition that includes a compound described herein, and, optionally (b) informational material.
- the informational material can be descriptive, instructional, marketing or other material that relates to the methods described herein and/or the use of a compound described herein for the methods described herein.
- the informational material of the kits is not limited in its form.
- the informational material can include information about production of the compound, molecular weight of the compound, concentration, date of expiration, batch or production site information, and so forth.
- the informational material relates to methods for administering the compound.
- the informational material can include instructions to administer a compound described herein in a suitable manner to perform the methods described herein, e.g., in a suitable dose, dosage form, or mode of administration (e.g., a dose, dosage form, or mode of administration described herein).
- the informational material can include instructions to administer a compound described herein to a suitable subject, e.g., a human, e.g., a human having or at risk for a disorder described herein.
- the informational material of the kits is not limited in its form.
- the informational material e.g., instructions
- the informational material is provided in printed matter, e.g., a printed text, drawing, and/or photograph, e.g., a label or printed sheet.
- the informational material can also be provided in other formats, such as Braille, computer readable material, video recording, or audio recording.
- the informational material of the kit is contact information, e.g., a physical address, email address, website, or telephone number, where a user of the kit can obtain substantive information about a compound described herein and/or its use in the methods described herein.
- the informational material can also be provided in any combination of formats.
- the composition of the kit can include other ingredients, such as a solvent or buffer, a stabilizer, a preservative, a flavoring agent (e.g., a bitter antagonist or a sweetener), a fragrance or other cosmetic ingredient, and/or a second agent for treating a condition or disorder described herein.
- the other ingredients can be included in the kit, but in different compositions or containers than a compound described herein.
- the kit can include instructions for admixing a compound described herein and the other ingredients, or for using a compound described herein together with the other ingredients.
- a compound described herein can be provided in any form, e.g., liquid, dried or lyophilized form.
- a compound described herein be substantially pure and/or sterile.
- the liquid solution preferably is an aqueous solution, with a sterile aqueous solution being preferred.
- a compound described herein is provided as a dried form, reconstitution generally is by the addition of a suitable solvent.
- the solvent e.g., sterile water or buffer, can optionally be provided in the kit.
- the kit can include one or more containers for the composition containing a compound described herein. In some embodiments, the kit contains separate containers, dividers or compartments for the composition and informational material.
- the composition can be contained in a bottle, vial, or syringe, and the informational material can be contained in a plastic sleeve or packet.
- the separate elements of the kit are contained within a single, undivided container.
- the composition is contained in a bottle, vial or syringe that has attached thereto the informational material in the form of a label.
- the kit includes a plurality (e.g., a pack) of individual containers, each containing one or more unit dosage forms (e.g., a dosage form described herein) of a compound described herein.
- the kit includes a plurality of syringes, ampules, foil packets, or blister packs, each containing a single unit dose of a compound described herein.
- the containers of the kits can be air tight, wate ⁇ r ⁇ of (e.g., impermeable to changes in moisture or evaporation), and/or light-tight.
- the kit optionally includes a device suitable for administration of the composition, e.g., a syringe, inhalant, pipette, forceps, measured spoon, dropper (e.g., eye dropper), swab (e.g., a cotton swab or wooden swab), or any such delivery device.
- the device is a medical implant device, e.g., packaged for surgical insertion.
- a medical implant device e.g., packaged for surgical insertion.
- the fact that a patient has been treated with a molecule of the invention, or the patient's response to treatment with a molecule of the invention, can be used, alone or in combination with other information, e.g., other information about the patient, to determine whether to authorize or transfer of funds to pay for a service or treatment provided to a subject.
- an entity e.g., a hospital, care giver, government entity, or an insurance company or other entity which pays for, or reimburses medical expenses, can use such information to determine whether a party, e.g., a party other than the subject patient, will pay for services or treatment provided to the patient.
- a first entity e.g., an insurance company
- a first entity e.g., an insurance company
- the invention also features a database that associates information about or identifying one or more of the compounds described herein with a parameter about a patient, e.g., a patient being treated with a disorder herein.
- the parameter can be a general parameter, e.g., blood pressure, core body temperature, etc. , or a parameter related to a viral disease or disorder, e.g., as described herein, e.g., e.g., viral load or white blood cell count.
- Disposable Source Catalog Number 1 384 white low volume Greiner / Bellco 4507-84075 plates 2 Tips for matrix 16 chan Apogent Discoveries 7421 pipet 3 25ml divided reagent Apogent Discoveries 8095 reservoirs 4 Plate Sealing Films Apogent Discoveries 4418
- Standard Reagent Formulations Prepared Component M.W. Component Final Sto ⁇ Reagent Name Name Quantity Component (in water) Concentratio ⁇ 1 Tris-HCl, pH 8.0 Trizma-HCI 157.6 157.6 g / L 1 M RT HCI to pH 8.0 pH ⁇ .O 2 Sodium Chloride NaCI 58.44 292 g / L 5M RT 3 Magnesium MgCI 2 203.3 20.33 g / L 100mM RT Chloride 4 Potassium KCI 74.55 20.13 g / L 270mM RT Chloride 5 Polyoxyethylene Tween-20 1ml / 10ml 10% RT sorbitan monolaurate 6 NAD NAD 717 0.0717g / ml 100mM -20C 7 Nicotinamide Nicotinamide 122 0.0061g / ml 50mM -20C
- Step Description 1 Prepare amount of 2x Substrates necessary for the number of wells to be assayed.
- Appendix 1 Preparation of a standard curve using Fluor de Lys deactylated standard 1 Determine the concentration range of deactylated standard to use in conjunction with the above assay by making a 1uM dilution of the standard. Mix 10ul of the 1 uM dilution with 10ul developer and read at the same wavelengths and sensitivity settings that the assay is read at. Use this estimate of AFU (arbitrary fluorescence units )/uM to determine the range of concentrations to test in the standard curve.
- AFU arbitrary fluorescence units
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Virology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Molecular Biology (AREA)
- Tropical Medicine & Parasitology (AREA)
- AIDS & HIV (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Nitrogen And Oxygen As The Only Ring Hetero Atoms (AREA)
- Plural Heterocyclic Compounds (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Oxygen Or Sulfur (AREA)
- Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
- Indole Compounds (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2006551523A JP2007529422A (ja) | 2004-01-29 | 2005-01-31 | 抗ウイルス治療 |
| EP05712361A EP1715855A4 (en) | 2004-01-29 | 2005-01-31 | ANTIVIRAL DRUGS |
| CA002553670A CA2553670A1 (en) | 2004-01-29 | 2005-01-31 | Anti-viral therapeutics |
| AU2005208938A AU2005208938A1 (en) | 2004-01-29 | 2005-01-31 | Anti-viral therapeutics |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US54044404P | 2004-01-29 | 2004-01-29 | |
| US60/540,444 | 2004-01-29 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2005072412A2 true WO2005072412A2 (en) | 2005-08-11 |
| WO2005072412A3 WO2005072412A3 (en) | 2007-03-22 |
Family
ID=34826219
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2005/002897 Ceased WO2005072412A2 (en) | 2004-01-29 | 2005-01-31 | Anti-viral therapeutics |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20060019952A1 (enExample) |
| EP (1) | EP1715855A4 (enExample) |
| JP (1) | JP2007529422A (enExample) |
| AU (1) | AU2005208938A1 (enExample) |
| CA (1) | CA2553670A1 (enExample) |
| WO (1) | WO2005072412A2 (enExample) |
Cited By (50)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005090320A3 (en) * | 2004-03-12 | 2006-04-27 | Wyeth Corp | Triazole derivatives and method of using the same to treat hiv infections |
| WO2006026619A3 (en) * | 2004-08-30 | 2006-05-04 | Us Health | Inhibition of viruses using rnase h inhibitors |
| EP1694323A4 (en) * | 2003-12-19 | 2009-05-13 | Elixir Pharmaceuticals Inc | METHOD FOR TREATING A DISEASE |
| US7598248B2 (en) | 2006-08-02 | 2009-10-06 | Cytokinetics, Inc. | Certain 1H-imidazo[4,5-b]pyrazin-2(3H)-ones and 1H-imidazo[4,5-b]pyrazin-2-ols, compositions thereof, and methods for their use |
| US7838517B2 (en) | 2006-11-15 | 2010-11-23 | Vertex Pharmaceuticals Incorporated | Compounds useful as protein kinase inhibitors |
| US7851484B2 (en) | 2007-03-30 | 2010-12-14 | Cytokinetics, Inc. | Certain chemical entities, compositions, and methods |
| US8227603B2 (en) | 2006-08-01 | 2012-07-24 | Cytokinetics, Inc. | Modulating skeletal muscle |
| US8299248B2 (en) | 2006-08-02 | 2012-10-30 | Cytokinetics, Incorporated | Certain 1H-imidazo[4,5-b]pyrazin-2(3H)-ones and 1H-imidazo[4,5-b]pyrazin-2-ols and methods for their use |
| US8324239B2 (en) | 2010-04-21 | 2012-12-04 | Novartis Ag | Furopyridine compounds and uses thereof |
| US8569331B2 (en) | 2010-11-01 | 2013-10-29 | Arqule, Inc. | Substituted benzo[f]lmidazo[1,2-d]pyrido[2,3-b][1,4]diazepine compounds |
| US9351954B2 (en) | 2009-12-04 | 2016-05-31 | Sunovion Pharmaceuticals Inc. | Multicyclic compounds and methods of use thereof |
| US9586880B2 (en) | 2008-12-23 | 2017-03-07 | President And Fellows Of Harvard College | Small molecule inhibitors of necroptosis |
| US9611267B2 (en) | 2012-06-13 | 2017-04-04 | Incyte Holdings Corporation | Substituted tricyclic compounds as FGFR inhibitors |
| US9708318B2 (en) | 2015-02-20 | 2017-07-18 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US9725452B2 (en) | 2013-03-15 | 2017-08-08 | Presidents And Fellows Of Harvard College | Substituted indoles and pyrroles as RIP kinase inhibitors |
| US9745311B2 (en) | 2012-08-10 | 2017-08-29 | Incyte Corporation | Substituted pyrrolo[2,3-b]pyrazines as FGFR inhibitors |
| US9801889B2 (en) | 2015-02-20 | 2017-10-31 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US9890156B2 (en) | 2015-02-20 | 2018-02-13 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US10040790B2 (en) | 2013-04-19 | 2018-08-07 | Incyte Holdings Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US10196403B2 (en) | 2016-07-29 | 2019-02-05 | Sunovion Pharmaceuticals Inc. | Compounds and compositions and uses thereof |
| US10213427B2 (en) | 2010-12-22 | 2019-02-26 | Incyte Corporation | Substituted imidazopyridazines and benzimidazoles as inhibitors of FGFR3 |
| US10272082B2 (en) | 2011-07-13 | 2019-04-30 | Cytokinetics, Inc. | Combination ALS therapy |
| US10611762B2 (en) | 2017-05-26 | 2020-04-07 | Incyte Corporation | Crystalline forms of a FGFR inhibitor and processes for preparing the same |
| US10780074B2 (en) | 2017-08-02 | 2020-09-22 | Sunovion Pharmaceuticals Inc. | Compounds and uses thereof |
| US10815249B2 (en) | 2018-02-16 | 2020-10-27 | Sunovion Pharmaceuticals Inc. | Salts, crystal forms, and production methods thereof |
| US10851105B2 (en) | 2014-10-22 | 2020-12-01 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US11077090B2 (en) | 2016-07-29 | 2021-08-03 | Sunovion Pharmaceuticals Inc. | Compounds and compositions and uses thereof |
| US11129807B2 (en) | 2017-02-16 | 2021-09-28 | Sunovion Pharmaceuticals Inc. | Methods of treating schizophrenia |
| US11136304B2 (en) | 2019-03-14 | 2021-10-05 | Sunovion Pharmaceuticals Inc. | Salts of a heterocyclic compound and crystalline forms, processes for preparing, therapeutic uses, and pharmaceutical compositions thereof |
| US11174257B2 (en) | 2018-05-04 | 2021-11-16 | Incyte Corporation | Salts of an FGFR inhibitor |
| US11407750B2 (en) | 2019-12-04 | 2022-08-09 | Incyte Corporation | Derivatives of an FGFR inhibitor |
| US11466004B2 (en) | 2018-05-04 | 2022-10-11 | Incyte Corporation | Solid forms of an FGFR inhibitor and processes for preparing the same |
| US11607416B2 (en) | 2019-10-14 | 2023-03-21 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US11628162B2 (en) | 2019-03-08 | 2023-04-18 | Incyte Corporation | Methods of treating cancer with an FGFR inhibitor |
| US11661422B2 (en) | 2020-08-27 | 2023-05-30 | Incyte Corporation | Tricyclic urea compounds as JAK2 V617F inhibitors |
| US11691971B2 (en) | 2020-06-19 | 2023-07-04 | Incyte Corporation | Naphthyridinone compounds as JAK2 V617F inhibitors |
| US11738002B2 (en) | 2020-04-14 | 2023-08-29 | Sunovion Pharmaceuticals Inc. | Methods of treating neurological and psychiatric disorders |
| US11753413B2 (en) | 2020-06-19 | 2023-09-12 | Incyte Corporation | Substituted pyrrolo[2,1-f][1,2,4]triazine compounds as JAK2 V617F inhibitors |
| US11767323B2 (en) | 2020-07-02 | 2023-09-26 | Incyte Corporation | Tricyclic pyridone compounds as JAK2 V617F inhibitors |
| US11780840B2 (en) | 2020-07-02 | 2023-10-10 | Incyte Corporation | Tricyclic urea compounds as JAK2 V617F inhibitors |
| CN116919949A (zh) * | 2023-08-31 | 2023-10-24 | 中国医学科学院医药生物技术研究所 | 2-氨基-5-苯基噻吩-3-羧酸酰胺在制备抗新型冠状病毒药物中的应用 |
| US11897891B2 (en) | 2019-12-04 | 2024-02-13 | Incyte Corporation | Tricyclic heterocycles as FGFR inhibitors |
| US11919908B2 (en) | 2020-12-21 | 2024-03-05 | Incyte Corporation | Substituted pyrrolo[2,3-d]pyrimidine compounds as JAK2 V617F inhibitors |
| US11939331B2 (en) | 2021-06-09 | 2024-03-26 | Incyte Corporation | Tricyclic heterocycles as FGFR inhibitors |
| US11958861B2 (en) | 2021-02-25 | 2024-04-16 | Incyte Corporation | Spirocyclic lactams as JAK2 V617F inhibitors |
| US12012409B2 (en) | 2020-01-15 | 2024-06-18 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US12065494B2 (en) | 2021-04-12 | 2024-08-20 | Incyte Corporation | Combination therapy comprising an FGFR inhibitor and a Nectin-4 targeting agent |
| US12084430B2 (en) | 2022-03-17 | 2024-09-10 | Incyte Corporation | Tricyclic urea compounds as JAK2 V617F inhibitors |
| US12122767B2 (en) | 2019-10-01 | 2024-10-22 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US12428420B2 (en) | 2021-06-09 | 2025-09-30 | Incyte Corporation | Tricyclic heterocycles as FGFR inhibitors |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7649098B2 (en) * | 2006-02-24 | 2010-01-19 | Lexicon Pharmaceuticals, Inc. | Imidazole-based compounds, compositions comprising them and methods of their use |
| TW200920355A (en) * | 2007-09-06 | 2009-05-16 | Lexicon Pharmaceuticals Inc | Compositions and methods for treating immunological and inflammatory diseases and disorders |
| EP2240481A1 (en) | 2008-01-11 | 2010-10-20 | Albany Molecular Research, Inc. | (1-azinone) -substituted pyridoindoles as mch antagonists |
| US7998976B2 (en) * | 2008-02-04 | 2011-08-16 | Cytokinetics, Inc. | Certain chemical entities, compositions and methods |
| JP2011510985A (ja) * | 2008-02-04 | 2011-04-07 | サイトキネティックス, インコーポレイテッド | 特定の化学的実体、組成物および方法 |
| US8629158B2 (en) * | 2009-07-01 | 2014-01-14 | Albany Molecular Research, Inc. | Azabicycloalkane-indole and azabicycloalkane-pyrrolo-pyridine MCH-1 antagonists, methods of making, and use thereof |
| WO2011003005A1 (en) * | 2009-07-01 | 2011-01-06 | Albany Molecular Research, Inc. | Azinone-substituted azepino[b]indole and pyrido-pyrrolo-azepine mch-1 antagonists, methods of making, and use thereof |
| WO2011003012A1 (en) * | 2009-07-01 | 2011-01-06 | Albany Molecular Research, Inc. | Azinone-substituted azapolycycle mch-1 antagonists, methods of making, and use thereof |
| WO2011003021A1 (en) * | 2009-07-01 | 2011-01-06 | Albany Molecular Research, Inc. | Azinone-substituted azabicycloalkane-indole and azabicycloalkane-pyrrolo-pyridine mch-1 antagonists, methods of making, and use thereof |
| SG176983A1 (en) | 2009-07-08 | 2012-02-28 | Dermira Canada Inc | Tofa analogs useful in treating dermatological disorders or conditions |
| WO2012088038A2 (en) | 2010-12-21 | 2012-06-28 | Albany Molecular Research, Inc. | Piperazinone-substituted tetrahydro-carboline mch-1 antagonists, methods of making, and uses thereof |
| WO2012088124A2 (en) | 2010-12-21 | 2012-06-28 | Albany Molecular Research, Inc. | Tetrahydro-azacarboline mch-1 antagonists, methods of making, and uses thereof |
| US9266892B2 (en) | 2012-12-19 | 2016-02-23 | Incyte Holdings Corporation | Fused pyrazoles as FGFR inhibitors |
| JP2018529714A (ja) * | 2015-09-30 | 2018-10-11 | ギリアード サイエンシーズ, インコーポレイテッド | Hivの処置のための化合物および組合せ物 |
| US11591329B2 (en) | 2019-07-09 | 2023-02-28 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US11566028B2 (en) | 2019-10-16 | 2023-01-31 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5308612A (en) * | 1992-08-12 | 1994-05-03 | Blue Marble Research, Inc. | Uses of polystyrenesulfonate and related compounds as inhibitors of transactivating transcription factor (TAT) and as therapeutics for HIV infection and AIDS |
| US6335358B1 (en) * | 1995-04-12 | 2002-01-01 | President And Fellows Of Harvard College | Lactacystin analogs |
| AU6339198A (en) * | 1997-02-26 | 1998-09-18 | Ciblex Corporation | Inhibitors of leaderless protein export |
| US6262055B1 (en) * | 1998-06-03 | 2001-07-17 | Merck & Co., Inc. | HIV integrase inhibitors |
| US6620841B1 (en) * | 1998-12-25 | 2003-09-16 | Shionogi & Co., Ltd. | Aromatic heterocycle compounds having HIV integrase inhibiting activities |
| US20040005574A1 (en) * | 2002-07-08 | 2004-01-08 | Leonard Guarente | SIR2 activity |
| CA2465978C (en) * | 2001-09-14 | 2015-04-07 | Soon Hyung Woo | Inhibitors of histone deacetylase |
| US7351542B2 (en) * | 2002-05-20 | 2008-04-01 | The Regents Of The University Of California | Methods of modulating tubulin deacetylase activity |
-
2005
- 2005-01-31 EP EP05712361A patent/EP1715855A4/en not_active Withdrawn
- 2005-01-31 JP JP2006551523A patent/JP2007529422A/ja not_active Withdrawn
- 2005-01-31 AU AU2005208938A patent/AU2005208938A1/en not_active Abandoned
- 2005-01-31 WO PCT/US2005/002897 patent/WO2005072412A2/en not_active Ceased
- 2005-01-31 US US11/048,490 patent/US20060019952A1/en not_active Abandoned
- 2005-01-31 CA CA002553670A patent/CA2553670A1/en not_active Abandoned
Non-Patent Citations (1)
| Title |
|---|
| See references of EP1715855A4 * |
Cited By (85)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1694323A4 (en) * | 2003-12-19 | 2009-05-13 | Elixir Pharmaceuticals Inc | METHOD FOR TREATING A DISEASE |
| US7563905B2 (en) | 2004-03-12 | 2009-07-21 | Wyeth | Triazole derivatives and method of using the same to treat HIV infections |
| WO2005090320A3 (en) * | 2004-03-12 | 2006-04-27 | Wyeth Corp | Triazole derivatives and method of using the same to treat hiv infections |
| WO2006026619A3 (en) * | 2004-08-30 | 2006-05-04 | Us Health | Inhibition of viruses using rnase h inhibitors |
| US8227603B2 (en) | 2006-08-01 | 2012-07-24 | Cytokinetics, Inc. | Modulating skeletal muscle |
| US8293761B2 (en) | 2006-08-02 | 2012-10-23 | Cytokinetics, Inc. | Certain chemical entities, compositions and methods |
| US7956056B2 (en) | 2006-08-02 | 2011-06-07 | Cytokinetics, Inc. | Certain 1H-imidazo[4,5-B]pyrazin-2(3H)-ones and 1H-imidazo[4,5-B]pyrazin-2-ols, compositions thereof, and methods for their use |
| US8716291B2 (en) | 2006-08-02 | 2014-05-06 | Cytokinetics, Inc. | Certain 1H-imidazo[4,5-b]pyrazin-2(3H)-ones and 1H-imidazo[4,5-b]pyrazin-2-ols and methods for their use |
| US8299248B2 (en) | 2006-08-02 | 2012-10-30 | Cytokinetics, Incorporated | Certain 1H-imidazo[4,5-b]pyrazin-2(3H)-ones and 1H-imidazo[4,5-b]pyrazin-2-ols and methods for their use |
| US7598248B2 (en) | 2006-08-02 | 2009-10-06 | Cytokinetics, Inc. | Certain 1H-imidazo[4,5-b]pyrazin-2(3H)-ones and 1H-imidazo[4,5-b]pyrazin-2-ols, compositions thereof, and methods for their use |
| US10766899B2 (en) | 2006-08-02 | 2020-09-08 | Cytokinetics, Incorporated | Methods for preparing substituted imidazo[4,5-b]pyrazines |
| US7838517B2 (en) | 2006-11-15 | 2010-11-23 | Vertex Pharmaceuticals Incorporated | Compounds useful as protein kinase inhibitors |
| US8399458B2 (en) | 2006-11-15 | 2013-03-19 | Vertex Pharmaceuticals Incorporated | Compounds useful as protein kinase inhibitors |
| US7851484B2 (en) | 2007-03-30 | 2010-12-14 | Cytokinetics, Inc. | Certain chemical entities, compositions, and methods |
| US9586880B2 (en) | 2008-12-23 | 2017-03-07 | President And Fellows Of Harvard College | Small molecule inhibitors of necroptosis |
| US10894033B2 (en) | 2009-12-04 | 2021-01-19 | Sunovion Pharmaceuticals Inc. | Multicyclic compounds and methods of use thereof |
| US10085968B2 (en) | 2009-12-04 | 2018-10-02 | Sunovion Pharmaceuticals Inc. | Multicyclic compounds and methods of use thereof |
| US9351954B2 (en) | 2009-12-04 | 2016-05-31 | Sunovion Pharmaceuticals Inc. | Multicyclic compounds and methods of use thereof |
| US8324239B2 (en) | 2010-04-21 | 2012-12-04 | Novartis Ag | Furopyridine compounds and uses thereof |
| US8569331B2 (en) | 2010-11-01 | 2013-10-29 | Arqule, Inc. | Substituted benzo[f]lmidazo[1,2-d]pyrido[2,3-b][1,4]diazepine compounds |
| US10813930B2 (en) | 2010-12-22 | 2020-10-27 | Incyte Corporation | Substituted imidazopyridazines and benzimidazoles as inhibitors of FGFR3 |
| US10213427B2 (en) | 2010-12-22 | 2019-02-26 | Incyte Corporation | Substituted imidazopyridazines and benzimidazoles as inhibitors of FGFR3 |
| US10272082B2 (en) | 2011-07-13 | 2019-04-30 | Cytokinetics, Inc. | Combination ALS therapy |
| US11053246B2 (en) | 2012-06-13 | 2021-07-06 | Incyte Corporation | Substituted tricyclic compounds as FGFR inhibitors |
| US11840534B2 (en) | 2012-06-13 | 2023-12-12 | Incyte Corporation | Substituted tricyclic compounds as FGFR inhibitors |
| US10131667B2 (en) | 2012-06-13 | 2018-11-20 | Incyte Corporation | Substituted tricyclic compounds as FGFR inhibitors |
| US9611267B2 (en) | 2012-06-13 | 2017-04-04 | Incyte Holdings Corporation | Substituted tricyclic compounds as FGFR inhibitors |
| US9745311B2 (en) | 2012-08-10 | 2017-08-29 | Incyte Corporation | Substituted pyrrolo[2,3-b]pyrazines as FGFR inhibitors |
| US9725452B2 (en) | 2013-03-15 | 2017-08-08 | Presidents And Fellows Of Harvard College | Substituted indoles and pyrroles as RIP kinase inhibitors |
| US10947230B2 (en) | 2013-04-19 | 2021-03-16 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US10040790B2 (en) | 2013-04-19 | 2018-08-07 | Incyte Holdings Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US10450313B2 (en) | 2013-04-19 | 2019-10-22 | Incyte Holdings Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US11530214B2 (en) | 2013-04-19 | 2022-12-20 | Incyte Holdings Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US10851105B2 (en) | 2014-10-22 | 2020-12-01 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US9801889B2 (en) | 2015-02-20 | 2017-10-31 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US11014923B2 (en) | 2015-02-20 | 2021-05-25 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US10632126B2 (en) | 2015-02-20 | 2020-04-28 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US11667635B2 (en) | 2015-02-20 | 2023-06-06 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US9890156B2 (en) | 2015-02-20 | 2018-02-13 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US10738048B2 (en) | 2015-02-20 | 2020-08-11 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US10251892B2 (en) | 2015-02-20 | 2019-04-09 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US10214528B2 (en) | 2015-02-20 | 2019-02-26 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US9708318B2 (en) | 2015-02-20 | 2017-07-18 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US10016438B2 (en) | 2015-02-20 | 2018-07-10 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US11173162B2 (en) | 2015-02-20 | 2021-11-16 | Incyte Corporation | Bicyclic heterocycles as FGFR4 inhibitors |
| US10196403B2 (en) | 2016-07-29 | 2019-02-05 | Sunovion Pharmaceuticals Inc. | Compounds and compositions and uses thereof |
| US11077090B2 (en) | 2016-07-29 | 2021-08-03 | Sunovion Pharmaceuticals Inc. | Compounds and compositions and uses thereof |
| US10927124B2 (en) | 2016-07-29 | 2021-02-23 | Sunovion Pharmaceuticals Inc. | Compounds and compositions and uses thereof |
| US11958862B2 (en) | 2016-07-29 | 2024-04-16 | Sumitomo Pharma America, Inc. | Compounds and compositions and uses thereof |
| US11129807B2 (en) | 2017-02-16 | 2021-09-28 | Sunovion Pharmaceuticals Inc. | Methods of treating schizophrenia |
| US11472801B2 (en) | 2017-05-26 | 2022-10-18 | Incyte Corporation | Crystalline forms of a FGFR inhibitor and processes for preparing the same |
| US10611762B2 (en) | 2017-05-26 | 2020-04-07 | Incyte Corporation | Crystalline forms of a FGFR inhibitor and processes for preparing the same |
| US11491133B2 (en) | 2017-08-02 | 2022-11-08 | Sunovion Pharmaceuticals Inc. | Heteroaryl-isochroman compounds and uses thereof |
| US10780074B2 (en) | 2017-08-02 | 2020-09-22 | Sunovion Pharmaceuticals Inc. | Compounds and uses thereof |
| US11440921B2 (en) | 2018-02-16 | 2022-09-13 | Sunovion Pharmaceuticals Inc. | Salts, crystal forms, and production methods thereof |
| US11987591B2 (en) | 2018-02-16 | 2024-05-21 | Sumitomo Pharma America, Inc. | Salts, crystal forms, and production methods thereof |
| US10815249B2 (en) | 2018-02-16 | 2020-10-27 | Sunovion Pharmaceuticals Inc. | Salts, crystal forms, and production methods thereof |
| US11174257B2 (en) | 2018-05-04 | 2021-11-16 | Incyte Corporation | Salts of an FGFR inhibitor |
| US12024517B2 (en) | 2018-05-04 | 2024-07-02 | Incyte Corporation | Salts of an FGFR inhibitor |
| US11466004B2 (en) | 2018-05-04 | 2022-10-11 | Incyte Corporation | Solid forms of an FGFR inhibitor and processes for preparing the same |
| US12473286B2 (en) | 2018-05-04 | 2025-11-18 | Incyte Corporation | Salts of an FGFR inhibitor |
| US11628162B2 (en) | 2019-03-08 | 2023-04-18 | Incyte Corporation | Methods of treating cancer with an FGFR inhibitor |
| US11136304B2 (en) | 2019-03-14 | 2021-10-05 | Sunovion Pharmaceuticals Inc. | Salts of a heterocyclic compound and crystalline forms, processes for preparing, therapeutic uses, and pharmaceutical compositions thereof |
| US12122767B2 (en) | 2019-10-01 | 2024-10-22 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US11607416B2 (en) | 2019-10-14 | 2023-03-21 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US12083124B2 (en) | 2019-10-14 | 2024-09-10 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US11897891B2 (en) | 2019-12-04 | 2024-02-13 | Incyte Corporation | Tricyclic heterocycles as FGFR inhibitors |
| US11407750B2 (en) | 2019-12-04 | 2022-08-09 | Incyte Corporation | Derivatives of an FGFR inhibitor |
| US12168660B2 (en) | 2019-12-04 | 2024-12-17 | Incyte Corporation | Derivatives of an FGFR inhibitor |
| US12012409B2 (en) | 2020-01-15 | 2024-06-18 | Incyte Corporation | Bicyclic heterocycles as FGFR inhibitors |
| US11738002B2 (en) | 2020-04-14 | 2023-08-29 | Sunovion Pharmaceuticals Inc. | Methods of treating neurological and psychiatric disorders |
| US11691971B2 (en) | 2020-06-19 | 2023-07-04 | Incyte Corporation | Naphthyridinone compounds as JAK2 V617F inhibitors |
| US11753413B2 (en) | 2020-06-19 | 2023-09-12 | Incyte Corporation | Substituted pyrrolo[2,1-f][1,2,4]triazine compounds as JAK2 V617F inhibitors |
| US12187725B2 (en) | 2020-07-02 | 2025-01-07 | Incyte Corporation | Tricyclic urea compounds as JAK2 V617F inhibitors |
| US11780840B2 (en) | 2020-07-02 | 2023-10-10 | Incyte Corporation | Tricyclic urea compounds as JAK2 V617F inhibitors |
| US11767323B2 (en) | 2020-07-02 | 2023-09-26 | Incyte Corporation | Tricyclic pyridone compounds as JAK2 V617F inhibitors |
| US11661422B2 (en) | 2020-08-27 | 2023-05-30 | Incyte Corporation | Tricyclic urea compounds as JAK2 V617F inhibitors |
| US11919908B2 (en) | 2020-12-21 | 2024-03-05 | Incyte Corporation | Substituted pyrrolo[2,3-d]pyrimidine compounds as JAK2 V617F inhibitors |
| US11958861B2 (en) | 2021-02-25 | 2024-04-16 | Incyte Corporation | Spirocyclic lactams as JAK2 V617F inhibitors |
| US12065494B2 (en) | 2021-04-12 | 2024-08-20 | Incyte Corporation | Combination therapy comprising an FGFR inhibitor and a Nectin-4 targeting agent |
| US11939331B2 (en) | 2021-06-09 | 2024-03-26 | Incyte Corporation | Tricyclic heterocycles as FGFR inhibitors |
| US12428420B2 (en) | 2021-06-09 | 2025-09-30 | Incyte Corporation | Tricyclic heterocycles as FGFR inhibitors |
| US12084430B2 (en) | 2022-03-17 | 2024-09-10 | Incyte Corporation | Tricyclic urea compounds as JAK2 V617F inhibitors |
| CN116919949B (zh) * | 2023-08-31 | 2024-03-22 | 中国医学科学院医药生物技术研究所 | 2-氨基-5-苯基噻吩-3-羧酸酰胺在制备抗新型冠状病毒药物中的应用 |
| CN116919949A (zh) * | 2023-08-31 | 2023-10-24 | 中国医学科学院医药生物技术研究所 | 2-氨基-5-苯基噻吩-3-羧酸酰胺在制备抗新型冠状病毒药物中的应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2005072412A3 (en) | 2007-03-22 |
| JP2007529422A (ja) | 2007-10-25 |
| EP1715855A4 (en) | 2010-06-16 |
| AU2005208938A1 (en) | 2005-08-11 |
| US20060019952A1 (en) | 2006-01-26 |
| CA2553670A1 (en) | 2005-08-11 |
| EP1715855A2 (en) | 2006-11-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP1715855A2 (en) | Anti-viral therapeutics | |
| Inks et al. | A novel class of small molecule inhibitors of HDAC6 | |
| Negi et al. | Role of heterocyclic compounds in SARS and SARS CoV-2 pandemic | |
| Ren et al. | Discovery of STAT3 and histone deacetylase (HDAC) dual-pathway inhibitors for the treatment of solid cancer | |
| JP4908215B2 (ja) | 疾患の治療法 | |
| US20090306168A1 (en) | SirT Inhibitors That Bind to NAD | |
| US20050250794A1 (en) | Methods of treating a disorder | |
| CN104271557B (zh) | 去泛素化活性的抑制方法 | |
| Ohkanda et al. | Design and synthesis of peptidomimetic protein farnesyltransferase inhibitors as anti-Trypanosoma brucei agents | |
| JP2010522697A (ja) | キナーゼタンパク質結合阻害剤 | |
| Xiong et al. | In silico screening-based discovery of novel covalent inhibitors of the SARS-CoV-2 3CL protease | |
| US20050256181A1 (en) | Treating a viral disorder | |
| WO2018177865A1 (en) | Compounds for use as heparanase inhibitors | |
| Centko et al. | Combination of selective PARP3 and PARP16 inhibitory analogues of latonduine a corrects F508del-CFTR Trafficking | |
| US20080214800A1 (en) | Sirt inhibitors that bind to nad | |
| US20090298934A1 (en) | Diamidine Inhibitors of TDP1 | |
| Gulnik et al. | Approaches to the design of HIV protease inhibitors with improved resistance profiles | |
| Oderinlo et al. | Acridone alkaloids: in-silico investigation against SARS-CoV-2 main protease | |
| CN106310268A (zh) | 一种治疗三阴性乳腺癌的药物组合物 | |
| WO2020247567A1 (en) | Kdm4b inhibitors for the treatment of inflammatory diseases and disorders | |
| US20240366540A1 (en) | Mitofusin inhibitors and uses thereof | |
| EP4444284A1 (en) | Mitofusin inhibitors and uses thereof | |
| Zhou et al. | Preclinical Characterization of SDFZ‐8, a Highly Potent HDAC1 Inhibitor, for Cancer Immunotherapy | |
| JP2011512356A (ja) | キナーゼタンパク質結合阻害剤 | |
| AU772516B2 (en) | Antitumor agents |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2553670 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006551523 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2005712361 Country of ref document: EP Ref document number: 2005208938 Country of ref document: AU |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2005208938 Country of ref document: AU Date of ref document: 20050131 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005208938 Country of ref document: AU |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005712361 Country of ref document: EP |