WO2004053039A2 - Detergent composition comprising endo-glucanase - Google Patents

Detergent composition comprising endo-glucanase Download PDF

Info

Publication number
WO2004053039A2
WO2004053039A2 PCT/DK2003/000844 DK0300844W WO2004053039A2 WO 2004053039 A2 WO2004053039 A2 WO 2004053039A2 DK 0300844 W DK0300844 W DK 0300844W WO 2004053039 A2 WO2004053039 A2 WO 2004053039A2
Authority
WO
WIPO (PCT)
Prior art keywords
glucanase
endo
enzyme
detergent composition
redeposition
Prior art date
Application number
PCT/DK2003/000844
Other languages
French (fr)
Other versions
WO2004053039A3 (en
Inventor
Keith Gibson
Lone Hansen
Original Assignee
Novozymes A/S
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novozymes A/S filed Critical Novozymes A/S
Priority to BRPI0317124A priority Critical patent/BRPI0317124B1/en
Priority to JP2004557818A priority patent/JP4851093B2/en
Priority to US10/538,343 priority patent/US20060035800A1/en
Priority to AU2003302905A priority patent/AU2003302905A1/en
Priority to MXPA05006071A priority patent/MXPA05006071A/en
Priority to EP03812567.0A priority patent/EP1572996B1/en
Publication of WO2004053039A2 publication Critical patent/WO2004053039A2/en
Publication of WO2004053039A3 publication Critical patent/WO2004053039A3/en
Priority to US11/734,065 priority patent/US20070179076A1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • C12N9/2405Glucanases
    • C12N9/2434Glucanases acting on beta-1,4-glucosidic bonds
    • C12N9/2437Cellulases (3.2.1.4; 3.2.1.74; 3.2.1.91; 3.2.1.150)
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/0005Other compounding ingredients characterised by their effect
    • C11D3/0036Soil deposition preventing compositions; Antiredeposition agents
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38627Preparations containing enzymes, e.g. protease or amylase containing lipase
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38636Preparations containing enzymes, e.g. protease or amylase containing enzymes other than protease, amylase, lipase, cellulase, oxidase or reductase
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38645Preparations containing enzymes, e.g. protease or amylase containing cellulase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
    • C12Y302/01004Cellulase (3.2.1.4), i.e. endo-1,4-beta-glucanase

Definitions

  • the present invention relates to a detergent composition comprising an endo- glucanase that p rovides i mproved d etergency p erformance.
  • the i nvention a Iso relates to a detergent composition comprising a combination of an endo-glucanase and other enzymes.
  • One aspect of the invention relates to a process of washing a fabric or hard surface with the endo-glucanase-containing detergent.
  • An important objective of a washing process is to transfer, as completely as possible, the soil from the object being washed into the washing solution, such that the soil can then be discarded with the wash solution.
  • a wash process which merely redistributes the soil on the object being washed is obviously not satisfactory.
  • evaluations of detergency performance i.e. the performance of washing processes, must include consideration both of the removal of soil from the object being washed and of the redeposition of this soil onto the object being washed or onto the equipment being used for the wash process.
  • Problem soils include p articulate soils such as clays and carbon. Visible soils are often difficult to wash away completely because they are bound to, or attracted to, a surface by traces of non-visible, sticky substances. Problem surfaces include the surfaces of cotton fibres.
  • detergent formulations may include an anti- redeposition agent.
  • the anti-redeposition agent is added in order to ensure that the above mentioned problem soils, once detached from the fabrics, can be kept dissolved or suspended in the wash liquor in such a way that they are not re-deposited on the cleaned fabric.
  • a mixture of cellulases to the detergent, one cellulase having anti- redeposition effect and one having a cellulose-degrading effect.
  • EP 822 973 relates to a detergent composition comprising a mixture of cellulases and optionally also containing additional enzymes.
  • enzymes having anti-redeposition effect and other enzymes such as proteases, amylases, hemi-cellulases, lipases and pectinases.
  • Enzymes are commonly used to remove the sticky substances that increase soil binding. There is a need for improved enzyme performance in terms of soil removal and/or prevention of soil redeposition.
  • the invention relates to a detergent composition
  • a detergent composition comprising an anti-redeposition endo-glucanase, i.e. an endo-glucanase having anti-redeposition effect.
  • the inventors have found that such endo-glucanase containing detergents give advantages when used for washing fabrics (especially laundry washing) or hard surfaces (especially automatic dish washing).
  • an endo-glucanase having anti-redeposition effect is characterised by its ability to prevent redeposition in a wash test.
  • detergent compositions comprising specific combinations of certain endo-glucanase(s) having anti-redeposition effect and certain cellulase(s) having increased stability towards anionic tensides such as linear (straight-chain) alkyl benzene sulfonates (often referred to as "LAS"), have advantages compared to the prior art detergent compositions described in EP 822 973. For instance, a decreased amount of enzyme protein is necessary to obtain the desired cleaning and anti-redeposition effect. This results in improved product economy.
  • LAS linear alkyl benzene sulfonates
  • the inventors also have found that it is surprisingly advantageous to include an endo- glucanase having anti-redeposition effect in detergents that also contain other enzymes.
  • these other enzymes include, for example, enzymes that are classified as protease, amylase, beta-glucanase, lipase, hemi-cellulase, cutinase, pectinase and pectate lyase.
  • the invention relates to a detergent composition comprising an endo-glucanase, wherein the endo-glucanase is selected from one of: (i) the endo-glucanase having the amino acid sequence of position 1 to p osition 773 of
  • SEQ ID NO: 2 (ii) an endo-glucanase having a sequence of at least 90% identity to the amino acid se- quence of position 1 to position 773 of SEQ ID NO:2; or a fragment thereof that has endo-glucanase activity; (iii) an endo-glucanase characterized by the wash test method disclosed herein.
  • the invention in a second aspect relates to a detergent composition
  • a detergent composition comprising ani- onic tensides and a combination of an endo-glucanase as defined above and a fungal cellu- lase, wherein both enzymes are stable in the presence of anionic tensides.
  • the invention in a third aspect relates to a detergent composition containing both an endo-glucanase as defined above and one or more other enzyme from classes such as, but not limited to protease, amylase, beta-glucanase, lipase, hemi-cellulase, cutinase, pectinase and pectate lyase.
  • the invention relates to a process of using a detergent composition of the invention for washing or cleaning of fabric, hard surfaces or other objects in need of cleaning.
  • the invention relates to a detergent composition comprising an endo-glucanase having anti-redeposition effect.
  • the endo-glucanase with anti-redeposition effect is according to the invention selected from one of: (i) the endo-glucanase having the amino acid sequence of p osition 1 to position 773 of
  • SEQ ID NO: 2 (ii) an endo-glucanase having a sequence of at least 90% identity to the amino acid se- quence of position 1 to position 773 of SEQ ID NO:2; or a fragment thereof that has endo-glucanase activity; (iii) any endo-glucanase characterized by the wash test method disclosed below.
  • the endo-glucanase is derived from Bacillus sp. AA349, DSM 12648 and also shown in SEQ ID NO: 2 herein or a sequence being 90% identical thereto.
  • the strain Bacillus sp. AA349 which has been isolated from a soil sample originating in Greece, was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1 b, D-38124 Braunschweig, Germany, on 25 January 1999 under the deposition number DSM 12648.
  • the deposit was made by Novo Nordisk A/S and was later assigned to Novozymes A S.
  • compositions comprising anionic tensides
  • a preferred embodiment the invention relates to a detergent composition comprising anionic tensides, and to a combination of an endo-glucanase as defined above and a fungal cellulase, wherein both enzymes are stable in the presence of anionic tensides, such as LAS.
  • anionic tensides such as LAS.
  • enzymes that are stable in LAS are defined by a LAS stability test. Enzymes that give a LAS stability result of at least 50% are regarded as being LAS stable.
  • Detergents commonly contain more than one type of surfactant, for example combinations of both anionic and nonionic surfactants.
  • the invention relates to detergent formulations in which the ratio (based on weight) between anionic and non- ionic surfactants is >1 :1 , preferably >1.5:1.
  • the invention relates to a detergent composition wherein
  • the endo-glucanase is selected from one of:
  • cellulase is selected from one of:
  • a cellulase having a sequence of at least 70% identity to the amino acid sequence of position 1 to position 299 of SEQ ID NO:4, or a fragment thereof that has cellulase activity.
  • endo-glucanase of (a)(i) above is derived from Bacillus sp.
  • Preferred embodiments of the invention comprise these alternative cellulases in combination with the endo-glucanases of (a) above.
  • the cellulase is a Thielavia terrestris cellulase, preferably the cellulase disclosed in SEQ ID NO: 9 in WO 96/29397 and SEQ ID NO: 4 herein or an enzyme with at least 70% identity thereto.
  • the cellulase is the
  • Thielavia terrestris variant disclosed in Example 1 of WO 98/12307.
  • the degree of identity is determined between two sequences indicating a derivation of the first sequence from the second.
  • the identity is determined by means of the computer program GAP provided in the GCG program package.
  • GAP uses the method of Needleman/Wunsch/Sellers to make alignments.
  • Detergent compositions comprising other enzymes
  • Various types of enzymes are very commonly included in detergent formulations for laundry cleaning and for hard surface cleaning.
  • One purpose of these enzymes is to degrade soil binding substances. These substances bind or attract soil and stains onto the fabric or hard surface. T he degraded substances, and t he associated s oil and stain, are then more easily removed during the washing process. Redeposition of soil, which can be increased by soil binding substances, is prevented.
  • the substance on which an enzyme acts is called the substrate.
  • Enzymes are known to be "substrate specific", i.e. each class of enzyme can only degrade one class of substances. F or e xample, a p rotease c an d egrade p roteins b ut c annot d egrade s tarch.
  • a n amylase can degrade starch but cannot degrade proteins. Because the soils and stains that are important for detergent formulators can contain many kinds of soil binding substances, a range of different enzymes, all with different substrate specificities have been developed for use in detergents.
  • T hese include enzymes such as protease, amylase, beta-glucanase, lipase, hemi-cellulase, cutinase, pectinase and pectate lyase.
  • enzymes such as protease, amylase, beta-glucanase, lipase, hemi-cellulase, cutinase, pectinase and pectate lyase.
  • the endo-glucanase of the present invention includes, in addition to the enzymes specified by reference to S EQ ID N O 2 , other endo-glucanases with s urprisingly h igh a nti- redeposition effect.
  • Two tests are provided in order to describe and identify these enzymes: 1 ) a test for endo-glucanase activity, and 2) a test for anti-redeposition effect. Enzymes which provide greater than the specified minimum performance on both these tests are regarded, for the purpose of this invention, as endo-glucanases having anti-redeposition effect.
  • an endo-glucanase of the invention is used together with a n a mylase t o p rovide i mproved d etergency p erformance o n s oils t hat contain s tarch.
  • amylases comprise e.g. ⁇ - or ⁇ -amylases of bacterial or fungal origin. Chemically or genetically modified mutants of such amylases are included in this connection.
  • Relevant ⁇ - amylases include, for example, ⁇ -amylases obtainable from Bacillus species, in particular a special strain of ⁇ . licheniformis, described in more detail in GB 1296839.
  • amylases include NatalaseTM, Stainzyme ® , Duramyl ® , Termamyl ® , TermamylTM Ultra, Fungamyl ® and BAN ® (all available from Novozymes A/S, Bagsvaerd, Denmark), and RapidaseTM and MaxamylTM P (available from DSM, Holland).
  • the alpha-amylase is derived from Bacillus sp. strains NCIB 12289, NCIB 12512, NCIB 12513 and DSM 9375.
  • alpha- amylases shown in SEQ ID NOS 1 and 2 of WO 95/26397 are particularly preferred.
  • the alpha-amylase is the AA560 alpha-amylase derived from Bacillus sp. DSM 12649 disclosed as SEQ ID NO: 2 in WO 00/60060 (hereby incorporated by reference).
  • AA560 alpha-amylase derived from Bacillus sp. DSM 12649 disclosed as SEQ ID NO: 2 in WO 00/60060 (hereby incorporated by reference).
  • variants of the AA560 alpha-amylase including the AA560 variant disclosed in Example 7 and 8 (hereby incorporated by reference).
  • CGTases cyclodextrin glucanotransferases, EC 2.4.1.19
  • an endo-glucanase of the invention is used together with a p rotease to provide improved detergency performance on soils that contain protein.
  • proteases comprise those of animal, vegetable or microbial origin. Proteases of microbial origin are preferred. Chemically or genetically modified mutants of such proteases are included in this connection.
  • the protease may be a serine protease, preferably an alkaline microbial protease or a trypsin-like protease.
  • alkaline proteases are subtilisins, especially those derived from Bacillus, e.g., subtilisin Novo, subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin 168 (described in WO 89/06279).
  • trypsin-like proteases are trypsin (e.g. of porcine or bovine origin) and the Fusarium protease described in WO 89/06270.
  • protease enzymes include Primase ® , Durazym ® , Everlase ® , Kannase ® , Alcalase ® , Savinase ® and Esperase ® (all available from Novozymes A/S, Bagsvaerd, Denmark), MaxataseTM, MaxacalTM, MaxapemTM and ProperaseTM (available from DSM, Holland), PurafectTM and PurafectTM OXP (available from Genencor International, USA), and OpticleanTM and OptimaseTM (available from by Solvay Enzymes).
  • an endo-glucanase of the invention is used to- gether with a lipase to provide improved detergency performance on soils that contain fat or oil.
  • lipases comprise those of bacterial or fungal origin. Chemically or genetically modified mutants of such lipases are included in this connection.
  • useful lipases include a Humicola lanuginosa lipase, e.g. as described in EP 258 068 and EP 305 216; a Rhizomucor miehei lipase, e.g. as described in EP 238 023; a Candida lipase, such as a C. antarctica lipase, e.g. the C. antarctica lipase A or B described in EP 214 761; a Pseudomonas lipase, such as one of those described in EP 721 981 (e.g. a lipase obtainable from a Pseudomonas sp.
  • a Humicola lanuginosa lipase e.g. as described in EP 258 068 and EP 305 216
  • a Rhizomucor miehei lipase e.g. as described in EP 238 023
  • a Candida lipase such as a C
  • a P. fluorescens lipase as disclosed in GB 1 ,372,034, or a P. fluorescens lipase; a Bacillus lipase, e.g. a e.g. a B. subtilis lipase (Dartois et al. (1993) Biochemica et Biophysica Acta 1131 :253-260), a B. stearothermophilus lipase (JP 64/744992) and a B. pumilus lipase (WO 91/16422).
  • lipolytic enzymes include cutinases, e.g. a cutinase derived from Pseudomonas mendocina as described in WO 88/09367, or a cutinase derived from Fusarium solani f. pisi (described, e.g., in WO 90/09446).
  • Suitable commercially available lipases include Lipex ® , Lipolase ® and Lipolase Ultra ® (available from Novozymes A S), M1 LipaseTM and LipomaxTM (available from Genencor Inc.) and Lipase P "Amano” (available from Amano Pharmaceutical Co. Ltd.).
  • Commercially available cutinases include LumafastTM from Genencor Inc.
  • an endo-glucanase of the invention is used together with a hemi-cellulase to provide improved detergency performance on soils that contain hemi- cellulose and similar polysaccharides.
  • Such hemi-cellulases include xylanases, xyloglucanases, arabinofuranosidases, acetyl xylan esterases, glucuronidases, ferulic acid esterases, coumahc acid esterases, endo-galactanases, mannanases, endo- or exo- arabinanases, exo-galactanases.
  • Suitable mannanases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
  • the mannanase is derived from a strain of the genus Bacillus, especially Bacillus sp. I633 disclosed in positions 31-330 of SEQ ID NO:2 or in SEQ ID NO: 5 of WO 99/64619 or Bacillus agaradhaerens, for example from the type strain DSM 8721.
  • a suitable mannanase is Mannaway ® produced by Novozymes A/S.
  • an endo-glucanase of the invention is used together with a beta-glucanase (EC 3.2.1.6) to provide improved detergency performance on soils that contain beta-glucans.
  • a beta-glucanase EC 3.2.1.6
  • Further preferred beta-glucanases include lichenases and laminarinases.
  • an endo-glucanase of the invention is used together with pectinolytic enzymes such as a protopectinase, pectinase, polygalacturonase or pectate lyase to provide improved detergency performance on pectinaceous soils.
  • Suitable pectinolytic enzymes include those d escribed in WO 99/27083, WO 99/27084, WO 00/55309 and WO 02/092741.
  • Suitable pectate lyases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
  • the pectate lyase is derived from a strain of the genus Bacillus, especially a strain of Bacillus substilis, especially Bacillus subtilis DSM14218 disclosed in SEQ ID NO:2 or a variant thereof disclosed in Example 6 of WO 02/092741.
  • an endo-glucanase of the invention is used together with other enzymes of the classes: pectate lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyase (EC 4.2.2.2), pectin lyas
  • rhamnogalacturonan lyase (EC not defined), endo-1 ,4-galactanase (EC 3.2.1.89), xyloglucanase (EC not defined), xylanase (EC 3.2.1.8), arabinanase (EC 3.2.1.99), alpha-L- arabinofuranosidase (EC 3.2.1.55), Mannan endo-1,4-mannosidase (EC 3.2.1.78), beta- mannosidase (EC 3.2.1.25), beta-1 ,3-1 ,4-glucanase (EC 3.2.1.73), rhamnogalacturonan hydrolase, exo-polygalacturonase (EC 3.2.1.67), rhamnogalacturonase (EC not defined), Glucan 1 ,3-beta-glucosidase ( EC 3.2.1.58), Glucan e ndo-1 ,6-beta-glucosidas
  • Acetyl and methyl esterase enzymes such as: rhamnogalacturonan methyl esterase, rhamnogalacturonan acetyl esterase, pectin methylesterase (EC 3.1.1.11), pectin acetylesterase (EC not defined), xylan methyl esterase, acetyl xylan esterase (EC 3.1.1.72), feruloyl esterase (EC 3.1.1.73), cinnamoyl esterase (EC 3.1.1.73) to provide improved detergency performance on corresponding soils.
  • Acetyl and methyl esterase enzymes such as: rhamnogalacturonan methyl esterase, rhamnogalacturonan acetyl esterase, pectin methylesterase (EC 3.1.1.11), pectin acetylesterase (EC not defined), xylan methyl esterase, acetyl xylan esterase (EC 3.1.1.72),
  • the detergent compositions according to the present invention comprise a surfactant system, wherein the surfactant can be selected from nonionic and/or anionic and/or cationic and/or amphoteric and/or zwitterionic and/or semi-polar surfactants.
  • the surfactant is typically present at a level from 0.1% to 60% by weight.
  • the s urfactant i s p referably formulated to b e compatible w ith e nzyme components present in the composition.
  • the surfactant is most preferably formulated in such a way that it promotes, or at least does not degrade, the stability of any enzyme in these compositions.
  • Preferred systems to be used according to the present invention comprise as a surfactant one or more of the nonionic and/or anionic surfactants described herein.
  • Polyethylene, polypropylene, and polybutylene oxide condensates of alkyl phenols are suitable for use as the nonionic surfactant of the surfactant systems of the present invention, with the polyethylene oxide condensates being preferred.
  • These compounds include the condensation products of alkyl phenols having an alkyl group containing from about 6 to about 14 carbon atoms, preferably from about 8 to about 14 carbon atoms, in either a straight chain or branched-chain configuration with the alkylene oxide.
  • the ethylene oxide is present in an amount equal to from about 2 to about 25 moles, more preferably from about 3 to about 15 moles, of ethylene oxide per mole of alkyl phenol.
  • nonionic surfactants of this type include IgepalTM CO-630, marketed by the GAF Corporation; and TritonTM X-45, X-114, X-100 and X-102, all marketed by the Rohm & Haas Company. These surfactants are commonly referred to as alkylphenol alkoxylates (e.g., alkyl phenol ethoxylates).
  • the condensation products of primary and secondary aliphatic alcohols with about 1 to about 25 moles of ethylene oxide are suitable for use as the nonionic surfactant of t he nonionic surfactant systems of the present invention.
  • the alkyl chain of the aliphatic alcohol can either be straight or branched, primary or secondary, and generally contains from about 8 to about 22 carbon atoms.
  • About 2 to about 7 moles of ethylene oxide and most preferably from 2 to 5 moles of ethylene oxide per mole of alcohol are present in said condensation products.
  • nonionic surfactants of this type include TergitolTM 15-S-9 (The condensation product of Cn-C 15 linear alcohol with 9 moles ethylene oxide), TergitolTM 24-L-6 NMW (the condensation product of C 12 -C 14 primary alcohol with 6 moles ethylene oxide with a narrow molecular weight distribution), both marketed by Union Carbide Corporation; NeodolTM 45-9 (the condensation product of C 14 -C 15 linear alcohol with 9 moles of ethylene oxide), NeodolTM 23-3 (the condensation product of C 12 -C 13 linear alcohol with 3.0 moles of ethylene oxide), NeodolTM 45-7 (the condensation product of C 14 -C 15 linear alcohol with 7 moles of ethylene oxide), NeodolTM 45-5 (the condensation product of C 14 -C ⁇ 5 linear alcohol with 5 moles of ethylene oxide) marketed by Shell Chemical Company, KyroTM EOB (the condensation product of C ⁇ 3 -C 15 alcohol with 9 moles ethylene oxide), marketed by The Procter &
  • alkylpolysaccharides disclosed in U S 4,565,647, having a hydrophobic group containing from about 6 to about 30 carbon atoms, preferably from about 10 to about 16 carbon atoms and a polysaccharide, e.g. a polyglycoside, hydrophilic group containing from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7 saccha de units.
  • Any reducing saccharide containing 5 or 6 carbon atoms can be used, e.g., glucose, galactose and galactosyl moieties can be substituted for the glucosyl moieties ( optionally the h ydrophobic group is attached at t he 2-, 3-, 4-, etc. positions thus giving a glucose or galactose as opposed to a glucoside or galactoside).
  • the intersaccharide bonds can be, e.g., between the one position of the additional saccharide units and the 2-, 3-, 4-, and/or 6- positions on the preceding saccharide units.
  • the preferred alkylpolyglycosides have the formula 2 0(C n H 2n O),(glycosyl) x
  • R 2 is selected from the group consisting of alkyl, alkylphenyl, hydroxyalkyl, hydroxyalkylphenyl, and mixtures thereof in which the alkyl groups contain from about 10 to about 18, preferably from about 12 to about 14, carbon atoms; n is 2 or 3, preferably 2; t is from 0 to about 10, preferably 0; and x is from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7.
  • the glycosyl is preferably derived from glucose. To prepare these compounds, the alcohol or alkylpolyethoxy alcohol is formed first and then reacted with glucose, or a source of glucose, to form the glucoside (attachment at the 1 -position). The additional glycosyl units can then be attached between their 1 -position and the preceding glycosyl units 2-, 3-, 4-, and/or 6-position, preferably predominantly the 2- position.
  • the condensation products of ethylene oxide with a hydrophobic base formed by the condensation of propylene oxide with propylene glycol are also suitable for use as the additional nonionic surfactant systems of the present invention.
  • the hydrophobic portion of these compounds will preferably have a molecular weight from about 1500 to about 1800 and will exhibit water insolubility.
  • the addition of polyoxyethylene moieties to this hydrophobic portion tends to increase the water solubility of the molecule as a whole, and the liquid character of the product is retained up to the point where the polyoxyethylene content is about 50% of the total weight of the condensation product, which corresponds to condensation with up to about 40 moles of ethylene oxide.
  • Examples of compounds of this type include certain of the commercially available PluronicTM surfactants, marketed by BASF.
  • nonionic surfactant of the nonionic surfactant system of the present invention are the condensation products of ethylene oxide with the product resulting from the reaction of propylene oxide and ethylenediamine.
  • the hydrophobic moiety of these products consists of the reaction product of ethylenediamine and excess propylene oxide, and generally has a molecular weight of from about 2500 to about 3000.
  • This hydrophobic moiety is condensed with ethylene oxide to the extent that the condensation product contains from about 40% to about 80% by weight of polyoxyethylene and has a molecular weight of from about 5,000 to about 11 ,000.
  • Examples of this type of nonionic surfactant include certain of the commercially available TetronicTM compounds, marketed by BASF.
  • nonionic surfactant of the surfactant systems of the present invention are polyethylene oxide condensates of alkyl phenols, condensation products of primary and secondary aliphatic alcohols with from about 1 to about 25 moles of ethyleneoxide, alkylpolysaccharides, and mixtures hereof. Most preferred are C 8 -C ⁇ 4 alkyl phenol ethoxylates having from 3 to 15 ethoxy groups and C 8 -C 18 alcohol ethoxylates (preferably C 10 avg.) having from 2 to 10 ethoxy groups, and mixtures thereof.
  • Highly preferred nonionic surfactants are polyhydroxy fatty acid amide surfactants of the formula
  • R 1 is H, or R 1 is C ⁇ hydrocarbyl, 2-hydroxyethyl, 2-hydroxypropyl or a mixture thereof, R 2 is C 5 . 31 hydrocarbyl, and Z is a polyhydroxyhydrocarbyl having a linear hydrocarbyl chain with at least 3 hydroxyls directly connected to the chain, or an alkoxylated derivative thereof.
  • R 1 is methyl
  • R 2 is straight Cn. 15 alkyl or C 16 . ⁇ 8 alkyl or alkenyl chain such as coconut alkyl or mixtures thereof
  • Z is derived from a reducing sugar such as glucose, fructose, maltose or lactose, in a reductive amination reaction.
  • Highly preferred anionic surfactants include alkyl alkoxylated sulfate surfactants.
  • Examples hereof are water soluble salts or acids of the formula RO(A) m S0 3 M wherein R is an unsubstituted C 10 -C- 24 alkyl or hydroxyalkyl group having a C ⁇ 0 -C 24 alkyl component, preferably a C 12 -C 20 alkyl or hydro-xyalkyl, more preferably C 12 -C 18 alkyl or hydroxyalkyl, A is an ethoxy or propoxy unit, m is greater than zero, typically between about 0.5 and about 6, more preferably between about 0.5 and about 3, and M is H or a cation which can be, for example, a metal cation (e.g., sodium, potassium, lithium, calcium, magnesium, etc.), ammonium or substituted-ammonium cation.
  • R is an unsubstituted C 10 -C- 24 alkyl or hydroxyalkyl group having a C ⁇ 0 -C 24 alkyl component, preferably a C 12 -
  • Alkyl ethoxylated sulfates as well as alkyl propoxylated sulfates are contemplated herein.
  • Specific examples of substituted ammonium cations include methyl-, dimethyl, trimethyl-ammonium cations and quaternary ammonium cations such as tetramethyl-ammonium and dimethyl piperdinium cations and those derived from alkylamines such as ethylamine, diethylamine, triethylamine, mixtures thereof, and the like.
  • Exemplary surfactants are C 12 -C 18 alkyl polyethoxylate (1.0) sulfate (C 12 -C 18 E(1.0)M), C ⁇ 2 - Ci 8 alkyl polyethoxylate (2.25) sulfate (C 12 -C 18 (2.25)M, and C 12 -C 18 alkyl polyethoxylate (3.0) sulfate (C 12 -C 18 E(3.0)M), and C 12 -C 18 alkyl polyethoxylate (4.0) sulfate (C 12 -C ⁇ 8 E(4.0)M), wherein M is conveniently selected from sodium and potassium.
  • Suitable anionic surfactants to be used are alkyl ester sulfonate surfactants including linear esters of C 8 -C 20 carboxylic acids (i.e., fatty acids) which are sulfonated with gaseous S0 3 according to "The Journal of the American Oil Chemists Society", 52 (1975), pp. 323-329.
  • Suitable starting materials would include natural fatty substances as derived from tallow, palm oil, etc.
  • the preferred alkyl ester sulfonate surfactant especially for laundry applications, comprises alkyl ester sulfonate surfactants of the structural formula:
  • R 3 - CH - C - OR 4 S0 3 M wherein R 3 is a C 8 -C 20 hydrocarbyl, preferably an alkyl, or combination thereof, R 4 is a C C 6 hydrocarbyl, preferably an alkyl, or combination thereof, and M is a cation which forms a water soluble salt with the alkyl ester sulfonate.
  • Suitable salt-forming cations include metals such as sodium, potassium, and lithium, and substituted or unsubstituted ammonium cations, such as monoethanolamine, diethonolamine, and triethanolamine.
  • R 3 is C 10 -C 16 alkyl, and R 4 is methyl, ethyl or isopropyl.
  • the methyl ester sulfonates wherein R 3 is Cio-Ci ⁇ alkyl.
  • alkyl sulfate surfactants which are water soluble salts or acids of the formula ROS0 3 M wherein R preferably is a C ⁇ 0 -C 24 hydrocarbyl, preferably an alkyl or hydroxyalkyl having a C 10 -C 2 o alkyl component, more preferably a C 12 -C ⁇ 8 alkyl or hydroxyalkyl, and M is H or a cation, e.g., an alkali metal cation (e.g. sodium, potassium, lithium), or ammonium or substituted ammonium (e.g.
  • R preferably is a C ⁇ 0 -C 24 hydrocarbyl, preferably an alkyl or hydroxyalkyl having a C 10 -C 2 o alkyl component, more preferably a C 12 -C ⁇ 8 alkyl or hydroxyalkyl
  • M is H or a cation, e.g., an alkali metal cation (e.g. sodium, potassium
  • alkylamines such as ethylamine, diethylamine, triethylamine, and mixtures thereof, and the like.
  • alkyl chains of C 12 -C 16 are preferred for lower wash temperatures (e.g. below about 50°C) and C 16 -C 18 alkyl chains are preferred for higher wash temperatures (e.g. above about 50°C).
  • Other anionic surfactants useful for detersive purposes can also be included in the laundry detergent compositions of the present invention.
  • Theses can include salts (including, for example, sodium, potassium, ammonium, and substituted ammonium salts such as mono- di- and triethanolamine salts) of soap, C 8 -C 22 primary or secondary alkanesulfonates, C 8 -C 24 olefinsulfonates, sulfonated polycarboxylic acids prepared by sulfonation of the pyrolyzed product of alkaline earth metal citrates, e.g., as described in British patent specification No.
  • alkylpolyglycolethersulfa.es (containing up to 10 moles of ethylene oxide); alkyl glycerol sulfonates, fatty acyl glycerol sulfonates, fatty oleyl glycerol sulfates, alkyl phenol ethylene oxide ether sulfates, paraffin sulfonates, alkyl phosphates, isethionates such as the acyl isethionates, N-acyl taurates, alkyl succinamates and sulfosuccinates, monoesters of sulfosuccinates (especially saturated and unsaturated C 12 -C 18 monoesters) and diesters of sulfosuccinates (especially saturated and unsaturated C 6 -C 12 diesters), acyl sarcosinates, sulfates of alkylpolysaccharides such
  • Resin acids and hydrogenated resin acids are also suitable, such as rosin, hydrogenated rosin, and resin acids and hydrogenated resin acids present in or derived from tall oil.
  • Alkylbenzene sulfonates are highly preferred. Especially preferred are linear (straight- chain) alkyl benzene sulfonates (LAS) wherein the alkyl group preferably contains from 10 to 18 carbon atoms.
  • the detergent compositions of the present invention typically comprise from about 1% to about 40%, preferably from about 3% to about 25 % by weight of such anionic surfactants.
  • the laundry detergent compositions of the present invention may also contain cationic, amphoteric, zwitterionic, and semi-polar surfactants, as well as the nonionic and/or anionic surfactants other than those already described herein.
  • Cationic detersive surfactants suitable for use in the laundry detergent compositions of the present invention are those having one long-chain hydrocarbyl group.
  • cationic surfactants include the ammonium surfactants such as alkyltrimethylammonium halogenides, and those surfactants having the formula:
  • R 2 is an alkyl or alkyl benzyl group having from about 8 to about 18 carbon atoms in the alkyl chain
  • each R 3 is selected form the group consisting of -CH 2 CH 2 -, -CH 2 CH(CH 3 )-, - CH 2 CH(CH 2 OH)-, -CH 2 CH 2 CH 2 -, and mixtures thereof
  • each R 4 is selected from the group consisting of 0 ⁇ 0 4 alkyl, Ci-C 4 hydroxyalkyl, benzyl ring structures formed by joining the two R 4 groups, -CH 2 CHOHCHOHCOR 6 CHOHCH 2 OH, wherein R 6 is any hexose or hexose polymer having a molecular weight less than about 1000, and hydrogen when y is not 0
  • R 5 is the same as R 4 or is an alkyl chain, wherein the total number of carbon atoms of R 2 plus R 5 is not more than about 18
  • each y is from 0 to about 10,
  • R ⁇ is C 8 -C ⁇ 6 alkyl
  • each of R 2 , R 3 and R 4 is independently C C alkyl, C C 4 hydroxy alkyl, benzyl, and -(C 2 H 40 ) X H where x has a value from 2 to 5, and X is an anion.
  • R 2 , R 3 or R 4 should be benzyl.
  • the preferred alkyl chain length for Ri is C 12 -Ci 5 , particularly where the alkyl group is a mixture of chain lengths derived from coconut or palm kernel fat or is derived synthetically by olefin build up or OXO alcohols synthesis.
  • R 2 , R 3 and R 4 are methyl and hydroxyethyl groups and the anion X may be selected from halide, methosulphate, acetate and phosphate ions.
  • quaternary ammonium compounds of formulae (i) for use herein are: c oconut trimethyl ammonium chloride or bromide; c oconut methyl dihydroxyethyl ammonium chloride or bromide; d ecyl triethyl ammonium chloride; d ecyl dimethyl hydroxyethyl ammonium chloride or bromide; C 12 - 15 dimethyl hydroxyethyl ammonium chloride or bromide; c oconut dimethyl hydroxyethyl ammonium chloride or bromide; my styl trimethyl ammonium methyl sulphate; I auryl dimethyl benzyl ammonium chloride or bromide;
  • the detergent compositions of the present invention typically comprise from 0.2% to about 25%, preferably from about 1 % to about 8% by weight of such cationic surfactants.
  • Amphoteric surfactants are also suitable for use in the detergent compositions of the present invention. These surfactants can be broadly described as aliphatic derivatives of secondary o r t ertiary a mines, o r a liphatic d erivatives o f h eterocyclic s econdary a nd t ertiary amines in which the aliphatic radical can be straight- or branched-chain.
  • One of the aliphatic substituents contains at least about 8 carbon atoms, typically from about 8 to about 18 carbon atoms, and at least one contains an anionic water-solubilizing group, e.g. carboxy, sulfonate, sulfate. See US 3,929,678 (column 19, lines 18-35) for examples of amphoteric surfactants.
  • the detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such amphoteric surfactants.
  • Zwitterionic surfactants a re also suitable for use in detergent compositions.
  • T hese surfactants can be broadly described as derivatives of secondary and tertiary amines, derivatives of heterocyclic secondary and tertiary amines, or derivatives of quaternary ammonium, quaternary phosphonium or tertiary sulfonium compounds. See US 3,929,678 (column 19, line 38 through column 22, line 48) for examples of zwitterionic surfactants.
  • the detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such zwitterionic surfactants.
  • Semi-polar nonionic surfactants are a special category of nonionic surfactants which include water-soluble amine oxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; water soluble phosphine oxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; and water-soluble sulfoxides containing one alkyl moiety from about 10 to about 18 carbon atoms and a moiety selected from the group consisting of alkyl and hydroxyalkyl moieties of from about 1 to about 3 carbon atoms.
  • Semi-polar nonionic detergent surfactants include the amine oxide surfactants having the formula: O f R 3 (OR 4 )xN(R 5 )2 wherein R 3 is an alkyl, hydroxyalkyl, or alkyl phenyl group or mixtures thereof containing from about 8 to about 22 carbon atoms; R 4 is an alkylene or hydroxyalkylene group containing from about 2 to about 3 carbon atoms or mixtures thereof; x is from 0 to about 3: and each R 5 is an alkyl or hydroxyalkyl group containing from about 1 to about 3 carbon atoms or a polyethylene oxide group containing from about 1 to about 3 ethylene oxide groups.
  • the R 5 groups can be attached to each other, e.g., through an oxygen or nitrogen atom, to form a ring structure.
  • These amine oxide surfactants in particular include C 10 -C 18 alkyl dimethyl amine oxides and C 8 -C ⁇ 2 alkoxy ethyl dihydroxy ethyl amine oxides.
  • the detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such semi-polar nonionic surfactants.
  • compositions according to the present invention may further comprise a builder system.
  • a builder system Any conventional builder system is suitable for use herein including aluminosilicate materials, silicates, polycarboxylates and fatty acids, materials such as ethylenediamine tetraacetate, metal ion sequestrants such as aminopolyphosphonates, particularly ethylenediamine tetramethylene phosphonic acid and diethylene triamine pentamethylenephosphonic acid.
  • phosphate builders can also be used herein.
  • Suitable builders can be an inorganic ion exchange material, commonly an inorganic hydrated aluminosilicate material, more particularly a hydrated synthetic zeolite such as hydrated zeolite A, X, B, HS or MAP.
  • SKS-6 is a crystalline layered silicate consisting of sodium silicate (Na 2 Si 2 Os).
  • Suitable polycarboxylates containing one carboxy group include lactic acid, glycolic acid and ether derivatives thereof as disclosed in Belgian Patent Nos. 831 , 368, 821 ,369 and 821 ,370.
  • Polycarboxylates containing two carboxy groups include the water-soluble salts of succinic acid, malonic acid, (ethylenedioxy) diacetic acid, maleic acid, diglycollic acid, tartaric acid, tartronic acid and fumaric acid, as well as the ether carboxylates described in DE 2,446,686, and 2 ,446,487, US 3,935,257 and the sulfinyl carboxylates described in Belgian Patent No. 840,623.
  • Polycarboxylates containing three carboxy groups include, in particular, water-soluble citrates, aconitrates and citraconates as well as succinate derivatives such as the carboxymethyloxysuccinates described in British Patent No. 1 ,379,241 , lactoxysuccinates described in Netherlands Application 7205873, and the oxypolycarboxylate materials such as 2-oxa-1 ,1 ,3-propane tricarboxylates described in British Patent No. 1 ,387,447.
  • Polycarboxylates containing four carboxy groups include oxydisuccinates disclosed in British Patent No. 1 ,261 ,829, 1 ,1 ,2,2,-ethane tetracarboxylates, 1 ,1 ,3,3-propane tetracarboxylates containing sulfo substituents include the sulfosuccinate derivatives disclosed in British Patent Nos. 1 ,398,421 and 1 ,398,422 and in US 3,936,448, and the sulfonated pyrolysed citrates described in British Patent No. 1 ,082,179, while polycarboxylates containing phosphone substituents are disclosed in British Patent No. 1 ,439,000.
  • Alicyclic and heterocyclic polycarboxylates include cyclopentane-cis,cis-cis- tetracarboxylates, cyclopentadienide pentacarboxylates, 2,3,4,5-tetrahydro-furan - cis, cis, cis- tetracarboxylates, 2,5-tetrahydro-furan-cis, discarboxylates, 2,2,5,5,-tetrahydrofuran - tetracarboxylates, 1 ,2,3,4,5,6-hexane - hexacarboxylates and carboxymethyl derivatives of polyhydric alcohols such as sorbitol, mannitol and xylitol.
  • Aromatic polycarboxylates include mellitic acid, pyromellitic acid and the phthalic acid derivatives disclosed in British Patent No. 1 ,425,343.
  • the preferred polycarboxylates are hydroxy-carboxylates containing up to three carboxy groups per molecule, more particularly citrates.
  • Preferred builder systems for use in the present compositions include a mixture of a water-insoluble aluminosilicate builder such as zeolite A or of a layered silicate (SKS-6), and a water-soluble carboxylate chelating agent such as citric acid.
  • a suitable chelant for inclusion in the detergent compositions in accordance with the invention is ethylenediamine-N,N'-disuccinic acid (EDDS) or the alkali metal, alkaline earth metal, ammonium, or substituted ammonium salts thereof, or mixtures thereof.
  • EDDS compounds are the free acid form and the sodium or magnesium salt thereof. Examples of such preferred sodium salts of EDDS include Na 2 EDDS and Na 4 EDDS. Examples of such preferred magnesium salts of EDDS include MgEDDS and Mg 2 EDDS. The magnesium salts are the most preferred for inclusion in compositions in accordance with the invention.
  • Suitable water-soluble organic salts are the homo- or co-polymeric acids or their salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated form each other by not more than two carbon atoms.
  • Polymers of this type are disclosed in GB-A-1 ,596,756.
  • Examples of such salts are polyacrylates of MW 2000-5000 and their copolymers with maleic anhydride, such copolymers having a molecular weight of from 20,000 to 70,000, especially about 40,000.
  • Detergency builder salts are normally included in amounts of from 5% to 80% by weight of the composition. Preferred levels of builder for liquid detergents are from 5% to 30%.
  • Bleaching agents Additional optional detergent ingredients that can be included in the detergent compositions of the present invention include bleaching agents such as perborate PB1 , PB4 and percarbonate. These bleaching agent components can include one or more oxygen bleaching agents and, depending upon the bleaching agent chosen, one or more bleach activators. Present oxygen bleaching compounds will typically be present at levels of from about 1% to about 25%. In general, bleaching compounds are optional added components in non-liquid formulations, e.g. granular detergents.
  • the bleaching agent component for use herein can be any of the bleaching agents useful for detergent compositions including oxygen bleaches as well as others known in the art.
  • the bleaching agent suitable for the present invention can be an activated or non- activated bleaching agent.
  • One category of oxygen bleaching agent that can be used encompasses percar- boxylic acid bleaching agents and salts thereof. Suitable examples of this class of agents include magnesium monoperoxyphthalate hexahydrate, the magnesium salt of meta-chloro perbenzoic acid, 4-nonylamino-4-oxoperoxybutyhc acid and diperoxydodecanedioic acid.
  • Such bleaching agents are disclosed in US 4,483,781 , EP 0 133 354 and US 4,412,934.
  • Highly preferred bleaching agents also include 6-nonylamino-6-oxoperoxycaproic acid as described in US 4,634,551.
  • bleaching agents encompasses the halogen bleaching agents.
  • hypohalite bleaching agents include trichloro isocyanuric acid and the sodium and potassium dichloroisocyanurates and N-chloro and N-bromo alkane sulphonamides. Such materials are normally added at 0.5-10% by weight of the finished product, preferably 1-5% by weight.
  • halogen bleaching agents are generally less preferred for use in enzymatic detergents.
  • the hydrogen peroxide releasing agents can be used in combination with bleach activators such as tetra-acetylethylenediamine (TAED), nonanoyloxybenzenesulfonate (NOBS, described in US 4,412,934), 3,5-trimethyl-hexsanoloxybenzenesulfonate (ISONOBS, described in EP 120 591 ) or pentaacetylglucose (PAG), which are perhydrolyzed to form a peracid as the active bleaching species, leading to improved bleaching effect.
  • bleach activators such as tetra-acetylethylenediamine (TAED), nonanoyloxybenzenesulfonate (NOBS, described in US 4,412,934), 3,5-trimethyl-hexsanoloxybenzenesulfonate (ISONOBS, described in EP 120 591 ) or pentaacetylglucose (PAG), which are perhydrolyzed to form
  • bleach activators C8 (6-octanamido-caproyl) oxybenzene-sulfonate, C9(6- nonanamido caproyl) oxybenzenesulfonate and C10 (6-decanamido caproyl) oxybenzene- sulfonate or mixtures thereof.
  • acylated citrate esters such as disclosed in European Patent Application No. 91870207.7.
  • bleaching agents including peroxyacids and bleaching systems comprising bleach activators and peroxygen bleaching compounds for use in cleaning compositions according to the invention are described in application USSN 08/136,626.
  • the hydrogen peroxide may also be present by adding an enzymatic system (i.e. an enzyme and a substrate therefore) which is capable of generation of hydrogen peroxide at the beginning or during the washing and/or rinsing process.
  • an enzymatic system i.e. an enzyme and a substrate therefore
  • Such enzymatic systems are disclosed in European Patent Application EP 0 537 381.
  • Bleaching agents other than oxygen bleaching agents are also known in the art and can be utilized herein.
  • One type of non-oxygen bleaching agent of particular interest includes photoactivated bleaching agents such as the sulfonated zinc and/or aluminium phthalocyanines. These materials can be deposited upon the substrate during the washing process.
  • the sulfonated zinc phthalocyanine Upon irradiation with light, in the presence of oxygen, such as by hanging clothes out to dry in the daylight, the sulfonated zinc phthalocyanine is activated and, consequently, the substrate is bleached.
  • Preferred zinc phthalocyanine and a photoactivated bleaching process are described in US 4,033,718.
  • detergent composition will contain about 0.025% to about 1.25%, by weight, of sulfonated zinc phthalocyanine.
  • Bleaching agents may also comprise a manganese catalyst.
  • the manganese catalyst may, e.g., be one of the compounds described in "Efficient manganese catalysts for low- temperature bleaching", Nature (369) 1994, pp. 637-639.
  • Suds suppressors Another optional ingredient is a suds suppressor, exemplified by silicones, and silica-silicone mixtures.
  • Silicones can generally be represented by alkylated polysiloxane materials, while silica is normally used in finely divided forms exemplified by silica aerogels and xerogels and hydrophobic silicas of various types. Theses materials can be incorporated as particulates, in which the suds suppressor is advantageously releasably incorporated in a water-soluble or water-dispersible, substantially non surface-active detergent impermeable carrier. Alternatively the suds suppressor can be dissolved or dispersed in a liquid carrier and applied by spraying onto one or more of the other components.
  • a preferred silicone suds controlling agent is disclosed in US 3,933,672.
  • Other particularly useful suds suppressors are the self-emulsifying silicone suds suppressors, described in German Patent Application DTOS 2,646,126.
  • An example of such a compound is DC-544, commercially available form Dow Corning, which is a siloxane-glycol copolymer.
  • Especially preferred suds controlling agent are the suds suppressor system comprising a mixture of silicone oils and 2-alkyl-alkanols. Suitable 2-alkyl-alkanols are 2-butyl-octanols, which are commercially available under the trade name Isofol 12 R.
  • compositions can comprise a silicone/ silica mixture in combination with fumed nonporous silica such as Aerosil ® .
  • the suds suppressors described above are normally employed at levels of from 0.001% to 2% by weight of the composition, preferably from 0.01% to 1 % by weight.
  • compositions may be employed such as soil-suspending or anti-redeposition agents, soil-releasing agents, optical brighteners, abrasives, bacte cides, tarnish inhibitors, coloring agents, and/or encapsulated or non- encapsulated perfumes.
  • suitable encapsulating materials are water soluble capsules which consist of a matrix of polysaccharide and polyhydroxy compounds such as described in GB 1 ,464,616.
  • Other suitable water soluble encapsulating materials comprise dextrins derived from ungelatinized starch acid esters of substituted dicarboxylic acids such as described in US 3,455,838. These acid-ester dextrins are, preferably, prepared from such starches as waxy maize, waxy sorghum, sago, tapioca and potato.
  • Suitable examples of said encapsulation materials include N-Lok manufactured by National Starch.
  • the N-Lok encapsulating material consists of a modified maize starch and glucose.
  • the starch is modified by adding monofunctional substituted groups such as octenyl succinic acid anhydride.
  • Typical anti-redeposition agents used in detergents include water-soluble, generally organic colloids, including for example the water-soluble salts of polymeric carboxylic acids such as polyacrylic acid or polymaleic acid or co-polymers thereof, glue, gelatine, salts of ether carboxylic a cids o r ether s ulfonic a cids of s tarch o r cellulose o r salts of s ulfuric a cid esters of cellulose or starch.
  • Water-soluble polyamides containing acidic groups are also used as anti-redeposition agent. Soluble starch preparations and other starch products than those mentioned above, for example partly hydrolyzed starch, may also be used.
  • Sodium carboxymethyl cellulose, methyl cellulose, hydroxyethyl cellulose, methyl hydroxyethyl cellulose and mixtures thereof are preferably used. These materials are normally used at levels of from 0.05% to 10% by weight, more preferably form 0.2% to 8%, most preferably from 0.5% to 6% by weight of the composition.
  • Preferred optical brighteners are anionic in character, examples of which are disodium 4,4'-bis-(2-diethanolamino-4-anilino-s-triazin-6-ylamino)stilbene-2:2' disulpho-nate, disodium 4, - 4'-bis-(2-morpholino-4-anilino-s-triazin-6-ylamino-stilbene-2:2' - disulphonate, disodium 4,4' - bis-(2,4-dianilino-s-triazin-6-ylamino)stilbene-2:2' - disulpho-nate, monosodium 4',4" - bis-(2,4-dianilino-s-tri-azin-6-ylamino)stilbene-2-sulphonate, disodium 4,4'-bis-(2-anilino- 4-(N-methyl-N-2-hydroxyethylamino)-s-triazin-6-ylamino) stilbene-2,2'
  • polyethylene glycols particularly those of molecular weight 1000-10000, more particularly 2000 to 8000 and most preferably about 4000. These are used at levels of from 0.20% to 5% more preferably from 0.25% to 2.5% by weight. These polymers and the previously mentioned homo- or co-polymeric poly-carboxylate salts are valuable for improving whiteness maintenance, fabric ash deposition, and cleaning performance on clay, proteinaceous and oxidizable soils in the presence of transition metal impurities.
  • Soil release agents useful in compositions of the present invention are conventionally copolymers or terpolymers of terephthalic acid with ethylene glycol and/or propylene glycol units in various arrangements. Examples of such polymers are disclosed in US 4,116,885 and 4,711 ,730 and EP 0 272 033.
  • a particular preferred polymer in accordance with EP 0 272 033 has the formula:
  • PEG is -(OC 2 H 4 )0-
  • PO is (OC 3 H 6 0)
  • T is (pOOC 6 H 4 CO).
  • modified polyesters as random copolymers of dimethyl terephthalate, dimethyl sulfoisophthalate, ethylene glycol and 1 ,2-propanediol, the end groups consisting primarily of sulphobenzoate and secondarily of mono esters of ethylene glycol and/or 1 ,2-propanediol.
  • the target is to obtain a polymer capped at both end by sulphobenzoate groups, "primarily", in the present context most of said copolymers herein will be endcapped by sulphobenzoate groups.
  • some copolymers will be less than fully capped, and therefore their end groups may consist of monoester of ethylene glycol and/or 1 ,2-propanediol, thereof consist “secondarily” of such species.
  • the selected polyesters herein contain about 46% by weight of dimethyl terephthalic acid, about 16% by weight of 1 ,2-propanediol, about 10% by weight ethylene glycol, about 13% by weight of dimethyl sulfobenzoic acid and about 15% by weight of sulfoisophthalic acid, and have a molecular weight of about 3.000.
  • the polyesters and their method of preparation are described in detail in EP 311 342.
  • Fabric softening agents can also be incorporated into laundry detergent compositions in accordance with the present invention. These agents m ay be inorganic or organic in type. Inorganic softening agents are exemplified by the smectite clays disclosed in GB-A-1 400898 and in US 5,019,292.
  • Organic fabric softening agents include the water insoluble tertiary amines as disclosed in GB-A1 514 276 and EP 0 011 340 and their combination with mono C ⁇ 2 -C ⁇ 4 quaternary ammonium salts are disclosed in EP-B-0 026 528 and di-long-chain amides as disclosed in EP 0 242 919.
  • Other useful organic ingredients of fabric softening systems include high molecular weight polyethylene oxide materials as disclosed in EP 0 299 575 and 0 313 146.
  • Levels of smectite clay are normally in the range from 5% to 15%, more preferably from 8% to 12% by weight, with the material being added as a dry mixed component to the remainder of the formulation.
  • Organic fabric softening agents such as the water-insoluble tertiary amines or di-long chain amide materials are incorporated at levels of from 0.5% to 5% by weight, normally from 1% to 3% by weight whilst the high molecular weight polyethylene oxide materials and the water soluble cationic materials are added at levels of from 0.1% to 2%, normally from 0.15% to 1.5% by weight.
  • These materials are normally added to the spray dried portion of the composition, although in some instances it may be more convenient to add them as a dry mixed particulate, or spray them as molten liquid on to other solid components of the composition.
  • Polymeric dve-transfer inhibiting agents may also comprise from 0.001% to 10%, preferably from 0.01% to 2%, more preferably form 0.05% to 1% by weight of polymeric dye- transfer inhibiting agents.
  • Said polymeric dye-transfer inhibiting agents are normally incorporated into detergent compositions in order to inhibit the transfer of dyes from colored fabrics onto fabrics washed therewith. These polymers have the ability of complexing or adsorbing the fugitive dyes washed out of dyed fabrics before the dyes have the opportunity to become attached to other articles in the wash.
  • Especially suitable polymeric dye-transfer inhibiting agents are polyamine N-oxide polymers, copolymers of N-vinyl-pyrrolidone and N-vinylimidazole, polyvinylpyrrolidone polymers, polyvinyloxazolidones and polyvinylimidazoles or mixtures thereof.
  • a detergent composition of the invention may in an embodiment of the invention besides the endo-glucanase having anti-redeposition effect as defined above, comprise other enzyme(s) which provides cleaning performance and/or fabric care benefits.
  • Such enzymes include certain proteases, lipases, cutinases, cellulases, amylases, peroxidases, oxidases (e.g. laccases), and hemicellulases such as mannanase and pectate lyase.
  • protease suitable for use in alkaline solutions can be used. Suitable proteases include those of animal, vegetable or microbial origin. Microbial origin is preferred. Chemically or genetically modified mutants are included.
  • the protease may be a serine protease, preferably an alkaline microbial protease or a trypsin-like protease.
  • alkaline proteases are subtilisins, especially those derived from Bacillus, e.g., subtilisin Novo, subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin 168 (described in WO 89/06279).
  • trypsin-like proteases are trypsin (e.g.
  • protease enzymes include those sold under the trade names EverlaseTM, KannaseTM, AlcalaseTM, SavinaseTM, PrimaseTM, DurazymTM, and EsperaseTM by Novozymes A S (Denmark), those sold under the tradename Maxatase, Maxacal, Maxapem, Properase, Purafect and Purafect OXP by Genencor International, and those sold under the tradename Opticlean and Optimase by Solvay Enzymes.
  • Protease enzymes m ay be incorporated into the compositions in accordance with the invention at a level of from 0.000001% to 2% of enzyme protein by weight of the composition, preferably at a level of from 0.00001 % to 1 % of enzyme protein by weight of the composition, more preferably at a level of from 0.0001% to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001 % to 0.2% of enzyme protein by weight of the composition.
  • Lipases Any lipase suitable for use in alkaline solutions can be used. Suitable lipases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
  • useful lipases include a Humicola lanuginosa lipase, e.g., as described in EP 258 068 and EP 305 216, a Rhizomucor miehei lipase, e.g., as described in EP 238 023, a Candida lipase, such as a C. antarctica lipase, e.g., the C. antarctica lipase A or B described in EP 214 761 , a Pseudomonas lipase such as a P. alcaligenes and P. pseudoalcaligenes lipase, e.g., as described in EP 218 272, a P.
  • a Humicola lanuginosa lipase e.g., as described in EP 258 068 and EP 305 216
  • a Rhizomucor miehei lipase e.g., as described in EP 238 023
  • cepacia lipase e.g., as described in EP 331 376
  • a P. stutzeri lipase e.g., as disclosed in GB 1 ,372,034
  • a P. fluorescens lipase a Bacillus lipase, e.g., a B. subtilis lipase (Dartois et al., (1993), Biochemica et Biophysica acta 1 131 , 253-260)
  • a B. stearothermophilus lipase JP 64/744992
  • ⁇ . pumilus lipase WO 91/16422
  • a number of cloned lipases may be useful, including the Penicillium camembertii lipase described by Yamaguchi et al., (1991 ), Gene 103, 61-67), the Geotricum candidum lipase (Schimada, Y. et al., (1989), J. Biochem., 106, 383-388), and various Rhizopus lipases such as a R. delemar lipase (Hass, M.J et al., (1991 ), Gene 109, 117-113), a R. niveus l ipase ( Kugimiya et a I., ( 1992), B iosci. B iotech. B iochem. 56, 7 16-719) a nd a R. oryzae lipase.
  • R. delemar lipase Hass, M.J et al., (1991 ), Gene 109,
  • cutinases may also be useful, e.g., a cutinase derived from Pseudomonas mendocina as described in WO 88/09367, or a cutinase derived from Fusarium solani pisi (e.g. described in WO 90/09446).
  • the lipase is a variant of Humicola lanuginosa DSM 4109 as described in WO 00/60063.
  • the variants disclosed in the Example in WO 00/60063 with improved first wash performance i.e., T231 R+N233R; G91A+D96W+E99K+G263Q+L264A+I265T+G266D+T267A+L269N+ 270AGGFSWRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS; R209P+T231 R+N233R; N33Q+D96S+T231 R+N233R+Q249R; E99N+N101 S+T231 R+ N233R+Q249R; E99N+N101S+T231 R+N233R+Q249R.
  • lipases such as M1 LipaseTM and LipomaxTM (Genencor), LipolaseTM and Lipolase UltraTM, LipexTM (Novozymes A/S), and Lipase P "Amano” (Amano Pharmaceutical Co. Ltd.).
  • Suitable cutinases include LumafastTM available from Genencor Inc.
  • the lipases are normally incorporated in the detergent composition at a level of from
  • enzyme protein by weight of the composition preferably at a level of from 0.00001 % to 1 % of enzyme protein by weight of the composition, more preferably at a level of from 0.0001% to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001 % to 0.2% of enzyme protein by weight of the composition.
  • Amylases Any amylase (alpha and/or beta) suitable for use in alkaline solutions can be used. Suitable amylases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included. Amylases include, for example, alpha-amylases obtained from a special strain of ⁇ . licheniformis, described in more detail in GB 1 ,296,839. Commercially available amylases are NatalaseTM, TermamylTM Ultra, DuramylTM, TermamylTM, FungamylTM and BANTM (available from Novozymes A/S) and RapidaseTM and Maxamyl PTM (available from Genencor Inc.).
  • the alpha-amylase is derived from Bacillus sp. strains NCIB 12289, NCIB 12512, NCIB 12513 and DSM 9375. Especially preferred are the alpha-amylases shown in SEQ ID NOS 1 and 2 of WO 95/26397.
  • the alpha-amylase is the AA560 alpha-amylase derived from Bacillus sp. DSM 12649 disclosed as SEQ ID NO: 2 in WO 00/60060 (hereby incorporated by reference).
  • AA560 alpha-amylase derived from Bacillus sp. DSM 12649 disclosed as SEQ ID NO: 2 in WO 00/60060 (hereby incorporated by reference).
  • variants of the AA560 alpha-amylase including the AA560 variant disclosed in Example 7 and 8 (hereby incorporated by reference).
  • the amylases are normally incorporated in the detergent composition at a level of from 0.000001 % to 2% of enzyme protein by weight of the composition, preferably at a level of from 0.00001% to 1% of enzyme protein by weight of the composition, more preferably at a level of from 0.0001% to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001 % to 0.2% of enzyme protein by weight of the composition.
  • Cellulases Any cellulase suitable for use in alkaline solutions can be used. Suitable cellulases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included. Suitable cellulases are disclosed in US 4,435,307, which discloses fungal cellulases produced from Humicola insolens. Especially suitable cellulases are the cellulases having colour care benefits. Examples of such cellulases are cellulases described in European patent application No. 0 495 257.
  • the cellulase is a Thielavia terrestris cellulase, preferably the cellulase disclosed in SEQ ID NO: 9 in WO 96/29397 and SEQ ID NO: 9 herein or an enzyme with at least 70% identity thereto.
  • cellulase is the Thielavia terrestris variant disclosed in Example 1 of WO 98/12307.
  • Cellulases include Celluzyme ® produced by a strain of Humicola insolens, Carezyme ® and Renozyme ® (Novozymes A/S), and KAC-500(B)TM (Kao Corporation).
  • Cellulases are normally incorporated in the detergent composition at a level of from 0.000001% to 2% of enzyme protein by weight of the composition, preferably at a level of from 0.00001 % to 1 % of enzyme protein by weight of the composition, more preferably at a level of from 0.0001 % to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001 % to 0.2% of enzyme protein by weight of the composition.
  • Mannanases Any mannanase suitable for use in alkaline solutions can be used. Suitable mannanases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
  • the mannanase is derived from a strain of the genus Ba- cillus, especially Bacillus sp. I633 disclosed in positions 31-330 of SEQ ID NO:2 or in SEQ ID NO:
  • mannanases are Purabrite available from Genencor Inc. and Mannaway ® produced by Novozymes A/S.
  • Pectate lyase Any pectate lyase suitable for use in alkaline solutions can be used. Suitable pectate lyases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
  • the pectate lyase is derived from a strain of the genus Bacillus, especially a strain of Bacillus subtilis, especially Bacillus subtilis DSM14218 disclosed in SEQ ID NO:2 or a variant thereof disclosed in Example 6 of WO 02/092741.
  • Peroxidases/Oxidases Peroxidase enzymes are used in combination with hydrogen peroxide or a source thereof (e.g. a percarbonate, perborate or persulfate). Oxidase enzymes are used in combination with oxygen. Both types of enzymes are used for "solution bleaching", i.e. to prevent transfer of a textile dye from a dyed fabric to another fabric when said fabrics are washed together in a wash liquor, preferably together with an enhancing agent as described in e.g. WO 94/12621 and WO 95/01426. Suitable peroxidases/oxidases include those of plant, bacterial or fungal origin. Chemically or genetically modified mutants are included.
  • Peroxidase and/or oxidase enzymes are normally incorporated in the detergent composition at a level of from 0.000001 % to 2% of enzyme protein by weight of the composition, preferably at a level of from 0.00001% to 1% of enzyme protein by weight of the composition, more preferably at a level of from 0.0001% to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001% to 0.2% of enzyme protein by weight of the composition.
  • mixtures of the above mentioned enzymes are encompassed herein, in particular a mixture of two, three, four, five, six or more different enzymes, for example a protease, an amylase, a lipase and a cellulase.
  • the enzyme of the invention is normally incorporated in the detergent composition at a level from 0.000001% to 2% of enzyme protein by weight of the composition, preferably at a level from 0.00001% to 1 % of enzyme protein by weight of the composition, more preferably at a level from 0.0001 % to 0.5% of enzyme protein by weight of the composition, even more preferably at a level from 0.001 % to 0.2% of enzyme protein by weight of the composition.
  • Enzymes may be incorporated in the form of liquid solutions or granulates.
  • Non- dusting granulates may be produced, e.g., as disclosed in US 4,106,991 and 4,661 ,452 (both to Novo Industri A S, now Novozymes A/S) and may optionally be coated by methods known in the art.
  • waxy coating materials are poly(ethylene oxide) products (polyethyleneglycol, PEG) with mean molecular weights of 1000 to 20000; ethoxylated nonyl- phenols having f rom 16 to 50 ethylene oxide units; ethoxylated fatty alcohols in which the alcohol contains from 12 to 20 carbon atoms and in which there are 15 to 80 ethylene oxide units; fatty alcohols; fatty acids; and mono- and di- and triglycerides of fatty acids.
  • PEG poly(ethylene oxide) products
  • PEG polyethyleneglycol
  • the detergent composition according to the invention can be in liquid, paste, gels, bars, tablet or granular forms.
  • Granular compositions according to the present invention can also be in "compact form", i.e. they may have a relatively higher density than conventional granular detergents, i.e. form 550 to 950 g/l; in such case, the granular detergent compositions according to the present invention will contain a lower amount of "Inorganic filler salt", compared to conventional granular detergents; typical filler salts are alkaline earth metal salts of sulphates and chlorides, typically sodium sulphate; "Compact" detergent typically comprise not more than 10% filler salt.
  • the liquid compositions according to the present invention can also be in "concentrated form", in such case, the liquid detergent compositions according to the present invention will contain a lower amount of water, compared to conventional liquid detergents.
  • the water content of the concentrated liquid detergent is less than 30%, more preferably less than 20%, most preferably less than 10% by weight of the detergent compositions.
  • the compositions of the invention may for example, be formulated as hand and machine laundry detergent compositions including laundry additive compositions and compositions suitable for use in the pretreatment of stained fabrics, rinse added fabric softener compositions, and compositions for use in general household hard surface cleaning operations and machine or hand dishwashing operations.
  • compositions for the present invention are not necessarily meant to limit or otherwise define the scope of the invention.
  • TAS Sodium tallow alkyl sulphate
  • Nonionic C ⁇ 3 - C 15 mixed ethoxylated/propoxylated fatty alcohol with an average degree of ethoxylation of 3.8 and an average degree of propoxylation of 4.5 sold under the tradename Plurafax LF404 by BASF Gmbh
  • CFAA C 12 - C 14 alkyl N-methyl glucamide
  • NaSKS-6 Crystalline layered silicate of formula ⁇ -Na 2 Si 2 0 5
  • MA/AA Copolymer of 1 :4 maleic/acrylic acid, average molecular weight about 80,000
  • Polyacrylate Polyacrylate homopolymer with an average molecular weight of 8,000 sold under the tradename Sokalan PA30 by BASF Gmbh Zeolite A: Hydrated Sodium Aluminosilicate of formula Na ⁇ 2 (AI0 2 Si0 2 ) 12 .27H 2 0 having a primary particle size in the range from 1 to 10 micrometers
  • Perborate Anhydrous sodium perborate monohydrate bleach, empirical formula NaB0 2 .H 2 0 2
  • PB4 Anhydrous sodium perborate tetrahydrate Percarbonate: Anhydrous sodium percarbonate bleach of empirical formula 2Na 2 C0 3 .3H 2 0 2
  • TAED Tetraacetyl ethylene diamine
  • CMC Sodium carboxymethyl cellulose
  • DETPMP Diethylene triamine penta (methylene phosphonic acid), marketed by Monsanto under the Tradename Dequest 2060
  • PVP Polyvinylpyrrolidone polymer
  • EDDS Ethylenediamine-N, N'-disuccinic acid, [S,S] isomer in the form of the sodium salt
  • HMWPEO High molecular weight polyethylene oxide
  • TAE 25 Tallow alcohol ethoxylate (25)
  • a granular fabric cleaning composition in accordance with the invention may be prepared as follows:
  • a compact granular fabric cleaning composition (density 800 g/l) in accord with the invention may be prepared as follows:
  • Enzyme (incl. endo- ⁇ glucanase) 0.1
  • Granular suds suppressor 3.5 water/minors Up to 100%
  • Granular fabric cleaning compositions in accordance with the invention which are especially useful in the laundering of coloured fabrics were prepared as follows:
  • Enzyme (incl. endo-glucanase) 0.10 0 .05
  • Softening through the wash capability may be prepared as follows:
  • Enzyme incl. endo-glucanase 0.10 0.05
  • Heavy duty liquid fabric cleaning compositions in accordance with the invention may be prepared as follows:
  • Enzyme incl. endo-glucanase 0.10 0.05
  • the enzyme composition of the i nvention may b e u seful i n a d etergent composition for household or industrial laundering of textiles and garments, and in a process for machine wash treatment of fabrics comprising treating the fabrics during one or more washing cycle of a machine washing process with a washing solution containing the enzyme or enzyme preparation of the invention.
  • the enzyme composition of the invention may also be useful in a detergent composition for household or industrial dish or cutlery or other hard surface washing, and in a process for treatment of dishes, cutlery etc. comprising a treatment with a washing solution containing the enzyme or enzyme preparation of the invention.
  • the detergent composition used in the washing process comprises conventional ingredients such as surfactants (anionic, nonionic, zwitterionic, amphoteric), builders, bleaches (perborates, percarbonates or hydrogen peroxide) and other ingredients, e.g. as described in WO 97/01629 which is hereby incorporated by reference in its entirety.
  • the endo-glucanase of t he invention provides advantages such as improved stain removal and decreased soil redeposition.
  • Certain stains for example certain food stains, contain beta-glucans which make complete removal of the stain difficult to achieve.
  • the cellulosic fibres of the fabrics may possess, particularly in the "non-crystalline" and surface regions, glucan polymers that are degraded by this enzyme. Hydrolysis of such glucans, either in the stain or on the fabric, during the washing process decreases the binding of soils onto the fabrics.
  • Household laundry processes are carried out under a range of conditions. Commonly, the washing time is from 5 to 60 minutes and the washing temperature is in the range 10 - 60°C, most commonly from 20 - 40°C. Prolonged soaking is commonly used.
  • the washing solution is normally neutral or alkaline, most commonly with pH 5 - 11.5.
  • Bleaches are commonly used, particularly for laundry of white fabrics and in the washing of hard surfaces. These bleaches are commonly the peroxide bleaches, such as sodium perborate, sodium percarbonate or hydrogen peroxide.
  • the Bacillus sp. DSM 12648 mentioned above comprises the endo-glucanase encoding DNA sequence shown in SEQ ID NO:1.
  • B.subtilis PL2306 This strain is the B.subtilis DN1885 with disrupted apr and npr genes (Diderichsen, B., Wedsted, U., Hedegaard, L, Jensen, B. R., Sj ⁇ holm, C. (1990) Cloning of aldB, which e ncodes a Ipha-acetolactate decarboxylase, a n e xoenzyme from Bacillus brevis. J. Bacteriol., 172, 4315-4321) disrupted in the transcriptional unit of the known Bacillus subtilis cellulase gene, resulting in cellulase negative cells.
  • Competent cells were prepared and transformed as described by Yasbin, R.E., Wil- son, G.A. and Young, F.E. (1975) Transformation and transfection in lysogenic strains of Bacillus subtilis: evidence for selective induction of prophage in competent cells. J. Bacteriol, 121 :296-304.
  • Enzymes for DNA manipulations were used according to the manufacturer's instructions (e.g. restriction endonucleases, ligases etc. are obtainable from New England Biolabs, Inc.).
  • This plasmid is a pUB110 derivative essentially containing elements making the plasmid propagate in Bacillus subtilis, kanamycin resistance gene and having a strong promoter and signal peptide cloned from the amyL gene of B.licheniformis ATCC14580.
  • the signal peptide contains a Sacll site making it convenient to clone the DNA encoding the ma- ture part of a protein in-fusion with the signal peptide. This results in the expression of a Pre- protein which is directed towards the exterior of the cell.
  • the plasmid was constructed by means of ordinary genetic engineering and is briefly described in the following.
  • pMOL944 The pUB110 plasmid (McKenzie, T. et al., 1986, Plasmid 15:93-103) was digested with the unique restriction enzyme Neil. A PCR fragment amplified from the amyL promoter encoded on the plasmid pDN1981 (P.L. J ⁇ rgensen et al., 1990, Gene, 96, p37-41.) was digested with Neil and inserted in the Neil digested pUB110 to give the plasmid pSJ2624. The two PCR primers used have the following sequences: # LWN5494 (SEQ ID NO:5)
  • the primer #LWN5494 inserts a Notl site in the plasmid.
  • the plasmid pSJ2624 was then digested with Sacl and Notl and a new PCR fragment amplified on amyL promoter encoded on the pDN1981 was digested with Sacl and Notl and this DNA fragment was inserted in the Sacl-Notl digested pSJ2624 to give the plasmid pSJ2670.
  • This cloning replaces the first amyL promoter cloning with the same promoter but in the opposite direction.
  • the two primers used for PCR amplification have the following sequences:
  • #LWN5938 (SEQ ID NO:7) 5 ' -GTCGGCGGCCGCTGATCACGTACCAAGCTTGTCGACCTGCAGAATG
  • the plasmid pSJ2670 was digested with the restriction enzymes Pstl and Bell and a
  • PCR fragment amplified from a cloned DNA sequence encoding the alkaline amylase SP722 (Patent # W09526397-A1 ) was digested with Pstl and Bell and inserted to give the plasmid pMOL944.
  • the two primers used for PCR amplification have the following sequence: #LWN7864 (SEQ ID NO:9) 5 ' -AACAGCTGATCACGACTGATCTTTTAGCTTGGCAC-3 '
  • the primer #LWN7901 inserts a Sacll site in the plasmid.
  • the strain DSM 12648 was propagated in liquid medium 2xTY containing 1% carboxymethyl-cellulose + (0.1 M Na2C03 + 0.1 M NaHC03 separately autoclaved and added aseptically after cooling to room temperature). After 16 hours of incubation at 30°C and 300 rpm, the cells were harvested, and genomic DNA was isolated by the method described by Pitcher et al. [Pitcher, D. G., Saunders, N. A., Owen, R. J; Rapid extraction of bacterial genomic DNA with guanidium thiocyanate; Lett Appl Microbiol 1989, 8:151-156].
  • LBPG is LB agar supplemented with 0.5% Glucose and 0.05 M potassium phosphate, pH 7.0
  • AZCL-HE-cellulose is added to LBPG-agar to 0.5 % AZCL- HE-cellulose is from Megazyme, Australia.
  • BPX media is described in EP 0 506 780 (WO 91/09129).
  • Cal 18-2 media is described in patent application WO 00/75344 A1).
  • test for anti-redeposition effect used in combination with the "test for anti-redeposition effect" described below, is to determine if an enzyme is an endo-glucanase with anti- redeposition effect, according to this invention.
  • the test is made by determining the color released from an insoluble, colored, glucan substrate over a reaction time of 30 minutes at a temperature of 40°C.
  • Enzyme sample The enzyme sample for testing is a solution of the enzyme protein with a concentration of 0.1 mg /ml. Standard biochemical techniques can be used to verify the purity and determine the protein concentration of the sample.
  • Buffer Prepare a 0.05M phosphate buffer solution with pH 7.0 from NaH 2 P0 4 .2H 2 0 and NaOH and add 1g/l nonionic surfactant (e.g. Berol 537, from Akzo Nobel).
  • Test method Transfer 6 ml buffer into two test tubes. To one tube add 50 ⁇ l of the enzyme sample. No enzyme is added to the second t ube. Add one beta-glucazyme tablet (supplied by Megazyme, Ireland, catalogue number T-BGZ) to each tube. Mix the contents of the tubes for 10 seconds with a vortex mixer, then place the tubes in a 40°C water bath. After 10 minutes and after 20 minutes, mix the contents of the tubes by inverting the tubes. After 30 minutes, mix the contents of the tubes by inverting the tubes and then filter the contents of the tubes through a Whatman GF/C 9cm filter, collecting the filtrates in clean tubes. Measure the color released as OD at 590 nm using a spectrophotometer. Calculate deltaOD by subtracting the result with no enzyme from the result with enzyme.
  • the purpose of this test used in combination with the "test for endo-glucanase activity" described above, is to determine if an enzyme is an endo-glucanase with anti- redeposition effect, according to this invention.
  • the anti-redeposition effect is measured by a wash test.
  • the anti-redeposition wash test is made by washing samples of soiled cotton fabric and samples of clean cotton fabric, both together, in a small-scale wash test apparatus. After the washing the soil on the originally clean cotton fabric is evaluated by light reflectance.
  • E nzyme sample The enzyme sample for testing is a solution of the enzyme protein with a concentration of 0.1 mg /ml. Standard biochemical techniques can be used to verify the purity and determine the protein concentration of the sample.
  • Cotton fabric #2003 white woven 100% cotton fabric, supplied by Tanigashira, 4-11- 15 Komatsu Yodogawa-ku, O saka, 533-0004, Japan. T he new cotton fabric is pre-washed three times before use in the wash test. The pre-washing is done using a European household front-loader washing machine, and using a standard 40°C wash process. LAS (Surfac ® SDBS80 sodium alkylbenzene sulfonate, 80%) is added to the wash water at concentration 0.5 g per liter and the wash solution pH is adjusted to 10 by addition of sodium carbonate. After the pre-washing the fabric is dried in a tumbler drier. Swatches of the pre-washed cotton fabric, size 5x5cm, weight approximately 0.3g each, are cut out and these swatches are used for the wash tests.
  • LAS Sudfac ® SDBS80 sodium alkylbenzene sulfonate
  • Soiled cotton swatches Swatches of the pre-washed #2003 fabric, prepared as above, are soiled as follows. A suspension of 210 mg carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) is prepared in 75 ml tetrachloroethylene (Fluka, cat. nr. 86972) by strong stirring. The cotton swatches are placed flat on a horizontal metal surface. 300 ⁇ l of the carbon suspension is pipetted onto the centre of each cotton swatch. The soiled cotton swatches are allowed to dry at room temperature overnight.
  • carbon black carbon black
  • Detergent solutions are prepared as follows. To prepare 1 liter of solution, dissolve in deionised water 0.5g sodium carbonate and 1.0g sodium hydrogen carbonate and add 2 ml of a solution containing 117.8 g/l CaCI 2 .2H 2 0 and 54.3 g/l MgCI 2 .6H 2 0. This calcium/magnesium addition provides a water hardness of 12 °dH. Add 0.5g LAS (Surfac SDBS80 sodium alkylbenzene sulfonate, 80%, supplied by Surfachem, UK or an equivalent material) and adjust the final volume to 1 liter. Adjust the pH to 9.5 (e.g.
  • the detergent solutions are pre-warmed to 40°C before starting the test.
  • the cotton swatches and 100 ⁇ l of the enzyme sample are added at the start of the 30 minute wash period.
  • the reference test, with no added enzyme, is started at the same time.
  • the enzyme is an endo-glucanase with anti-redeposition effect according to the invention if the anti-redeposition effect obtained is >7.5, and the result in the test for endo- glucanase activity, above, is >0.2.
  • the test is made by comparing the color released from an insoluble colored cellulase substrate over a reaction time of 60 minutes at a temperature of 40°C when the solution contains a buffer but no surfactant and when the solution contains a buffer and LAS. If the enzyme is stable during the 60 minute reaction time then the color released is greater than if the enzyme is not stable, because the stable enzyme will continue to degrade the substrate whereas the non-stable enzyme will not continue to degrade the substrate. In the context of the present invention, if the result with LAS is > 50% of the result without LAS then the enzyme is LAS stable.
  • the LAS is Surfac ® SDBS80 sodium alkylbenzene sulfonate, 80% (supplied by Surfachem, UK) or an equivalent material.
  • the concentration of the enzyme is such that the result for deltaOD (no LAS), calculated as described below, is in the range 0.2 to 0.5.
  • the wash tests are made by washing samples of soiled cotton fabric and samples of clean cotton fabric, both together, in a small-scale wash test apparatus. After the washing the soil on the cotton fabric is evaluated by light reflectance. Both the originally soiled cotton fabric and the originally clean cotton fabric samples are evaluated.
  • Cotton fabric #2003 white woven 100% cotton fabric, supplied by Tanigashira, 4-11-
  • the new cotton fabric is pre-washed three times before use in the wash test.
  • the pre-washing is done using a European household front-loader washing machine, and using a standard 40°C wash process.
  • LAS Sudfac ® SDBS80 sodium alkylbenzene sulfonate, 80%
  • the wash solution pH is adjusted to 10 by addition of sodium carbonate.
  • the fabric is dried in a tumbler drier. Swatches of the pre-washed cotton fabric, size 5x5cm, weight approximately 0.3g each, are cut out and these swatches are used for the wash tests.
  • Soiled cotton swatches These are prepared from the 5x5cm swatches described above.
  • the detergent solutions are pre-warmed to 40°C before starting the test.
  • the fabric and the enzymes are added at the start of the 30 minute wash period. After the wash, the fabric swatches are rinsed for 5 minutes under running tap water, then spread out flat and allowed to air dry at room temperature overnight.
  • Detergent solutions are prepared as follows: To prepare 1 liter of solution, dissolve in deionised water 0.5g sodium carbonate and 1.0g sodium hydrogen carbonate and add 2 ml of a solution containing 117.8 g/l CaCI 2 .2H 2 0 and 54.3 g/l MgCI 2 .6H 2 0. This calcium/magnesium addition provides a water hardness of 12 °dH. Add nonionic surfactant (Berol ® 537, Akzo Nobel) and/or LAS (Surfac ® SDBS80 sodium alkylbenzene sulfonate, 80%) and adjust the final volume to 1 liter. Adjust the pH to either pH 9.5 (by addition of sodium carbonate) or to pH 7.5 (by addition of 10% citric acid solution). The concentration of LAS and of nonionic surfactant and the detergent solution pH are specified below for each wash test.
  • nonionic surfactant Berol ® 537, Akzo Nobel
  • LAS Sudfac ®
  • Enzyme addition The enzymes to be tested are pre-dissolved at known concentrations in water, and the required amount of enzyme is added to the detergent solution at the start of the wash process.
  • the enzyme detergency benefit is a measure of how much more clean the swatches, both the originally soiled and the originally clean, become a s a result of i ncluding e nzymes i n the wash test.
  • the enzyme d etergency benefit is calculated as follows: After the wash test the average R, 500nm value for the soiled swatches is R, soiled. After the wash test the average R, 500nm value for the clean swatches is R, clean.
  • the enzyme detergency benefit from a wash test with enzymes is the sum of R, soiled + R, clean with enzymes minus the sum of R, soiled + R, clean with no added enzyme.
  • the enzyme detergency benefit value determined in this way is a combined measure both of the removal of soil from the fabric and of the redeposition of soil onto the fabric.
  • the enzyme detergency benefit value can have values that are negative or positive.
  • the enzyme detergency benefit value can be used to compare the performance of different enzymes. The highest positive detergency benefit value is the preferred result.
  • the endo-glucanase encoding DNA sequence of the invention was PCR amplified using the PCR primer set consisting of these two oligo-nucleotides:
  • the oligonucleotides were used in a PCR reaction in HiFidelityTM PCR buffer (Boehringer Mannheim, Germany) supplemented with 200 micro M of each dNTP, 2.6 units of HiFidelityTM Expand enzyme mix and 200 pmol of each primer. Chromosomal DNA isolated from Bacillus sp. DSM12648 as described above was used as template. The PCR reaction was performed using a DNA thermal cycler (Landgraf ® , Germany).
  • the isolated PCR DNA fragment was then ligated to the Sacll-Notl digested and purified pMOL944. The ligation was performed overnight at 16°C using 0.5 micro g of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boe- hringer Mannheim, Germany).
  • the ligation mixture was used to transform competent ⁇ . subtilis PL2306.
  • the transformed cells were plated onto LBPG-10 micro g/ml of kanamycin-agar plates. After 18 hours incubation at 37°C colonies were seen on the plates.
  • Several clones were analyzed by isolating plasmid DNA from overnight culture broths. One such positive clone was re-streaked several times on agar plates as used above; this clone was called M B1181-7.
  • the c lone M B1181-7 was grown overnight i n TY-10micro g/mL kanamycin at 37°C, and next day 1 ml of cells were used to isolate a plasmid from the cells using the Qiaprep ® Spin Plasmid Miniprep Kit #27106 according to the manufacturers recommendations for B. subtilis plasmid preparations.
  • This DNA was sequenced and revealed a DNA sequence identical to the endo-glucanase gene in SEQ ID NO:1 bp 1-2322 encoding the mature endo-glucanase.
  • the derived protein sequence is represented in SEQ ID NO: 2.
  • MB1181-7 obtained as described in Example 1 was grown in 15 x 200 ml Cal-18-2 media with 10 microg/mL of kanamycin, in 500 mL two-baffled shake flasks, for 4 days at 37°C at 300 rpm, whereby about 2500 ml of culture broth was obtained.
  • the culture fluid was flocculated by adding 50% CaCI 2 (10 ml per liter of culture broth) together with 11% sodium alu- minate (10 mL per liter of culture broth), maintaining the pH between 7.0 and 7.5 by adding 20% formic acid.
  • the supernatant was clarified using Whatman glass filters GF/D and C. Then ultra- filtration was used to concentrate and reduce the ionic strength of the solution.
  • the ultra- filtration membrane was Filtron ® UF with a cut-off of 10 kDa. After ultra-filtration the solution had conductivity ⁇ 3mS/cm. The pH was adjusted to pH 8.0.
  • the activity units, ECU are determined by method SM-0302, which is available from Novozymes A/S on request.
  • ECU method the ability of the enzyme sample to reduce the viscosity of a solution of carboxymethyl-cellulose is determined, and the result is given in ECU.
  • a vibration viscosimeter such as MIVI 3000, Sofraser ® , France is used to measure the viscosity.
  • This test demonstrates the stain removal and anti-redeposition effects of the endo- glucanase obtained in Example 2. Additionally this test demonstrates that the enzyme performance is essentially unchanged when sodium perborate bleach is included.
  • Cotton swatches are stained with beta-glucan (from barley) plus carbon black. Soiled swatches are washed together with clean swatches. After washing the swatches are rinsed and dried. The soil removal from the soiled switches and the soil redeposition onto the clean swatches is determined by reflectance measurements. The soil removal and soil redeposition after washing without or with addition of the endo-glucanase are compared.
  • Swatches Cut from 100% cotton fabric, type #2003 (Tanigashira, Osaka, Japan), pre-washed at 40°C as a precaution to remove any water soluble contaminations, size 5x5cm, weight approximately 0.3g.
  • Washing equipment Stirred beakers, beaker volume 250 ml, with temperature control by water bath heating. The equipment is the Mini-Terg-O-Tometer, a multi-beaker miniature agitator washer, as described in the Materials and Methods section.
  • Detergent solution Prepared by adding the following into deionised water. Sodium carbonate, 0.5 g per liter
  • Anionic surfactant Surfac ® SDBS80 (sodium alkylbenzene sulphonate), 0.5 g per liter
  • Nonionic surfactant Berol ® 537 (Akzo Nobel), 1.0 g per liter Sodium perborate, type SPB from wfk Testgewebe, either 0 or 1.0 g per liter
  • Solution pH is approximately 9.5.
  • washing procedure 100mL detergent solution is added to each beaker.
  • the water bath temperature is 40°C.
  • the mechanical agitators are operated at approximately 125 rpm.
  • the detergent solutions are pre-warmed for 10 minutes and then the endo-glucanase and the swatches are added.
  • three soiled swatches (prepared as described below) and three clean swatches are added to each beaker. After washing for 30 minutes, the swatches are removed from the detergent solution, rinsed under running tap water for 5 minutes, spread flat on absorbent paper and allowed to dry.
  • Reflectance measurements Made using a Macbeth ® 7000 Color Eye reflectance spectrophotometer. In the case of the soiled swatches, each swatch is measured once in the center of the soiled area, then the average value is calculated. In the case of the clean swatches, each swatch is measured once on each side, then the average value is calculated.
  • the reflectance measurements are all made at 500nm.
  • Soiled swatches are made using beta-glucan (from barley) and car- bon black ("carbon for detergency tests" supplied by Sentaku Kagaku Kyokai, Tokyo, Japan). Dissolve about 0.67g of beta-glucan in 100 mL tap water by stirring and warming to >50°C. Add 0.33g carbon black. Blend with an UltraTurrax ® T25 blender, speed 4000 rpm for 2 minutes. Apply 250 microL of the beta-glucan/carbon onto the center of each swatch. Allow to dry overnight at room temperature. The swatches used in this example had an average reflectance value of 93.5 before soil application and 17.5 after soiling.
  • Endo-glucanase addition The endo-glucanase from Example 2 was added to give an activity concentration of 0, 20 or 100 ECU per liter of detergent solution.
  • the activity units, ECU are determined by method SM-0302, as above.
  • the endo-glucanase increased the removal of soil from the fabric, as seen by the increased reflectance value of the stained swatches after washing with endo-glucanase as compared to the result after washing without endo-glucanase.
  • the endo-glucanase also decreases the soil redeposition, as seen by the increased reflectance value of the clean swatches after washing with endo-glucanase.
  • the improvements of soil removal and anti- redeposition provided by the endo-glucanase are essentially unchanged by the addition of the bleach.
  • Clean cotton fabric is washed together with soiled cotton fabric in a solution of a household detergent.
  • the wash is carried out in a Terg-O-Tometer. During the wash, soil is released from the soiled fabric into the detergent liquor. This soil can then redeposit onto the clean cotton. After washing, the cotton fabrics are rinsed and dried, and then measured with a reflectance spectrophotometer in order to detect the degree of soil redeposition.
  • Detergent Powder household detergent, Asian.
  • Detergent concentration 0.67g/l in water with hardness 4°dH. 1000 mL of detergent solution per T-O-T beaker.
  • Cotton fabric Total of 33g fabric per T-O-T beaker, comprising suitably sized pieces of: white woven cotton, #2003 (Tanigashira, Osaka, Japan), total weight 11g white cotton interlock, total weight 13g soiled cotton fabric, type EMPA101 (EMPA, Switzerland), total weight 9g. Wash: Temperature 25°C, wash time 40 minutes, at 125 rpm. After washing the #2003 cotton is rinsed under running tap water for 10 minutes, then dried. Reflectance measurements. The pieces of #2003 woven cotton are measured, on both sides, using a Macbeth ® 7000 reflectance spectrophotometer, 500nm. The average result for measurements from each T-O-M beaker is calculated.
  • the activity units, ECU are determined by method SM-0302, as above. From the results it can be concluded that addition of the endo-glucanase reduces the soil redeposition.
  • the LAS stability % was determined by the procedure described above. The following enzymes were tested:
  • Carezyme is the trade name for enzyme products from Novozymes A/S that contain (as the only enzyme component) the 43 kD cellulase derived from Humicola insolens DSM 1800 disclosed in WO 91/17243 (SEQ ID NO: 2 and hereby incorporated by reference). Detergent compositions containing this enzyme are disclosed in EP 822 973.
  • Renozyme is the trade name for enzyme products from Novozymes A/S that contain (as the only enzyme component) the Thielavia terrestris cellulase variant disclosed in Example 1 of WO 98/12307.
  • Endo-glucanase This is an endo-glucanase with anti-redeposition effect as defined above.
  • a method for preparation of this enzyme is described in Example 2.
  • the soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A suspension of 210 mg carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) was prepared in 75 ml tetrachloroethylene (Fluka ® , cat. nr. 86972) by strong stirring. The cotton swatches were placed flat on a horizontal metal surface. 300 ⁇ l of the carbon suspension was pipetted onto the centre of each cotton swatch. The soiled cotton swatches were allowed to dry at room temperature overnight. For this test the detergent composition was as described above and with the following surfactants and pH:
  • the enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
  • a suitable cellulase can be obtained from samples of the commercial product Renozyme ® from Novozymes A/S or derived as described in Example 1 of WO 98/12307.
  • the endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above.
  • a method for preparation of this enzyme is described in Example 2.
  • the purpose of this test was to measure the enzyme detergency benefit of Stainzyme ® alone and of Stainzyme ® in combination with endo-glucanase on a soil that contains starch.
  • Stainzyme ® is the trade name of a commercially available alpha-amylase product produced by Novozymes A/S. Stainzyme ® is intended for use in detergents for laundry and hard surface cleaning.
  • soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, p repared a s a bove, were soiled as follows. A s uspension of 4.5g of potato starch ("kartoffelmel", produced by KMC kartoffelmel-centralen, DK-7400 Herning, Denmark, starch content approximately 80%) was prepared in 500ml tap water with stirring, then heated to boiling and then cooled.
  • kartoffelmel produced by KMC kartoffelmel-centralen, DK-7400 Herning, Denmark, starch content approximately 80%
  • the enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures.
  • Standard biochemical techniques can be used to purify and characterise the enzymes.
  • a suitable amylase can be obtained from samples of the commercial product
  • Stainzyme ® from Novozymes A/S or derived from ⁇ . licheniformis variants as disclosed in WO 01/66712 and WO 01/64852.
  • the endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above.
  • a method for preparation of this enzyme is described in Example 2. In this test the soil contains starch. The results show that the combinations of endo- glucanase and Stainzyme ® give a higher enzyme detergency benefit than Stainzyme ® alone.
  • the purpose of this test was to measure the enzyme detergency benefit of Savinase alone and of Savinase in combination with endo-glucanase on a soil that contains protein.
  • Savinase ® is the trade name of subtilisin 309. It is a commercially available protease product produced by Novozymes A/S. Savinase ® is intended for use in detergents for laundry and hard surface cleaning.
  • the soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A solution of 7.2g of gelatine (gelatine from porcine skin, Fluka ® , cat. number 04055) was prepared in 100ml tap water by warming and with stirring. 10 ml of this solution was diluted to 50ml with water and 165 mg of carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) were added, and the suspension was homogenised with an UltraTurrax ® blender. The cotton swatches were placed flat on a horizontal metal surface. 250 ⁇ l of the carbon/gelatine suspension was pipetted onto the centre of each cotton swatch. The soiled cotton swatches were allowed to dry at room temperature overnight.
  • gelatine gelatine from porcine skin, Fluka ® , cat
  • the enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
  • a suitable protease can be obtained from samples of the commercial product Savinase ® from Novozymes A S or derived from Bacillus lentus NCIB 10309 as described in US 3,723,250.
  • the endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above.
  • a method for preparation of this enzyme is described in Example 2.
  • the purpose of this test was to measure the enzyme detergency benefit of a mannanase alone and of a m annanase in combination with endo-glucanase on a soil that contains galactomannan.
  • soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A solution of 667 mg of guar gum (Sigma ® , G 4129) was prepared in 200ml tap water by warming and with stirring and 332 mg of carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) were added, and the suspension was homogenised with an UltraTurrax ® blender. The cotton swatches were placed flat on a horizontal metal surface. 500 ⁇ l of the carbon/guar gum suspension was pipetted onto the centre of each cotton swatch. The soiled cotton swatches were allowed to dry at room temperature overnight.
  • the enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
  • a suitable mannanase can be obtained from Bacillus sp.1633, disclosed in WO 99/64619. Preferred is the mannanase of SEQ ID NO: 2 of WO 99/64619.
  • the endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above.
  • a method for preparation of this enzyme is described in Example 2.
  • BioPrep ® is the trade name of a commercially available pectate lyase product produced by Novozymes A/S. BioPrep ® is intended for use in cleaning of cotton fibres.
  • the soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A solution of 150 mg of pectin (Sigma ® , P 9311 ) was prepared in 50ml tap water by warming and with stirring and 83 mg of carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) were added, and the suspension was homogenised with an UltraTurrax ® blender. The cotton swatches were placed flat on a horizontal metal surface.
  • pectin Sigma ® , P 9311
  • the enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
  • a suitable pectate lyase can be obtained from Bacillus licheniformis, as described in US 6,124,127.
  • the endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above.
  • a method for preparation of this enzyme is described in Example 2.
  • EXAMPLE 11 Wash test: Lipex ® and endo-glucanase
  • Lipex ® is the trade name of a commercially available lipase product produced by
  • Novozymes A/S. Lipex ® is intended for use in detergents for laundry and hard surface cleaning.
  • soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A suspension of 1.5 g of oat flakes (rolled, toasted oats, containing approximately 7% fats by weight, e.g. from Faellesindk ⁇ b l/S, 2605 Br ⁇ ndby, Denmark) was prepared in 500ml tap water by stirring and heating to boiling and homogenising with an UltraTurrax ® blender and then cooling.
  • oat flakes rolled, toasted oats, containing approximately 7% fats by weight, e.g. from Faellesindk ⁇ b l/S, 2605 Br ⁇ ndby, Denmark
  • the enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
  • the l ipase can e ither be o btained from samples of the commercial p roduct L ipex ® from Novozymes A/S or derived from suitable Humicola lanuginosa variants as described in WO 00/60063.
  • the endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above. A method for preparation of this enzyme is described in Example 2.
  • Carezyme i.e. the 43 kD cellulase derived from Humicola insolens.
  • Example 2 enzyme is an anti-redeposition endo-glucanase, i.e. an endo-glucanase with anti-redeposition effect according to the invention, and that Carezyme is not.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Detergent Compositions (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

A detergent composition is provided comprising an endo-glucanase which prevents redeposition of soil. The detergent composition may additionally comprise other enzymes, e.g a fungal cellulase. A process of washing a fabric of hard surface with said composition is described.

Description

DETERGENT COMPOSITION
The present invention relates to a detergent composition comprising an endo- glucanase that p rovides i mproved d etergency p erformance. The i nvention a Iso relates to a detergent composition comprising a combination of an endo-glucanase and other enzymes. One aspect of the invention relates to a process of washing a fabric or hard surface with the endo-glucanase-containing detergent.
BACKGROUND OF THE INVENTION
An important objective of a washing process is to transfer, as completely as possible, the soil from the object being washed into the washing solution, such that the soil can then be discarded with the wash solution. A wash process which merely redistributes the soil on the object being washed is obviously not satisfactory. Thus evaluations of detergency performance, i.e. the performance of washing processes, must include consideration both of the removal of soil from the object being washed and of the redeposition of this soil onto the object being washed or onto the equipment being used for the wash process.
With some soils and some surfaces it is very difficult to achieve a satisfactory detergency performance. Problem soils include p articulate soils such as clays and carbon. Visible soils are often difficult to wash away completely because they are bound to, or attracted to, a surface by traces of non-visible, sticky substances. Problem surfaces include the surfaces of cotton fibres.
To help overcome such problem soils, detergent formulations may include an anti- redeposition agent. The anti-redeposition agent is added in order to ensure that the above mentioned problem soils, once detached from the fabrics, can be kept dissolved or suspended in the wash liquor in such a way that they are not re-deposited on the cleaned fabric. To obtain both an anti-redeposition effect and a cleaning effect it has been suggested to add a mixture of cellulases to the detergent, one cellulase having anti- redeposition effect and one having a cellulose-degrading effect. EP 822 973 relates to a detergent composition comprising a mixture of cellulases and optionally also containing additional enzymes. However, there is a need for improved combinations of enzymes having anti-redeposition effect and other enzymes, such as proteases, amylases, hemi-cellulases, lipases and pectinases.
Enzymes are commonly used to remove the sticky substances that increase soil binding. There is a need for improved enzyme performance in terms of soil removal and/or prevention of soil redeposition. SUMMARY OF THE INVENTION
The invention relates to a detergent composition comprising an anti-redeposition endo-glucanase, i.e. an endo-glucanase having anti-redeposition effect. The inventors have found that such endo-glucanase containing detergents give advantages when used for washing fabrics (especially laundry washing) or hard surfaces (especially automatic dish washing).
In the context of the present invention, an endo-glucanase having anti-redeposition effect is characterised by its ability to prevent redeposition in a wash test.
The inventors also have found that detergent compositions comprising specific combinations of certain endo-glucanase(s) having anti-redeposition effect and certain cellulase(s) having increased stability towards anionic tensides such as linear (straight-chain) alkyl benzene sulfonates (often referred to as "LAS"), have advantages compared to the prior art detergent compositions described in EP 822 973. For instance, a decreased amount of enzyme protein is necessary to obtain the desired cleaning and anti-redeposition effect. This results in improved product economy.
The inventors also have found that it is surprisingly advantageous to include an endo- glucanase having anti-redeposition effect in detergents that also contain other enzymes. These other enzymes include, for example, enzymes that are classified as protease, amylase, beta-glucanase, lipase, hemi-cellulase, cutinase, pectinase and pectate lyase. Thus in a first aspect the invention relates to a detergent composition comprising an endo-glucanase, wherein the endo-glucanase is selected from one of: (i) the endo-glucanase having the amino acid sequence of position 1 to p osition 773 of
SEQ ID NO: 2; (ii) an endo-glucanase having a sequence of at least 90% identity to the amino acid se- quence of position 1 to position 773 of SEQ ID NO:2; or a fragment thereof that has endo-glucanase activity; (iii) an endo-glucanase characterized by the wash test method disclosed herein.
In a second aspect the invention relates to a detergent composition comprising ani- onic tensides and a combination of an endo-glucanase as defined above and a fungal cellu- lase, wherein both enzymes are stable in the presence of anionic tensides.
In a third aspect the invention relates to a detergent composition containing both an endo-glucanase as defined above and one or more other enzyme from classes such as, but not limited to protease, amylase, beta-glucanase, lipase, hemi-cellulase, cutinase, pectinase and pectate lyase. In an aspect the invention relates to a process of using a detergent composition of the invention for washing or cleaning of fabric, hard surfaces or other objects in need of cleaning.
DETAILED DESCRIPTION OF THE INVENTION
The invention relates to a detergent composition comprising an endo-glucanase having anti-redeposition effect.
The endo-glucanase with anti-redeposition effect The endo-glucanase having anti-redeposition effect is according to the invention selected from one of: (i) the endo-glucanase having the amino acid sequence of p osition 1 to position 773 of
SEQ ID NO: 2; (ii) an endo-glucanase having a sequence of at least 90% identity to the amino acid se- quence of position 1 to position 773 of SEQ ID NO:2; or a fragment thereof that has endo-glucanase activity; (iii) any endo-glucanase characterized by the wash test method disclosed below.
In a preferred embodiment the endo-glucanase is derived from Bacillus sp. AA349, DSM 12648 and also shown in SEQ ID NO: 2 herein or a sequence being 90% identical thereto.
The strain Bacillus sp. AA349, which has been isolated from a soil sample originating in Greece, was deposited by the inventors according to the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure at the Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH, Mascheroder Weg 1 b, D-38124 Braunschweig, Germany, on 25 January 1999 under the deposition number DSM 12648.
The deposit was made by Novo Nordisk A/S and was later assigned to Novozymes A S.
Detergent compositions comprising anionic tensides
A preferred embodiment the invention relates to a detergent composition comprising anionic tensides, and to a combination of an endo-glucanase as defined above and a fungal cellulase, wherein both enzymes are stable in the presence of anionic tensides, such as LAS. For the purpose of the present invention, enzymes that are stable in LAS are defined by a LAS stability test. Enzymes that give a LAS stability result of at least 50% are regarded as being LAS stable. Detergents commonly contain more than one type of surfactant, for example combinations of both anionic and nonionic surfactants. In a preferred embodiment the invention relates to detergent formulations in which the ratio (based on weight) between anionic and non- ionic surfactants is >1 :1 , preferably >1.5:1. Thus, in a preferred embodiment the invention relates to a detergent composition wherein
(a) the endo-glucanase is selected from one of:
(i) the endo-glucanase having the amino acid sequence of position 1 to position 773 of SEQ ID NO: 2; (ii) an endo-glucanase having a sequence of at least 90% identity to the amino acid sequence of position 1 to position 773 of SEQ ID NO:2; or a fragment thereof that has endo-glucanase activity; and
(b) the cellulase is selected from one of:
(i) the cellulase having the amino acid sequence of position 1 to position 299 of SEQ ID NO: 4; or
(ii) a cellulase having a sequence of at least 70% identity to the amino acid sequence of position 1 to position 299 of SEQ ID NO:4, or a fragment thereof that has cellulase activity.
Alternatively, the endo-glucanase of (a)(i) above is derived from Bacillus sp.
KSMS237 deposited as FERM P-16067 (with the Patent Microorganism Depository, National
Institute of Bioscience and Human-Technology, Agency of Industrial Science & Industry,
Tsukuba-shi, Ibaraki, 305 Japan) and shown in position 1 to 824 of SEQ ID NO: 1 of JP
2000210081 A (hereby incorporated by reference). Other alternative cellulases are the LAS resistant variants disclosed in Example 8 of
WO 98/12307. Preferred embodiments of the invention comprise these alternative cellulases in combination with the endo-glucanases of (a) above.
In a preferred embodiment the cellulase is a Thielavia terrestris cellulase, preferably the cellulase disclosed in SEQ ID NO: 9 in WO 96/29397 and SEQ ID NO: 4 herein or an enzyme with at least 70% identity thereto. In a preferred embodiment the cellulase is the
Thielavia terrestris variant disclosed in Example 1 of WO 98/12307.
Identity
In the context of the present invention the degree of identity is determined between two sequences indicating a derivation of the first sequence from the second. The identity is determined by means of the computer program GAP provided in the GCG program package. Thus, Gap GCGvδ is used with the following default parameters: GAP creation penalty of 3.0 and GAP extension penalty of 0.1 , the default scoring matrix, for protein sequences. GAP uses the method of Needleman/Wunsch/Sellers to make alignments.
Detergent compositions comprising other enzymes Various types of enzymes are very commonly included in detergent formulations for laundry cleaning and for hard surface cleaning. One purpose of these enzymes is to degrade soil binding substances. These substances bind or attract soil and stains onto the fabric or hard surface. T he degraded substances, and t he associated s oil and stain, are then more easily removed during the washing process. Redeposition of soil, which can be increased by soil binding substances, is prevented.
The substance on which an enzyme acts is called the substrate. Enzymes are known to be "substrate specific", i.e. each class of enzyme can only degrade one class of substances. F or e xample, a p rotease c an d egrade p roteins b ut c annot d egrade s tarch. A n amylase can degrade starch but cannot degrade proteins. Because the soils and stains that are important for detergent formulators can contain many kinds of soil binding substances, a range of different enzymes, all with different substrate specificities have been developed for use in detergents. T hese include enzymes such as protease, amylase, beta-glucanase, lipase, hemi-cellulase, cutinase, pectinase and pectate lyase. Surprisingly it has been found that the endo-glucanase of the invention are not substrate specific, in that they can provide detergency benefits on a wide range of soils and stains when used in combination with other enzymes.
The endo-glucanase of the present invention includes, in addition to the enzymes specified by reference to S EQ ID N O 2 , other endo-glucanases with s urprisingly h igh a nti- redeposition effect. Two tests are provided in order to describe and identify these enzymes: 1 ) a test for endo-glucanase activity, and 2) a test for anti-redeposition effect. Enzymes which provide greater than the specified minimum performance on both these tests are regarded, for the purpose of this invention, as endo-glucanases having anti-redeposition effect.
Thus in a preferred embodiment an endo-glucanase of the invention is used together with a n a mylase t o p rovide i mproved d etergency p erformance o n s oils t hat contain s tarch. Such amylases comprise e.g. α- or β-amylases of bacterial or fungal origin. Chemically or genetically modified mutants of such amylases are included in this connection. Relevant α- amylases include, for example, α-amylases obtainable from Bacillus species, in particular a special strain of β. licheniformis, described in more detail in GB 1296839. Relevant commercially available amylases include Natalase™, Stainzyme®, Duramyl®, Termamyl®, Termamyl™ Ultra, Fungamyl® and BAN® (all available from Novozymes A/S, Bagsvaerd, Denmark), and Rapidase™ and Maxamyl™ P (available from DSM, Holland). In a preferred embodiment the alpha-amylase is derived from Bacillus sp. strains NCIB 12289, NCIB 12512, NCIB 12513 and DSM 9375. Especially preferred are the alpha- amylases shown in SEQ ID NOS 1 and 2 of WO 95/26397.
In another preferred embodiment the alpha-amylase is the AA560 alpha-amylase derived from Bacillus sp. DSM 12649 disclosed as SEQ ID NO: 2 in WO 00/60060 (hereby incorporated by reference). Especially preferred are variants of the AA560 alpha-amylase, including the AA560 variant disclosed in Example 7 and 8 (hereby incorporated by reference).
Other useful amylases are CGTases (cyclodextrin glucanotransferases, EC 2.4.1.19), e.g. those obtainable from species of Bacillus, Thermoanaerobactor or Thermoanaerobacterium. In another preferred embodiment an endo-glucanase of the invention is used together with a p rotease to provide improved detergency performance on soils that contain protein. Such proteases comprise those of animal, vegetable or microbial origin. Proteases of microbial origin are preferred. Chemically or genetically modified mutants of such proteases are included in this connection. The protease may be a serine protease, preferably an alkaline microbial protease or a trypsin-like protease. Examples of alkaline proteases are subtilisins, especially those derived from Bacillus, e.g., subtilisin Novo, subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin 168 (described in WO 89/06279). Examples of trypsin-like proteases are trypsin (e.g. of porcine or bovine origin) and the Fusarium protease described in WO 89/06270.
Relevant commercially available protease enzymes include Primase®, Durazym®, Everlase®, Kannase®, Alcalase®, Savinase® and Esperase® (all available from Novozymes A/S, Bagsvaerd, Denmark), Maxatase™, Maxacal™, Maxapem™ and Properase™ (available from DSM, Holland), Purafect™ and Purafect™ OXP (available from Genencor International, USA), and Opticlean™ and Optimase™ (available from by Solvay Enzymes).
In another preferred embodiment an endo-glucanase of the invention is used to- gether with a lipase to provide improved detergency performance on soils that contain fat or oil. Such lipases comprise those of bacterial or fungal origin. Chemically or genetically modified mutants of such lipases are included in this connection.
Examples of useful lipases include a Humicola lanuginosa lipase, e.g. as described in EP 258 068 and EP 305 216; a Rhizomucor miehei lipase, e.g. as described in EP 238 023; a Candida lipase, such as a C. antarctica lipase, e.g. the C. antarctica lipase A or B described in EP 214 761; a Pseudomonas lipase, such as one of those described in EP 721 981 (e.g. a lipase obtainable from a Pseudomonas sp. SD705 strain having deposit accession number FERM BP- 4772), in PCT/JP96/00426, in PCT/JP96/00454 (e.g. a P. solanacearum lipase), in EP 571 982 or in WO 95/14783 (e.g. a P. mendocina lipase), a P. alcaligenes or P. pseudoalcaligenes lipase, e.g. as described in EP 218 272, a P. cepacia lipase, e.g. as described in EP 331 376, a P. stutz- eri lipase, e.g. as disclosed in GB 1 ,372,034, or a P. fluorescens lipase; a Bacillus lipase, e.g. a e.g. a B. subtilis lipase (Dartois et al. (1993) Biochemica et Biophysica Acta 1131 :253-260), a B. stearothermophilus lipase (JP 64/744992) and a B. pumilus lipase (WO 91/16422).
Other potentially useful types of lipolytic enzymes include cutinases, e.g. a cutinase derived from Pseudomonas mendocina as described in WO 88/09367, or a cutinase derived from Fusarium solani f. pisi (described, e.g., in WO 90/09446).
Suitable commercially available lipases include Lipex®, Lipolase® and Lipolase Ultra® (available from Novozymes A S), M1 Lipase™ and Lipomax™ (available from Genencor Inc.) and Lipase P "Amano" (available from Amano Pharmaceutical Co. Ltd.). Commercially available cutinases include Lumafast™ from Genencor Inc. In another preferred embodiment an endo-glucanase of the invention is used together with a hemi-cellulase to provide improved detergency performance on soils that contain hemi- cellulose and similar polysaccharides. Such hemi-cellulases include xylanases, xyloglucanases, arabinofuranosidases, acetyl xylan esterases, glucuronidases, ferulic acid esterases, coumahc acid esterases, endo-galactanases, mannanases, endo- or exo- arabinanases, exo-galactanases. Suitable mannanases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
In a preferred embodiment the mannanase is derived from a strain of the genus Bacillus, especially Bacillus sp. I633 disclosed in positions 31-330 of SEQ ID NO:2 or in SEQ ID NO: 5 of WO 99/64619 or Bacillus agaradhaerens, for example from the type strain DSM 8721. A suitable mannanase is Mannaway® produced by Novozymes A/S.
Thus in a preferred embodiment an endo-glucanase of the invention is used together with a beta-glucanase (EC 3.2.1.6) to provide improved detergency performance on soils that contain beta-glucans. Further preferred beta-glucanases include lichenases and laminarinases. Thus in a preferred embodiment an endo-glucanase of the invention is used together with pectinolytic enzymes such as a protopectinase, pectinase, polygalacturonase or pectate lyase to provide improved detergency performance on pectinaceous soils. Suitable pectinolytic enzymes include those d escribed in WO 99/27083, WO 99/27084, WO 00/55309 and WO 02/092741. Suitable pectate lyases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
In a preferred embodiment the pectate lyase is derived from a strain of the genus Bacillus, especially a strain of Bacillus substilis, especially Bacillus subtilis DSM14218 disclosed in SEQ ID NO:2 or a variant thereof disclosed in Example 6 of WO 02/092741.
Additionally, in a preferred embodiment an endo-glucanase of the invention is used together with other enzymes of the classes: pectate lyase (EC 4.2.2.2), pectin lyase (EC
4.2.2.10), rhamnogalacturonan lyase (EC not defined), endo-1 ,4-galactanase (EC 3.2.1.89), xyloglucanase (EC not defined), xylanase (EC 3.2.1.8), arabinanase (EC 3.2.1.99), alpha-L- arabinofuranosidase (EC 3.2.1.55), Mannan endo-1,4-mannosidase (EC 3.2.1.78), beta- mannosidase (EC 3.2.1.25), beta-1 ,3-1 ,4-glucanase (EC 3.2.1.73), rhamnogalacturonan hydrolase, exo-polygalacturonase (EC 3.2.1.67), rhamnogalacturonase (EC not defined), Glucan 1 ,3-beta-glucosidase ( EC 3.2.1.58), Glucan e ndo-1 ,6-beta-glucosidase ( EC 3.2.1.75), M annan endo-1 ,4-beta-mannosidase (EC 3.2.1.78), Endo-1 ,4-beta-xylanase (EC 3.2.1.8), Cellulose 1 ,4- cellobiosidase (EC 3.2.1.91), cellobiohydrolase (EC 3.2.1.91). Polygalacturonases (EC 3.2.1.15). Acetyl and methyl esterase enzymes such as: rhamnogalacturonan methyl esterase, rhamnogalacturonan acetyl esterase, pectin methylesterase (EC 3.1.1.11), pectin acetylesterase (EC not defined), xylan methyl esterase, acetyl xylan esterase (EC 3.1.1.72), feruloyl esterase (EC 3.1.1.73), cinnamoyl esterase (EC 3.1.1.73) to provide improved detergency performance on corresponding soils.
Detergent composition of the invention
The detergent compositions according to the present invention comprise a surfactant system, wherein the surfactant can be selected from nonionic and/or anionic and/or cationic and/or amphoteric and/or zwitterionic and/or semi-polar surfactants.
The surfactant is typically present at a level from 0.1% to 60% by weight. The s urfactant i s p referably formulated to b e compatible w ith e nzyme components present in the composition. In liquid or gel compositions the surfactant is most preferably formulated in such a way that it promotes, or at least does not degrade, the stability of any enzyme in these compositions.
Preferred systems to be used according to the present invention comprise as a surfactant one or more of the nonionic and/or anionic surfactants described herein.
Polyethylene, polypropylene, and polybutylene oxide condensates of alkyl phenols are suitable for use as the nonionic surfactant of the surfactant systems of the present invention, with the polyethylene oxide condensates being preferred. These compounds include the condensation products of alkyl phenols having an alkyl group containing from about 6 to about 14 carbon atoms, preferably from about 8 to about 14 carbon atoms, in either a straight chain or branched-chain configuration with the alkylene oxide. In a preferred embodiment, the ethylene oxide is present in an amount equal to from about 2 to about 25 moles, more preferably from about 3 to about 15 moles, of ethylene oxide per mole of alkyl phenol. Commercially available nonionic surfactants of this type include Igepal™ CO-630, marketed by the GAF Corporation; and Triton™ X-45, X-114, X-100 and X-102, all marketed by the Rohm & Haas Company. These surfactants are commonly referred to as alkylphenol alkoxylates (e.g., alkyl phenol ethoxylates).
The condensation products of primary and secondary aliphatic alcohols with about 1 to about 25 moles of ethylene oxide are suitable for use as the nonionic surfactant of t he nonionic surfactant systems of the present invention. The alkyl chain of the aliphatic alcohol can either be straight or branched, primary or secondary, and generally contains from about 8 to about 22 carbon atoms. Preferred are the condensation products of alcohols having an alkyl group containing from about 8 to about 20 carbon atoms, more preferably from about 10 to about 18 carbon atoms, with from about 2 to about 10 moles of ethylene oxide per mole of alcohol. About 2 to about 7 moles of ethylene oxide and most preferably from 2 to 5 moles of ethylene oxide per mole of alcohol are present in said condensation products. Examples of commercially available nonionic surfactants of this type include Tergitol™ 15-S-9 (The condensation product of Cn-C15 linear alcohol with 9 moles ethylene oxide), Tergitol™ 24-L-6 NMW (the condensation product of C12-C14 primary alcohol with 6 moles ethylene oxide with a narrow molecular weight distribution), both marketed by Union Carbide Corporation; Neodol™ 45-9 (the condensation product of C14-C15 linear alcohol with 9 moles of ethylene oxide), Neodol™ 23-3 (the condensation product of C12-C13 linear alcohol with 3.0 moles of ethylene oxide), Neodol™ 45-7 (the condensation product of C14-C15 linear alcohol with 7 moles of ethylene oxide), Neodol™ 45-5 (the condensation product of C14-Cι5 linear alcohol with 5 moles of ethylene oxide) marketed by Shell Chemical Company, Kyro™ EOB (the condensation product of Cι3-C15 alcohol with 9 moles ethylene oxide), marketed by The Procter & Gamble Company, and Genapol LA 050 (the condensation product of C12-C14 alcohol with 5 moles of ethylene oxide) marketed by Hoechst. Preferred range of HLB in these products is from 8-1 1 and most preferred from 8-10.
Also useful as the nonionic surfactant of the surfactant systems of the present invention are alkylpolysaccharides disclosed in U S 4,565,647, having a hydrophobic group containing from about 6 to about 30 carbon atoms, preferably from about 10 to about 16 carbon atoms and a polysaccharide, e.g. a polyglycoside, hydrophilic group containing from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7 saccha de units. Any reducing saccharide containing 5 or 6 carbon atoms can be used, e.g., glucose, galactose and galactosyl moieties can be substituted for the glucosyl moieties ( optionally the h ydrophobic group is attached at t he 2-, 3-, 4-, etc. positions thus giving a glucose or galactose as opposed to a glucoside or galactoside). The intersaccharide bonds can be, e.g., between the one position of the additional saccharide units and the 2-, 3-, 4-, and/or 6- positions on the preceding saccharide units.
The preferred alkylpolyglycosides have the formula 20(CnH2nO),(glycosyl)x
wherein R2 is selected from the group consisting of alkyl, alkylphenyl, hydroxyalkyl, hydroxyalkylphenyl, and mixtures thereof in which the alkyl groups contain from about 10 to about 18, preferably from about 12 to about 14, carbon atoms; n is 2 or 3, preferably 2; t is from 0 to about 10, preferably 0; and x is from about 1.3 to about 10, preferably from about 1.3 to about 3, most preferably from about 1.3 to about 2.7. The glycosyl is preferably derived from glucose. To prepare these compounds, the alcohol or alkylpolyethoxy alcohol is formed first and then reacted with glucose, or a source of glucose, to form the glucoside (attachment at the 1 -position). The additional glycosyl units can then be attached between their 1 -position and the preceding glycosyl units 2-, 3-, 4-, and/or 6-position, preferably predominantly the 2- position.
The condensation products of ethylene oxide with a hydrophobic base formed by the condensation of propylene oxide with propylene glycol are also suitable for use as the additional nonionic surfactant systems of the present invention. The hydrophobic portion of these compounds will preferably have a molecular weight from about 1500 to about 1800 and will exhibit water insolubility. The addition of polyoxyethylene moieties to this hydrophobic portion tends to increase the water solubility of the molecule as a whole, and the liquid character of the product is retained up to the point where the polyoxyethylene content is about 50% of the total weight of the condensation product, which corresponds to condensation with up to about 40 moles of ethylene oxide. Examples of compounds of this type include certain of the commercially available Pluronic™ surfactants, marketed by BASF.
Also suitable for use as the nonionic surfactant of the nonionic surfactant system of the present invention, are the condensation products of ethylene oxide with the product resulting from the reaction of propylene oxide and ethylenediamine. The hydrophobic moiety of these products consists of the reaction product of ethylenediamine and excess propylene oxide, and generally has a molecular weight of from about 2500 to about 3000. This hydrophobic moiety is condensed with ethylene oxide to the extent that the condensation product contains from about 40% to about 80% by weight of polyoxyethylene and has a molecular weight of from about 5,000 to about 11 ,000. Examples of this type of nonionic surfactant include certain of the commercially available Tetronic™ compounds, marketed by BASF.
Preferred for use as the nonionic surfactant of the surfactant systems of the present invention are polyethylene oxide condensates of alkyl phenols, condensation products of primary and secondary aliphatic alcohols with from about 1 to about 25 moles of ethyleneoxide, alkylpolysaccharides, and mixtures hereof. Most preferred are C8-Cι4 alkyl phenol ethoxylates having from 3 to 15 ethoxy groups and C8-C18 alcohol ethoxylates (preferably C10 avg.) having from 2 to 10 ethoxy groups, and mixtures thereof. Highly preferred nonionic surfactants are polyhydroxy fatty acid amide surfactants of the formula
R2 - C - N - Z, I I I I 0 R
wherein R1 is H, or R1 is C^ hydrocarbyl, 2-hydroxyethyl, 2-hydroxypropyl or a mixture thereof, R2 is C5.31 hydrocarbyl, and Z is a polyhydroxyhydrocarbyl having a linear hydrocarbyl chain with at least 3 hydroxyls directly connected to the chain, or an alkoxylated derivative thereof. Preferably, R1 is methyl, R2 is straight Cn.15 alkyl or C168 alkyl or alkenyl chain such as coconut alkyl or mixtures thereof, and Z is derived from a reducing sugar such as glucose, fructose, maltose or lactose, in a reductive amination reaction. Highly preferred anionic surfactants include alkyl alkoxylated sulfate surfactants.
Examples hereof are water soluble salts or acids of the formula RO(A)mS03M wherein R is an unsubstituted C10-C-24 alkyl or hydroxyalkyl group having a Cι0-C24 alkyl component, preferably a C12-C20 alkyl or hydro-xyalkyl, more preferably C12-C18 alkyl or hydroxyalkyl, A is an ethoxy or propoxy unit, m is greater than zero, typically between about 0.5 and about 6, more preferably between about 0.5 and about 3, and M is H or a cation which can be, for example, a metal cation (e.g., sodium, potassium, lithium, calcium, magnesium, etc.), ammonium or substituted-ammonium cation. Alkyl ethoxylated sulfates as well as alkyl propoxylated sulfates are contemplated herein. Specific examples of substituted ammonium cations include methyl-, dimethyl, trimethyl-ammonium cations and quaternary ammonium cations such as tetramethyl-ammonium and dimethyl piperdinium cations and those derived from alkylamines such as ethylamine, diethylamine, triethylamine, mixtures thereof, and the like. Exemplary surfactants are C12-C18 alkyl polyethoxylate (1.0) sulfate (C12-C18E(1.0)M), Cι2- Ci8 alkyl polyethoxylate (2.25) sulfate (C12-C18(2.25)M, and C12-C18 alkyl polyethoxylate (3.0) sulfate (C12-C18E(3.0)M), and C12-C18 alkyl polyethoxylate (4.0) sulfate (C12-Cι8E(4.0)M), wherein M is conveniently selected from sodium and potassium.
Suitable anionic surfactants to be used are alkyl ester sulfonate surfactants including linear esters of C8-C20 carboxylic acids (i.e., fatty acids) which are sulfonated with gaseous S03 according to "The Journal of the American Oil Chemists Society", 52 (1975), pp. 323-329. Suitable starting materials would include natural fatty substances as derived from tallow, palm oil, etc.
The preferred alkyl ester sulfonate surfactant, especially for laundry applications, comprises alkyl ester sulfonate surfactants of the structural formula:
R3 - CH - C - OR4 S03M wherein R3 is a C8-C20 hydrocarbyl, preferably an alkyl, or combination thereof, R4 is a C C6 hydrocarbyl, preferably an alkyl, or combination thereof, and M is a cation which forms a water soluble salt with the alkyl ester sulfonate. Suitable salt-forming cations include metals such as sodium, potassium, and lithium, and substituted or unsubstituted ammonium cations, such as monoethanolamine, diethonolamine, and triethanolamine. Preferably, R3 is C10-C16 alkyl, and R4 is methyl, ethyl or isopropyl. Especially preferred are the methyl ester sulfonates wherein R3 is Cio-Ciβ alkyl.
Other suitable anionic surfactants include the alkyl sulfate surfactants which are water soluble salts or acids of the formula ROS03M wherein R preferably is a Cι0-C24 hydrocarbyl, preferably an alkyl or hydroxyalkyl having a C10-C2o alkyl component, more preferably a C12-Cι8 alkyl or hydroxyalkyl, and M is H or a cation, e.g., an alkali metal cation (e.g. sodium, potassium, lithium), or ammonium or substituted ammonium (e.g. methyl-, dimethyl-, and trimethyl ammonium cations and quaternary ammonium cations such as tetramethyl-ammonium and dimethyl piperdinium cations and quaternary ammonium cations derived from alkylamines such as ethylamine, diethylamine, triethylamine, and mixtures thereof, and the like). Typically, alkyl chains of C12-C16 are preferred for lower wash temperatures (e.g. below about 50°C) and C16-C18 alkyl chains are preferred for higher wash temperatures (e.g. above about 50°C). Other anionic surfactants useful for detersive purposes can also be included in the laundry detergent compositions of the present invention. Theses can include salts (including, for example, sodium, potassium, ammonium, and substituted ammonium salts such as mono- di- and triethanolamine salts) of soap, C8-C22 primary or secondary alkanesulfonates, C8-C24 olefinsulfonates, sulfonated polycarboxylic acids prepared by sulfonation of the pyrolyzed product of alkaline earth metal citrates, e.g., as described in British patent specification No. 1 ,082,179, C8-C24 alkylpolyglycolethersulfa.es (containing up to 10 moles of ethylene oxide); alkyl glycerol sulfonates, fatty acyl glycerol sulfonates, fatty oleyl glycerol sulfates, alkyl phenol ethylene oxide ether sulfates, paraffin sulfonates, alkyl phosphates, isethionates such as the acyl isethionates, N-acyl taurates, alkyl succinamates and sulfosuccinates, monoesters of sulfosuccinates (especially saturated and unsaturated C12-C18 monoesters) and diesters of sulfosuccinates (especially saturated and unsaturated C6-C12 diesters), acyl sarcosinates, sulfates of alkylpolysaccharides such as the sulfates of alkylpolyglucoside (the nonionic nonsulfated compounds being described below), branched primary alkyl sulfates, and alkyl polyethoxy carboxylates such as those of the formula RO(CH2CH2O)k-CH2C00-M+ wherein R is a C8-C22 alkyl, k is an integer from 1 to 10, and M is a soluble salt forming cation. Resin acids and hydrogenated resin acids are also suitable, such as rosin, hydrogenated rosin, and resin acids and hydrogenated resin acids present in or derived from tall oil. Alkylbenzene sulfonates are highly preferred. Especially preferred are linear (straight- chain) alkyl benzene sulfonates (LAS) wherein the alkyl group preferably contains from 10 to 18 carbon atoms.
Further examples are described in "Surface Active Agents and Detergents" (Vol. I and II by Schwartz, Perrry and Berch). A variety of such surfactants are also generally disclosed in US 3,929,678, (Column 23, line 58 through Column 29, line 23, herein incorporated by reference).
When included therein, the detergent compositions of the present invention typically comprise from about 1% to about 40%, preferably from about 3% to about 25 % by weight of such anionic surfactants.
The laundry detergent compositions of the present invention may also contain cationic, amphoteric, zwitterionic, and semi-polar surfactants, as well as the nonionic and/or anionic surfactants other than those already described herein.
Cationic detersive surfactants suitable for use in the laundry detergent compositions of the present invention are those having one long-chain hydrocarbyl group. Examples of such cationic surfactants include the ammonium surfactants such as alkyltrimethylammonium halogenides, and those surfactants having the formula:
[R2(OR3)y][R4(OR3)y]2R5N+X-
wherein R2 is an alkyl or alkyl benzyl group having from about 8 to about 18 carbon atoms in the alkyl chain, each R3 is selected form the group consisting of -CH2CH2-, -CH2CH(CH3)-, - CH2CH(CH2OH)-, -CH2CH2CH2-, and mixtures thereof; each R4 is selected from the group consisting of 0^04 alkyl, Ci-C4 hydroxyalkyl, benzyl ring structures formed by joining the two R4 groups, -CH2CHOHCHOHCOR6CHOHCH2OH, wherein R6 is any hexose or hexose polymer having a molecular weight less than about 1000, and hydrogen when y is not 0; R5 is the same as R4 or is an alkyl chain, wherein the total number of carbon atoms of R2 plus R5 is not more than about 18; each y is from 0 to about 10, and the sum of the y values is from 0 to about 15; and X is any compatible anion. Highly preferred cationic surfactants are the water soluble quaternary ammonium compounds useful in the present composition having the formula:
R1R2R3R4N+X" ( i)
wherein R^ is C8-Cι6 alkyl, each of R2, R3 and R4 is independently C C alkyl, C C4 hydroxy alkyl, benzyl, and -(C2H40)XH where x has a value from 2 to 5, and X is an anion. Not more than one of R2, R3 or R4 should be benzyl. The preferred alkyl chain length for Ri is C12-Ci5, particularly where the alkyl group is a mixture of chain lengths derived from coconut or palm kernel fat or is derived synthetically by olefin build up or OXO alcohols synthesis.
Preferred groups for R2, R3 and R4 are methyl and hydroxyethyl groups and the anion X may be selected from halide, methosulphate, acetate and phosphate ions.
Examples of suitable quaternary ammonium compounds of formulae (i) for use herein are: c oconut trimethyl ammonium chloride or bromide; c oconut methyl dihydroxyethyl ammonium chloride or bromide; d ecyl triethyl ammonium chloride; d ecyl dimethyl hydroxyethyl ammonium chloride or bromide; C 12-15 dimethyl hydroxyethyl ammonium chloride or bromide; c oconut dimethyl hydroxyethyl ammonium chloride or bromide; my styl trimethyl ammonium methyl sulphate; I auryl dimethyl benzyl ammonium chloride or bromide;
I auryl dimethyl (ethenoxy)4 ammonium chloride or bromide; c holine esters (compounds of formula (i) wherein Ri is
CH2-CH2-0-C-Cι2-i4 alkyl and R2R3R4 are methyl). O d i-alkyl imidazolines [compounds of formula (i)].
Other cationic surfactants useful herein are also described in US 4,228,044 and in EP 000 224.
When included therein, the detergent compositions of the present invention typically comprise from 0.2% to about 25%, preferably from about 1 % to about 8% by weight of such cationic surfactants.
Amphoteric surfactants are also suitable for use in the detergent compositions of the present invention. These surfactants can be broadly described as aliphatic derivatives of secondary o r t ertiary a mines, o r a liphatic d erivatives o f h eterocyclic s econdary a nd t ertiary amines in which the aliphatic radical can be straight- or branched-chain. One of the aliphatic substituents contains at least about 8 carbon atoms, typically from about 8 to about 18 carbon atoms, and at least one contains an anionic water-solubilizing group, e.g. carboxy, sulfonate, sulfate. See US 3,929,678 (column 19, lines 18-35) for examples of amphoteric surfactants.
When included therein, the detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such amphoteric surfactants. Zwitterionic surfactants a re also suitable for use in detergent compositions. T hese surfactants can be broadly described as derivatives of secondary and tertiary amines, derivatives of heterocyclic secondary and tertiary amines, or derivatives of quaternary ammonium, quaternary phosphonium or tertiary sulfonium compounds. See US 3,929,678 (column 19, line 38 through column 22, line 48) for examples of zwitterionic surfactants.
When included therein, the detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such zwitterionic surfactants.
Semi-polar nonionic surfactants are a special category of nonionic surfactants which include water-soluble amine oxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; water soluble phosphine oxides containing one alkyl moiety of from about 10 to about 18 carbon atoms and 2 moieties selected from the group consisting of alkyl groups and hydroxyalkyl groups containing from about 1 to about 3 carbon atoms; and water-soluble sulfoxides containing one alkyl moiety from about 10 to about 18 carbon atoms and a moiety selected from the group consisting of alkyl and hydroxyalkyl moieties of from about 1 to about 3 carbon atoms.
Semi-polar nonionic detergent surfactants include the amine oxide surfactants having the formula: O f R3(OR4)xN(R5)2 wherein R3 is an alkyl, hydroxyalkyl, or alkyl phenyl group or mixtures thereof containing from about 8 to about 22 carbon atoms; R4 is an alkylene or hydroxyalkylene group containing from about 2 to about 3 carbon atoms or mixtures thereof; x is from 0 to about 3: and each R5 is an alkyl or hydroxyalkyl group containing from about 1 to about 3 carbon atoms or a polyethylene oxide group containing from about 1 to about 3 ethylene oxide groups. The R5 groups can be attached to each other, e.g., through an oxygen or nitrogen atom, to form a ring structure. These amine oxide surfactants in particular include C10-C18 alkyl dimethyl amine oxides and C8-Cι2 alkoxy ethyl dihydroxy ethyl amine oxides.
When included therein, the detergent compositions of the present invention typically comprise from 0.2% to about 15%, preferably from about 1% to about 10% by weight of such semi-polar nonionic surfactants.
Builder system
The compositions according to the present invention may further comprise a builder system. Any conventional builder system is suitable for use herein including aluminosilicate materials, silicates, polycarboxylates and fatty acids, materials such as ethylenediamine tetraacetate, metal ion sequestrants such as aminopolyphosphonates, particularly ethylenediamine tetramethylene phosphonic acid and diethylene triamine pentamethylenephosphonic acid. Though less preferred for obvious environmental reasons, phosphate builders can also be used herein.
Suitable builders can be an inorganic ion exchange material, commonly an inorganic hydrated aluminosilicate material, more particularly a hydrated synthetic zeolite such as hydrated zeolite A, X, B, HS or MAP.
Another suitable inorganic builder material is layered silicate, e.g. SKS-6 (Hoechst). SKS-6 is a crystalline layered silicate consisting of sodium silicate (Na2Si2Os).
Suitable polycarboxylates containing one carboxy group include lactic acid, glycolic acid and ether derivatives thereof as disclosed in Belgian Patent Nos. 831 , 368, 821 ,369 and 821 ,370. Polycarboxylates containing two carboxy groups include the water-soluble salts of succinic acid, malonic acid, (ethylenedioxy) diacetic acid, maleic acid, diglycollic acid, tartaric acid, tartronic acid and fumaric acid, as well as the ether carboxylates described in DE 2,446,686, and 2 ,446,487, US 3,935,257 and the sulfinyl carboxylates described in Belgian Patent No. 840,623. Polycarboxylates containing three carboxy groups include, in particular, water-soluble citrates, aconitrates and citraconates as well as succinate derivatives such as the carboxymethyloxysuccinates described in British Patent No. 1 ,379,241 , lactoxysuccinates described in Netherlands Application 7205873, and the oxypolycarboxylate materials such as 2-oxa-1 ,1 ,3-propane tricarboxylates described in British Patent No. 1 ,387,447.
Polycarboxylates containing four carboxy groups include oxydisuccinates disclosed in British Patent No. 1 ,261 ,829, 1 ,1 ,2,2,-ethane tetracarboxylates, 1 ,1 ,3,3-propane tetracarboxylates containing sulfo substituents include the sulfosuccinate derivatives disclosed in British Patent Nos. 1 ,398,421 and 1 ,398,422 and in US 3,936,448, and the sulfonated pyrolysed citrates described in British Patent No. 1 ,082,179, while polycarboxylates containing phosphone substituents are disclosed in British Patent No. 1 ,439,000.
Alicyclic and heterocyclic polycarboxylates include cyclopentane-cis,cis-cis- tetracarboxylates, cyclopentadienide pentacarboxylates, 2,3,4,5-tetrahydro-furan - cis, cis, cis- tetracarboxylates, 2,5-tetrahydro-furan-cis, discarboxylates, 2,2,5,5,-tetrahydrofuran - tetracarboxylates, 1 ,2,3,4,5,6-hexane - hexacarboxylates and carboxymethyl derivatives of polyhydric alcohols such as sorbitol, mannitol and xylitol. Aromatic polycarboxylates include mellitic acid, pyromellitic acid and the phthalic acid derivatives disclosed in British Patent No. 1 ,425,343. Of the above, the preferred polycarboxylates are hydroxy-carboxylates containing up to three carboxy groups per molecule, more particularly citrates. Preferred builder systems for use in the present compositions include a mixture of a water-insoluble aluminosilicate builder such as zeolite A or of a layered silicate (SKS-6), and a water-soluble carboxylate chelating agent such as citric acid.
A suitable chelant for inclusion in the detergent compositions in accordance with the invention is ethylenediamine-N,N'-disuccinic acid (EDDS) or the alkali metal, alkaline earth metal, ammonium, or substituted ammonium salts thereof, or mixtures thereof. Preferred EDDS compounds are the free acid form and the sodium or magnesium salt thereof. Examples of such preferred sodium salts of EDDS include Na2EDDS and Na4EDDS. Examples of such preferred magnesium salts of EDDS include MgEDDS and Mg2EDDS. The magnesium salts are the most preferred for inclusion in compositions in accordance with the invention.
Other builder materials that can form part of the builder system for use in granular compositions include inorganic materials such as alkali metal carbonates, bicarbonates, silicates, and organic materials such as the organic phosphonates, amino polyalkylene phosphonates and amino polycarboxylates.
Other suitable water-soluble organic salts are the homo- or co-polymeric acids or their salts, in which the polycarboxylic acid comprises at least two carboxyl radicals separated form each other by not more than two carbon atoms.
Polymers of this type are disclosed in GB-A-1 ,596,756. Examples of such salts are polyacrylates of MW 2000-5000 and their copolymers with maleic anhydride, such copolymers having a molecular weight of from 20,000 to 70,000, especially about 40,000.
Detergency builder salts are normally included in amounts of from 5% to 80% by weight of the composition. Preferred levels of builder for liquid detergents are from 5% to 30%.
Bleaching agents: Additional optional detergent ingredients that can be included in the detergent compositions of the present invention include bleaching agents such as perborate PB1 , PB4 and percarbonate. These bleaching agent components can include one or more oxygen bleaching agents and, depending upon the bleaching agent chosen, one or more bleach activators. Present oxygen bleaching compounds will typically be present at levels of from about 1% to about 25%. In general, bleaching compounds are optional added components in non-liquid formulations, e.g. granular detergents.
The bleaching agent component for use herein can be any of the bleaching agents useful for detergent compositions including oxygen bleaches as well as others known in the art. The bleaching agent suitable for the present invention can be an activated or non- activated bleaching agent. One category of oxygen bleaching agent that can be used encompasses percar- boxylic acid bleaching agents and salts thereof. Suitable examples of this class of agents include magnesium monoperoxyphthalate hexahydrate, the magnesium salt of meta-chloro perbenzoic acid, 4-nonylamino-4-oxoperoxybutyhc acid and diperoxydodecanedioic acid. Such bleaching agents are disclosed in US 4,483,781 , EP 0 133 354 and US 4,412,934. Highly preferred bleaching agents also include 6-nonylamino-6-oxoperoxycaproic acid as described in US 4,634,551.
Another category of bleaching agents encompasses the halogen bleaching agents. Examples of hypohalite bleaching agents, for example, include trichloro isocyanuric acid and the sodium and potassium dichloroisocyanurates and N-chloro and N-bromo alkane sulphonamides. Such materials are normally added at 0.5-10% by weight of the finished product, preferably 1-5% by weight. Such halogen bleaching agents are generally less preferred for use in enzymatic detergents.
The hydrogen peroxide releasing agents can be used in combination with bleach activators such as tetra-acetylethylenediamine (TAED), nonanoyloxybenzenesulfonate (NOBS, described in US 4,412,934), 3,5-trimethyl-hexsanoloxybenzenesulfonate (ISONOBS, described in EP 120 591 ) or pentaacetylglucose (PAG), which are perhydrolyzed to form a peracid as the active bleaching species, leading to improved bleaching effect. In addition, very suitable are the bleach activators C8 (6-octanamido-caproyl) oxybenzene-sulfonate, C9(6- nonanamido caproyl) oxybenzenesulfonate and C10 (6-decanamido caproyl) oxybenzene- sulfonate or mixtures thereof. Also suitable activators are acylated citrate esters such as disclosed in European Patent Application No. 91870207.7.
Useful bleaching agents, including peroxyacids and bleaching systems comprising bleach activators and peroxygen bleaching compounds for use in cleaning compositions according to the invention are described in application USSN 08/136,626.
The hydrogen peroxide may also be present by adding an enzymatic system (i.e. an enzyme and a substrate therefore) which is capable of generation of hydrogen peroxide at the beginning or during the washing and/or rinsing process. Such enzymatic systems are disclosed in European Patent Application EP 0 537 381. Bleaching agents other than oxygen bleaching agents are also known in the art and can be utilized herein. One type of non-oxygen bleaching agent of particular interest includes photoactivated bleaching agents such as the sulfonated zinc and/or aluminium phthalocyanines. These materials can be deposited upon the substrate during the washing process. Upon irradiation with light, in the presence of oxygen, such as by hanging clothes out to dry in the daylight, the sulfonated zinc phthalocyanine is activated and, consequently, the substrate is bleached. Preferred zinc phthalocyanine and a photoactivated bleaching process are described in US 4,033,718. Typically, detergent composition will contain about 0.025% to about 1.25%, by weight, of sulfonated zinc phthalocyanine.
Bleaching agents may also comprise a manganese catalyst. The manganese catalyst may, e.g., be one of the compounds described in "Efficient manganese catalysts for low- temperature bleaching", Nature (369) 1994, pp. 637-639.
Suds suppressors: Another optional ingredient is a suds suppressor, exemplified by silicones, and silica-silicone mixtures. Silicones can generally be represented by alkylated polysiloxane materials, while silica is normally used in finely divided forms exemplified by silica aerogels and xerogels and hydrophobic silicas of various types. Theses materials can be incorporated as particulates, in which the suds suppressor is advantageously releasably incorporated in a water-soluble or water-dispersible, substantially non surface-active detergent impermeable carrier. Alternatively the suds suppressor can be dissolved or dispersed in a liquid carrier and applied by spraying onto one or more of the other components. A preferred silicone suds controlling agent is disclosed in US 3,933,672. Other particularly useful suds suppressors are the self-emulsifying silicone suds suppressors, described in German Patent Application DTOS 2,646,126. An example of such a compound is DC-544, commercially available form Dow Corning, which is a siloxane-glycol copolymer. Especially preferred suds controlling agent are the suds suppressor system comprising a mixture of silicone oils and 2-alkyl-alkanols. Suitable 2-alkyl-alkanols are 2-butyl-octanols, which are commercially available under the trade name Isofol 12 R.
Such s uds s uppressor s ystem a re d escribed i n European P atent A pplication E P O 593 841.
Especially preferred silicone suds controlling agents are described in European Patent Application No. 92201649.8. Said compositions can comprise a silicone/ silica mixture in combination with fumed nonporous silica such as Aerosil®.
The suds suppressors described above are normally employed at levels of from 0.001% to 2% by weight of the composition, preferably from 0.01% to 1 % by weight.
Other components: Other components used in detergent compositions may be employed such as soil-suspending or anti-redeposition agents, soil-releasing agents, optical brighteners, abrasives, bacte cides, tarnish inhibitors, coloring agents, and/or encapsulated or non- encapsulated perfumes.
Especially suitable encapsulating materials are water soluble capsules which consist of a matrix of polysaccharide and polyhydroxy compounds such as described in GB 1 ,464,616. Other suitable water soluble encapsulating materials comprise dextrins derived from ungelatinized starch acid esters of substituted dicarboxylic acids such as described in US 3,455,838. These acid-ester dextrins are, preferably, prepared from such starches as waxy maize, waxy sorghum, sago, tapioca and potato. Suitable examples of said encapsulation materials include N-Lok manufactured by National Starch. The N-Lok encapsulating material consists of a modified maize starch and glucose. The starch is modified by adding monofunctional substituted groups such as octenyl succinic acid anhydride.
Typical anti-redeposition agents used in detergents include water-soluble, generally organic colloids, including for example the water-soluble salts of polymeric carboxylic acids such as polyacrylic acid or polymaleic acid or co-polymers thereof, glue, gelatine, salts of ether carboxylic a cids o r ether s ulfonic a cids of s tarch o r cellulose o r salts of s ulfuric a cid esters of cellulose or starch. Water-soluble polyamides containing acidic groups are also used as anti-redeposition agent. Soluble starch preparations and other starch products than those mentioned above, for example partly hydrolyzed starch, may also be used. Sodium carboxymethyl cellulose, methyl cellulose, hydroxyethyl cellulose, methyl hydroxyethyl cellulose and mixtures thereof are preferably used. These materials are normally used at levels of from 0.05% to 10% by weight, more preferably form 0.2% to 8%, most preferably from 0.5% to 6% by weight of the composition.
Preferred optical brighteners are anionic in character, examples of which are disodium 4,4'-bis-(2-diethanolamino-4-anilino-s-triazin-6-ylamino)stilbene-2:2' disulpho-nate, disodium 4, - 4'-bis-(2-morpholino-4-anilino-s-triazin-6-ylamino-stilbene-2:2' - disulphonate, disodium 4,4' - bis-(2,4-dianilino-s-triazin-6-ylamino)stilbene-2:2' - disulpho-nate, monosodium 4',4" - bis-(2,4-dianilino-s-tri-azin-6-ylamino)stilbene-2-sulphonate, disodium 4,4'-bis-(2-anilino- 4-(N-methyl-N-2-hydroxyethylamino)-s-triazin-6-ylamino) stilbene-2,2' - disulphonate, di- sodium 4,4' -bis-(4-phenyl-2,1 ,3-triazol-2-yl)-stilbene-2,2' disulphonate, disodium 4,4'bis(2- anilino-4-(1-methyl-2-hydroxyethylamino)-s-triazin-6-ylami-no)stilbene-2,2'disulphonate, sodium 2(stilbyl-4"-(naphtho-1,,2,:4,5)-1 ,2,3, - triazole-2"-sulphonate and 4,4'-bis(2- sulphostyryl)biphenyl.
Other useful polymeric m aterials are the polyethylene glycols, particularly those of molecular weight 1000-10000, more particularly 2000 to 8000 and most preferably about 4000. These are used at levels of from 0.20% to 5% more preferably from 0.25% to 2.5% by weight. These polymers and the previously mentioned homo- or co-polymeric poly-carboxylate salts are valuable for improving whiteness maintenance, fabric ash deposition, and cleaning performance on clay, proteinaceous and oxidizable soils in the presence of transition metal impurities.
Soil release agents useful in compositions of the present invention are conventionally copolymers or terpolymers of terephthalic acid with ethylene glycol and/or propylene glycol units in various arrangements. Examples of such polymers are disclosed in US 4,116,885 and 4,711 ,730 and EP 0 272 033. A particular preferred polymer in accordance with EP 0 272 033 has the formula:
(CH3(PEG)43)0 75(POH)025[T-PO)28(T-PEG)04]T(POH)0 25((PEG)43CH3)0 75
where PEG is -(OC2H4)0-, PO is (OC3H60) and T is (pOOC6H4CO).
Also very useful are modified polyesters as random copolymers of dimethyl terephthalate, dimethyl sulfoisophthalate, ethylene glycol and 1 ,2-propanediol, the end groups consisting primarily of sulphobenzoate and secondarily of mono esters of ethylene glycol and/or 1 ,2-propanediol. The target is to obtain a polymer capped at both end by sulphobenzoate groups, "primarily", in the present context most of said copolymers herein will be endcapped by sulphobenzoate groups. However, some copolymers will be less than fully capped, and therefore their end groups may consist of monoester of ethylene glycol and/or 1 ,2-propanediol, thereof consist "secondarily" of such species.
The selected polyesters herein contain about 46% by weight of dimethyl terephthalic acid, about 16% by weight of 1 ,2-propanediol, about 10% by weight ethylene glycol, about 13% by weight of dimethyl sulfobenzoic acid and about 15% by weight of sulfoisophthalic acid, and have a molecular weight of about 3.000. The polyesters and their method of preparation are described in detail in EP 311 342.
Softening agents: Fabric softening agents can also be incorporated into laundry detergent compositions in accordance with the present invention. These agents m ay be inorganic or organic in type. Inorganic softening agents are exemplified by the smectite clays disclosed in GB-A-1 400898 and in US 5,019,292. Organic fabric softening agents include the water insoluble tertiary amines as disclosed in GB-A1 514 276 and EP 0 011 340 and their combination with mono Cι2-Cι4 quaternary ammonium salts are disclosed in EP-B-0 026 528 and di-long-chain amides as disclosed in EP 0 242 919. Other useful organic ingredients of fabric softening systems include high molecular weight polyethylene oxide materials as disclosed in EP 0 299 575 and 0 313 146.
Levels of smectite clay are normally in the range from 5% to 15%, more preferably from 8% to 12% by weight, with the material being added as a dry mixed component to the remainder of the formulation. Organic fabric softening agents such as the water-insoluble tertiary amines or di-long chain amide materials are incorporated at levels of from 0.5% to 5% by weight, normally from 1% to 3% by weight whilst the high molecular weight polyethylene oxide materials and the water soluble cationic materials are added at levels of from 0.1% to 2%, normally from 0.15% to 1.5% by weight. These materials are normally added to the spray dried portion of the composition, although in some instances it may be more convenient to add them as a dry mixed particulate, or spray them as molten liquid on to other solid components of the composition.
Polymeric dve-transfer inhibiting agents: The detergent compositions according to the present invention may also comprise from 0.001% to 10%, preferably from 0.01% to 2%, more preferably form 0.05% to 1% by weight of polymeric dye- transfer inhibiting agents. Said polymeric dye-transfer inhibiting agents are normally incorporated into detergent compositions in order to inhibit the transfer of dyes from colored fabrics onto fabrics washed therewith. These polymers have the ability of complexing or adsorbing the fugitive dyes washed out of dyed fabrics before the dyes have the opportunity to become attached to other articles in the wash.
Especially suitable polymeric dye-transfer inhibiting agents are polyamine N-oxide polymers, copolymers of N-vinyl-pyrrolidone and N-vinylimidazole, polyvinylpyrrolidone polymers, polyvinyloxazolidones and polyvinylimidazoles or mixtures thereof.
Addition of such polymers also enhances the performance of the enzymes according the invention.
Enzymes A detergent composition of the invention may in an embodiment of the invention besides the endo-glucanase having anti-redeposition effect as defined above, comprise other enzyme(s) which provides cleaning performance and/or fabric care benefits.
Such enzymes include certain proteases, lipases, cutinases, cellulases, amylases, peroxidases, oxidases (e.g. laccases), and hemicellulases such as mannanase and pectate lyase.
Proteases: Any protease suitable for use in alkaline solutions can be used. Suitable proteases include those of animal, vegetable or microbial origin. Microbial origin is preferred. Chemically or genetically modified mutants are included. The protease may be a serine protease, preferably an alkaline microbial protease or a trypsin-like protease. Examples of alkaline proteases are subtilisins, especially those derived from Bacillus, e.g., subtilisin Novo, subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin 168 (described in WO 89/06279). Examples of trypsin-like proteases are trypsin (e.g. of porcine or bovine origin) and the Fusarium protease described in WO 89/06270. Preferred commercially available protease enzymes include those sold under the trade names Everlase™, Kannase™, Alcalase™, Savinase™, Primase™, Durazym™, and Esperase™ by Novozymes A S (Denmark), those sold under the tradename Maxatase, Maxacal, Maxapem, Properase, Purafect and Purafect OXP by Genencor International, and those sold under the tradename Opticlean and Optimase by Solvay Enzymes. Protease enzymes m ay be incorporated into the compositions in accordance with the invention at a level of from 0.000001% to 2% of enzyme protein by weight of the composition, preferably at a level of from 0.00001 % to 1 % of enzyme protein by weight of the composition, more preferably at a level of from 0.0001% to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001 % to 0.2% of enzyme protein by weight of the composition.
Lipases: Any lipase suitable for use in alkaline solutions can be used. Suitable lipases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
Examples of useful lipases include a Humicola lanuginosa lipase, e.g., as described in EP 258 068 and EP 305 216, a Rhizomucor miehei lipase, e.g., as described in EP 238 023, a Candida lipase, such as a C. antarctica lipase, e.g., the C. antarctica lipase A or B described in EP 214 761 , a Pseudomonas lipase such as a P. alcaligenes and P. pseudoalcaligenes lipase, e.g., as described in EP 218 272, a P. cepacia lipase, e.g., as described in EP 331 376, a P. stutzeri lipase, e.g., as disclosed in GB 1 ,372,034, a P. fluorescens lipase, a Bacillus lipase, e.g., a B. subtilis lipase (Dartois et al., (1993), Biochemica et Biophysica acta 1 131 , 253-260), a B. stearothermophilus lipase (JP 64/744992) and a β. pumilus lipase (WO 91/16422). Furthermore, a number of cloned lipases may be useful, including the Penicillium camembertii lipase described by Yamaguchi et al., (1991 ), Gene 103, 61-67), the Geotricum candidum lipase (Schimada, Y. et al., (1989), J. Biochem., 106, 383-388), and various Rhizopus lipases such as a R. delemar lipase (Hass, M.J et al., (1991 ), Gene 109, 117-113), a R. niveus l ipase ( Kugimiya et a I., ( 1992), B iosci. B iotech. B iochem. 56, 7 16-719) a nd a R. oryzae lipase.
Other types of lipolytic enzymes such as cutinases may also be useful, e.g., a cutinase derived from Pseudomonas mendocina as described in WO 88/09367, or a cutinase derived from Fusarium solani pisi (e.g. described in WO 90/09446).
In a preferred embodiment the lipase is a variant of Humicola lanuginosa DSM 4109 as described in WO 00/60063. Especially preferred are the variants disclosed in the Example in WO 00/60063 with improved first wash performance., i.e., T231 R+N233R; G91A+D96W+E99K+G263Q+L264A+I265T+G266D+T267A+L269N+ 270AGGFSWRRYRSAESVDKRATMTDAELEKKLNSYVQMDKEYVKNNQARS; R209P+T231 R+N233R; N33Q+D96S+T231 R+N233R+Q249R; E99N+N101 S+T231 R+ N233R+Q249R; E99N+N101S+T231 R+N233R+Q249R.
Especially suitable lipases are lipases such as M1 Lipase™ and Lipomax™ (Genencor), Lipolase™ and Lipolase Ultra™, Lipex™ (Novozymes A/S), and Lipase P "Amano" (Amano Pharmaceutical Co. Ltd.). Suitable cutinases include Lumafast™ available from Genencor Inc.
The lipases are normally incorporated in the detergent composition at a level of from
0.000001% to 2% of enzyme protein by weight of the composition, preferably at a level of from 0.00001 % to 1 % of enzyme protein by weight of the composition, more preferably at a level of from 0.0001% to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001 % to 0.2% of enzyme protein by weight of the composition.
Amylases: Any amylase (alpha and/or beta) suitable for use in alkaline solutions can be used. Suitable amylases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included. Amylases include, for example, alpha-amylases obtained from a special strain of β. licheniformis, described in more detail in GB 1 ,296,839. Commercially available amylases are Natalase™, Termamyl™ Ultra, Duramyl™, Termamyl™, Fungamyl™ and BAN™ (available from Novozymes A/S) and Rapidase™ and Maxamyl P™ (available from Genencor Inc.).
In a preferred embodiment the alpha-amylase is derived from Bacillus sp. strains NCIB 12289, NCIB 12512, NCIB 12513 and DSM 9375. Especially preferred are the alpha-amylases shown in SEQ ID NOS 1 and 2 of WO 95/26397.
In another preferred embodiment the alpha-amylase is the AA560 alpha-amylase derived from Bacillus sp. DSM 12649 disclosed as SEQ ID NO: 2 in WO 00/60060 (hereby incorporated by reference). Especially preferred are variants of the AA560 alpha-amylase, including the AA560 variant disclosed in Example 7 and 8 (hereby incorporated by reference).
The amylases are normally incorporated in the detergent composition at a level of from 0.000001 % to 2% of enzyme protein by weight of the composition, preferably at a level of from 0.00001% to 1% of enzyme protein by weight of the composition, more preferably at a level of from 0.0001% to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001 % to 0.2% of enzyme protein by weight of the composition.
Cellulases: Any cellulase suitable for use in alkaline solutions can be used. Suitable cellulases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included. Suitable cellulases are disclosed in US 4,435,307, which discloses fungal cellulases produced from Humicola insolens. Especially suitable cellulases are the cellulases having colour care benefits. Examples of such cellulases are cellulases described in European patent application No. 0 495 257. In a preferred embodiment the cellulase is a Thielavia terrestris cellulase, preferably the cellulase disclosed in SEQ ID NO: 9 in WO 96/29397 and SEQ ID NO: 9 herein or an enzyme with at least 70% identity thereto. In a preferred embodiment cellulase is the Thielavia terrestris variant disclosed in Example 1 of WO 98/12307.
Commercially available cellulases include Celluzyme® produced by a strain of Humicola insolens, Carezyme® and Renozyme® (Novozymes A/S), and KAC-500(B)™ (Kao Corporation). Cellulases are normally incorporated in the detergent composition at a level of from 0.000001% to 2% of enzyme protein by weight of the composition, preferably at a level of from 0.00001 % to 1 % of enzyme protein by weight of the composition, more preferably at a level of from 0.0001 % to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001 % to 0.2% of enzyme protein by weight of the composition.
Mannanases: Any mannanase suitable for use in alkaline solutions can be used. Suitable mannanases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
In a preferred embodiment the mannanase is derived from a strain of the genus Ba- cillus, especially Bacillus sp. I633 disclosed in positions 31-330 of SEQ ID NO:2 or in SEQ ID
NO: 5 of WO 99/64619 or Bacillus agaradhaerens, for example from the type strain DSM 8721.
Further, suitable mannanases are Purabrite available from Genencor Inc. and Mannaway® produced by Novozymes A/S.
Pectate lyase: Any pectate lyase suitable for use in alkaline solutions can be used. Suitable pectate lyases include those of bacterial or fungal origin. Chemically or genetically modified mutants are included.
In a preferred embodiment the pectate lyase is derived from a strain of the genus Bacillus, especially a strain of Bacillus subtilis, especially Bacillus subtilis DSM14218 disclosed in SEQ ID NO:2 or a variant thereof disclosed in Example 6 of WO 02/092741.
Peroxidases/Oxidases: Peroxidase enzymes are used in combination with hydrogen peroxide or a source thereof (e.g. a percarbonate, perborate or persulfate). Oxidase enzymes are used in combination with oxygen. Both types of enzymes are used for "solution bleaching", i.e. to prevent transfer of a textile dye from a dyed fabric to another fabric when said fabrics are washed together in a wash liquor, preferably together with an enhancing agent as described in e.g. WO 94/12621 and WO 95/01426. Suitable peroxidases/oxidases include those of plant, bacterial or fungal origin. Chemically or genetically modified mutants are included.
Peroxidase and/or oxidase enzymes are normally incorporated in the detergent composition at a level of from 0.000001 % to 2% of enzyme protein by weight of the composition, preferably at a level of from 0.00001% to 1% of enzyme protein by weight of the composition, more preferably at a level of from 0.0001% to 0.5% of enzyme protein by weight of the composition, even more preferably at a level of from 0.001% to 0.2% of enzyme protein by weight of the composition.
Mixtures of the above mentioned enzymes are encompassed herein, in particular a mixture of two, three, four, five, six or more different enzymes, for example a protease, an amylase, a lipase and a cellulase.
The enzyme of the invention, or any other enzyme incorporated in the detergent composition, is normally incorporated in the detergent composition at a level from 0.000001% to 2% of enzyme protein by weight of the composition, preferably at a level from 0.00001% to 1 % of enzyme protein by weight of the composition, more preferably at a level from 0.0001 % to 0.5% of enzyme protein by weight of the composition, even more preferably at a level from 0.001 % to 0.2% of enzyme protein by weight of the composition.
Enzymes may be incorporated in the form of liquid solutions or granulates. Non- dusting granulates may be produced, e.g., as disclosed in US 4,106,991 and 4,661 ,452 (both to Novo Industri A S, now Novozymes A/S) and may optionally be coated by methods known in the art. Examples of waxy coating materials are poly(ethylene oxide) products (polyethyleneglycol, PEG) with mean molecular weights of 1000 to 20000; ethoxylated nonyl- phenols having f rom 16 to 50 ethylene oxide units; ethoxylated fatty alcohols in which the alcohol contains from 12 to 20 carbon atoms and in which there are 15 to 80 ethylene oxide units; fatty alcohols; fatty acids; and mono- and di- and triglycerides of fatty acids. Examples of film-forming coating materials suitable for application by fluid bed techniques are given in GB 1483591.
Detergent composition examples: The detergent composition according to the invention can be in liquid, paste, gels, bars, tablet or granular forms. Granular compositions according to the present invention can also be in "compact form", i.e. they may have a relatively higher density than conventional granular detergents, i.e. form 550 to 950 g/l; in such case, the granular detergent compositions according to the present invention will contain a lower amount of "Inorganic filler salt", compared to conventional granular detergents; typical filler salts are alkaline earth metal salts of sulphates and chlorides, typically sodium sulphate; "Compact" detergent typically comprise not more than 10% filler salt. The liquid compositions according to the present invention can also be in "concentrated form", in such case, the liquid detergent compositions according to the present invention will contain a lower amount of water, compared to conventional liquid detergents. Typically, the water content of the concentrated liquid detergent is less than 30%, more preferably less than 20%, most preferably less than 10% by weight of the detergent compositions. The compositions of the invention may for example, be formulated as hand and machine laundry detergent compositions including laundry additive compositions and compositions suitable for use in the pretreatment of stained fabrics, rinse added fabric softener compositions, and compositions for use in general household hard surface cleaning operations and machine or hand dishwashing operations.
The following examples are meant to exemplify compositions for the present invention, but are not necessarily meant to limit or otherwise define the scope of the invention.
In the detergent compositions, the abbreviated component identifications have the following meanings:
LAS: Sodium linear C 2 alkyl benzene sulphonate
TAS: Sodium tallow alkyl sulphate
XYAS: Sodium C1X - C Y alkyl sulfate
SS: Secondary soap surfactant of formula 2-butyl octanoic acid
25EY: A Cι2 - C15 predominantly linear primary alcohol condensed with an average of Y moles of ethylene oxide
45EY: A Cu - C15 predominantly linear primary alcohol condensed with an average of Y moles of ethylene oxide XYEZS: C1X - Cιγ sodium alkyl sulfate condensed with an average of Z moles of ethylene oxide per mole
Nonionic: Cι3 - C15 mixed ethoxylated/propoxylated fatty alcohol with an average degree of ethoxylation of 3.8 and an average degree of propoxylation of 4.5 sold under the tradename Plurafax LF404 by BASF Gmbh
CFAA: C12 - C14 alkyl N-methyl glucamide
TFAA: Ci6 - Cis alkyl N-methyl glucamide
Silicate: Amorphous Sodium Silicate (Si02:Na20 ratio = 2.0)
NaSKS-6: Crystalline layered silicate of formula δ-Na2Si205
Carbonate: Anhydrous sodium carbonate
Phosphate: Sodium tripolyphosphate
MA/AA: Copolymer of 1 :4 maleic/acrylic acid, average molecular weight about 80,000
Polyacrylate: Polyacrylate homopolymer with an average molecular weight of 8,000 sold under the tradename Sokalan PA30 by BASF Gmbh Zeolite A: Hydrated Sodium Aluminosilicate of formula Naι2(AI02Si02)12.27H20 having a primary particle size in the range from 1 to 10 micrometers
Citrate: Tri-sodium citrate dihydrate
Citric: Citric Acid
Perborate: Anhydrous sodium perborate monohydrate bleach, empirical formula NaB02.H202
PB4: Anhydrous sodium perborate tetrahydrate Percarbonate: Anhydrous sodium percarbonate bleach of empirical formula 2Na2C03.3H202
TAED: Tetraacetyl ethylene diamine
CMC: Sodium carboxymethyl cellulose
DETPMP: Diethylene triamine penta (methylene phosphonic acid), marketed by Monsanto under the Tradename Dequest 2060
PVP: Polyvinylpyrrolidone polymer EDDS: Ethylenediamine-N, N'-disuccinic acid, [S,S] isomer in the form of the sodium salt
Suds 25% paraffin wax Mpt 50°C, 17% hydrophobic silica, 58% Suppressor: paraffin oil
Granular Suds 12% Silicone/silica, 18% stearyl alcohol, 70% suppressor: starch in granular form
Sulphate: Anhydrous sodium sulphate
HMWPEO: High molecular weight polyethylene oxide
TAE 25: Tallow alcohol ethoxylate (25)
Detergent Example I
A granular fabric cleaning composition in accordance with the invention may be prepared as follows:
S odium linear Cι2 alkyl 6.5 b enzene sulfonate
Sodium sulfate 15.0
Zeolite A 26.0
Sodium nitrilotriacetate 5.0
E nzymes (incl. endoglucanase) 0.1 PVP 0.5
TAED 3.0
Boric acid 4.0
P erborate 18.0 P henol sulphonate 0.1
M inors Up to 100
Detergent Example II
A compact granular fabric cleaning composition (density 800 g/l) in accord with the invention may be prepared as follows:
45AS 8.0
25E3S 2.0
25E5 3.0
25E3 3.0
TFAA 2.5
Zeolite A 17.0
NaSKS-6 12.0
Citric acid 3.0
Carbonate 7.0
MA/AA 5.0
CMC 0.4
Enzyme (incl. endo- glucanase) 0.1
TAED 6.0
Percarbonate 22.0
EDDS 0.3
Granular suds suppressor 3.5 water/minors Up to 100%
Detergent Example III
Granular fabric cleaning compositions in accordance with the invention which are especially useful in the laundering of coloured fabrics were prepared as follows:
LAS 10.7
TAS 2.4 TFAA - 4.0
45AS 3.1 10.0
45E7 4.0 25E3S - 3.0
68E1 1 1 .8 -
25E5 - 8.0
Citrate 15.0 7.0
Carbonate - 10
Citric acid 2.5 3.0
Zeolite A 32.1 25.0
Na-SKS-6 - 9.0
MA/AA 5.0 5.0
DETPMP 0.2 0.8
Enzyme (incl. endo-glucanase) 0.10 0 .05
Silicate 2.5 -
Sulphate 5.2 3.0
PVP 0.5 -
Poly (4-vinylpyridine)-N- 0.2 Oxide/copolymer of vinyl- imidazole and vinyl- pyrrolidone
Perborate 1 .0
Phenol sulfonate 0.2 Water/Minors Up to 100%
Detergent Example IV Granular fabric cleaning compositions in accordance with the invention which provide
"Softening through the wash" capability may be prepared as follows:
45AS - 10.0
LAS 7.6
68AS 1 .3 45E7 4.0
25E3 - 5.0
Coco-alkyl-dimethyl hydroxy- 1.4 1 .0 ethyl ammonium chloride
Citrate 5.0 3.0 Na-SKS-6 - 11.0 Zeolite A 15.0 15.0 MA/AA 4.0 4.0 DETPMP 0.4 0.4 Perborate 15.0 -
Percarbonate - 15.0
TAED 5.0 5.0
Smectite clay 10.0 10.0
HMWPEO - 0.1
Enzyme (incl. endo-glucanase) 0.10 0.05
Silicate 3.0 5.0
Carbonate 10.0 10.0
Granular suds suppressor 1 .0 4.0
CMC 0.2 0.1
Water/Minors Up to 100%
Deterqent Example V
Heavy duty liquid fabric cleaning compositions in accordance with the invention may be prepared as follows:
I
LAS acid form - 25.0
Citric acid 5.0 2.0
25AS acid form 8.0 -
25AE2S acid form 3.0 -
25AE7 8.0 -
CFAA 5 -
DETPMP 1.0 1 .0
Fatty acid 8 -
Oleic acid - 1 .0
Ethanol 4.0 6.0
Propanediol 2.0 6.0
Enzyme (incl. endo-glucanase) 0.10 0.05
Coco-alkyl dimethyl . 3.0 hydroxy ethyl ammonium chloride
Smectite clay - 5.0 PVP 2.0
Water / Minors Up to 100% Use of d etergents: The enzyme composition of the i nvention may b e u seful i n a d etergent composition for household or industrial laundering of textiles and garments, and in a process for machine wash treatment of fabrics comprising treating the fabrics during one or more washing cycle of a machine washing process with a washing solution containing the enzyme or enzyme preparation of the invention.
The enzyme composition of the invention may also be useful in a detergent composition for household or industrial dish or cutlery or other hard surface washing, and in a process for treatment of dishes, cutlery etc. comprising a treatment with a washing solution containing the enzyme or enzyme preparation of the invention. Typically, the detergent composition used in the washing process comprises conventional ingredients such as surfactants (anionic, nonionic, zwitterionic, amphoteric), builders, bleaches (perborates, percarbonates or hydrogen peroxide) and other ingredients, e.g. as described in WO 97/01629 which is hereby incorporated by reference in its entirety.
The endo-glucanase of t he invention provides advantages such as improved stain removal and decreased soil redeposition. Certain stains, for example certain food stains, contain beta-glucans which make complete removal of the stain difficult to achieve. Also, the cellulosic fibres of the fabrics may possess, particularly in the "non-crystalline" and surface regions, glucan polymers that are degraded by this enzyme. Hydrolysis of such glucans, either in the stain or on the fabric, during the washing process decreases the binding of soils onto the fabrics.
Household laundry processes are carried out under a range of conditions. Commonly, the washing time is from 5 to 60 minutes and the washing temperature is in the range 10 - 60°C, most commonly from 20 - 40°C. Prolonged soaking is commonly used. The washing solution is normally neutral or alkaline, most commonly with pH 5 - 11.5. Bleaches are commonly used, particularly for laundry of white fabrics and in the washing of hard surfaces. These bleaches are commonly the peroxide bleaches, such as sodium perborate, sodium percarbonate or hydrogen peroxide.
MATERIALS & METHODS
Strains and donor organism
The Bacillus sp. DSM 12648 mentioned above comprises the endo-glucanase encoding DNA sequence shown in SEQ ID NO:1.
B.subtilis PL2306: This strain is the B.subtilis DN1885 with disrupted apr and npr genes (Diderichsen, B., Wedsted, U., Hedegaard, L, Jensen, B. R., Sjøholm, C. (1990) Cloning of aldB, which e ncodes a Ipha-acetolactate decarboxylase, a n e xoenzyme from Bacillus brevis. J. Bacteriol., 172, 4315-4321) disrupted in the transcriptional unit of the known Bacillus subtilis cellulase gene, resulting in cellulase negative cells. The disruption was performed essentially as described in Eds. A.L. Sonenshein, J.A. Hoch and Richard Losick (1993) Bacillus subtilis and other Gram-Positive Bacteria, American Society for microbiology, p.618.
Competent cells were prepared and transformed as described by Yasbin, R.E., Wil- son, G.A. and Young, F.E. (1975) Transformation and transfection in lysogenic strains of Bacillus subtilis: evidence for selective induction of prophage in competent cells. J. Bacteriol, 121 :296-304.
General molecular biology methods Unless otherwise stated all the DNA manipulations and transformations were performed using standard methods of molecular biology (Sambrook et al. (1989) Molecular cloning: A laboratory manual, Cold Spring Harbor lab., Cold Spring Harbor, NY; Ausubel, F. M. et al. (eds.) "Current protocols in Molecular Biology". John Wiley and Sons, 1995; Harwood, C. R., and Cutting, S. M. (eds.) "Molecular Biological Methods for Bacillus". John Wiley and Sons, 1990).
Enzymes for DNA manipulations were used according to the manufacturer's instructions (e.g. restriction endonucleases, ligases etc. are obtainable from New England Biolabs, Inc.).
Plasmids pMOL944. This plasmid is a pUB110 derivative essentially containing elements making the plasmid propagate in Bacillus subtilis, kanamycin resistance gene and having a strong promoter and signal peptide cloned from the amyL gene of B.licheniformis ATCC14580. The signal peptide contains a Sacll site making it convenient to clone the DNA encoding the ma- ture part of a protein in-fusion with the signal peptide. This results in the expression of a Pre- protein which is directed towards the exterior of the cell.
The plasmid was constructed by means of ordinary genetic engineering and is briefly described in the following.
Construction of pMOL944: The pUB110 plasmid (McKenzie, T. et al., 1986, Plasmid 15:93-103) was digested with the unique restriction enzyme Neil. A PCR fragment amplified from the amyL promoter encoded on the plasmid pDN1981 (P.L. Jørgensen et al., 1990, Gene, 96, p37-41.) was digested with Neil and inserted in the Neil digested pUB110 to give the plasmid pSJ2624. The two PCR primers used have the following sequences: # LWN5494 (SEQ ID NO:5)
5'-GTCGCCGGGGCGGCCGCTATCAATTGGTAACTGTATCTCAGC -3' # LWN5495 (SEQ ID NO:6)
5'-GTCGCCCGGGAGCTCTGATCAGGTACCAAGCTTGTCGACCTGCAGAA TGAGGCAGCAAGAAGAT -3'
The primer #LWN5494 inserts a Notl site in the plasmid.
The plasmid pSJ2624 was then digested with Sacl and Notl and a new PCR fragment amplified on amyL promoter encoded on the pDN1981 was digested with Sacl and Notl and this DNA fragment was inserted in the Sacl-Notl digested pSJ2624 to give the plasmid pSJ2670. This cloning replaces the first amyL promoter cloning with the same promoter but in the opposite direction. The two primers used for PCR amplification have the following sequences:
#LWN5938 (SEQ ID NO:7) 5'-GTCGGCGGCCGCTGATCACGTACCAAGCTTGTCGACCTGCAGAATG
AGGCAGCAAGAAGAT -3' #LWN5939 (SEQ ID NO:8)
5"-GTCGGAGCTCTATCAATTGGTAACTGTATCTCAGC -3'
The plasmid pSJ2670 was digested with the restriction enzymes Pstl and Bell and a
PCR fragment amplified from a cloned DNA sequence encoding the alkaline amylase SP722 (Patent # W09526397-A1 ) was digested with Pstl and Bell and inserted to give the plasmid pMOL944. The two primers used for PCR amplification have the following sequence: #LWN7864 (SEQ ID NO:9) 5' -AACAGCTGATCACGACTGATCTTTTAGCTTGGCAC-3'
#LWN7901 (SEQ ID NO:10)
5' -AACTGCAGCCGCGGCACATCATAATGGGACAAATGGG -3'
The primer #LWN7901 inserts a Sacll site in the plasmid.
Genomic DNA Preparation
The strain DSM 12648 was propagated in liquid medium 2xTY containing 1% carboxymethyl-cellulose + (0.1 M Na2C03 + 0.1 M NaHC03 separately autoclaved and added aseptically after cooling to room temperature). After 16 hours of incubation at 30°C and 300 rpm, the cells were harvested, and genomic DNA was isolated by the method described by Pitcher et al. [Pitcher, D. G., Saunders, N. A., Owen, R. J; Rapid extraction of bacterial genomic DNA with guanidium thiocyanate; Lett Appl Microbiol 1989, 8:151-156]. Media
TY (as described in Ausubel, F. M. et al. (eds.): "Current protocols in Molecular Biology", John Wiley and Sons, 1995). 2xTY (as described in Ausubel, F. M. et al. (eds.): "Current protocols in Molecular Biology", John Wiley and Sons, 1995).
LB agar (as described in Ausubel, F. M. et al. (eds.): "Current protocols in Molecular Biology", John Wiley and Sons, 1995).
LBPG is LB agar supplemented with 0.5% Glucose and 0.05 M potassium phosphate, pH 7.0
AZCL-HE-cellulose is added to LBPG-agar to 0.5 % AZCL- HE-cellulose is from Megazyme, Australia.
BPX media is described in EP 0 506 780 (WO 91/09129). Cal 18-2 media is described in patent application WO 00/75344 A1).
Test for endo-glucanase activity
The purpose of this test, used in combination with the "test for anti-redeposition effect" described below, is to determine if an enzyme is an endo-glucanase with anti- redeposition effect, according to this invention. The test is made by determining the color released from an insoluble, colored, glucan substrate over a reaction time of 30 minutes at a temperature of 40°C.
Enzyme sample: The enzyme sample for testing is a solution of the enzyme protein with a concentration of 0.1 mg /ml. Standard biochemical techniques can be used to verify the purity and determine the protein concentration of the sample. Buffer: Prepare a 0.05M phosphate buffer solution with pH 7.0 from NaH2P04.2H20 and NaOH and add 1g/l nonionic surfactant (e.g. Berol 537, from Akzo Nobel).
Test method: Transfer 6 ml buffer into two test tubes. To one tube add 50μl of the enzyme sample. No enzyme is added to the second t ube. Add one beta-glucazyme tablet (supplied by Megazyme, Ireland, catalogue number T-BGZ) to each tube. Mix the contents of the tubes for 10 seconds with a vortex mixer, then place the tubes in a 40°C water bath. After 10 minutes and after 20 minutes, mix the contents of the tubes by inverting the tubes. After 30 minutes, mix the contents of the tubes by inverting the tubes and then filter the contents of the tubes through a Whatman GF/C 9cm filter, collecting the filtrates in clean tubes. Measure the color released as OD at 590 nm using a spectrophotometer. Calculate deltaOD by subtracting the result with no enzyme from the result with enzyme.
If deltaOD > 0.2 then the enzyme is an endo-glucanase. Test for anti-redeposition effect
The purpose of this test, used in combination with the "test for endo-glucanase activity" described above, is to determine if an enzyme is an endo-glucanase with anti- redeposition effect, according to this invention. The anti-redeposition effect is measured by a wash test. The anti-redeposition wash test is made by washing samples of soiled cotton fabric and samples of clean cotton fabric, both together, in a small-scale wash test apparatus. After the washing the soil on the originally clean cotton fabric is evaluated by light reflectance.
E nzyme sample: The enzyme sample for testing is a solution of the enzyme protein with a concentration of 0.1 mg /ml. Standard biochemical techniques can be used to verify the purity and determine the protein concentration of the sample.
Cotton fabric: #2003 white woven 100% cotton fabric, supplied by Tanigashira, 4-11- 15 Komatsu Yodogawa-ku, O saka, 533-0004, Japan. T he new cotton fabric is pre-washed three times before use in the wash test. The pre-washing is done using a European household front-loader washing machine, and using a standard 40°C wash process. LAS (Surfac® SDBS80 sodium alkylbenzene sulfonate, 80%) is added to the wash water at concentration 0.5 g per liter and the wash solution pH is adjusted to 10 by addition of sodium carbonate. After the pre-washing the fabric is dried in a tumbler drier. Swatches of the pre-washed cotton fabric, size 5x5cm, weight approximately 0.3g each, are cut out and these swatches are used for the wash tests.
Soiled cotton swatches: Swatches of the pre-washed #2003 fabric, prepared as above, are soiled as follows. A suspension of 210 mg carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) is prepared in 75 ml tetrachloroethylene (Fluka, cat. nr. 86972) by strong stirring. The cotton swatches are placed flat on a horizontal metal surface. 300μl of the carbon suspension is pipetted onto the centre of each cotton swatch. The soiled cotton swatches are allowed to dry at room temperature overnight.
Detergent solutions: Detergent solutions are prepared as follows. To prepare 1 liter of solution, dissolve in deionised water 0.5g sodium carbonate and 1.0g sodium hydrogen carbonate and add 2 ml of a solution containing 117.8 g/l CaCI2.2H20 and 54.3 g/l MgCI2.6H20. This calcium/magnesium addition provides a water hardness of 12 °dH. Add 0.5g LAS (Surfac SDBS80 sodium alkylbenzene sulfonate, 80%, supplied by Surfachem, UK or an equivalent material) and adjust the final volume to 1 liter. Adjust the pH to 9.5 (e.g. by addition of sodium carbonate) Wash tests: Three soiled swatches (prepared as described) and three clean swatches (of the same pre-washed #2003 cotton) are washed in a Mini-Terg-O-Tometer machine. The Mini-Terg-O-Tometer is a small-scale version of the Terg-O-Tometer test washing machine described in Jay C. Harris, "Detergency Evaluation and Testing", Interscience Publishers Ltd. (1954) pp. 60-61. The following conditions are used:
Beaker size 250ml Wash solution volume 100ml
Wash temperature 40°C
Wash time 30 minutes
Agitation 150 rpm
The detergent solutions are pre-warmed to 40°C before starting the test. The cotton swatches and 100μl of the enzyme sample are added at the start of the 30 minute wash period. The reference test, with no added enzyme, is started at the same time.
After the wash, the fabric swatches are rinsed for 5 minutes under running tap water, then spread out flat and allowed to air dry at room temperature overnight. Instrumental evaluations: Light reflectance evaluation of the originally clean fabric swatches is done using a Macbeth Color Eye 7000 reflectance spectrophotometer. The measurements are made at 500nm. The UV filter is not included. Measurements are made on the front and back of each swatch. An average result for reflectance (R, 500nm) for the three originally clean swatches is then calculated from the six measurements. The anti-redeposition effect of a given enzyme sample is calculated as:
(R, 500nm with the enzyme) - (R, 500nm no enzyme added) The enzyme is an endo-glucanase with anti-redeposition effect according to the invention if the anti-redeposition effect obtained is >7.5, and the result in the test for endo- glucanase activity, above, is >0.2.
LAS stability test
The test is made by comparing the color released from an insoluble colored cellulase substrate over a reaction time of 60 minutes at a temperature of 40°C when the solution contains a buffer but no surfactant and when the solution contains a buffer and LAS. If the enzyme is stable during the 60 minute reaction time then the color released is greater than if the enzyme is not stable, because the stable enzyme will continue to degrade the substrate whereas the non-stable enzyme will not continue to degrade the substrate. In the context of the present invention, if the result with LAS is > 50% of the result without LAS then the enzyme is LAS stable.
The details of the test method are as follows. Buffer (no LAS): Prepare a 0.05M phosphate buffer solution with pH 7.0 from NaH2P04.2H20 and NaOH. Buffer (with LAS):
Dissolve 1.0g LAS in 1 liter of the above buffer. The LAS is Surfac® SDBS80 sodium alkylbenzene sulfonate, 80% (supplied by Surfachem, UK) or an equivalent material.
Test method:
Prepare a dilution of the enzyme to be tested in deionised water. The concentration of the enzyme is such that the result for deltaOD (no LAS), calculated as described below, is in the range 0.2 to 0.5.
Transfer 6 ml of the b uffer ( no LAS) i nto two test tubes. Add 1 50μl of the e nzyme dilution into one tube. No enzyme is added to the other tube. Add one Cellazyme® C tablet (supplied by Megazyme, Ireland, catalogue number T-CCZ) into both tubes. Mix strongly for about 10 seconds using a vortex mixer. Place both tubes in a 40°C water bath. After 15, 30 and 45 minutes, mix the contents of the tubes by inverting the tubes. After 60 minutes, mix the contents of the tubes by inverting the tubes and then filter the contents through a 9cm diameter Whatman® GF/C filter, collecting the filtrate in a clean tube. Measure the OD of the filtrate at 590 nm using a spectrophotometer. Calculate deltaOD (no LAS) by subtracting the result with no enzyme from the result with enzyme.
Then repeat the test using the same concentration of the enzyme and with 6 ml buffer (with LAS) instead of 6 ml buffer (no LAS). Calculate deltaOD (with LAS) by subtracting the result with no enzyme from the result with enzyme.
Calculate the LAS stability %:
(deltaOD (with LAS) / deltaOD (no LAS)) * 100
Wash tests with the endo-glucanase in combination with other enzymes
This procedure is used to determine the enzyme detergency benefit values, see Examples 6 - 11 below.
The wash tests are made by washing samples of soiled cotton fabric and samples of clean cotton fabric, both together, in a small-scale wash test apparatus. After the washing the soil on the cotton fabric is evaluated by light reflectance. Both the originally soiled cotton fabric and the originally clean cotton fabric samples are evaluated. Cotton fabric: #2003 white woven 100% cotton fabric, supplied by Tanigashira, 4-11-
15 Komatsu Yodogawa-ku, O saka, 533-0004, Japan. The new cotton fabric is pre-washed three times before use in the wash test. The pre-washing is done using a European household front-loader washing machine, and using a standard 40°C wash process. LAS (Surfac® SDBS80 sodium alkylbenzene sulfonate, 80%) is added to the wash water at concentration 0.5 g per liter and the wash solution pH is adjusted to 10 by addition of sodium carbonate. After the pre-washing the fabric is dried in a tumbler drier. Swatches of the pre-washed cotton fabric, size 5x5cm, weight approximately 0.3g each, are cut out and these swatches are used for the wash tests.
Soiled cotton swatches: These are prepared from the 5x5cm swatches described above.
Wash tests: Three soiled swatches and three clean swatches are washed in a Mini- Terg-O-Tometer machine. The Mini-Terg-O-Tometer is a small-scale version of the Terg-O- Tometer test washing machine described in Jay C. Harris, "Detergency Evaluation and Testing", Interscience Publishers Ltd. (1954) pp. 60-61. The following conditions are used:
Beaker size 250ml
Wash solution volume 100ml
Wash temperature 40°C
Wash time 30 minutes
Agitation 150 rpm
The detergent solutions are pre-warmed to 40°C before starting the test. The fabric and the enzymes are added at the start of the 30 minute wash period. After the wash, the fabric swatches are rinsed for 5 minutes under running tap water, then spread out flat and allowed to air dry at room temperature overnight.
Instrumental evaluations: Light reflectance evaluation of the fabric swatches is done using a Macbeth Color Eye 7000 reflectance spectrophotometer. The measurements are made at 500nm. The UV filter is not included. Measurements are made on the front and back of each swatch. The soiled swatches are measured in the centre of the soiled area. Average results for reflectance (R, 500nm) for the soiled swatches and for the clean swatches are then calculated from the six measurements on each type. Detergent solutions: Detergent solutions are prepared as follows: To prepare 1 liter of solution, dissolve in deionised water 0.5g sodium carbonate and 1.0g sodium hydrogen carbonate and add 2 ml of a solution containing 117.8 g/l CaCI2.2H20 and 54.3 g/l MgCI2.6H20. This calcium/magnesium addition provides a water hardness of 12 °dH. Add nonionic surfactant (Berol® 537, Akzo Nobel) and/or LAS (Surfac® SDBS80 sodium alkylbenzene sulfonate, 80%) and adjust the final volume to 1 liter. Adjust the pH to either pH 9.5 (by addition of sodium carbonate) or to pH 7.5 (by addition of 10% citric acid solution). The concentration of LAS and of nonionic surfactant and the detergent solution pH are specified below for each wash test.
Enzyme addition: The enzymes to be tested are pre-dissolved at known concentrations in water, and the required amount of enzyme is added to the detergent solution at the start of the wash process.
Calculation of enzyme detergency benefit: The enzyme detergency benefit is a measure of how much more clean the swatches, both the originally soiled and the originally clean, become a s a result of i ncluding e nzymes i n the wash test. The enzyme d etergency benefit is calculated as follows: After the wash test the average R, 500nm value for the soiled swatches is R, soiled. After the wash test the average R, 500nm value for the clean swatches is R, clean. The enzyme detergency benefit from a wash test with enzymes is the sum of R, soiled + R, clean with enzymes minus the sum of R, soiled + R, clean with no added enzyme.
The enzyme detergency benefit value determined in this way is a combined measure both of the removal of soil from the fabric and of the redeposition of soil onto the fabric. Thus the enzyme detergency benefit value can have values that are negative or positive. The enzyme detergency benefit value can be used to compare the performance of different enzymes. The highest positive detergency benefit value is the preferred result.
EXAMPLE 1
Cloning and expression of endo-glucanase gene from Bacillus sp.
Sub-cloning and expression of mature endo-glucanase in B.subtilis.
The endo-glucanase encoding DNA sequence of the invention was PCR amplified using the PCR primer set consisting of these two oligo-nucleotides:
# 168684 (SEQ ID NO:11 )
5 -CATTCT GCA GCCGCGGCA GCA GAA GGAAAC ACT CGT GAA GAC-3'
# 168685 (SEQ ID NO:12) 5'-GCG TTG AGA CGC GCG GCC GCT TAC TCT TCT TTC TCT TCT TTC TC-3' Restriction sites Sacll and Notl are underlined.
The oligonucleotides were used in a PCR reaction in HiFidelity™ PCR buffer (Boehringer Mannheim, Germany) supplemented with 200 micro M of each dNTP, 2.6 units of HiFidelity™ Expand enzyme mix and 200 pmol of each primer. Chromosomal DNA isolated from Bacillus sp. DSM12648 as described above was used as template. The PCR reaction was performed using a DNA thermal cycler (Landgraf®, Germany). One incubation at 94°C for 1 min followed by ten cycles of PCR performed using a cycle profile of denaturation at 94°C for 15 sec, annealing at 60°C for 60 sec, and extension at 72°C for 120sec, followed by twenty cycles of denaturation at 94°C for 15 sec, 60°C for 60 sec and 72°C for 120 sec (at this elongation step 20 sec are added every cycle). 5 μl aliquots of the amplification product was analysed by electrophoresis in 0.7 % agarose gels (NuSieve®, FMC). The appearance of a DNA fragment size 2.4 kb indicated proper amplification of the gene segment.
Subcloning of PCR fragment:
45 microL aliquots of the PCR products generated as described above were purified using QIAquick® PCR purification kit (Qiagen®, USA) according to the manufacturer's instructions. The purified DNA was eluted in 50 microL of 10mM Tris-HCI, pH 8.5. 5 μg of pMOL944 and 25 microL of the purified PCR fragment was digested with Sacll and Notl, electrophoresed in 0.7 % agarose gels (NuSieve®, FMC), the relevant fragments were excised from the gels, and purified using QIAquick® Gel extraction Kit (Qiagen®, USA) according to the manufacturer's instructions. The isolated PCR DNA fragment was then ligated to the Sacll-Notl digested and purified pMOL944. The ligation was performed overnight at 16°C using 0.5 micro g of each DNA fragment, 1 U of T4 DNA ligase and T4 ligase buffer (Boe- hringer Mannheim, Germany).
The ligation mixture was used to transform competent β. subtilis PL2306. The transformed cells were plated onto LBPG-10 micro g/ml of kanamycin-agar plates. After 18 hours incubation at 37°C colonies were seen on the plates. Several clones were analyzed by isolating plasmid DNA from overnight culture broths. One such positive clone was re-streaked several times on agar plates as used above; this clone was called M B1181-7. The c lone M B1181-7 was grown overnight i n TY-10micro g/mL kanamycin at 37°C, and next day 1 ml of cells were used to isolate a plasmid from the cells using the Qiaprep® Spin Plasmid Miniprep Kit #27106 according to the manufacturers recommendations for B. subtilis plasmid preparations. This DNA was sequenced and revealed a DNA sequence identical to the endo-glucanase gene in SEQ ID NO:1 bp 1-2322 encoding the mature endo-glucanase. The derived protein sequence is represented in SEQ ID NO: 2.
EXAMPLE 2
Expression and recovery of the endo-glucanase from Bacillus sp. DSM 12648
MB1181-7 obtained as described in Example 1 was grown in 15 x 200 ml Cal-18-2 media with 10 microg/mL of kanamycin, in 500 mL two-baffled shake flasks, for 4 days at 37°C at 300 rpm, whereby about 2500 ml of culture broth was obtained. The culture fluid was flocculated by adding 50% CaCI2 (10 ml per liter of culture broth) together with 11% sodium alu- minate (10 mL per liter of culture broth), maintaining the pH between 7.0 and 7.5 by adding 20% formic acid. Cationic agent Superfloc® C521 (25 mL of a 10% v/v dilution per liter of cul- ture broth) and anionic agent Superfloc® A130 (75 ml of a 0.1% w/v dilution in water per liter of culture broth) was added during agitation to complete the flocculation. The flocculated material was separated by centrifugation using a Sorval® RC 3B centrifuge at 10000 rpm for 30 min at 6°C. The resulting supernatant contained the endo-glucanase activity.
The supernatant was clarified using Whatman glass filters GF/D and C. Then ultra- filtration was used to concentrate and reduce the ionic strength of the solution. The ultra- filtration membrane was Filtron® UF with a cut-off of 10 kDa. After ultra-filtration the solution had conductivity < 3mS/cm. The pH was adjusted to pH 8.0.
Anion-exchange chromatography on Q-Sepharose® was then used for additional purification. The solution from ultra-filtration was applied to a 300 mL column containing Q- Sepharose® (Pharmacia) equilibrated with a buffer of 25 mmol Tris pH 8.0. The endo- glucanase bound to the Q-Sepharose®, and was then eluted using a 0.5 M NaCl gradient. The fractions with high endo-glucanase activity were pooled. The endo-glucanase activity of the final pooled endo-glucanase solution was approximately 1000 ECU per mL.
The activity units, ECU, are determined by method SM-0302, which is available from Novozymes A/S on request. In the ECU method the ability of the enzyme sample to reduce the viscosity of a solution of carboxymethyl-cellulose is determined, and the result is given in ECU. Conditions: CMC type 7LFD from Hercules, pH7.5 in 0.1 M phosphate buffer, CMC concentration 31.1 g per liter, reaction at 40°C for 30 minutes. A vibration viscosimeter such as MIVI 3000, Sofraser®, France is used to measure the viscosity.
EXAMPLE 3: Stain removal and anti-redeposition effect
This test demonstrates the stain removal and anti-redeposition effects of the endo- glucanase obtained in Example 2. Additionally this test demonstrates that the enzyme performance is essentially unchanged when sodium perborate bleach is included. Cotton swatches are stained with beta-glucan (from barley) plus carbon black. Soiled swatches are washed together with clean swatches. After washing the swatches are rinsed and dried. The soil removal from the soiled switches and the soil redeposition onto the clean swatches is determined by reflectance measurements. The soil removal and soil redeposition after washing without or with addition of the endo-glucanase are compared. Swatches: Cut from 100% cotton fabric, type #2003 (Tanigashira, Osaka, Japan), pre-washed at 40°C as a precaution to remove any water soluble contaminations, size 5x5cm, weight approximately 0.3g. Washing equipment: Stirred beakers, beaker volume 250 ml, with temperature control by water bath heating. The equipment is the Mini-Terg-O-Tometer, a multi-beaker miniature agitator washer, as described in the Materials and Methods section.
Detergent solution: Prepared by adding the following into deionised water. Sodium carbonate, 0.5 g per liter
Sodium bicarbonate, 0.7 g per liter
Ca27Mg2+, to give water hardness 12°dH
Anionic surfactant, Surfac® SDBS80 (sodium alkylbenzene sulphonate), 0.5 g per liter
Nonionic surfactant, Berol® 537 (Akzo Nobel), 1.0 g per liter Sodium perborate, type SPB from wfk Testgewebe, either 0 or 1.0 g per liter
Solution pH is approximately 9.5.
Washing procedure: 100mL detergent solution is added to each beaker. The water bath temperature is 40°C. The mechanical agitators are operated at approximately 125 rpm. The detergent solutions are pre-warmed for 10 minutes and then the endo-glucanase and the swatches are added. In each case three soiled swatches (prepared as described below) and three clean swatches are added to each beaker. After washing for 30 minutes, the swatches are removed from the detergent solution, rinsed under running tap water for 5 minutes, spread flat on absorbent paper and allowed to dry.
Reflectance measurements: Made using a Macbeth® 7000 Color Eye reflectance spectrophotometer. In the case of the soiled swatches, each swatch is measured once in the center of the soiled area, then the average value is calculated. In the case of the clean swatches, each swatch is measured once on each side, then the average value is calculated.
The reflectance measurements are all made at 500nm.
Soiled swatches: Soiled swatches are made using beta-glucan (from barley) and car- bon black ("carbon for detergency tests" supplied by Sentaku Kagaku Kyokai, Tokyo, Japan). Dissolve about 0.67g of beta-glucan in 100 mL tap water by stirring and warming to >50°C. Add 0.33g carbon black. Blend with an UltraTurrax® T25 blender, speed 4000 rpm for 2 minutes. Apply 250 microL of the beta-glucan/carbon onto the center of each swatch. Allow to dry overnight at room temperature. The swatches used in this example had an average reflectance value of 93.5 before soil application and 17.5 after soiling.
Endo-glucanase addition: The endo-glucanase from Example 2 was added to give an activity concentration of 0, 20 or 100 ECU per liter of detergent solution. The activity units, ECU, are determined by method SM-0302, as above.
Results: Detergent without bleach (average of reflectance measurements after washing)
Figure imgf000045_0001
Results: Detergent with bleach (average of reflectance measurements after washing)
Figure imgf000045_0002
The endo-glucanase increased the removal of soil from the fabric, as seen by the increased reflectance value of the stained swatches after washing with endo-glucanase as compared to the result after washing without endo-glucanase. The endo-glucanase also decreases the soil redeposition, as seen by the increased reflectance value of the clean swatches after washing with endo-glucanase. The improvements of soil removal and anti- redeposition provided by the endo-glucanase are essentially unchanged by the addition of the bleach.
EXAMPLE 4: Anti-redeposition effect
Clean cotton fabric is washed together with soiled cotton fabric in a solution of a household detergent. The wash is carried out in a Terg-O-Tometer. During the wash, soil is released from the soiled fabric into the detergent liquor. This soil can then redeposit onto the clean cotton. After washing, the cotton fabrics are rinsed and dried, and then measured with a reflectance spectrophotometer in order to detect the degree of soil redeposition. Detergent: Powder household detergent, Asian. Detergent concentration: 0.67g/l in water with hardness 4°dH. 1000 mL of detergent solution per T-O-T beaker.
Cotton fabric: Total of 33g fabric per T-O-T beaker, comprising suitably sized pieces of: white woven cotton, #2003 (Tanigashira, Osaka, Japan), total weight 11g white cotton interlock, total weight 13g soiled cotton fabric, type EMPA101 (EMPA, Switzerland), total weight 9g. Wash: Temperature 25°C, wash time 40 minutes, at 125 rpm. After washing the #2003 cotton is rinsed under running tap water for 10 minutes, then dried. Reflectance measurements. The pieces of #2003 woven cotton are measured, on both sides, using a Macbeth® 7000 reflectance spectrophotometer, 500nm. The average result for measurements from each T-O-M beaker is calculated.
Enzyme addition: In this trial, the glucanase prepared as described in Example 2 was added to the detergent liquor before the start of the wash step.
Results:
Figure imgf000046_0001
The activity units, ECU, are determined by method SM-0302, as above. From the results it can be concluded that addition of the endo-glucanase reduces the soil redeposition.
EXAMPLE 5: LAS stability of enzyme samples
The LAS stability % was determined by the procedure described above. The following enzymes were tested:
Carezyme is the trade name for enzyme products from Novozymes A/S that contain (as the only enzyme component) the 43 kD cellulase derived from Humicola insolens DSM 1800 disclosed in WO 91/17243 (SEQ ID NO: 2 and hereby incorporated by reference). Detergent compositions containing this enzyme are disclosed in EP 822 973.
Renozyme is the trade name for enzyme products from Novozymes A/S that contain (as the only enzyme component) the Thielavia terrestris cellulase variant disclosed in Example 1 of WO 98/12307.
Endo-glucanase. This is an endo-glucanase with anti-redeposition effect as defined above. A method for preparation of this enzyme is described in Example 2.
Results:
Figure imgf000046_0002
Endo-glucanase 83
These results show that, according to the definition used, Carezyme is not LAS stable and that both Renozyme and the endo-glucanase are LAS stable.
EXAMPLE 6: Wash test: Renozyme® and endo-glucanase
The purpose of this test was to measure the enzyme detergency benefit of Renozyme® alone and of Renozyme® in combination with endo-glucanase.
For this test the soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A suspension of 210 mg carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) was prepared in 75 ml tetrachloroethylene (Fluka®, cat. nr. 86972) by strong stirring. The cotton swatches were placed flat on a horizontal metal surface. 300μl of the carbon suspension was pipetted onto the centre of each cotton swatch. The soiled cotton swatches were allowed to dry at room temperature overnight. For this test the detergent composition was as described above and with the following surfactants and pH:
LAS: 0.5g per liter Nonionic: none pH: 9.5
Enzyme detergency benefit results:
Figure imgf000047_0001
The enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
A suitable cellulase can be obtained from samples of the commercial product Renozyme® from Novozymes A/S or derived as described in Example 1 of WO 98/12307. The endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above. A method for preparation of this enzyme is described in Example 2.
The results show that the combinations of Renozyme® and the endo-glucanase give a higher enzyme detergency benefit than Renozyme® alone in a detergent solution that contains LAS but no other surfactants.
EXAMPLE 7: Wash test: Stainzyme® and endo-glucanase
The purpose of this test was to measure the enzyme detergency benefit of Stainzyme® alone and of Stainzyme® in combination with endo-glucanase on a soil that contains starch.
Stainzyme® is the trade name of a commercially available alpha-amylase product produced by Novozymes A/S. Stainzyme® is intended for use in detergents for laundry and hard surface cleaning.
For this test the soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, p repared a s a bove, were soiled as follows. A s uspension of 4.5g of potato starch ("kartoffelmel", produced by KMC kartoffelmel-centralen, DK-7400 Herning, Denmark, starch content approximately 80%) was prepared in 500ml tap water with stirring, then heated to boiling and then cooled. To 100ml of this solution, 332 mg of carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta- ku, Tokyo 146-8620, Japan) were added, and the suspension was homogenised with an UltraTurrax® blender. The cotton swatches were placed flat on a horizontal metal surface. 250μl of the carbon/starch suspension was pipetted onto the centre of each cotton swatch. The soiled cotton swatches were allowed to dry at room temperature overnight.
For this test the detergent composition was as described above and with the following surfactants and pH:
LAS: 0.4g per liter Nonionic: 0.2g per liter pH: 9.5
Enzyme detergency benefit results:
Figure imgf000048_0001
The enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes. A suitable amylase can be obtained from samples of the commercial product
Stainzyme® from Novozymes A/S or derived from β. licheniformis variants as disclosed in WO 01/66712 and WO 01/64852.
The endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above. A method for preparation of this enzyme is described in Example 2. In this test the soil contains starch. The results show that the combinations of endo- glucanase and Stainzyme® give a higher enzyme detergency benefit than Stainzyme® alone.
EXAMPLE 8: Wash test: Savinase® and endo-glucanase
The purpose of this test was to measure the enzyme detergency benefit of Savinase alone and of Savinase in combination with endo-glucanase on a soil that contains protein.
Savinase® is the trade name of subtilisin 309. It is a commercially available protease product produced by Novozymes A/S. Savinase® is intended for use in detergents for laundry and hard surface cleaning.
For this test the soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A solution of 7.2g of gelatine (gelatine from porcine skin, Fluka®, cat. number 04055) was prepared in 100ml tap water by warming and with stirring. 10 ml of this solution was diluted to 50ml with water and 165 mg of carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) were added, and the suspension was homogenised with an UltraTurrax® blender. The cotton swatches were placed flat on a horizontal metal surface. 250μl of the carbon/gelatine suspension was pipetted onto the centre of each cotton swatch. The soiled cotton swatches were allowed to dry at room temperature overnight.
For this test the detergent composition was as described above and with the following surfactants and pH:
LAS: 0.4g per liter Nonionic: 0.2g per liter pH: 9.5
Enzyme detergency benefit results: Savinase® at 0.8 mg/l Savinase® at 1.9 mg/l
No endo-glucanase 3.7 7.6 Endo-glucanase at 75 μg/l 16.6 Endo-glucanase at 190 μg/l 17.7
The enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
A suitable protease can be obtained from samples of the commercial product Savinase® from Novozymes A S or derived from Bacillus lentus NCIB 10309 as described in US 3,723,250.
The endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above. A method for preparation of this enzyme is described in Example 2.
In this test the soil contains protein. The results show that the combinations of the endo-glucanase and Savinase® give a higher enzyme detergency benefit than Savinase® alone.
EXAMPLE 9: Wash test: Mannanase and endo-glucanase
The purpose of this test was to measure the enzyme detergency benefit of a mannanase alone and of a m annanase in combination with endo-glucanase on a soil that contains galactomannan.
For this test the soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A solution of 667 mg of guar gum (Sigma®, G 4129) was prepared in 200ml tap water by warming and with stirring and 332 mg of carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) were added, and the suspension was homogenised with an UltraTurrax® blender. The cotton swatches were placed flat on a horizontal metal surface. 500μl of the carbon/guar gum suspension was pipetted onto the centre of each cotton swatch. The soiled cotton swatches were allowed to dry at room temperature overnight.
For this test the detergent composition was as described above and with the following surfactants and pH:
LAS: 0.4g per liter Nonionic: 0.2g per liter pH: 9.5
Enzyme detergency benefit results:
Figure imgf000051_0001
The enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
A suitable mannanase can be obtained from Bacillus sp.1633, disclosed in WO 99/64619. Preferred is the mannanase of SEQ ID NO: 2 of WO 99/64619.
The endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above. A method for preparation of this enzyme is described in Example 2.
In this test the soil contains a galactomannan. The results show that the combinations of the endo-glucanase and mannanase give a higher enzyme detergency benefit than mannanase alone.
EXAMPLE 10: Wash test: Pectate Lyase and endo-glucanase
The purpose of this test was to measure the enzyme detergency benefit of a pectate lyase (BioPrep® L) alone and in combination with endo-glucanase on a soil that contains pectin.
BioPrep® is the trade name of a commercially available pectate lyase product produced by Novozymes A/S. BioPrep® is intended for use in cleaning of cotton fibres.
For this test the soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A solution of 150 mg of pectin (Sigma®, P 9311 ) was prepared in 50ml tap water by warming and with stirring and 83 mg of carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) were added, and the suspension was homogenised with an UltraTurrax® blender. The cotton swatches were placed flat on a horizontal metal surface. 500μl of the carbon/pectin suspension was pipetted onto the centre of each cotton swatch. The soiled cotton swatches were allowed to dry at room temperature overnight. For this test the detergent composition was as described above and with the following surfactants and pH:
LAS: 0.4g per liter Nonionic: 0.2g per liter pH: 9.5
Enzyme detergency benefit results:
Figure imgf000052_0001
The enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
A suitable pectate lyase can be obtained from Bacillus licheniformis, as described in US 6,124,127.
The endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above. A method for preparation of this enzyme is described in Example 2.
In this test the soil contains a pectin. The results show that the combinations of the endo-glucanase and pectate lyase give a higher enzyme detergency benefit than the pectate lyase alone.
EXAMPLE 11 : Wash test: Lipex® and endo-glucanase
The purpose of this test was to measure the enzyme detergency benefit of a lipase (Lipex®) alone and in combination with endo-glucanase on a soil that contains triglycehde oils. Lipex® is the trade name of a commercially available lipase product produced by
Novozymes A/S. Lipex® is intended for use in detergents for laundry and hard surface cleaning.
For this test the soiled swatches were prepared as follows: Swatches of the pre- washed #2003 fabric, prepared as above, were soiled as follows. A suspension of 1.5 g of oat flakes (rolled, toasted oats, containing approximately 7% fats by weight, e.g. from Faellesindkøb l/S, 2605 Brøndby, Denmark) was prepared in 500ml tap water by stirring and heating to boiling and homogenising with an UltraTurrax® blender and then cooling. To 100ml of this suspension 166 mg of carbon black ("carbon for detergency tests", supplied by Sentakukagaku-kyokai, 2-11-1 Shimomaruko Ohta-ku, Tokyo 146-8620, Japan) were added, and the suspension was homogenised with an UltraTurrax blender. 25ml of corn oil (refined corn oil, for household use, 100% oil by weight) were added and the mixture was homogenised with an UltraTurrax® blender. The cotton swatches were placed flat on a horizontal metal surface. 100μl of the carbon/oil suspension was pipetted onto the centre of each cotton swatch. The soiled cotton swatches were allowed to dry at room temperature overnight.
For this test the detergent composition was as described above and with the following surfactants and pH:
LAS: 0.4g per liter Nonionic: 0.2g per liter pH: 9.5
Enzyme detergency benefit results:
Figure imgf000053_0001
The enzyme concentrations are specified here in terms of the equivalent concentration of the pure, catalytically active enzyme proteins, in order to avoid ambiguity resulting from activity assay procedures. Standard biochemical techniques can be used to purify and characterise the enzymes.
The l ipase can e ither be o btained from samples of the commercial p roduct L ipex® from Novozymes A/S or derived from suitable Humicola lanuginosa variants as described in WO 00/60063. The endo-glucanase is an endo-glucanase with anti-redeposition effect as defined above. A method for preparation of this enzyme is described in Example 2.
In this test the soil contains a triglyceride oil. The results show that the combinations of the endo-glucanase and Lipex® give a higher enzyme detergency benefit than Lipex® alone.
EXAMPLE 12: Tests for endo-glucanase with anti-redeposition effect
Two enzymes were evaluated by the tests for "endo-glucanase with anti-redeposition effect". These were: The enzyme that can be prepared as described in Example 2 above ("Example 2 enzyme"), and
Carezyme, i.e. the 43 kD cellulase derived from Humicola insolens.
Results:
Figure imgf000054_0001
The results show that the Example 2 enzyme is an anti-redeposition endo-glucanase, i.e. an endo-glucanase with anti-redeposition effect according to the invention, and that Carezyme is not.
1/1
PCT
Original (for SUBMISSION) - printed on 10 12 2003 11 27 31 AM wi 1 D n&m m
Figure imgf000055_0003
Figure imgf000055_0001
FOR RECEIVING OFFICE USE ONLY
Figure imgf000055_0002

Claims

1. A detergent composition comprising an endo-glucanase, wherein the endo-glucanase is selected from one of: (i) the endo-glucanase having the amino acid sequence of p osition 1 to p osition 773 of SEQ ID NO: 2; (ii) an endo-glucanase having a sequence of at least 90% identity to the amino acid sequence of position 1 to position 773 of SEQ ID NO:2; or a fragment thereof that has glucanase activity, when identity is determined by GAP provided in the GCG program pack- age using a GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
2. A detergent composition comprising an endo-glucanase, wherein the endo-glucanase is an anti-redeposition endo-glucanase as determined by the test for endo-glucanase activity together with the test for anti-redeposition effect.
3. A detergent composition comprising anionic tensides and a combination of an endo- glucanase as described in claims 1 or 2 and a fungal cellulase, wherein both enzymes are stable in the presence of anionic tensides.
4. The detergent composition of claim 3, wherein
(a) the endo-glucanase is selected from one of:
(i) the endo-glucanase having the amino acid sequence of position 1 to position 773 of SEQ ID NO: 2; (ii) an endo-glucanase having a sequence of at least 90% identity to the amino acid sequence of position 1 to position 773 of SEQ ID NO:2; or a fragment thereof that has glucanase activity, when identity is determined by GAP provided in the GCG program package using a GAP creation penalty of 3.0 and GAP extension penalty of 0.1 ;
(b) the cellulase is selected from one of: (i) the cellulase having the amino acid sequence of position 1 to position 299 of SEQ
ID NO: 4 or (ii) a cellulase having a sequence of at least 70% identity to the amino acid sequence of position 1 to position 299 of SEQ ID NO:4, or a fragment thereof that has cellulase activity, when identity is determined by GAP provided in the GCG program package using a GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
5. The detergent composition of claims 1 to 4, wherein the endo-glucanase is active at a pH at least in the range of 4-11 , preferably 5.5-10.5.
6. The detergent composition of claims 3 to 5, wherein cellulase is derived from a strain of the genus Thielavia, preferably a strain of Thielavia terrestris, especially Thielavia terrestris NRRL
8126 and shown in SEQ ID NO: 4.
7. The composition of claims 1 to 6, wherein the composition further comprises one or more enzymes selected from the group consisting of proteases, cellulases, beta-glucanases, hemi- cellulases, lipases, peroxidases, laccases, alpha-amylases, glucoamylases, cutinases, pecti- nases, reductases, oxidases, phenoloxidases, ligninases, pullulanases, pectate lyases, xy- loglucanases, xylanases, pectin acetyl esterases, polygalacturonases, rhamnogalacturonases, pectin lyases, other m annanases, pectin m ethylesterases, cellobiohydrolases, transglutami- nases; or mixtures thereof.
8. The composition of claim 7, wherein the protease is derived from a strain of Bacillus, preferably where the protease is a subtilisin selected from the group of subtilisin Novo, subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin 168.
9. The composition of claim 8, wherein the lipase is derived from a strain of the genus Humicola, preferably a strain of Humicola lanuginose, especially Humicola lanuginose DSM4109.
10. The composition of claim 9, wherein the alpha-amylase is derived from a strain of the genus Bacillus, preferably a strain of Bacillus sp., especially Bacillus sp. DSM 12649, NCIB 12512, or NCIB 12513.
11. The composition of claim 10, wherein the mannanase is derived from a strain of the genus Bacillus, preferably Bacillus licheniformis, especially Bacillus licheniformis sp. I633
12. The composition of claim 11 , wherein the pectate lyase is derived from a strain of the genus Bacillus, preferably Bacillus subtilis, especially Bacillus subtilis DSM14218
13. The composition of claim 12, wherein the cellulase is derived from a strain of the genus Humicola, preferably Humicola insolens, especially Humicola insolens DSM 1800.
14. A detergent composition comprising an anti-redeposition endo-glucanase and a cellulase, characterised in that the enzyme detergency benefit from the enzyme combination is higher than, preferably at least 5 units higher than the enzyme detergency benefit of the same detergent composition without the anti-redeposition glucanase (the enzyme detergency benefit being determined by the wash test method of Example 6) .
15. A detergent composition comprising an anti-redeposition endo-glucanase and an amylase, characterised in that the enzyme detergency benefit from the enzyme combination is higher than, preferably at least 5 units higher than the enzyme detergency benefit of the same detergent composition without the anti-redeposition glucanase (the enzyme detergency benefit being determined by the wash test method of Example 7) .
16. A detergent composition comprising an anti-redeposition endo-glucanase and a protease, characterised in that the enzyme detergency benefit from the enzyme combination is higher than, preferably at least 5 units higher than the enzyme detergency benefit of the same detergent composition without the anti-redeposition glucanase (the enzyme detergency benefit be- ing determined by the wash test method of Example 8) .
17. A detergent composition comprising an anti-redeposition endo-glucanase and a hemi- cellulase, characterised in that the enzyme detergency benefit from the enzyme combination is higher than, preferably at least 5 units higher than the enzyme detergency benefit of the same detergent composition without the anti-redeposition glucanase (the enzyme detergency benefit being determined by the wash test method of Example 9) .
18. A detergent composition of Claim 17 wherein the hemi-cellulase is a mannanase.
19. A detergent composition comprising an anti-redeposition endo-glucanase and a lipase, characterised in that the enzyme detergency benefit from the enzyme combination is higher than, preferably at least 5 units higher than the enzyme detergency benefit of the same detergent composition without the anti-redeposition glucanase (the enzyme detergency benefit being determined by the wash test method of Example 11 ) .
20. A detergent composition comprising an anti-redeposition endo-glucanase and a pectinase or pectate lyase, characterised in that the enzyme detergency benefit from the enzyme combination is higher than, preferably at least 5 units higher than the enzyme detergency benefit of the same detergent composition without the anti-redeposition glucanase (the enzyme de- tergency benefit being determined by the wash test method of Example 10).
21. The detergent composition according to any of claims 14-20, wherein the endo-glucanase comprises the amino acid sequence of SEQ ID NO: 2, or an endo-glucanase having a sequence of at least 90% identity to the amino acid sequence of position 1 to position 773 of SEQ ID NO:2; or a fragment thereof that has endo-glucanase activity, when identity is determined by GAP provided in the GCG program package using a GAP creation penalty of 3.0 and GAP extension penalty of 0.1.
22. A process for washing a fabric, comprising contacting a fabric with an aqueous solution of a composition of claims 1 to 21 , optionally under agitation, for an effective period of time.
23. The process of claim 22, wherein the period of time is between 2 minutes and 24 hours, preferably 10 minutes to 60 minutes.
24. A process of claim 23, wherein the weight ratio of the endo-glucanase protein component to the total enzyme protein is less than 1 :2.
25. A process for washing a hard surface, comprising contacting the surface with an aqueous solution of a composition of claims 1 to 21 for an effective period of time.
26. The process of claim 22, wherein the period of time is between 1 minute and 1 hour, preferably 5 minutes to 30 minutes.
27. A process of anyone of claims 22 or 25, wherein the weight ratio of the endo-glucanase protein component to the total enzyme protein is less than 1 :2.
PCT/DK2003/000844 2002-12-11 2003-12-10 Detergent composition comprising endo-glucanase WO2004053039A2 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
BRPI0317124A BRPI0317124B1 (en) 2002-12-11 2003-12-10 detergent composition and processes for washing a fabric and a hard surface
JP2004557818A JP4851093B2 (en) 2002-12-11 2003-12-10 Detergent composition
US10/538,343 US20060035800A1 (en) 2002-12-11 2003-12-10 Detergent composition
AU2003302905A AU2003302905A1 (en) 2002-12-11 2003-12-10 Detergent composition comprising endo-glucanase
MXPA05006071A MXPA05006071A (en) 2002-12-11 2003-12-10 Detergent composition comprising endo-glucanase.
EP03812567.0A EP1572996B1 (en) 2002-12-11 2003-12-10 Detergent composition comprising endo-glucanase
US11/734,065 US20070179076A1 (en) 2002-12-11 2007-04-11 Detergent composition

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DKPA200201898 2002-12-11
DKPA200201898 2002-12-11

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US11/734,065 Continuation US20070179076A1 (en) 2002-12-11 2007-04-11 Detergent composition

Publications (2)

Publication Number Publication Date
WO2004053039A2 true WO2004053039A2 (en) 2004-06-24
WO2004053039A3 WO2004053039A3 (en) 2004-07-29

Family

ID=32479661

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/DK2003/000844 WO2004053039A2 (en) 2002-12-11 2003-12-10 Detergent composition comprising endo-glucanase

Country Status (8)

Country Link
US (2) US20060035800A1 (en)
EP (2) EP1572996B1 (en)
JP (1) JP4851093B2 (en)
CN (1) CN1738899A (en)
AU (1) AU2003302905A1 (en)
BR (1) BRPI0317124B1 (en)
MX (1) MXPA05006071A (en)
WO (1) WO2004053039A2 (en)

Cited By (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2006143854A (en) * 2004-11-18 2006-06-08 Lion Corp Amylase-containing granular detergent composition
JP2006143855A (en) * 2004-11-18 2006-06-08 Lion Corp Amylase-containing bleaching composition with improved effect for removing drink stain
WO2007071820A1 (en) 2005-12-22 2007-06-28 Ab Enzymes Oy Novel enzymes
WO2007087319A2 (en) * 2006-01-23 2007-08-02 The Procter & Gamble Company Detergent compositions
US7256032B2 (en) 2005-12-22 2007-08-14 Ab Enzymes Oy Enzymes
WO2007087242A3 (en) * 2006-01-23 2007-10-04 Procter & Gamble A composition comprising a lipase and a bleach catalyst
EP1867708A1 (en) * 2006-06-16 2007-12-19 The Procter and Gamble Company Detergent Compositions
EP1867707A1 (en) * 2006-06-16 2007-12-19 The Procter and Gamble Company Detergent compositions
EP1876226A1 (en) 2006-07-07 2008-01-09 The Procter and Gamble Company Detergent compositions
EP1876227A1 (en) * 2006-07-07 2008-01-09 The Procter and Gamble Company Detergent Compositions
EP1882731A1 (en) * 2006-06-16 2008-01-30 The Procter and Gamble Company Detergent compositions
EP1963498A1 (en) * 2005-12-22 2008-09-03 ROAL Oy Treatment of cellulosic material and enzymes useful therein
WO2010019728A1 (en) * 2008-08-13 2010-02-18 The Procter & Gamble Company Particulate bleaching composition comprising enzymes
WO2010108002A1 (en) 2009-03-18 2010-09-23 The Procter & Gamble Company Structured fluid detergent compositions comprising dibenzylidene sorbitol acetal derivatives
WO2010108000A1 (en) 2009-03-18 2010-09-23 The Procter & Gamble Company Structured fluid detergent compositions comprising dibenzylidene polyol acetal derivatives and detersive enzymes
WO2011080267A2 (en) 2009-12-29 2011-07-07 Novozymes A/S Polypetides having detergency enhancing effect
WO2011104339A1 (en) 2010-02-25 2011-09-01 Novozymes A/S Variants of a lysozyme and polynucleotides encoding same
WO2011134809A1 (en) 2010-04-26 2011-11-03 Novozymes A/S Enzyme granules
WO2012028482A1 (en) 2010-08-30 2012-03-08 Novozymes A/S A two-soak wash
WO2012028483A1 (en) 2010-08-30 2012-03-08 Novozymes A/S A concentrated soak wash
WO2012035103A1 (en) 2010-09-16 2012-03-22 Novozymes A/S Lysozymes
CN101346464B (en) * 2005-12-22 2012-06-20 生化酶股份有限公司 Novel enzymes
WO2012084582A1 (en) * 2010-12-21 2012-06-28 Henkel Ag & Co. Kgaa Liquid surfactant preparation containing lipase and phosphonate
WO2012089024A1 (en) * 2010-12-30 2012-07-05 Novozymes A/S Method for treating textile with endoglucanase
EP2487237A1 (en) * 2011-02-14 2012-08-15 Achim Gau Bifunctional polypeptide and compounds containing same
EP2537918A1 (en) 2011-06-20 2012-12-26 The Procter & Gamble Company Consumer products with lipase comprising coated particles
WO2012175401A2 (en) 2011-06-20 2012-12-27 Novozymes A/S Particulate composition
WO2013067026A1 (en) 2011-10-31 2013-05-10 Bp Corporation North America Inc. Use of plant promoters in filamentous fungi
WO2013067028A1 (en) 2011-10-31 2013-05-10 Bp Corporation North America Inc. Use of mammalian promoters in filamentous fungi
CN103429736A (en) * 2010-12-30 2013-12-04 诺维信公司 Method for treating textile with endoglucanase
WO2014053594A1 (en) * 2012-10-05 2014-04-10 Novozymes A/S Preventing adhesion of bacteria
WO2014070856A2 (en) 2012-11-02 2014-05-08 Bp Corporation North America Inc. Thermotolerant beta-glucosidase variants
WO2014145768A2 (en) 2013-03-15 2014-09-18 Bp Corporation North America Inc. Use of non-fungal 5' utrs in filamentous fungi
US8846598B2 (en) 2006-07-07 2014-09-30 The Procter & Gamble Company Composition comprising a cellulase and a bleach catalyst
US8999912B2 (en) 2007-07-09 2015-04-07 The Procter & Gamble Company Detergent compositions
WO2016041676A1 (en) 2014-09-18 2016-03-24 Unilever Plc Whitening composition
US9506050B2 (en) 2012-12-24 2016-11-29 Novozymes A/S Polypeptides having endoglucanase activity and polynucleotides encoding same
WO2017106676A1 (en) 2015-12-18 2017-06-22 Danisco Us Inc Polypeptides with endoglucanase activity and uses thereof
WO2018089211A1 (en) 2016-11-08 2018-05-17 Ecolab Usa Inc. Non-aqueous cleaner for vegetable oil soils
US9994836B2 (en) 2014-10-27 2018-06-12 Ab Enzymes Oy Fungal endoglucanase variants, their production and use
CN108431220A (en) * 2015-12-07 2018-08-21 诺维信公司 Polypeptide with 1,4 beta-glucanase activity encodes its polynucleotides and its purposes in cleaning and detergent composition
EP3456809A1 (en) 2012-10-04 2019-03-20 Ecolab USA, Inc. Pre-soak technology for laundry and other hard surface cleaning
WO2020150386A1 (en) 2019-01-16 2020-07-23 Fornia Biosolutions, Inc. Endoglucanase compositions and methods
WO2021030676A1 (en) 2019-08-14 2021-02-18 Ecolab Usa Inc. Methods of cleaning and soil release of highly oil absorbing substrates employing optimized extended chain nonionic surfactants
WO2021074430A1 (en) 2019-10-18 2021-04-22 Basf Se Storage-stable hydrolase containing liquids
WO2021105336A1 (en) 2019-11-29 2021-06-03 Basf Se Compositions comprising polymer and enzyme
WO2021115912A1 (en) 2019-12-09 2021-06-17 Basf Se Formulations comprising a hydrophobically modified polyethyleneimine and one or more enzymes
US11103118B2 (en) 2014-08-01 2021-08-31 Ecolab Usa Inc. Method of manual surface cleaning using cleaning textiles and of washing said cleaning textiles
WO2022010911A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Foaming mixed alcohol/water compositions comprising a structured alkoxylated siloxane
WO2022010893A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Foaming mixed alcohol/water compositions comprising a combination of alkyl siloxane and a hydrotrope/solubilizer
WO2022008732A1 (en) 2020-07-10 2022-01-13 Basf Se Enhancing the activity of antimicrobial preservatives
WO2022010906A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Peg-modified castor oil based compositions for microemulsifying and removing multiple oily soils
WO2022063699A1 (en) 2020-09-22 2022-03-31 Basf Se Improved combination of protease and protease inhibitor with secondary enzyme
WO2022063698A1 (en) 2020-09-22 2022-03-31 Basf Se Liquid composition comprising peptide aldehyde
EP4015629A1 (en) 2020-12-18 2022-06-22 Basf Se Polymer mixtures for increasing stability and performance of hydrolase-containing detergents
EP4029936A2 (en) 2020-12-22 2022-07-20 Fornia BioSolutions, Inc. Additional endoglucanase variants and methods
WO2023111296A1 (en) 2021-12-17 2023-06-22 Basf Se Composition comprising an antimicrobial agent and a carboxamide
WO2023111297A1 (en) 2021-12-17 2023-06-22 Basf Se Lactones for enhancing the activity of antimicrobial agents
WO2023118015A1 (en) 2021-12-21 2023-06-29 Basf Se Environmental attributes for care composition ingredients
WO2023165507A1 (en) * 2022-03-02 2023-09-07 Novozymes A/S Use of xyloglucanase for improvement of sustainability of detergents
EP4034622A4 (en) * 2019-09-29 2023-10-11 Novozymes A/S Use of cellulase for improvement of sustainability of detergents
EP4289273A1 (en) 2022-06-07 2023-12-13 Basf Se Composition comprising an antimicrobial agent and a n-cyclohexyldiazeniumdioxy salt
WO2024012894A1 (en) 2022-07-15 2024-01-18 Basf Se Alkanolamine formates for enzyme stabilization in liquid formulations
WO2024020445A1 (en) 2022-07-20 2024-01-25 Ecolab Usa Inc. Novel nonionic extended surfactants, compositions and methods of use thereof
WO2024033135A2 (en) 2022-08-11 2024-02-15 Basf Se Amylase variants
WO2024033136A1 (en) 2022-08-11 2024-02-15 Basf Se Amylase variants
WO2024094733A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024094735A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024094732A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
EP4385328A1 (en) 2022-12-15 2024-06-19 Basf Se Alpha-hydroxyketones for enhancing the activity of antimicrobial agents
EP4389864A1 (en) 2022-12-20 2024-06-26 Basf Se Cutinases

Families Citing this family (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6936289B2 (en) 1995-06-07 2005-08-30 Danisco A/S Method of improving the properties of a flour dough, a flour dough improving composition and improved food products
WO2000005396A1 (en) 1998-07-21 2000-02-03 Danisco A/S Foodstuff
JP4309137B2 (en) 2001-05-18 2009-08-05 ダニスコ エイ/エス Preparation method of dough using enzyme
DE602004030000D1 (en) 2003-01-17 2010-12-23 Danisco PROCESS FOR IN-SITU-PRODUCTION OF AN EMULSIFIER IN A FOODSTUFF
US7955814B2 (en) 2003-01-17 2011-06-07 Danisco A/S Method
US20050196766A1 (en) 2003-12-24 2005-09-08 Soe Jorn B. Proteins
US7906307B2 (en) 2003-12-24 2011-03-15 Danisco A/S Variant lipid acyltransferases and methods of making
GB0716126D0 (en) 2007-08-17 2007-09-26 Danisco Process
US7718408B2 (en) 2003-12-24 2010-05-18 Danisco A/S Method
WO2008090395A1 (en) 2007-01-25 2008-07-31 Danisco A/S Production of a lipid acyltransferase from transformed bacillus licheniformis cells
GB0405637D0 (en) 2004-03-12 2004-04-21 Danisco Protein
AU2005263954B2 (en) 2004-07-16 2011-04-07 Dupont Nutrition Biosciences Aps Enzymatic oil-degumming method
JP4808428B2 (en) * 2005-03-25 2011-11-02 ライオン株式会社 Amylase-containing liquid detergent composition
EP2090646A1 (en) * 2008-01-22 2009-08-19 Thermphos Trading GmbH Surface treatment composition containing phosphonic acid compounds
US7491362B1 (en) 2008-01-28 2009-02-17 Ecolab Inc. Multiple enzyme cleaner for surgical instruments and endoscopes
ITMI20090921A1 (en) * 2009-05-25 2010-11-26 Icf Srl ENZYME-BASED COMPOSITION FOR THE REMOVAL OF MICROBIAL BIOFILM AND RELATED USES IN MEDICAL AND FOOD FIELDS
WO2011111836A1 (en) 2010-03-12 2011-09-15 花王株式会社 Mutated alkaline celluase
WO2012122166A2 (en) * 2011-03-07 2012-09-13 Clean Ethics, Llc Cleaning formulations and uses thereof
US8729006B2 (en) * 2011-06-28 2014-05-20 Ecolab Usa Inc. Methods and compositions using sodium carboxymethyl cellulose as scale control agent
WO2013159032A1 (en) * 2012-04-20 2013-10-24 The Sun Products Corporation Liquid detergent compositions
US8871699B2 (en) 2012-09-13 2014-10-28 Ecolab Usa Inc. Detergent composition comprising phosphinosuccinic acid adducts and methods of use
US9752105B2 (en) 2012-09-13 2017-09-05 Ecolab Usa Inc. Two step method of cleaning, sanitizing, and rinsing a surface
US20140308162A1 (en) 2013-04-15 2014-10-16 Ecolab Usa Inc. Peroxycarboxylic acid based sanitizing rinse additives for use in ware washing
US9023784B2 (en) 2012-09-13 2015-05-05 Ecolab Usa Inc. Method of reducing soil redeposition on a hard surface using phosphinosuccinic acid adducts
US9994799B2 (en) 2012-09-13 2018-06-12 Ecolab Usa Inc. Hard surface cleaning compositions comprising phosphinosuccinic acid adducts and methods of use
EP2938628A4 (en) * 2012-12-24 2016-10-19 Novozymes As Polypeptides having endoglucanase activity and polynucleotides encoding same
CN104968781A (en) * 2012-12-24 2015-10-07 诺维信公司 Polypeptides having endoglucanase activity and polynucleotides encoding same
WO2014200658A1 (en) 2013-06-13 2014-12-18 Danisco Us Inc. Alpha-amylase from promicromonospora vindobonensis
WO2014200656A1 (en) 2013-06-13 2014-12-18 Danisco Us Inc. Alpha-amylase from streptomyces umbrinus
WO2014200657A1 (en) 2013-06-13 2014-12-18 Danisco Us Inc. Alpha-amylase from streptomyces xiamenensis
EP3011020A1 (en) 2013-06-17 2016-04-27 Danisco US Inc. Alpha-amylase from bacillaceae family member
WO2015050723A1 (en) 2013-10-03 2015-04-09 Danisco Us Inc. Alpha-amylases from exiguobacterium, and methods of use, thereof
US20160186102A1 (en) 2013-10-03 2016-06-30 Danisco Us Inc. Alpha-amylases from exiguobacterium, and methods of use, thereof
MX2016006489A (en) 2013-11-20 2016-08-03 Danisco Us Inc Variant alpha-amylases having reduced susceptibility to protease cleavage, and methods of use, thereof.
WO2015083800A1 (en) * 2013-12-06 2015-06-11 ライオン株式会社 Liquid detergent
US20180171271A1 (en) * 2015-06-30 2018-06-21 Novozymes A/S Laundry detergent composition, method for washing and use of composition
US20180171269A1 (en) * 2015-09-01 2018-06-21 Novozymes A/S Laundry method
WO2017173324A2 (en) 2016-04-01 2017-10-05 Danisco Us Inc. Alpha-amylases, compositions & methods
WO2017173190A2 (en) 2016-04-01 2017-10-05 Danisco Us Inc. Alpha-amylases, compositions & methods

Citations (92)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB514276A (en) 1938-04-29 1939-11-03 Betterwear Products Ltd Improvements in or relating to combined combs and brushes
GB1082179A (en) 1965-07-19 1967-09-06 Citrique Belge Nv Unsaturated carboxylic salt materials and derivatives thereof
US3455838A (en) 1966-04-22 1969-07-15 Nat Starch Chem Corp Method of encapsulating water-insoluble substances and product thereof
GB1261829A (en) 1968-05-24 1972-01-26 Unilever Ltd Detergent compositions
NL7205873A (en) 1971-04-30 1972-11-01
GB1296839A (en) 1969-05-29 1972-11-22
US3723250A (en) 1967-10-03 1973-03-27 Novo Terapeutisk Labor As Proteolytic enzymes, their production and use
GB1372034A (en) 1970-12-31 1974-10-30 Unilever Ltd Detergent compositions
GB1379241A (en) 1971-03-02 1975-01-02 Unilever Ltd Preparation of salts of carboxymethyloxysuccinic acid
GB1387447A (en) 1971-06-30 1975-03-19 Monsanto Co Carboxylic acids and derivatives
BE821370A (en) 1974-03-04 1975-04-23 PROCESS FOR PREPARING ETHER-POLYCARBOXYLIC ACIDS
BE821369A (en) 1974-03-04 1975-04-23 PROCESS FOR PREPARING ETHER-POLYCARBOXYLIC ACIDS
GB1398422A (en) 1971-06-25 1975-06-18 Unilever Ltd Sulphosuccinate derivatives as detergent builders
GB1400898A (en) 1972-07-14 1975-07-16 Procter & Gamble Detergent compositions
BE831368A (en) 1974-07-15 1975-11-03 PROCESS FOR OBTAINING HYDROGEN AND OXYGEN BY DECOMPOSITION OF WATER
US3929678A (en) 1974-08-01 1975-12-30 Procter & Gamble Detergent composition having enhanced particulate soil removal performance
US3933672A (en) 1972-08-01 1976-01-20 The Procter & Gamble Company Controlled sudsing detergent compositions
US3935257A (en) 1974-03-18 1976-01-27 Monsanto Company Chemical compounds
GB1425343A (en) 1972-02-14 1976-02-18 Unilever Ltd Phthalic acid derivatives
DE2446686A1 (en) 1974-09-30 1976-04-15 Henkel & Cie Gmbh PROCESS FOR THE PREPARATION OF ETHERPOLYCARBONIC ACIDS
GB1439000A (en) 1972-11-29 1976-06-09 Henkel & Cie Gmbh Washing compositions and washing assistants for textiles
DE2446487A1 (en) 1974-09-28 1976-09-02 Basf Ag Laminated magnetogram carrier - having magnetic, image-registering layer bonded to polyethylene terephthalate film with defined surface roughness
BE840623A (en) 1975-04-11 1976-10-11 LIQUID DETERGENT COMPOSITION
GB1464616A (en) 1973-06-12 1977-02-16 Polak Frutal Works Encapsulation process
US4033718A (en) 1973-11-27 1977-07-05 The Procter & Gamble Company Photoactivated bleaching process
GB1483591A (en) 1973-07-23 1977-08-24 Novo Industri As Process for coating water soluble or water dispersible particles by means of the fluid bed technique
DE2646126A1 (en) 1976-10-13 1978-04-20 Baer Elektrowerke Kg Automatic control circuit for electric devices - has triac whose control electrode is connected to output of voltage divider with PTC resistor
US4106991A (en) 1976-07-07 1978-08-15 Novo Industri A/S Enzyme granulate composition and process for forming enzyme granulates
US4116885A (en) 1977-09-23 1978-09-26 The Procter & Gamble Company Anionic surfactant-containing detergent compositions having soil-release properties
EP0000224A1 (en) 1977-06-29 1979-01-10 THE PROCTER &amp; GAMBLE COMPANY Liquid detergent composition for improved greasy soil removal
EP0011340A1 (en) 1978-11-20 1980-05-28 THE PROCTER &amp; GAMBLE COMPANY Detergent composition having textile softening properties
US4228044A (en) 1978-06-26 1980-10-14 The Procter & Gamble Company Laundry detergent compositions having enhanced particulate soil removal and antiredeposition performance
GB1596756A (en) 1977-04-22 1981-08-26 Procter & Gamble Ltd Detergent compositions
US4412934A (en) 1982-06-30 1983-11-01 The Procter & Gamble Company Bleaching compositions
US4435307A (en) 1980-04-30 1984-03-06 Novo Industri A/S Detergent cellulase
EP0120591A1 (en) 1983-02-23 1984-10-03 The Procter & Gamble Company Detergent ingredients, and their use in cleaning compositions and washing processes
US4483781A (en) 1983-09-02 1984-11-20 The Procter & Gamble Company Magnesium salts of peroxycarboxylic acids
EP0026528B1 (en) 1979-09-29 1984-12-05 THE PROCTER &amp; GAMBLE COMPANY Detergent compositions
EP0133354A1 (en) 1983-08-09 1985-02-20 Interox Chemicals Limited Denture cleansing compositions
US4565647A (en) 1982-04-26 1986-01-21 The Procter & Gamble Company Foaming surfactant compositions
US4634551A (en) 1985-06-03 1987-01-06 Procter & Gamble Company Bleaching compounds and compositions comprising fatty peroxyacids salts thereof and precursors therefor having amide moieties in the fatty chain
EP0214761A2 (en) 1985-08-07 1987-03-18 Novo Nordisk A/S An enzymatic detergent additive, a detergent, and a washing method
EP0218272A1 (en) 1985-08-09 1987-04-15 Gist-Brocades N.V. Novel lipolytic enzymes and their use in detergent compositions
US4661452A (en) 1984-05-29 1987-04-28 Novo Industri A/S Enzyme containing granulates useful as detergent additives
EP0238023A2 (en) 1986-03-17 1987-09-23 Novo Nordisk A/S Process for the production of protein products in Aspergillus oryzae and a promoter for use in Aspergillus
EP0242919A1 (en) 1986-04-23 1987-10-28 The Procter & Gamble Company Softening detergent compositions containing amide softening agent
US4711730A (en) 1986-04-15 1987-12-08 The Procter & Gamble Company Capped 1,2-propylene terephthalate-polyoxyethylene terephthalate polyesters useful as soil release agents
EP0258068A2 (en) 1986-08-29 1988-03-02 Novo Nordisk A/S Enzymatic detergent additive
EP0272033A2 (en) 1986-12-15 1988-06-22 The Procter & Gamble Company Terephthalate ester copolymers and their use in laundry compositions
WO1988009367A1 (en) 1987-05-29 1988-12-01 Genencor, Inc. Cutinase cleaning composition
EP0299575A1 (en) 1987-07-14 1989-01-18 The Procter & Gamble Company Detergent compositions
EP0305216A1 (en) 1987-08-28 1989-03-01 Novo Nordisk A/S Recombinant Humicola lipase and process for the production of recombinant humicola lipases
JPS6474992A (en) 1987-09-16 1989-03-20 Fuji Oil Co Ltd Dna sequence, plasmid and production of lipase
EP0311342A2 (en) 1987-10-05 1989-04-12 The Procter & Gamble Company Sulfoaroyl end-capped ester oligomers suitable as soil-release agents in detergent compositions and fabric-conditioner articles
EP0313146A2 (en) 1987-10-19 1989-04-26 The Procter & Gamble Company Detergent compositions
WO1989006279A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Mutated subtilisin genes
WO1989006270A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Enzymatic detergent
EP0331376A2 (en) 1988-02-28 1989-09-06 Amano Pharmaceutical Co., Ltd. Recombinant DNA, bacterium of the genus pseudomonas containing it, and process for preparing lipase by using it
WO1990009446A1 (en) 1989-02-17 1990-08-23 Plant Genetic Systems N.V. Cutinase
US5019292A (en) 1987-06-30 1991-05-28 The Procter & Gamble Company Detergent compositions
WO1991009129A1 (en) 1989-12-18 1991-06-27 Novo Nordisk A/S Stable integration of dna in bacterial genomes
WO1991016422A1 (en) 1990-04-14 1991-10-31 Kali-Chemie Aktiengesellschaft Alkaline bacillus lipases, coding dna sequences therefor and bacilli which produce these lipases
WO1991017243A1 (en) 1990-05-09 1991-11-14 Novo Nordisk A/S A cellulase preparation comprising an endoglucanase enzyme
EP0495257A1 (en) 1991-01-16 1992-07-22 The Procter & Gamble Company Compact detergent compositions with high activity cellulase
EP0537381A1 (en) 1991-10-14 1993-04-21 The Procter & Gamble Company Detergent compositions inhibiting dye transfer in washing
EP0571982A1 (en) 1992-05-27 1993-12-01 Showa Denko Kabushiki Kaisha Alkaline lipase, method for producing the same, microorganism producing the same and detergent composition containing alkaline lipase
EP0593841A1 (en) 1992-10-23 1994-04-27 The Procter & Gamble Company Detergent composition with suds suppressing system
WO1994012621A1 (en) 1992-12-01 1994-06-09 Novo Nordisk Enhancement of enzyme reactions
WO1995001426A1 (en) 1993-06-29 1995-01-12 Novo Nordisk A/S Enhancement of laccase reactions
WO1995014783A1 (en) 1993-11-24 1995-06-01 Showa Denko K.K. Lipase gene and variant lipase
WO1995026397A1 (en) 1994-03-29 1995-10-05 Novo Nordisk A/S Alkaline bacillus amylase
EP0721981A1 (en) 1993-08-30 1996-07-17 Showa Denko Kabushiki Kaisha Novel lipase, microorganism producing the lipase, process for producing the lipase, and use of the lipase
WO1996029397A1 (en) 1995-03-17 1996-09-26 Novo Nordisk A/S Novel endoglucanases
WO1997001629A1 (en) 1995-06-28 1997-01-16 Novo Nordisk A/S A cellulase with reduced mobility
EP0822973A1 (en) 1995-04-28 1998-02-11 Henkel Kommanditgesellschaft auf Aktien Cellulase-containing washing agents
WO1998012307A1 (en) 1996-09-17 1998-03-26 Novo Nordisk A/S Cellulase variants
WO1999027083A1 (en) 1997-11-24 1999-06-03 Novo Nordisk A/S PECTIN DEGRADING ENZYMES FROM $i(BACILLUS LICHENIFORMIS)
WO1999027084A1 (en) 1997-11-24 1999-06-03 Novo Nordisk A/S Novel pectate lyases
WO1999064619A2 (en) 1998-06-10 1999-12-16 Novozymes A/S Novel mannanases
JP2000210081A (en) 1999-01-21 2000-08-02 Kao Corp Heat-resistant alkali cellulase gene
WO2000055309A1 (en) 1999-03-16 2000-09-21 Novozymes A/S Novel pectate lyases
US6124127A (en) 1997-11-24 2000-09-26 Novo Nordisk A/S Pectate lyase
WO2000060063A1 (en) 1999-03-31 2000-10-12 Novozymes A/S Lipase variant
WO2000060060A2 (en) 1999-03-31 2000-10-12 Novozymes A/S Polypeptides having alkaline alpha-amylase activity and nucleic acids encoding same
WO2000075344A1 (en) 1999-06-02 2000-12-14 Novozymes A/S Pectate lyase fusion for expression and secretion of polypeptides
WO2001064852A1 (en) 2000-03-03 2001-09-07 Novozymes A/S Polypeptides having alkaline alpha-amylase activity and nucleic acids encoding same
WO2001066712A2 (en) 2000-03-08 2001-09-13 Novozymes A/S Variants with altered properties
WO2002009909A2 (en) 2000-08-02 2002-02-07 Element Six (Pty) Ltd Abrasive product
WO2002092741A2 (en) 2001-05-14 2002-11-21 Novozymes A/S 0etergent compositions comprising bacillus subtilis pectate lyases
EP1350843A2 (en) 2002-03-27 2003-10-08 Kao Corporation Alkaline cellulase variants
US9600454B2 (en) 2007-05-07 2017-03-21 International Business Machines Corporation Method and system for effective schema generation via programmatic analysys
US9600426B2 (en) 2012-08-07 2017-03-21 Ricoh Company, Ltd. Bus control device, image processing apparatus, and bus control method

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5648263A (en) * 1988-03-24 1997-07-15 Novo Nordisk A/S Methods for reducing the harshness of a cotton-containing fabric
US5120463A (en) * 1989-10-19 1992-06-09 Genencor International, Inc. Degradation resistant detergent compositions based on cellulase enzymes
CA2093422C (en) * 1990-10-05 2001-04-03 Detergent compositions containing cellulase compositions deficient in cbh i type components
US5290474A (en) * 1990-10-05 1994-03-01 Genencor International, Inc. Detergent composition for treating cotton-containing fabrics containing a surfactant and a cellulase composition containing endolucanase III from trichoderma ssp
EP0544944A1 (en) * 1991-12-03 1993-06-09 The Procter & Gamble Company Rinse-active foam control particles
US6313081B1 (en) * 1995-04-28 2001-11-06 Henkel Kommanditgesellschaft Auf Aktien (Kgaa) Detergents comprising cellulases
WO1997024421A2 (en) * 1995-12-29 1997-07-10 The Procter & Gamble Company Detergent compositions comprising immobilized enzymes
EP0843041A1 (en) * 1996-11-13 1998-05-20 Novo Nordisk A/S Garments with considerable variation in abrasion level and process for its production using cellulolytic enzymes
US6294366B1 (en) * 1997-09-19 2001-09-25 Clariant Finance (Bvi) Limited Compositions and methods for treating cellulose containing fabrics using truncated cellulase enzyme compositions
WO2000070006A1 (en) * 1999-05-19 2000-11-23 Colgate-Palmolive Company Laundry detergent composition containing high level of protease enzyme
JP2002265998A (en) * 2001-03-15 2002-09-18 Kao Corp Detergent composition
AU2002311012A1 (en) * 2001-06-06 2002-12-16 Novozymes A/S Endo-beta-1,4-glucanase from bacillus
US7041488B2 (en) * 2001-06-06 2006-05-09 Novozymes A/S Endo-beta-1,4-glucanase from bacillus

Patent Citations (96)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB514276A (en) 1938-04-29 1939-11-03 Betterwear Products Ltd Improvements in or relating to combined combs and brushes
GB1082179A (en) 1965-07-19 1967-09-06 Citrique Belge Nv Unsaturated carboxylic salt materials and derivatives thereof
US3455838A (en) 1966-04-22 1969-07-15 Nat Starch Chem Corp Method of encapsulating water-insoluble substances and product thereof
US3723250A (en) 1967-10-03 1973-03-27 Novo Terapeutisk Labor As Proteolytic enzymes, their production and use
GB1261829A (en) 1968-05-24 1972-01-26 Unilever Ltd Detergent compositions
GB1296839A (en) 1969-05-29 1972-11-22
GB1372034A (en) 1970-12-31 1974-10-30 Unilever Ltd Detergent compositions
GB1379241A (en) 1971-03-02 1975-01-02 Unilever Ltd Preparation of salts of carboxymethyloxysuccinic acid
NL7205873A (en) 1971-04-30 1972-11-01
GB1398422A (en) 1971-06-25 1975-06-18 Unilever Ltd Sulphosuccinate derivatives as detergent builders
GB1398421A (en) 1971-06-25 1975-06-18 Unilever Ltd Sulphosuccinate derivatives for use as detergent builders
US3936448A (en) 1971-06-25 1976-02-03 Lever Brothers Company α-Amino-β-sulfosuccinates
GB1387447A (en) 1971-06-30 1975-03-19 Monsanto Co Carboxylic acids and derivatives
GB1425343A (en) 1972-02-14 1976-02-18 Unilever Ltd Phthalic acid derivatives
GB1400898A (en) 1972-07-14 1975-07-16 Procter & Gamble Detergent compositions
US3933672A (en) 1972-08-01 1976-01-20 The Procter & Gamble Company Controlled sudsing detergent compositions
GB1439000A (en) 1972-11-29 1976-06-09 Henkel & Cie Gmbh Washing compositions and washing assistants for textiles
GB1464616A (en) 1973-06-12 1977-02-16 Polak Frutal Works Encapsulation process
GB1483591A (en) 1973-07-23 1977-08-24 Novo Industri As Process for coating water soluble or water dispersible particles by means of the fluid bed technique
US4033718A (en) 1973-11-27 1977-07-05 The Procter & Gamble Company Photoactivated bleaching process
BE821370A (en) 1974-03-04 1975-04-23 PROCESS FOR PREPARING ETHER-POLYCARBOXYLIC ACIDS
BE821369A (en) 1974-03-04 1975-04-23 PROCESS FOR PREPARING ETHER-POLYCARBOXYLIC ACIDS
US3935257A (en) 1974-03-18 1976-01-27 Monsanto Company Chemical compounds
BE831368A (en) 1974-07-15 1975-11-03 PROCESS FOR OBTAINING HYDROGEN AND OXYGEN BY DECOMPOSITION OF WATER
US3929678A (en) 1974-08-01 1975-12-30 Procter & Gamble Detergent composition having enhanced particulate soil removal performance
DE2446487A1 (en) 1974-09-28 1976-09-02 Basf Ag Laminated magnetogram carrier - having magnetic, image-registering layer bonded to polyethylene terephthalate film with defined surface roughness
DE2446686A1 (en) 1974-09-30 1976-04-15 Henkel & Cie Gmbh PROCESS FOR THE PREPARATION OF ETHERPOLYCARBONIC ACIDS
BE840623A (en) 1975-04-11 1976-10-11 LIQUID DETERGENT COMPOSITION
US4106991A (en) 1976-07-07 1978-08-15 Novo Industri A/S Enzyme granulate composition and process for forming enzyme granulates
DE2646126A1 (en) 1976-10-13 1978-04-20 Baer Elektrowerke Kg Automatic control circuit for electric devices - has triac whose control electrode is connected to output of voltage divider with PTC resistor
GB1596756A (en) 1977-04-22 1981-08-26 Procter & Gamble Ltd Detergent compositions
EP0000224A1 (en) 1977-06-29 1979-01-10 THE PROCTER &amp; GAMBLE COMPANY Liquid detergent composition for improved greasy soil removal
US4116885A (en) 1977-09-23 1978-09-26 The Procter & Gamble Company Anionic surfactant-containing detergent compositions having soil-release properties
US4228044A (en) 1978-06-26 1980-10-14 The Procter & Gamble Company Laundry detergent compositions having enhanced particulate soil removal and antiredeposition performance
EP0011340A1 (en) 1978-11-20 1980-05-28 THE PROCTER &amp; GAMBLE COMPANY Detergent composition having textile softening properties
EP0026528B1 (en) 1979-09-29 1984-12-05 THE PROCTER &amp; GAMBLE COMPANY Detergent compositions
US4435307A (en) 1980-04-30 1984-03-06 Novo Industri A/S Detergent cellulase
US4565647B1 (en) 1982-04-26 1994-04-05 Procter & Gamble Foaming surfactant compositions
US4565647A (en) 1982-04-26 1986-01-21 The Procter & Gamble Company Foaming surfactant compositions
US4412934A (en) 1982-06-30 1983-11-01 The Procter & Gamble Company Bleaching compositions
EP0120591A1 (en) 1983-02-23 1984-10-03 The Procter & Gamble Company Detergent ingredients, and their use in cleaning compositions and washing processes
EP0133354A1 (en) 1983-08-09 1985-02-20 Interox Chemicals Limited Denture cleansing compositions
US4483781A (en) 1983-09-02 1984-11-20 The Procter & Gamble Company Magnesium salts of peroxycarboxylic acids
US4661452A (en) 1984-05-29 1987-04-28 Novo Industri A/S Enzyme containing granulates useful as detergent additives
US4634551A (en) 1985-06-03 1987-01-06 Procter & Gamble Company Bleaching compounds and compositions comprising fatty peroxyacids salts thereof and precursors therefor having amide moieties in the fatty chain
EP0214761A2 (en) 1985-08-07 1987-03-18 Novo Nordisk A/S An enzymatic detergent additive, a detergent, and a washing method
EP0218272A1 (en) 1985-08-09 1987-04-15 Gist-Brocades N.V. Novel lipolytic enzymes and their use in detergent compositions
EP0238023A2 (en) 1986-03-17 1987-09-23 Novo Nordisk A/S Process for the production of protein products in Aspergillus oryzae and a promoter for use in Aspergillus
US4711730A (en) 1986-04-15 1987-12-08 The Procter & Gamble Company Capped 1,2-propylene terephthalate-polyoxyethylene terephthalate polyesters useful as soil release agents
EP0242919A1 (en) 1986-04-23 1987-10-28 The Procter & Gamble Company Softening detergent compositions containing amide softening agent
EP0258068A2 (en) 1986-08-29 1988-03-02 Novo Nordisk A/S Enzymatic detergent additive
EP0272033A2 (en) 1986-12-15 1988-06-22 The Procter & Gamble Company Terephthalate ester copolymers and their use in laundry compositions
WO1988009367A1 (en) 1987-05-29 1988-12-01 Genencor, Inc. Cutinase cleaning composition
US5019292A (en) 1987-06-30 1991-05-28 The Procter & Gamble Company Detergent compositions
EP0299575A1 (en) 1987-07-14 1989-01-18 The Procter & Gamble Company Detergent compositions
EP0305216A1 (en) 1987-08-28 1989-03-01 Novo Nordisk A/S Recombinant Humicola lipase and process for the production of recombinant humicola lipases
JPS6474992A (en) 1987-09-16 1989-03-20 Fuji Oil Co Ltd Dna sequence, plasmid and production of lipase
EP0311342A2 (en) 1987-10-05 1989-04-12 The Procter & Gamble Company Sulfoaroyl end-capped ester oligomers suitable as soil-release agents in detergent compositions and fabric-conditioner articles
EP0313146A2 (en) 1987-10-19 1989-04-26 The Procter & Gamble Company Detergent compositions
WO1989006279A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Mutated subtilisin genes
WO1989006270A1 (en) 1988-01-07 1989-07-13 Novo-Nordisk A/S Enzymatic detergent
EP0331376A2 (en) 1988-02-28 1989-09-06 Amano Pharmaceutical Co., Ltd. Recombinant DNA, bacterium of the genus pseudomonas containing it, and process for preparing lipase by using it
WO1990009446A1 (en) 1989-02-17 1990-08-23 Plant Genetic Systems N.V. Cutinase
EP0506780A1 (en) 1989-12-18 1992-10-07 Novo Nordisk As Stable integration of dna in bacterial genomes.
WO1991009129A1 (en) 1989-12-18 1991-06-27 Novo Nordisk A/S Stable integration of dna in bacterial genomes
WO1991016422A1 (en) 1990-04-14 1991-10-31 Kali-Chemie Aktiengesellschaft Alkaline bacillus lipases, coding dna sequences therefor and bacilli which produce these lipases
WO1991017243A1 (en) 1990-05-09 1991-11-14 Novo Nordisk A/S A cellulase preparation comprising an endoglucanase enzyme
EP0495257A1 (en) 1991-01-16 1992-07-22 The Procter & Gamble Company Compact detergent compositions with high activity cellulase
EP0537381A1 (en) 1991-10-14 1993-04-21 The Procter & Gamble Company Detergent compositions inhibiting dye transfer in washing
EP0571982A1 (en) 1992-05-27 1993-12-01 Showa Denko Kabushiki Kaisha Alkaline lipase, method for producing the same, microorganism producing the same and detergent composition containing alkaline lipase
EP0593841A1 (en) 1992-10-23 1994-04-27 The Procter & Gamble Company Detergent composition with suds suppressing system
WO1994012621A1 (en) 1992-12-01 1994-06-09 Novo Nordisk Enhancement of enzyme reactions
WO1995001426A1 (en) 1993-06-29 1995-01-12 Novo Nordisk A/S Enhancement of laccase reactions
EP0721981A1 (en) 1993-08-30 1996-07-17 Showa Denko Kabushiki Kaisha Novel lipase, microorganism producing the lipase, process for producing the lipase, and use of the lipase
WO1995014783A1 (en) 1993-11-24 1995-06-01 Showa Denko K.K. Lipase gene and variant lipase
WO1995026397A1 (en) 1994-03-29 1995-10-05 Novo Nordisk A/S Alkaline bacillus amylase
WO1996029397A1 (en) 1995-03-17 1996-09-26 Novo Nordisk A/S Novel endoglucanases
EP0822973A1 (en) 1995-04-28 1998-02-11 Henkel Kommanditgesellschaft auf Aktien Cellulase-containing washing agents
WO1997001629A1 (en) 1995-06-28 1997-01-16 Novo Nordisk A/S A cellulase with reduced mobility
WO1998012307A1 (en) 1996-09-17 1998-03-26 Novo Nordisk A/S Cellulase variants
US6124127A (en) 1997-11-24 2000-09-26 Novo Nordisk A/S Pectate lyase
WO1999027083A1 (en) 1997-11-24 1999-06-03 Novo Nordisk A/S PECTIN DEGRADING ENZYMES FROM $i(BACILLUS LICHENIFORMIS)
WO1999027084A1 (en) 1997-11-24 1999-06-03 Novo Nordisk A/S Novel pectate lyases
WO1999064619A2 (en) 1998-06-10 1999-12-16 Novozymes A/S Novel mannanases
JP2000210081A (en) 1999-01-21 2000-08-02 Kao Corp Heat-resistant alkali cellulase gene
WO2000055309A1 (en) 1999-03-16 2000-09-21 Novozymes A/S Novel pectate lyases
WO2000060063A1 (en) 1999-03-31 2000-10-12 Novozymes A/S Lipase variant
WO2000060060A2 (en) 1999-03-31 2000-10-12 Novozymes A/S Polypeptides having alkaline alpha-amylase activity and nucleic acids encoding same
WO2000075344A1 (en) 1999-06-02 2000-12-14 Novozymes A/S Pectate lyase fusion for expression and secretion of polypeptides
WO2001064852A1 (en) 2000-03-03 2001-09-07 Novozymes A/S Polypeptides having alkaline alpha-amylase activity and nucleic acids encoding same
WO2001066712A2 (en) 2000-03-08 2001-09-13 Novozymes A/S Variants with altered properties
WO2002009909A2 (en) 2000-08-02 2002-02-07 Element Six (Pty) Ltd Abrasive product
WO2002092741A2 (en) 2001-05-14 2002-11-21 Novozymes A/S 0etergent compositions comprising bacillus subtilis pectate lyases
EP1350843A2 (en) 2002-03-27 2003-10-08 Kao Corporation Alkaline cellulase variants
US9600454B2 (en) 2007-05-07 2017-03-21 International Business Machines Corporation Method and system for effective schema generation via programmatic analysys
US9600426B2 (en) 2012-08-07 2017-03-21 Ricoh Company, Ltd. Bus control device, image processing apparatus, and bus control method

Non-Patent Citations (17)

* Cited by examiner, † Cited by third party
Title
"Bacillus subtilis and other Gram-Positive Bacteria", 1993, AMERICAN SOCIETY FOR MICROBIOLOGY, pages: 618
"Current protocols in Molecular Biology", 1995, JOHN WILEY AND SONS
"Efficient manganese catalysts for low- temperature bleaching", NATURE, 1994, pages 637 - 639
"Molecular Biological Methods for Bacillus", 1990, JOHN WILEY AND SONS
DARTOIS ET AL., BIOCHEMICA ET BIOPHYSICA ACTA, vol. 1131, 1993, pages 253 - 260
DIDERICHSEN, B.; WEDSTED, U.; HEDEGAARD, L.; JENSEN, B. R.; SJOHOLM, C.: "Cloning of aldB, which encodes alpha-acetolactate decarboxylase, an exoenzyme from Bacillus brevis", J. BACTERIOL., vol. 172, 1990, pages 4315 - 432
HASS, M.J ET AL., GENE, vol. 109, 1991, pages 117 - 113
JAY C. HARRIS: "Detergency Evaluation and Testing", 1954, INTERSCIENCE PUBLISHERS LTD., pages: 60 - 61
KUGIMIYA ET AL., BIOSCI. BIOTECH. BIOCHEM., vol. 56, 1992, pages 716 - 719
MCKENZIE, T. ET AL., PLASMID, vol. 15, 1986, pages 93 - 103
P.L. JØRGENSEN ET AL., GENE, vol. 96, 1990, pages 37 - 41
PITCHER, D. G.; SAUNDERS, N. A.; OWEN, R. J: "Rapid extraction of bacterial genomic DNA with guanidium thiocyanate", LETT APPL MICROBIOL, vol. 8, 1989, pages 151 - 156, XP009044138
SAMBROOK ET AL.: "Molecular cloning: A laboratory manual", 1989, COLD SPRING HARBOR LAB.
SCHIMADA, Y. ET AL., J. BIOCHEM., vol. 106, 1989, pages 383 - 388
THE JOURNAL OF THE AMERICAN OIL CHEMISTS SOCIETY, vol. 52, 1975, pages 323 - 329
YAMAGUCHI ET AL., GENE, vol. 103, 1991, pages 61 - 67
YASBIN, R.E.; WIL- SON, G.A.; YOUNG, F.E.: "Transformation and transfection in lysogenic strains of Bacillus subtilis: evidence for selective induction of prophage in competent cells", J. BACTERIOL, vol. 121, 1975, pages 296 - 304

Cited By (104)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2006143854A (en) * 2004-11-18 2006-06-08 Lion Corp Amylase-containing granular detergent composition
JP2006143855A (en) * 2004-11-18 2006-06-08 Lion Corp Amylase-containing bleaching composition with improved effect for removing drink stain
CN101346464B (en) * 2005-12-22 2012-06-20 生化酶股份有限公司 Novel enzymes
EP2453013A1 (en) 2005-12-22 2012-05-16 ROAL Oy Treatment of cellulosic material and enzymes useful therein
US7256032B2 (en) 2005-12-22 2007-08-14 Ab Enzymes Oy Enzymes
US8409836B2 (en) 2005-12-22 2013-04-02 Roal Oy Treatment of cellulosic material and enzymes useful therein
US9593324B2 (en) 2005-12-22 2017-03-14 Roal Oy Treatment of cellulosic material and enzymes useful therein
US9758777B2 (en) 2005-12-22 2017-09-12 Roal Oy Treatment of cellulosic material and enzymes useful therein
EP1963498A1 (en) * 2005-12-22 2008-09-03 ROAL Oy Treatment of cellulosic material and enzymes useful therein
WO2007071820A1 (en) 2005-12-22 2007-06-28 Ab Enzymes Oy Novel enzymes
EP2453014A1 (en) 2005-12-22 2012-05-16 ROAL Oy Treatment of cellulosic material and enzymes useful therein
AU2006326963B2 (en) * 2005-12-22 2012-03-29 Roal Oy Treatment of cellulosic material and enzymes useful therein
EP2319920A1 (en) 2005-12-22 2011-05-11 ROAL Oy Treatment of cellulosic material and enzymes useful therein
EP1963498A4 (en) * 2005-12-22 2010-01-06 Roal Oy Treatment of cellulosic material and enzymes useful therein
EP1969123A4 (en) * 2005-12-22 2009-07-01 Ab Enzymes Oy Novel enzymes
EP1969123A1 (en) * 2005-12-22 2008-09-17 AB Enzymes Oy Novel enzymes
US7786067B2 (en) 2006-01-23 2010-08-31 The Procter & Gamble Company Composition comprising a lipase and a bleach catalyst
WO2007087319A3 (en) * 2006-01-23 2007-12-21 Procter & Gamble Detergent compositions
WO2007087319A2 (en) * 2006-01-23 2007-08-02 The Procter & Gamble Company Detergent compositions
WO2007087242A3 (en) * 2006-01-23 2007-10-04 Procter & Gamble A composition comprising a lipase and a bleach catalyst
WO2007144857A1 (en) * 2006-06-16 2007-12-21 The Procter & Gamble Company Detergent compositions
EP1867708B1 (en) 2006-06-16 2017-05-03 The Procter and Gamble Company Detergent compositions
WO2007144855A1 (en) * 2006-06-16 2007-12-21 The Procter & Gamble Company Detergent compositions
EP1882731A1 (en) * 2006-06-16 2008-01-30 The Procter and Gamble Company Detergent compositions
CN101473023B (en) * 2006-06-16 2014-07-23 宝洁公司 Detergent compositions
EP1867707A1 (en) * 2006-06-16 2007-12-19 The Procter and Gamble Company Detergent compositions
EP1867708A1 (en) * 2006-06-16 2007-12-19 The Procter and Gamble Company Detergent Compositions
WO2008007320A2 (en) * 2006-07-07 2008-01-17 The Procter & Gamble Company Detergent compositions
EP1876227A1 (en) * 2006-07-07 2008-01-09 The Procter and Gamble Company Detergent Compositions
WO2008007320A3 (en) * 2006-07-07 2008-03-13 Procter & Gamble Detergent compositions
WO2008007318A3 (en) * 2006-07-07 2008-03-13 Procter & Gamble Detergent compositions
US8846598B2 (en) 2006-07-07 2014-09-30 The Procter & Gamble Company Composition comprising a cellulase and a bleach catalyst
EP1876226A1 (en) 2006-07-07 2008-01-09 The Procter and Gamble Company Detergent compositions
WO2008007318A2 (en) * 2006-07-07 2008-01-17 The Procter & Gamble Company Detergent compositions
US8999912B2 (en) 2007-07-09 2015-04-07 The Procter & Gamble Company Detergent compositions
EP2157162A1 (en) 2008-08-13 2010-02-24 The Procter and Gamble Company Particulate bleaching composition comprising enzymes
WO2010019728A1 (en) * 2008-08-13 2010-02-18 The Procter & Gamble Company Particulate bleaching composition comprising enzymes
WO2010108000A1 (en) 2009-03-18 2010-09-23 The Procter & Gamble Company Structured fluid detergent compositions comprising dibenzylidene polyol acetal derivatives and detersive enzymes
WO2010108002A1 (en) 2009-03-18 2010-09-23 The Procter & Gamble Company Structured fluid detergent compositions comprising dibenzylidene sorbitol acetal derivatives
WO2011080267A3 (en) * 2009-12-29 2011-09-29 Novozymes A/S Gh61 polypeptides having detergency enhancing effect
WO2011080267A2 (en) 2009-12-29 2011-07-07 Novozymes A/S Polypetides having detergency enhancing effect
WO2011104339A1 (en) 2010-02-25 2011-09-01 Novozymes A/S Variants of a lysozyme and polynucleotides encoding same
WO2011134809A1 (en) 2010-04-26 2011-11-03 Novozymes A/S Enzyme granules
EP2840134A1 (en) 2010-04-26 2015-02-25 Novozymes A/S Enzyme granules
WO2012028483A1 (en) 2010-08-30 2012-03-08 Novozymes A/S A concentrated soak wash
WO2012028482A1 (en) 2010-08-30 2012-03-08 Novozymes A/S A two-soak wash
WO2012035103A1 (en) 2010-09-16 2012-03-22 Novozymes A/S Lysozymes
WO2012084582A1 (en) * 2010-12-21 2012-06-28 Henkel Ag & Co. Kgaa Liquid surfactant preparation containing lipase and phosphonate
US8802423B2 (en) 2010-12-30 2014-08-12 Novozymes A/S Method for treating textile with endoglucanase
CN103429736A (en) * 2010-12-30 2013-12-04 诺维信公司 Method for treating textile with endoglucanase
WO2012089024A1 (en) * 2010-12-30 2012-07-05 Novozymes A/S Method for treating textile with endoglucanase
EP2658968A1 (en) * 2010-12-30 2013-11-06 Novozymes A/S Method for treating textile with endoglucanase
EP2658968A4 (en) * 2010-12-30 2017-05-03 Novozymes A/S Method for treating textile with endoglucanase
EP2487237A1 (en) * 2011-02-14 2012-08-15 Achim Gau Bifunctional polypeptide and compounds containing same
WO2013003025A1 (en) 2011-06-20 2013-01-03 The Procter & Gamble Company Consumer products with lipase comprising coated particles
WO2012175401A2 (en) 2011-06-20 2012-12-27 Novozymes A/S Particulate composition
EP2537918A1 (en) 2011-06-20 2012-12-26 The Procter & Gamble Company Consumer products with lipase comprising coated particles
WO2013067026A1 (en) 2011-10-31 2013-05-10 Bp Corporation North America Inc. Use of plant promoters in filamentous fungi
WO2013067028A1 (en) 2011-10-31 2013-05-10 Bp Corporation North America Inc. Use of mammalian promoters in filamentous fungi
EP3456809A1 (en) 2012-10-04 2019-03-20 Ecolab USA, Inc. Pre-soak technology for laundry and other hard surface cleaning
EP3176260A1 (en) * 2012-10-05 2017-06-07 Novozymes A/S Preventing adhesion of bacteria
US10005988B2 (en) 2012-10-05 2018-06-26 Novozymes A/S Reducing adhesion of bacteria to a surface or releasing bacteria from a surface to which they adhere using endo-beta-A,4-glucanases
WO2014053594A1 (en) * 2012-10-05 2014-04-10 Novozymes A/S Preventing adhesion of bacteria
WO2014070856A2 (en) 2012-11-02 2014-05-08 Bp Corporation North America Inc. Thermotolerant beta-glucosidase variants
US9598816B2 (en) 2012-12-24 2017-03-21 Novozymes A/S Methods for treating textiles using polypeptides having endoglucanase activity
US9506050B2 (en) 2012-12-24 2016-11-29 Novozymes A/S Polypeptides having endoglucanase activity and polynucleotides encoding same
WO2014145768A2 (en) 2013-03-15 2014-09-18 Bp Corporation North America Inc. Use of non-fungal 5' utrs in filamentous fungi
US11103118B2 (en) 2014-08-01 2021-08-31 Ecolab Usa Inc. Method of manual surface cleaning using cleaning textiles and of washing said cleaning textiles
WO2016041676A1 (en) 2014-09-18 2016-03-24 Unilever Plc Whitening composition
US9994836B2 (en) 2014-10-27 2018-06-12 Ab Enzymes Oy Fungal endoglucanase variants, their production and use
CN108431220A (en) * 2015-12-07 2018-08-21 诺维信公司 Polypeptide with 1,4 beta-glucanase activity encodes its polynucleotides and its purposes in cleaning and detergent composition
CN108431220B (en) * 2015-12-07 2022-06-07 诺维信公司 Polypeptides having beta-glucanase activity, polynucleotides encoding same and use thereof in cleaning and detergent compositions
WO2017106676A1 (en) 2015-12-18 2017-06-22 Danisco Us Inc Polypeptides with endoglucanase activity and uses thereof
WO2018089211A1 (en) 2016-11-08 2018-05-17 Ecolab Usa Inc. Non-aqueous cleaner for vegetable oil soils
WO2020150386A1 (en) 2019-01-16 2020-07-23 Fornia Biosolutions, Inc. Endoglucanase compositions and methods
US10927358B2 (en) 2019-01-16 2021-02-23 Fornia Biosolutions, Inc. Endoglucanase compositions and methods
WO2021030676A1 (en) 2019-08-14 2021-02-18 Ecolab Usa Inc. Methods of cleaning and soil release of highly oil absorbing substrates employing optimized extended chain nonionic surfactants
EP4034622A4 (en) * 2019-09-29 2023-10-11 Novozymes A/S Use of cellulase for improvement of sustainability of detergents
WO2021074430A1 (en) 2019-10-18 2021-04-22 Basf Se Storage-stable hydrolase containing liquids
WO2021105336A1 (en) 2019-11-29 2021-06-03 Basf Se Compositions comprising polymer and enzyme
WO2021115912A1 (en) 2019-12-09 2021-06-17 Basf Se Formulations comprising a hydrophobically modified polyethyleneimine and one or more enzymes
WO2022010906A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Peg-modified castor oil based compositions for microemulsifying and removing multiple oily soils
WO2022010893A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Foaming mixed alcohol/water compositions comprising a combination of alkyl siloxane and a hydrotrope/solubilizer
WO2022010911A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Foaming mixed alcohol/water compositions comprising a structured alkoxylated siloxane
WO2022008732A1 (en) 2020-07-10 2022-01-13 Basf Se Enhancing the activity of antimicrobial preservatives
WO2022063699A1 (en) 2020-09-22 2022-03-31 Basf Se Improved combination of protease and protease inhibitor with secondary enzyme
WO2022063698A1 (en) 2020-09-22 2022-03-31 Basf Se Liquid composition comprising peptide aldehyde
EP4015629A1 (en) 2020-12-18 2022-06-22 Basf Se Polymer mixtures for increasing stability and performance of hydrolase-containing detergents
EP4029936A2 (en) 2020-12-22 2022-07-20 Fornia BioSolutions, Inc. Additional endoglucanase variants and methods
WO2023111296A1 (en) 2021-12-17 2023-06-22 Basf Se Composition comprising an antimicrobial agent and a carboxamide
WO2023111297A1 (en) 2021-12-17 2023-06-22 Basf Se Lactones for enhancing the activity of antimicrobial agents
WO2023118015A1 (en) 2021-12-21 2023-06-29 Basf Se Environmental attributes for care composition ingredients
WO2023165507A1 (en) * 2022-03-02 2023-09-07 Novozymes A/S Use of xyloglucanase for improvement of sustainability of detergents
EP4289273A1 (en) 2022-06-07 2023-12-13 Basf Se Composition comprising an antimicrobial agent and a n-cyclohexyldiazeniumdioxy salt
WO2024012894A1 (en) 2022-07-15 2024-01-18 Basf Se Alkanolamine formates for enzyme stabilization in liquid formulations
WO2024020445A1 (en) 2022-07-20 2024-01-25 Ecolab Usa Inc. Novel nonionic extended surfactants, compositions and methods of use thereof
WO2024033135A2 (en) 2022-08-11 2024-02-15 Basf Se Amylase variants
WO2024033136A1 (en) 2022-08-11 2024-02-15 Basf Se Amylase variants
WO2024094733A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024094735A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
WO2024094732A1 (en) 2022-11-04 2024-05-10 Basf Se Polypeptides having protease activity for use in detergent compositions
EP4385328A1 (en) 2022-12-15 2024-06-19 Basf Se Alpha-hydroxyketones for enhancing the activity of antimicrobial agents
EP4389864A1 (en) 2022-12-20 2024-06-26 Basf Se Cutinases
WO2024132625A1 (en) 2022-12-20 2024-06-27 Basf Se Cutinases

Also Published As

Publication number Publication date
EP2311941A1 (en) 2011-04-20
WO2004053039A3 (en) 2004-07-29
BR0317124A (en) 2005-10-25
CN1738899A (en) 2006-02-22
BRPI0317124B1 (en) 2016-05-17
EP1572996A2 (en) 2005-09-14
MXPA05006071A (en) 2005-09-30
AU2003302905A1 (en) 2004-06-30
AU2003302905A8 (en) 2004-06-30
EP2311941B1 (en) 2014-03-19
JP2006509850A (en) 2006-03-23
US20070179076A1 (en) 2007-08-02
US20060035800A1 (en) 2006-02-16
JP4851093B2 (en) 2012-01-11
EP1572996B1 (en) 2014-06-11

Similar Documents

Publication Publication Date Title
EP2311941B1 (en) Detergent composition comprising endo-glucanase
US6268197B1 (en) Xyloglucan-specific alkaline xyloglucanase from bacillus
EP1002060B1 (en) Alkaline xyloglucanase
US8563290B2 (en) Pectate lyase variants
EP1259594B1 (en) Family 44 xyloglucanases
US8501448B2 (en) Family 44 xyloglucanases
US6207436B1 (en) Endo-B-1,4-glucanases from saccharothrix
US6630340B2 (en) Family 5 xyloglucanases
US5997584A (en) Method of treating polyester fabrics
US5968883A (en) Peroxidase variants
WO2001064853A1 (en) Family 5 xyloglucanases
EP1210414B1 (en) Alkaline xyloglucanase from malbranchea
US6500658B1 (en) Xyloglucanase from Malbranchea
EP0747470A1 (en) Cleaning compositions comprising keratanase
US20030087415A1 (en) Extracellular expression of pectate lyase using Bacillus or Escherichia coli
WO2001079440A2 (en) Extracellular expression of pectate lyase using bacillus or escherichia coli
WO1996041861A1 (en) Cleaning compositions comprising chondroitinase
MXPA99011756A (en) Alkaline xyloglucanase

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): BW GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
WWE Wipo information: entry into national phase

Ref document number: 2003812567

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: PA/a/2005/006071

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2004557818

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 2006035800

Country of ref document: US

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 10538343

Country of ref document: US

Ref document number: 1197/CHENP/2005

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 20038A86160

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2003812567

Country of ref document: EP

ENP Entry into the national phase

Ref document number: PI0317124

Country of ref document: BR

WWP Wipo information: published in national office

Ref document number: 10538343

Country of ref document: US