WO2004022004A2 - Modified glp-1 receptor agonists and their pharmacological methods of use - Google Patents
Modified glp-1 receptor agonists and their pharmacological methods of use Download PDFInfo
- Publication number
- WO2004022004A2 WO2004022004A2 PCT/US2003/028093 US0328093W WO2004022004A2 WO 2004022004 A2 WO2004022004 A2 WO 2004022004A2 US 0328093 W US0328093 W US 0328093W WO 2004022004 A2 WO2004022004 A2 WO 2004022004A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- polypeptide
- glp
- diabetes
- agents
- insulin
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- This invention relates to modified GLP-1 receptor agonists comprising a GLP-1 receptor agonist linked to a polyethylene glycol polymer having a molecular weight of greater than 30 kD, as well as related formulations, dosages and methods of administration thereof for therapeutic purposes. More particularly, these modified GLP-1 receptor agonists, compositions and methods are useful in providing a treatment option for those individuals afflicted with a metabolic disorder such as diabetes, impaired glucose tolerance, or metabolic syndrome, prediabetic states, by inducing glucose- dependent insulin secretion in the absence of the therapeutically limiting side effect of reducing or inhibiting gastrointestinal motility.
- a metabolic disorder such as diabetes, impaired glucose tolerance, or metabolic syndrome, prediabetic states
- Diabetes is characterized by impaired insulin secretion manifesting itself, among other things, by an elevated blood glucose level in the diabetic patient. Underlying defects lead to a classification of diabetes into two major groups: type 1 diabetes, or insulin dependent diabetes mellitus (IDDM), which arises when patients lack ⁇ -cells producing insulin in their pancreatic glands, and type 2 diabetes, or non-insulin dependent diabetes mellitus (NIDDM), which occurs in patients with an impaired ⁇ -cell insulin secretion and alterations in insulin action.
- IDDM insulin dependent diabetes mellitus
- NIDDM non-insulin dependent diabetes mellitus
- Type 1 diabetic patients are currently treated with insulin, while type 2 diabetic patients can be treated with agents that stimulate ⁇ -cell function or with agents that enhance the tissue sensitivity of the patients towards insulin. Over time almost one-half of type 2 diabetic subjects lose their response to these agents and then must be placed on insulin therapy.
- the drugs presently used to treat type 2 diabetes are described below.
- Alpha-glucosidase inhibitors e.g., PRECOSE®, VOGLIBOSETM, and MIGLITOL®
- PRECOSE® e.g., PRECOSE®, VOGLIBOSETM, and MIGLITOL®
- MIGLITOL® reduce the excursion of postprandial glucose by delaying the absorption of glucose from the gut.
- Insulin sensitizers are drugs that enhance the body's response to insulin.
- Thiozolidinediones such as AvandiaTM (rosiglitazone) and ActosTM activate the Peroxisome proliferator-activated receptor (PPAR) gamma and modulate the activity of a set of genes that have not been well described.
- RezulinTM troglitazone
- the first drug in this class was withdrawn because elevated liver enzyme levels and drug induced hepatotoxicity. These hepatic effects do not appear to be a significant problem in patients using AvandiaTM and ActosTM. Even so, liver enzyme testing is recommended every 2 months in the first year of therapy and periodically thereafter.
- AvandiaTM and ActosTM treatments are associated with fluid retention, edema and weight gain. AvandiaTM is not indicated for use with insulin because of concern about congestive heart failure.
- Insulin secretagogues such as sulfonylureas (SFUs) and the non-sulfonylureas (e.g., Nateglinide and Pepaglinide) act through the ATP-dependent K+ channel to cause glucose independent insulin secretion.
- SFUs sulfonylureas
- non-sulfonylureas e.g., Nateglinide and Pepaglinide
- Insulin treatment is required in 50% of the SFU responders after 5-7 years of therapy (Scheen, et al., Diabetes Res. Clin. Pract. 6:533-543, 1989).
- Nateglinide and Pepaglinide are short-acting drugs that need to be taken three times a day. They are used only for the control of post-prandial glucose and not for control of fasting glucose.
- GLUCOPHAGETM (metformin HCI) is a biguanide that lowers blood glucose by decreasing hepatic glucose output and increasing peripheral glucose uptake and utilization. The drug is effective at lowering blood glucose in mildly and moderately affected subjects, and does not have the side effects of weight gain or the potential to induce hypoglycemia.
- GLUCOPHAGETM has a number of side effects including gastrointestinal disturbances and lactic acidosis. GLUCOPHAGETM is contraindicated in diabetics over the age of 70 and in subjects with impairment in renal or liver function.
- GLUCOPHAGETM has the same primary and secondary failure rates as the SFUs.
- Insulin treatment is instituted after diet, exercise, and oral medications have failed to adequately control blood glucose. This treatment has the drawbacks that it is an injectable, can produce hypoglycemia, and causes weight gain. The possibility of inducing hypoglycemia with insulin limits the extent that hyperglycemia can be controlled.
- new therapies to treat type 2 diabetes are needed.
- new treatments to retain normal (glucose-dependent) insulin secretion are needed.
- Such new drugs should have the following characteristics: dependent on glucose for promoting insulin secretion (i.e., produce insulin secretion only in the presence of elevated blood glucose); low primary and secondary failure rates; and preserve islet cell function.
- the strategy to develop the new therapy disclosed herein is based on the cyclic adenosine monophosphate (cAMP) signaling mechanism and its effects on insulin secretion.
- cAMP cyclic adenosine monophosphate
- Glucose is a major regulator of the insulin secretion process. Elevation of this sugar promotes the closure of the K+ channels following the elevation of ATP. Closure of the K+ channels causes cell depolarization and subsequent opening of Ca++ channels, which in turn leads to exocytosis of insulin granules. Little, if any, effects on insulin secretion occurs in the absence of low glucose concentrations (Weinhaus, et al., Diabetes 47:1426-1435, 1998).
- Secretagogues like GLP-1 utilize the cAMP system to regulate insulin secretion through this glucose-dependent mechanism ( Komatsu, et al., Diabetes 46:1928-1938, 1997; Filipsson, et al., Diabetes 50:1959-1969, 2001 ; Drucker, Endocrinology 142:521-527, 2001). Insulin secretagogues via the elevation of cAMP is also able to enhance insulin synthesis in addition to insulin release (Skoglund, et al., Diabetes 49:1156-1164, 2000; Borboni, et al., Endocrinology 140:5530-5537, 1999).
- GLP-1 glucagon-like peptide 1
- incretin hormone i.e., it potentiates glucose-induced insulin release from the pancreatic ⁇ -cell. It is a 37-amino acid peptide that is differentially expressed by the glucagon gene, depending upon tissue type.
- the clinical data that support the beneficial effect of raising cAMP levels in ⁇ -cells have been collected with GLP-1. Infusions of GLP-1 in poorly controlled type 2 diabetics normalized their fasting blood glucose levels (Gutniak, et al., New Eng. J. Med.
- GLP-1 reduces gut motility (see, e.g., Kieffer and Habener, Endocrine Reviews 20:876-913, 1999 and Drucker, Gastroenterology 122:531-544, 2002), which in turn results in significant gastrointestinal side effects, such as nausea and vomiting.
- GLP-1 agonists such as NN-2211 (Agerso, et al., Diabetologia 45:195-202, 2002) and Exendin-4 (Amylin abstract, American Diabetes Association meetin, 2001).
- This invention relates to modified GLP-1 receptor agonists comprising a GLP-1 receptor agonist linked to a polyethylene glycol polymer having a molecular weight of greater than 30 kD, and which retains its ability to agonize the GLP-1 receptor.
- modified GLP-1 agonists are effective in the treatment of metabolic disorders, such as diabetes or impaired glucose tolerance, a prediabetic state.
- the modified GLP- 1 agonists of this invention are capable of treating metabolic disorders without inhibiting gastrointestinal motility, thereby producing fewer gastrointestinal side effects, such as nausea and vomiting and allowing higher more effective doses to be administered.
- one aspect of the invention is a polypeptide that functions as a GLP-1 receptor agonist.
- GLP-1 receptor agonists include, but are not limited to, the polypeptides shown in Figure 1 and include those polypeptides selected from the group consisting of SEQ ID NOs: 1-10, and fragments and variants of the polypeptide that function as an agonist of the GLP-1 receptor at substantially the same level as the polypeptides of the listed SEQ ID NOs: 1-10 (collectively, polypeptides of this invention).
- Another embodiment of the invention is polynucleotides that encode for the GLP-1 receptor agonist polypeptides, and the attendant vectors and host cells necessary to recombinantly express the polypeptides of this invention.
- Another aspect of this invention is a modified GLP-1 receptor agonist comprising one of the polypeptides of this invention, or fragments or variants thereof, that function as an agonist of the GLP-1 receptor at substantially the same level as the polypeptides of the invention that has been modified by linking to it a polyethylene glycol polymer having a molecular weight of greater than 30 kD (collectively, "modified polypeptides of this invention").
- modified GLP-1 receptor agonists include, but are not limited to, the modified polypeptides shown in Figure 2 and include those polypeptides selected from the group consisting of SEQ ID NOs: 13-14 and 16-31.
- the invention is also directed to methods of making the GLP-1 agonist polypeptides of this invention, both recombinant and synthetic, and methods of making the modified GLP-1 agonist polypeptides of this invention.
- FIG. 1 depicts amino acid sequences of polypeptides identified as SEQ ID NOs:1- 10 which are examples of GLP-1 receptor agonists, the polypeptides of the invention.
- FIG. 2 depicts amino acid sequences of polypeptides of SEQ ID NOs:13-14 and 16-31 , which are examples of modified GLP-1 agonists, the modified polypeptides of this invention.
- FIG. 3A is a line graph showing that fatty acid-modified GLP-1 reduced gastrointestinal motility.
- FIG. 3B is a line graph showing that GLP-1 modified with a 22 kD PEG reduced gastrointestinal motility, whereas GLP-1 modified with a 43 kD PEG did not reduce gastrointestinal motility.
- FIG. 4 is a line graph showing that a GLP-1 agonist of this invention (SEQ ID NO: 26) modified with a 22 kD or 30 kD PEG reduced gastrointestinal motility, whereas the same GLP-1 agoinst peptide modified with a 43 kD PEG did not reduce gastrointestinal motility.
- FIG. 5 is a bar graph showing that a GLP-1 agonist of this invention (SEQ ID NO: 26) modified with a 43 kD PEG will reduce gastrointestinal motility if injected ICV. DESCRIPTION OF THE INVENTION
- This invention relates to modified GLP-1 receptor agonists comprising a GLP-1 receptor agonist linked to a polyethylene glycol (PEG) polymer having a molecular weight of greater than 30 kD, and methods of administration thereof for therapeutic purposes are provided. More particularly, these modified GLP-1 receptor agonists and compositions function in vivo as GLP-1 receptor agonists in the prevention and/or treatment of such diseases or conditions as diabetes, hyperglycemia, impaired glucose tolerance, impaired fasting glucose, and obesity by inducing glucose-dependent insulin secretion, without reducing gastrointestinal motility.
- PEG polyethylene glycol
- GLP-1 receptor agonist activity has been identified, and include, for example, GLP-1 (7-36), GLP-1 (7-37), Exendin-4, and other GLP-1 analogs (see, e.g., WO 98/43658, WO 00/15224, WO 00/16797, WO 01/98331, U.S. Patent No. 5,545,618; U.S. Patent No. 5,118,666; and U.S. Patent Application Serial No. 60/395,738; the references of which are incorporated herein in their entirety).
- GLP-1 (7-37) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 2
- A alanine (ala); C, cysteine (cys); D, aspartic acid (asp); E, glutamic acid (glu); F, phenylalanine (phe); G, glycine (gly); H, histidine (his); I, isoleucine (ile); K, lycine (lys); L, leucine (leu); M, methionine (met); N, asparagine (asn); P, proline (pro); Q, glutamine (gin); R, arginine (arg); S, serine (ser); T, threonine (thr); V, valine (val); W, tryptophan (trp); and Y, tyrosine (tyr).
- GLP-1 receptor agonists play a role in glucose homeostatsis, and in particular, these peptides function as GLP-1 receptor agonists by lowering plasma glucose concentrations.
- GLP-1 receptor agonists are potentially valuable in the treatment of metabolic disorders and other diseases.
- GLP-1 receptor agonists have had significant side effects; namely a reduction in gastrointestinal motility, which in turn can lead to nausea and vomiting.
- PEGylation of a drug such as small molecules, peptides, or proteins can improve plasma half-life, physical solubility and stability, and resistance to protease degradation as well as reduce immunogenicity. Furthermore, it has been suggested in the art that PEGylation can reduce the extent of adverse side effects by reducing the trough to peak levels of the drug that result from sustained plasma concentrations. However, it was not known in the art that PEGylation could limit access of a drug to a certain tissue.
- modification of a peptide or protein with a particular size or structure of a polymer, such as PEG can selectively affect tissue distribution of the administered modified peptide or protein.
- modification of GLP-1 agonists with a linear 22 kD PEG does not increase the therapeutic index (glucose-lowering vs. gut motility) as compared to unmodified GLP-1 agonists and C16-fatty acid modified agonists.
- Modification with a linear 30 kD PEG modestly improved the therapeutic index
- modification with a branched 43 kD PEG greatly reduced CNS-mediated gut motility.
- the 43 kD-PEGylated GLP-1 agonist was able to induce gut motility.
- PEG size and structure are major determinants of such a selective process.
- the inventors herein have found that modifying the GLP-1 receptor agonists by linking a polyethylene glycol polymer having a molecular weight of greater than 30 kD to the GLP-1 receptor agonist will inhibit the reduction in gastrointestinal motility typically associated with GLP-1 receptor agonists. Without being bound to theory, the inventors herein believe that increasing the size of the GLP-1 receptor agonist using PEGylation technology prevents the GLP-1 receptor agonist from crossing the blood-brain-barrier and thus, accessing the central nervous system. As a result, the GLP-1 agonists' ability to cause gastrointestinal side effects (which are likely to be mediated by the central nervous system) is reduced. The PEGylated GLP-1 receptor agonist, however, still has access to the pancreas and thus, lowers blood glucose, the desired activity for treating type 2 diabetes.
- the polypeptides of this invention are GLP-1 receptor agonists and are determined as such by their ability to activate the GLP-1 receptor.
- the GLP-1 receptor agonist activates the GLP-1 receptor in one or more in vitro or in vivo assays for GLP-1 receptor activation. Examples of such assays include, but are not limited to, in vitro assays for induction of cAMP in RINm5F cells, in vitro assays for induction of insulin secretion from pancreatic ⁇ - cells, in vivo assays for reduction in plasma glucose levels, and in vivo assays for elevation in plasma insulin levels as described in the specific examples below.
- GLP-1 receptor agonists include, but are not limited to, the polypeptides selected from the group consisting of SEQ ID NOs: 1-10 and fragments, derivatives, variants and analogs thereof, that function as an agonist of the GLP-1 receptor at substantially the same level as the polypeptides of the listed SEQ ID NOs: 1-10
- GLP-1 receptor agonists the polypeptides of the present invention, may be naturally-occurring polypeptides, recombinant polypeptides, or synthetic peptides.
- Fragment, derivative, variant, and analog polypeptides retain substantially the same biological function or activity as, for example, polypeptides shown in SEQ ID NOS: 1-10.
- substantially the same biological function or activity each means that degree of biological activity that is within about 30% to about 100% (i.e., 30, 40, 50, 60, 70, 80, 90, or 100%) or more of that biological activity demonstrated by the polypeptide to which it is being compared when the biological activity of each polypeptide is determined by the same procedure.
- a fragment is less than a full-length polypeptide, such as the polypeptides shown in SEQ ID NOs: 1-10, which retains substantially similar functional activity, as shown in the in vitro and in vivo models disclosed herein.
- Derivatives include polypeptides that have been chemically modified to provide an additional structure and/or function. For example, a fatty acid can be added to a polypeptide to improve its half-life. Fusion polypeptides which confer targeting specificity or an additional activity also can be constructed, as described in more detail below. [042] Derivatives can be modified by either a natural process, such as posttranslational processing, or by chemical modification techniques, both of which are well known in the art. Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains, and the amino or carboxyl termini. It will be appreciated that the same type of modification may be present to the same or varying degrees at several sites in a given polypeptide. Also, a variant may contain one or more different types of modifications. Polypeptides may be branched, for example, as a result of ubiquitination, and they may be cyclic, with or without branching.
- Derivatives also include mature polypeptides that have been fused with another polypeptide, for example, human serum albumin, to improve their pharmacokinetic profile. Fusion of two polypeptides can be accomplished by any means known to one skilled in the art. For example, a DNA encoding human serum albumin and a DNA sequence encoding a polypeptide of the invention can be cloned into any mammalian expression vector known to one skilled in the art. Location of a polypeptide of the invention N- terminal to the other polypeptide is preferred, because it appears that a free N-terminal histidine is required for GLP-1 receptor activity (Kawa, Endocrinology 124(49): 1768-73, 1989). The resulting recombinant fusion protein can then be expressed by transforming a suitable cell line, such as HKB or CHO, with the vector and expressing the fusion protein.
- a suitable cell line such as HKB or CHO
- Variants of polypeptides of the invention include polypeptides having one or more amino acid sequence changes with respect to the amino acid sequences shown in SEQ ID NOS: 1-10. Variants also can have amino acids joined to each other by modified peptide bonds (i.e., peptide isosteres) and may contain amino acids other than the 20 naturally occurring amino acids.
- variants contain one or more conservative amino acid substitutions (i.e., 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 substitutions), preferably at nonessential amino acid residues.
- a "nonessential" amino acid residue is a residue that can be altered from a wild-type sequence of a protein without altering its biological activity, whereas an "essential" amino acid residue is required for biological activity.
- a conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, praline, phenylalanine, methionine, tryptophan
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
- Non-conservative substitutions would not be made for conserved amino acid residues or for amino acid residues residing within a conserved protein domain.
- Variants also include polypeptides that differ in amino acid sequence due to mutagenesis. Variants that function as GLP-1 receptor agonists can be identified by screening combinatorial libraries of mutants, for example, mutants of polypeptides with conservative substitutions at one or more positions (i.e., at 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 positions) can be screened for GLP-1 receptor agonist activity using methods well known in the art, and described in Examples 3, 4, 5, and 6.
- An analog includes a propolypeptide, which includes an amino acid sequence of a polypeptide of the invention.
- Active polypeptides of the invention can be cleaved from the additional amino acids in the propolypeptide molecule by natural, in vivo processes, or by procedures well known in the art, such as by enzymatic or chemical cleavage.
- Any polynucleotide sequence that encodes a polypeptide of the invention can be used to express the polypeptide.
- Polynucleotides can consist only of a coding sequence for a polypeptide or can include additional coding and/or non-coding sequences.
- Polynucleotide sequences encoding a polypeptide of the invention can be synthesized in whole or in part using chemical methods well known in the art (see, e.g., Caruthers, et al., Nucl. Acids Res. Symp. Ser. 215-23, 1980; Horn, et al., Nucl. Acids Res. Symp. Ser 225-32, 1980).
- the polynucleotide that encodes the polypeptide can then be cloned into an expression vector to express the polypeptide, or into a cloning vector to propagate the polynucleotide.
- codons preferred by a particular prokaryotic or eukaryotic host can be selected to increase the rate of polypeptide expression or to produce an RNA transcript having desirable properties, such as a half-life, which is longer than that of a transcript generated from the naturally occurring sequence.
- nucleotide sequences disclosed herein can be engineered using methods generally known in the art to alter the polypeptide-encoding sequences for a variety of reasons, including but not limited to, alterations which modify the cloning, processing, and/or expression of the polypeptide or mRNA product.
- DNA shuffling by random fragmentation and PCR reassembly of gene fragments and synthetic oligonucleotides can be used to engineer the nucleotide sequences.
- site-directed mutagenesis can be used to insert new restriction sites, alter glycosylation patterns, change codon preference, produce splice variants, introduce mutations, and so forth.
- the present invention also includes cloning and expression vectors comprising one or more nucleotide sequences encoding a polypeptide of the invention.
- the nucleotide sequence can be inserted in a forward or reverse orientation.
- a DNA sequence may be inserted into a vector by a variety of procedures. In general, a DNA sequence is inserted into an appropriate restriction endonuclease site by procedures known in the art and described in Sambrook et al., MOLECULAR CLONING: A LABORATORY MANUAL, 2d ed., (Cold Spring Harbor, N.Y., 1989). Such procedures and others are deemed to be within the scope of those skilled in the art.
- Examples of cloning vectors include, but are not limited to pBR322, pUC18, pUC19, pSport, and pCRII.
- An expression vector may further comprise regulatory sequences, including, for example, a promoter, operably linked to the coding sequence.
- regulatory sequences including, for example, a promoter, operably linked to the coding sequence.
- Bacterial expression vectors include, but are not limited to, pQE70, pQE60, pQE-9 (Qiagen); pBS, phagescript, psiX174, pBluescript SK, pBsKS, pNH ⁇ a, pNH16a, pNH18a, pNH46a (Stratagene); and pTRC99A, pKK223-3, pKK233-3, pDR540, PRIT5 (Pharmacia).
- Eukaryotic expression vectors include, but are not limited to, pWLneo, pSV2cat, pOG44, pXT1 , pSG (Stratagene); and pSVK3, pBPV, pMSG, PSVL (Pharmacia).
- Promoter regions can be selected from any desired gene using CAT (chloramphenicol transferase) expression vectors or other vectors with selectable markers.
- Two appropriate vectors are pKK232-8 and pCM7.
- bacterial promoters include laci, lacZ, T3, T7, gpt, lambda P R , P and trp.
- Eukaryotic promoters include CMV immediate early, HSV thymidine kinase, early and late SV40, LTRs from retrovirus, and mouse metallothionein-l. Selection of an appropriate vector and promoter is well within the level of ordinary skill in the art.
- An expression vector also may contain a ribosome binding site for translation initiation, a transcription terminator, and appropriate sequences for amplifying expression.
- Expression vectors may contain a gene to provide a phenotypic trait for selection of transformed host cells, such as dihydrofolate reductase or neomycin resistance for a eukaryotic cell culture, or such as tetracycline or ampicillin resistance for culture in E. coli.
- a library of variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library.
- a library of variants can be produced, for example, by enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential variant amino acid sequences is expressible as individual polypeptides or, alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of sequences therein.
- the present invention also provides host cells containing the above-described vectors.
- the host cell can be a higher eukaryotic cell, such as a mammalian cell, or a lower eukaryotic cell, such as a yeast cell.
- the host cell can be a prokaryotic cell, such as a bacterial cell.
- Host cells can be genetically engineered (transduced, transformed, or transfected) with cloning or expression vectors of the invention.
- the vector may be, for example, in the form of a plasmid, a viral particle, or a phage.
- Engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters or selecting transformants. The selection of appropriate culture conditions, such as temperature and pH, are well within the skill of the ordinarily skilled artisan.
- appropriate hosts include, but are not limited to, bacterial cells such as E. coli, Salmonella typhimurium, or Streptomyces; fungal cells such as yeast; insect cells such as Drosophila S2 and Spodoptera Sf9; or mammalian cells such as CHO, COS, or Bowes melanoma.
- bacterial cells such as E. coli, Salmonella typhimurium, or Streptomyces
- fungal cells such as yeast
- insect cells such as Drosophila S2 and Spodoptera Sf9
- mammalian cells such as CHO, COS, or Bowes melanoma.
- constructs in the host cell can be effected, for example, by calcium phosphate transfection, DEAE-Dextran mediated transfection, or electroporation (Davis, et al., BASIC METHODS IN MOLECULAR BIOLOGY, 1986).
- Constructs in host cells can be used in a conventional manner to produce the gene product encoded by the recombinant sequence.
- Mature proteins can be expressed in mammalian cells, yeast, bacteria, or other cells under the control of appropriate promoters. Cell-free translation systems can also be employed to produce such proteins using RNAs derived from the DNA constructs of the present invention. Appropriate cloning and expression vectors for use with prokaryotic and eukaryotic hosts are described above and in Sambrook, et al., (MOLECULAR CLONING: A LABORATORY MANUAL, 2d ed., Cold Spring Harbor, N.Y., 1989).
- Enhancers are c/s-acting elements of DNA, usually from about 10 to 300 bp, that act on a promoter to increase its transcription. Examples include the SV40 enhancer on the late side of the replication origin (bp 100 to 270), a cytomegalovirus early promoter enhancer, a polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
- recombinant expression vectors will include origins of replication and selectable markers permitting transformation of the host cell (e.g., the ampicillin resistance gene of E. coli and S.
- heterologous structural sequence is assembled in appropriate phase with translation, initiation and termination sequences, and preferably, a leader sequence capable of directing secretion of translated protein into the periplasmic space or extracellular medium.
- the heterologous sequence can encode a fusion protein including an N-terminal identification peptide imparting desired characteristics (e.g., stabilization or simplified purification of expressed recombinant product).
- the selected promoter is derepressed by appropriate means (e.g., temperature shift or chemical induction), and cells are cultured for an additional period.
- Cells are typically harvested by centrifugation and disrupted by physical or chemical means. The resulting crude extract is retained for further purification.
- Microbial cells employed in expression of proteins can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
- mammalian cell culture systems also can be employed to express recombinant protein.
- mammalian expression systems include the COS-7 lines of monkey kidney fibroblasts (Gluzman, Cell 23:175, 1981), and other cell lines capable of expressing a compatible vector, for example, C127, 3T3, CHO, HeLa, and HBK cell lines.
- Polypeptides of the present invention may be recovered and purified from recombinant cell cultures by methods well known in the art, including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxyapatite chromatography, and lectin chromatography.
- High performance liquid chromatography (HPLC) can be employed as a final purification step.
- Polypeptides of the invention can be conveniently isolated.
- a purified polypeptide is at least about 70% pure, that is, the isolated polypeptide is substantially free of cellular material and has less than about 30% (by dry weight) of non-polypeptide material.
- the preparations are 85% through 99% (i.e., 85, 87, 89, 91, 93, 95, 96, 97, 98, and 99%) pure. Purity of the preparations can be assessed by any means known in the art, such as SDS-polyacrylamide gel electrophoresis, mass spectroscopy, and liquid chromatography.
- polypeptides of the invention may be glycosylated with mammalian or other eukaryotic carbohydrates or may be non-glycosylated. Polypeptides of the invention may also include an initial methionine amino acid residue.
- polypeptides of the invention can be produced using chemical methods to synthesize its amino acid sequence, such as by direct peptide synthesis using solid-phase techniques (see, e.g., Merrifield, J. Am. Chem. Soc. 85:2149-2154, 1963; Roberge, et al., Science 269:202-204, 1995). Polypeptide synthesis can be performed using manual techniques or by automation. Automated synthesis can be achieved, for example, using Applied Biosystems 431A Peptide Synthesizer (Perkin Elmer).
- fragments of a polypeptide can be separately synthesized and combined using chemical methods to produce a full-length molecule.
- a newly synthesized polypeptide can be substantially purified by preparative high performance liquid chromatography (see, e.g., Creighton, Proteins: Structures And Molecular Principles, WH Freeman and Co., New York, N.Y., 1983).
- the composition of a synthetic polypeptide of the present invention can be confirmed by amino acid analysis or sequencing by, for example, the Edman degradation procedure (see, Creighton, supra). Additionally, any portion of the amino acid sequence of the polypeptide can be altered during direct synthesis and/or combined using chemical methods with sequences from other proteins to produce a variant polypeptide or a fusion polypeptide.
- modified GLP-1 receptor agonists of the present invention comprise a GLP-1 receptor agonist, or a fragment, derivative, variant or analog thereof, which is linked to a polyethylene glycol (PEG) polymer having a molecular weight of greater than 30 kD.
- PEG polyethylene glycol
- Suitable PEG polymers typically are commercially available or may be made by techniques well known to those skilled in the art.
- the PEG polymer has a molecular weight of greater than 30 kD, preferably a molecular weight of greater than 30 kD, more preferably greater than 40 kD, and still more preferably having a branched structure, such as for example, a 43 kD branched PEG-peptide (Shearwater 2001 catalog # 2D3X0T01 , mPEG2-MAL).
- the attachment of a PEG on an intact peptide can be accomplished by attaching the PEG on the opposite side of the peptide surface that interacts with the receptor.
- the attachment of PEG will occur on the GLP-1 agonist, numbered in accordance with GLP-1 (7-37), at positions 22-28 and 30-31 , as well as at positions past the C terminus; namely positions 32-37.
- attachment of the PEG will occur on the GLP-1 agonist, numbered in accordance with GLP-1 (7-37), at positions 24, 28, 30 and 31, as well as at positions past the C terminus; namely at positions 32, 34, 36 and 37.
- attachment of the PEG will occur on the GLP-1 agonist, numbered in accordance with GLP-1 (7-37), at the C terminus; namely position 31.
- cysteine PEGylation is one method for site-specific PEGylation, and it is often utilized if a peptide has few or no free cysteines.
- native GLP-1 (7- 37) for example, there are no cysteine residues.
- PEGylation of native GLP- 1 (7-37) or any GLP-1 agonist having no cysteine residues can be accomplished by introducing a unique cysteine mutation at one of the specific positions on the native GLP- 1 (7-37) or the GLP-1 agonist identified above and then reacting the resulting derivative with a cysteine-specific PEGylation reagent, such as PEG-maleimide.
- a cysteine-specific PEGylation reagent such as PEG-maleimide.
- GLP-1 agonist of this invention it may be necessary to mutate the GLP-1 agonist of this invention in order to allow for site-specific PEGylation.
- a GLP-1 agonist contains cysteine residues, these will need to be substituted with a conservative amino acids in order to ensure site specific PEGylation.
- rigid linkers including but not limited to, "GGS” (SEQ ID NO: 32), "GGSGGS” (SEQ ID NO: 33), and "PPPS” (SEQ ID NO: 34), may be added to the C-terminus of the GLP-1 agonist, but before the site of PEG attachment (i.e., a unique cysteine residue).
- modified GLP-1 receptor agonists of this invention include, but are not limited to, the polypeptides selected from the group consisting of SEQ ID NOs: 13-14 and 16-31.
- the most preferred modified GLP-1 receptor agonist of this invention is SEQ ID NO: 26.
- the polypeptides of the present invention may be employed in treatment diabetes, including both type 1 and type 2 diabetes (non-insulin dependent diabetes mellitus). Such treatment may also delay the onset of diabetes and diabetic complications.
- the polypeptides may be used to prevent subjects with impaired glucose tolerance from proceeding to develop type 2 diabetes.
- Other diseases and conditions that may be treated or prevented using compounds of the invention in methods of the invention include: Maturity-Onset Diabetes of the Young (MODY) (Herman, et al., Diabetes 43:40, 1994); Latent Autoimmune Diabetes Adult (LADA) (Zimmet, et al., Diabetes Med. 11:299, 1994); impaired glucose tolerance (IGT) (Expert Committee on Classification of Diabetes Mellitus, Diabetes Care 22 (Supp. 1):S5, 1999); impaired fasting glucose (IFG) (Charles, et al., Diabetes 40:796, 1991); gestational diabetes (Metzger, Diabetes, 40:197, 1991 ); and metabolic syndrome X.
- MODY Maturity
- polypeptides of the present invention may also be effective in such disorders as obesity, and in the treatment of atherosclerotic disease, hyperlipidemia, hypercholesteremia, low HDL levels, hypertension, cardiovascular disease (including atherosclerosis, coronary heart disease, coronary artery disease, and hypertension), cerebrovascular disease and peripheral vessel disease.
- the compounds of the present invention may also be useful for treating physiological disorders related to, for example, cell differentiation to produce lipid accumulating cells, regulation of insulin sensitivity and blood glucose levels, which are involved in, for example, abnormal pancreatic ⁇ -cell function, insulin secreting tumors and/or autoimmune hypoglycemia due to autoantibodies to insulin, autoantibodies to the insulin receptor, or autoantibodies that are stimulatory to pancreatic ⁇ -cells), macrophage differentiation which leads to the formation of atherosclerotic plaques, inflammatory response, carcinogenesis, hyperplasia, adipocyte gene expression, adipocyte differentiation, reduction in the pancreatic ⁇ -cell mass, insulin secretion, tissue sensitivity to insulin, liposarcoma cell growth, polycystic ovarian disease, chronic anovulation, hyperandrogenism, progesterone production, steroidogenesis, redox potential and oxidative stress in cells, nitric oxide synthase (NOS) production, increased
- Polypeptides of the invention may also be used in methods of the invention to treat secondary causes of diabetes (Expert Committee on Classification of Diabetes Mellitus, Diabetes Care 22 (Supp. 1):S5, 1999).
- Such secondary causes include glucocorticoid excess, growth hormone excess, pheochromocytoma, and drug-induced diabetes.
- Drugs that may induce diabetes include, but are not limited to, pyriminil, nicotinic acid, glucocorticoids, phenytoin, thyroid hormone, ⁇ -adrenergic agents, ⁇ -interferon and drugs used to treat HIV infection.
- polypeptides of the present invention may be used alone or in combination with additional therapies and/or compounds known to those skilled in the art in the treatment of diabetes and related disorders. Alternatively, the methods and compounds described herein may be used, partially or completely, in combination therapy.
- the polypeptides of the invention may also be administered in combination with other known therapies for the treatment of diabetes, including PPAR agonists, sulfonylurea drugs, non-sulfonylurea secretagogues, ⁇ -glucosidase inhibitors, insulin sensitizers, insulin secretagogues, hepatic glucose output lowering compounds, insulin and anti-obesity drugs.
- Such therapies may be administered prior to, concurrently with or following administration of the polypeptides of the invention.
- Insulin includes both long and short acting forms and formulations of insulin.
- PPAR agonist may include agonists of any of the PPAR subunits or combinations thereof.
- PPAR agonist may include agonists of PPAR- ⁇ , PPAR- ⁇ , PPAR- ⁇ or any combination of two or three of the subunits of PPAR.
- PPAR agonists include, for example, rosiglitazone and pioglitazone.
- Sulfonylurea drugs include, for example, glyburide, glimepiride, chlorpropamide, and glipizide.
- ⁇ -glucosidase inhibitors that may be useful in treating diabetes when administered with a polypeptide of the invention include acarbose, miglitol and voglibose.
- Insulin sensitizers that may be useful in treating diabetes include thiazolidinediones and non-thiazolidinediones.
- Hepatic glucose output lowering compounds that may be useful in treating diabetes when administered with a polypeptide of the invention include metformin, such as Glucophage and Glucophage XR.
- Insulin secretagogues that may be useful in treating diabetes when administered with a polypeptide of the invention include sulfonylurea and non-sulfonylurea drugs: GIP, secretin, nateglinide, meglitinide, repaglinide, glibenclamide, glimepiride, chlorpropamide, glipizide.
- polypeptides of the invention are used in combination with insulin secretagogues to increase the sensitivity of pancreatic ⁇ -cells to the insulin secretagogue.
- Polypeptides of the invention may also be used in methods of the invention in combination with anti-obesity drugs.
- Anti-obesity drugs include ⁇ -3 agonists, CB-1 antagonists, appetite suppressants, such as, for example, sibutramine (Meridia), and lipase inhibitors, such as, for example, orlistat (Xenical).
- Polypeptides of the invention may also be used in methods of the invention in combination with drugs commonly used to treat lipid disorders in diabetic patients.
- drugs include, but are not limited to, HMG-CoA reductase inhibitors, nicotinic acid, bile acid sequestrants, and fibric acid derivatives.
- Polypeptides of the invention may also be used in combination with anti-hypertensive drugs, such as, for example, ⁇ -blockers and ACE inhibitors.
- Such co-therapies may be administered in any combination of two or more drugs (e.g., a compound of the invention in combination with an insulin sensitizer and an anti- obesity drug). Such co-therapies may be administered in the form of pharmaceutical compositions, as described above.
- subject includes mammals (e.g., humans and animals).
- treatment includes any process, action, application, therapy, or the like, wherein a subject, including a human being, is provided medical aid with the object of improving the subject's condition, directly or indirectly, or slowing the progression of a condition or disorder in the subject.
- the term "combination therapy” or “co-therapy” means the administration of two or more therapeutic agents to treat a diabetic condition and/or disorder. Such administration encompasses co-administration of two or more therapeutic agents in a substantially simultaneous manner, such as in a single capsule having a fixed ratio of active ingredients or in multiple, separate capsules for each inhibitor agent. In addition, such administration encompasses use of each type of therapeutic agent in a sequential manner.
- the phrase "therapeutically effective” means the amount of each agent administered that will achieve the goal of improvement in a diabetic condition or disorder severity, while avoiding or minimizing adverse side effects associated with the given therapeutic treatment.
- pharmaceutically acceptable means that the subject item is appropriate for use in a pharmaceutical product.
- the effective dosage of the polypeptides of this invention can readily be determined for treatment of each desired indication.
- the amount of the active ingredient (e.g., polypeptides) to be administered in the treatment of one of these conditions can vary widely according to such considerations as the particular compound and dosage unit employed, the mode of administration, the period of treatment, the age and sex of the patient treated, and the nature and extent of the condition treated.
- the total amount of the active ingredient to be administered may generally range from about 0.0001 mg/kg to about 200 mg/kg, and preferably from about 0.01 mg/kg to about 200 mg/kg body weight per day.
- a unit dosage may contain from about 0.05 mg to about 1500 mg of active ingredient, and may be administered one or more times per day.
- the daily dosage for administration by injection including intravenous, intramuscular, subcutaneous, and parenteral injections, and use of infusion techniques may be from about 0.01 to about 200 mg/kg.
- the daily rectal dosage regimen may be from 0.01 to 200 mg/kg of total body weight.
- the transdermal concentration may be that required to maintain a daily dose of from 0.01 to 200 mg/kg.
- the specific initial and continuing dosage regimen for each patient will vary according to the nature and severity of the condition as determined by the attending diagnostician, the activity of the specific polypeptide employed, the age of the patient, the diet of the patient, time of administration, route of administration, rate of excretion of the drug, drug combinations, and the like.
- the desired mode of treatment and number of doses of a polypeptide of the present invention may be ascertained by those skilled in the art using conventional treatment tests.
- the polypeptides of this invention may be utilized to achieve the desired pharmacological effect by administration to a patient in need thereof in an appropriately formulated pharmaceutical composition.
- a patient for the purpose of this invention, is a mammal, including a human, in need of treatment for a particular condition or disease. Therefore, the present invention includes pharmaceutical compositions which are comprised of a pharmaceutically acceptable carrier and a therapeutically effective amount of a polypeptide.
- a pharmaceutically acceptable carrier is any carrier which is relatively non-toxic and innocuous to a patient at concentrations consistent with effective activity of the active ingredient so that any side effects ascribable to the carrier do not vitiate the beneficial effects of the active ingredient.
- a therapeutically effective amount of a polypeptide is that amount which produces a result or exerts an influence on the particular condition being treated.
- the polypeptides described herein may be administered with a pharmaceutically-acceptable carrier using any effective conventional dosage unit forms, including, for example, immediate and timed release preparations, orally, parenterally, topically, or the like.
- the polypeptides may be formulated into solid or liquid preparations such as, for example, capsules, pills, tablets, troches, lozenges, melts, powders, solutions, suspensions, or emulsions, and may be prepared according to methods known to the art for the manufacture of pharmaceutical compositions.
- the solid unit dosage forms may be a capsule which can be of the ordinary hard- or soft-shelled gelatin type containing, for example, surfactants, lubricants, and inert fillers such as lactose, sucrose, calcium phosphate, and corn starch.
- the polypeptides of this invention may be tableted with conventional tablet bases such as lactose, sucrose, and cornstarch in combination with binders such as acacia, cornstarch, or gelatin; disintegrating agents intended to assist the break-up and dissolution of the tablet following administration such as potato starch, alginic acid, corn starch, and guar gum; lubricants intended to improve the flow of tablet granulation and to prevent the adhesion of tablet material to the surfaces of the tablet dies and punches, for example, talc, stearic acid, or magnesium, calcium or zinc stearate; dyes; coloring agents; and flavoring agents intended to enhance the aesthetic qualities of the tablets and make them more acceptable to the patient.
- conventional tablet bases such as lactose, sucrose, and cornstarch in combination with binders such as acacia, cornstarch, or gelatin
- disintegrating agents intended to assist the break-up and dissolution of the tablet following administration such as potato starch, alginic acid, corn starch
- Suitable excipients for use in oral liquid dosage forms include diluents such as water and alcohols, for ' example, ethanol, benzyl alcohol, and polyethylene alcohols, either with or without the addition of a pharmaceutically acceptable surfactant, suspending agent, or emulsifying agent.
- Various other materials may be present as coatings or to otherwise modify the physical form of the dosage unit. For instance tablets, pills or capsules may be coated with shellac, sugar or both.
- Dispersible powders and granules are suitable for the preparation of an aqueous suspension. They provide the active ingredient in admixture with a dispersing or wetting agent, a suspending agent, and one or more preservatives. Suitable dispersing or wetting agents and suspending agents are exemplified by those already mentioned above. Additional excipients, for example, those sweetening, flavoring and coloring agents described above, may also be present.
- the pharmaceutical compositions of this invention may also be in the form of oil-in- water emulsions.
- the oily phase may be a vegetable oil such as liquid paraffin or a mixture of vegetable oils.
- Suitable emulsifying agents may be (1) naturally occurring gums such as gum acacia and gum tragacanth, (2) naturally occurring phosphatides such as soy bean and lecithin, (3) esters or partial esters derived from fatty acids and hexitol anhydrides, for example, sorbitan monooleate, and (4) condensation products of said partial esters with ethylene oxide, for example, polyoxyethylene sorbitan monooleate.
- the emulsions may also contain sweetening and flavoring agents.
- Oily suspensions may be formulated by suspending the active ingredient in a vegetable oil such as, for example, arachis oil, olive oil, sesame oil, or coconut oil; or in a mineral oil such as liquid paraffin.
- the oily suspensions may contain a thickening agent such as, for example, beeswax, hard paraffin, or cetyl alcohol.
- the suspensions may also contain one or more preservatives, for example, ethyl or n-propyl p- hydroxybenzoate; one or more coloring agents; one or more flavoring agents; and one or more sweetening agents such as sucrose or saccharin.
- Syrups and elixirs may be formulated with sweetening agents such as, for example, glycerol, propylene glycol, sorbitol, or sucrose. Such formulations may also contain a demulcent, and preservative, flavoring and coloring agents.
- sweetening agents such as, for example, glycerol, propylene glycol, sorbitol, or sucrose.
- Such formulations may also contain a demulcent, and preservative, flavoring and coloring agents.
- polypeptides of this invention may also be administered parenterally, that is, subcutaneously, intravenously, intramuscularly, or interperitoneally, as injectable dosages of the compound in a physiologically acceptable diluent with a pharmaceutical carrier which may be a sterile liquid or mixture of liquids such as water, saline, aqueous dextrose and related sugar solutions; an alcohol such as ethanol, isopropanol, or hexadecyl alcohol; glycols such as propylene glycol or polyethylene glycol; glycerol ketals such as 2,2-dimethyl-1,1-dioxolane-4-methanol, ethers such as poly(ethyleneglycol) 400; an oil; a fatty acid; a fatty acid ester or glyceride; or an acetylated fatty acid glyceride with or without the addition of a pharmaceutically acceptable surfactant such as a soap or a detergent, suspending agent such as peripher,
- oils which can be used in the parenteral formulations of this invention are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, sesame oil, cottonseed oil, corn oil, olive oil, petrolatum, and mineral oil.
- Suitable fatty acids include oleic acid, stearic acid, and isostearic acid.
- Suitable fatty acid esters are, for example, ethyl oleate and isopropyl myristate.
- Suitable soaps include fatty alkali metal, ammonium, and triethanolamine salts and suitable detergents include cationic detergents, for example, dimethyl dialkyl ammonium halides, alkyl pyridinium halides, and alkylamine acetates; anionic detergents, for example, alkyl, aryl, and olefin sulfonates, alkyl, olefin, ether, and monoglyceride sulfates, and sulfosuccinates; nonionic detergents, for example, fatty amine oxides, fatty acid alkanolamides, and polyoxyethylenepolypropylene copolymers; and amphoteric detergents, for example, alkyl-beta-aminopropionates, and 2-alkylimidazoline quarternary ammonium salts, as well as mixtures.
- suitable detergents include cationic detergents, for example, dimethyl dialkyl ammonium halides, al
- compositions of this invention may typically contain from about 0.5% to about 25% by weight of the active ingredient in solution. Preservatives and buffers may also be used advantageously. In order to minimize or eliminate irritation at the site of injection, such compositions may contain a non-ionic surfactant having a hydrophile-lipophile balance (HLB) of from about 12 to about 17. The quantity of surfactant in such formulation ranges from about 5% to about 15% by weight.
- the surfactant can be a single component having the above HLB or can be a mixture of two or more components having the desired HLB.
- Illustrative of surfactants used in parenteral formulations are the class of polyethylene sorbitan fatty acid esters, for example, sorbitan monooleate and the high molecular weight adducts of ethylene oxide with a hydrophobic base, formed by the condensation of propylene oxide with propylene glycol.
- the pharmaceutical compositions may be in the form of sterile injectable aqueous suspensions.
- Such suspensions may be formulated according to known methods using suitable dispersing or wetting agents and suspending agents such as, for example, sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethyl-cellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents which may be a naturally occurring phosphatide such as lecithin, a condensation product of an alkylene oxide with a fatty acid, for example, polyoxyethylene stearate, a condensation product of ethylene oxide with a long chain aliphatic alcohol, for example, heptadecaethyleneoxycetanol, a condensation product of ethylene oxide with a partial ester derived form a fatty acid and a hexitol such as polyoxyethylene sorbitol monooleate, or a condensation product of an ethylene oxide with a partial ester derived from
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent.
- Diluents and solvents that may be employed are, for example, water, Ringer's solution, and isotonic sodium chloride solution.
- sterile fixed oils are conventionally employed as solvents or suspending media.
- any bland, fixed oil may be employed including synthetic mono or diglycerides.
- fatty acids such as oleic acid may be used in the preparation of injectables.
- a composition of the invention may also be administered in the form of suppositories for rectal administration of the drug.
- These compositions may be prepared by mixing the drug (e.g., polypeptide) with a suitable non-irritation excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
- a suitable non-irritation excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
- suitable non-irritation excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
- Such material are, for example, cocoa butter and polyethylene glycol.
- transdermal delivery devices Such transdermal patches may be used to provide continuous or discontinuous infusion of the compounds of the present invention in controlled amounts.
- transdermal patches for the delivery of pharmaceutical agents is well known in the art (see, e.g., U.S. Patent No. 5,023,252, incorporated herein by reference).
- patches may be constructed for continuous, pulsatile, or on demand delivery of pharmaceutical agents.
- compositions of the invention may also contain other conventional pharmaceutically acceptable compounding ingredients, generally referred to as carriers or diluents, as necessary or desired. Any of the compositions of this invention may be preserved by the addition of an antioxidant such as ascorbic acid or by other suitable preservatives. Conventional procedures for preparing such compositions in appropriate dosage forms can be utilized.
- compositions for its intended route of administration include: acidifying agents, for example, but are not limited to, acetic acid, citric acid, fumaric acid, hydrochloric acid, nitric acid; and alkalinizing agents such as, but are not limited to, ammonia solution, ammonium carbonate, diethanolamine, monoethanolamine, potassium hydroxide, sodium borate, sodium carbonate, sodium hydroxide, triethanolamine, trolamine.
- acidifying agents for example, but are not limited to, acetic acid, citric acid, fumaric acid, hydrochloric acid, nitric acid
- alkalinizing agents such as, but are not limited to, ammonia solution, ammonium carbonate, diethanolamine, monoethanolamine, potassium hydroxide, sodium borate, sodium carbonate, sodium hydroxide, triethanolamine, trolamine.
- adsorbents e.g., powdered cellulose and activated charcoal
- aerosol propellants e.g., carbon dioxide, CCI 2 F 2 , F 2 CIC-CCIF 2 and CCIF 3
- air displacement agents e.g., nitrogen and argon
- antifungal preservatives e.g., benzoic acid, butylparaben, ethylparaben, methylparaben, propylparaben, sodium benzoate
- antimicrobial preservatives e.g., benzalkonium chloride, benzethonium chloride, benzyl alcohol, cetylpyridinium chloride, chlorobutanol, phenol, phenylethyl alcohol, phenylmercuric nitrate and thimerosal
- antioxidants e.g., ascorbic acid, ascorbyl palmitate, butylated hydroxyanisole, but
- clarifying agents e.g., bentonite
- emulsifying agents but are not limited to, acacia, cetomacrogol, cetyl alcohol, glyceryl monostearate, lecithin, sorbitan monooleate, polyethylene 50 stearate
- encapsulating agents e.g., gelatin and cellulose acetate phthalate
- flavorants e.g., anise oil, cinnamon oil, cocoa, menthol, orange oil, peppermint oil and vanillin
- humectants e.g., glycerin, propylene glycol and sorbitol
- levigating agents e.g., mineral oil and glycerin
- oils e.g., arachis oil, mineral oil, olive oil, peanut
- polypeptides described herein may be administered as the sole pharmaceutical agent or in combination with one or more other pharmaceutical agents where the combination causes no unacceptable adverse effects.
- the polypeptides of this invention can be combined with known anti-obesity, or with known antidiabetic or other indication agents, and the like, as well as with admixtures and combinations thereof.
- compositions which are comprised of an inert carrier and an effective amount of a compound identified by the methods described herein, or a salt or ester thereof.
- An inert carrier is any material which does not interact with the compound to be carried and which lends support, means of conveyance, bulk, traceable material, and the like to the compound to be carried.
- An effective amount of compound is that amount which produces a result or exerts an influence on the particular procedure being performed.
- Polypeptides are known to undergo hydrolysis, deamidation, oxidation, racemization and isomerization in aqueous and non-aqueous environment. Degradation such as hydrolysis, deamidation or oxidation can readily detected by capillary electrophoresis. Enzymatic degradation notwithstanding, polypeptides having a prolonged plasma half-life, or biological resident time, should, at minimum, be stable in aqueous solution. It is essential that polypeptide exhibits less than 10% degradation over a period of one day at body temperature. It is still more preferable that the polypeptide exhibits less than 5% degradation over a period of one day at body temperature.
- these therapeutic agents are convenient to administer, furthermore infrequently if by parenteral route. Stability (i.e., less than a few percent of degradation) over a period of weeks at body temperature will allow less frequent dosing. Stability in the magnitude of years at refrigeration temperature will allow the manufacturer to present a liquid formulation, thus avoid the inconvenience of reconstitution. Additionally, stability in organic solvent would provide polypeptide be formulated into novel dosage forms such as implant.
- Formulations suitable for subcutaneous, intravenous, intramuscular, and the like; suitable pharmaceutical carriers; and techniques for formulation and administration may be prepared by any of the methods well known in the art (see, e.g., Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., 20 th edition, 2000).
- a capsule formula is prepared from:
- the components are blended, passed through an appropriate mesh sieve, and filled into hard gelatin capsules.
- a tablet is prepared from:
- Polypeptide of this invention 25 mg
- aqueous and non-aqueous coatings may be applied to increase palatability, improve elegance and stability or delay absorption.
- a mg/mL solution of the desired compound of this invention is made using sterile, injectable water, and the pH is adjusted if necessary.
- the solution is diluted for administration with sterile 5% dextrose and is administered as an IV infusion.
- the following intramuscular suspension is prepared:
- Polypeptide of this invention 50 ⁇ g/mL
- the suspension is administered intramuscularly.
- a large number of unit capsules are prepared by filling standard two-piece hard galantine capsules each with powdered active ingredient, 50 mg of lactose, 50 mg of cellulose, and 6 mg of magnesium stearate.
- a mixture of active ingredient in a digestible oil such as soybean oil, cottonseed oil, or olive oil is prepared and injected by means of a positive displacement pump into molten gelatin to form soft gelatin capsules containing the active ingredient.
- the capsules are washed and dried.
- the active ingredient can be dissolved in a mixture of polyethylene glycol, glycerin and sorbitol to prepare a water miscible medicine mix.
- the active ingredient is mixed in a liquid containing ingredient such as sugar, gelatin, pectin, and sweeteners. These liquids are solidified into solid tablets or caplets by freeze drying and solid state extraction techniques.
- the drug compounds may be compressed with viscoelastic and thermoelastic sugars and polymers or effervescent components to produce porous matrices intended for immediate release, without the need of water.
- Matrix buffer 50/50 dH 2 O/acetonitrile with 3% TFA
- Matrix buffer 1/1 Those peptides not meeting the purity criteria of >95% were purified by reversed-phase chromatography on a Waters Delta Prep 4000 HPLC system (Waters Corporation, Milford, MA).
- Table 1 contains some selected polypeptides made according to the Peptide Synthesis protocols discussed above.
- PEGylation may be performed by any method known to those skilled in the art. However, in this instance, PEGylation was performed using two different methods to introduce a unique cysteine mutation into the peptide or at the C-terminus of the peptide, followed by PEGylating the cysteine via a stable thioether linkage between the sulfhydryl of the peptide and maleimide group of the methoxy-PEG-maleimide reagent (Inhale/Shearwater). It is preferable to introduce a unique cysteine at the C-terminus of the peptide.
- Table 2 contains some selected polypeptides made according to the PEGylation technology discussed herein. Note that the underlined amino acid represents the location that the PEG polymer is attached to the peptide. [139] Table 2
- activation of the GLP- 1 receptor in a cAMP scintillation proximity assay is induction of a maximum activity that is at least 50%, more preferably at least 70%, still more preferably at least 80%, and still more preferably at least 90% of the maximal activity induced by the native GLP-1 (7-36)- amide.
- the EC50 value for a modified GLP-1 receptor agonist of this invention is between 0.1 and 1000 nM. "EC50" is defined herein as the concentration of a polypeptide of this invention at which 50% of the maximal activity is achieved.
- RINm ⁇ F cells were plated in 96-well plates (Costar) at 1.5 x 10 5 cells/well and grown at 37°C for 24 hours in RPM1 1640, 5% FBS, antibiotic/antimycotic (Gibco BRL). The media was removed and the cells were washed twice with PBS. The cells were incubated with peptide concentrations ranging from 1 x 10 ⁇ 12 to 1 x 10 "5 M in HEPES-PBS containing 1% BSA and 100 ⁇ M IBMXfor 15 minutes at 37°C.
- Increase of insulin secretion from dispersed rat islet cells, in this assay, is an increase of at least 1.5 fold.
- the modified GLP-1 agonist of this invention increases insulin secretion from dispersed islet cells by at least about 1.5 fold to about 10 fold (i.e., 1.5, 2.0, 3.0, 4.0, 5.0, 6.0, 7.0, 8.0, 9.0, or 10-fold).
- Islets of Langerhans were isolated from SD rats (200-250 g) through a digestion procedure using collagenase. Dispersed islet cells were prepared through treatment with trypsin, seeded into 96 V-bottom plates and pelleted. Cells were cultured overnight in media with and without peptides of the invention. Media was aspirated and the cells were pre-incubated with Krebs-Ringer-HEPES buffer containing 3 mM glucose for 30 minutes at 37°C. Pre-incubation buffer was removed and cells were stimulated with Krebs- Ringer-HEPES buffer containing the appropriate glucose concentration (e.g., 8 mM), with and without peptides for an appropriate time at 37°C.
- Krebs-Ringer-HEPES buffer containing 3 mM glucose for 30 minutes at 37°C.
- Pre-incubation buffer was removed and cells were stimulated with Krebs- Ringer-HEPES buffer containing the appropriate glucose concentration (e.g., 8 mM), with and without peptides for an appropriate
- an increase in plasma insulin levels in this assay is an increase of at least about 2-fold.
- the modified GLP-1 receptor agonist of this invention increases insulin secretion in rats as measured by an increase in plasma insulin levels during in vivo glucose tolerance testing in fasted Wistar rats by about 2-fold to about 5-fold, more preferably by about 2-fold to about 10 fold, and still more preferably by about 2-fold to about 20-fold (i.e., 2.0, 3.0, 4.0, 5.0, 6.0, 7.0, 8.0, 9.0, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, or 20-fold).
- mice Male Wistar rats will be fasted overnight and then anesthetized with isoflurane gas. The rats will be given a tail vein injection of 0.4 g/kg of glucose plus either vehicle (0.9% saline + 1% albumin) or 1 nmol/kg GLP-1 (positive control) or 1 nmol/kg of the polypeptides of this invention. The rats will then be eye-bled one minute later and the plasma assayed for insulin using an ELISA Kit (Alpco Diagnostics, Windham, NH).
- ELISA Kit Alpha Diagnostics, Windham, NH
- a decrease in blood glucose levels as measured by this assay is a decrease of at least about 10%.
- the modified GLP-1 receptor agonist of the invention decreases blood glucose levels in mice as measured by intraperitoneal glucose tolerance testing in rats or mice by about 10% to about 60%, more preferably by about 10% to about 80%, still more preferably by about 10% to about 100% (i.e., 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100%).
- modified peptides of the invention significantly reduced blood glucose levels relative to the vehicle following the IPGTT, with 36%-54% reduction in the glucose AUC ("area under curve").
- modified peptides have prolonged glucose lowering activity in vivo.
- glucose lowering activity of the modified peptides of the invention it also indicates prolonged peptide half-life in vivo.
- Unmodified GLP-1 has a very short half-life in vivo ( ⁇ 10 minUTES).
- the ability of the modified peptides of the invention to lower blood glucose 3 hours following peptide administration is a clear indication that the peptide is present in the circulation at this time point and hence has prolonged half-life relative to unmodified GLP-1.
- Example 7 Measurement of Gastrointestinal Motility in Mice by Subcutaneous -Injection
- Modified GLP-1 receptor agonists of this invention have a therapeutic index of at least 5-fold.
- the modified GLP-1 receptor agonist of this invention has a therapeutic index of about 5-fold to about 10-fold, more preferably by about 5-fold to about 20 fold, still more preferably by about 5-fold to about 50-fold, even more preferable by about 5-fold to 100-fold, and most preferably by about 5-fold to 200-fold.
- the therapeutic index is the minimum concentration of peptide (i.e., agonist) required to reduce gut motility by at least 20% divided by minimum concentration required to reduce blood glucose AUC by at least 20% (see Example 6).
- Gastrointestinal motility in mice was tested using representative modified GLP-1 agonists of this invention (GLP-1 agonist linked to a 43 kD PEG, GLP-1 agonist linked to a 30 kD PEG, GLP-1 agonist peptides linked to 22 kD PEG, and GLP-1 agonist linked to a fatty acid). Gastrointestinal motility was measured as follows: Male Balb/c mice were either fasted overnight first and then given peptide (3-100 ⁇ g/kg) or vehicle by subcutaneous injection, or they were given peptide or vehicle first and then fasted overnight, depending on the time interval between dosing and the measurement of motility.
- mice were given a charcoal meal by oral gavage, and then euthanized by cervical dislocation five minutes later.
- the small intestine was dissected out and the length of the intestine measured as well as the length the charcoal traveled past the pyloric syphincter.
- the % traveled was calculated by dividing the distance the charcoal traveled by the total length of the small intestine and multiplying by 100.
- fatty acid-modified -GLP1 (R -GLP-1 (7-37) with K26 modified by ⁇ -L-glutamoyl(N ⁇ -hexadecanoyl)) was given to overnight fasted mice 3 hours prior to the charcoal meal.
- Fatty acid-GLP1 dose-dependently reduced gastrointestinal motility (Figure 3A).
- GLP-1 linked to a 22 kD PEG was given to overnight fasted mice 3 hours prior to the charcoal meal.
- GLP-1 linked to a 22 kD PEG also dose- dependently reduced gastrointestinal motility (Figure 3B).
- GLP-1 linked to a 43 kD PEG was given to overnight fasted mice 3 hours prior to the charcoal meal.
- GLP-1 linked to a 43 kD PEG showed no significant effect on gastrointestinal motility (Figure 3B).
- GLP-1 agonist linked to a 22 kD PEG was given to overnight fasted mice 3 hours prior to the charcoal meal.
- This GLP-1 agonist linked to a 22 kD PEG also dose-dependently reduced gastrointestinal motility (Figure 4).
- GLP-1 agonist linked to a 30 kD PEG was given to overnight fasted mice 3 hours prior to the charcoal meal.
- This GLP-1 agonist linked to a 30 kD PEG also dose-dependently reduced gastrointestinal motility (Figure 4).
- the representative modified GLP-1 agonist of this invention (GLP-1 agonist linked to a 43 kD PEG) was given to overnight fasted mice 3 hours prior to the charcoal meal.
- the representative modified GLP-1 agonist of this invention showed no significant effect on gastrointestinal motility (Figure 4).
- Stainless steel guide cannulas that were aimed at the brain third ventricle were implanted to male Wistar rats (275-350 g) anesthetized with isoflurane anesthesia.
- the single 21 G cannula was aimed at the brain third ventricle using a stereotaxic instrument and the following coordinates: -2.2 mm posterior from bregma and -7.5 mm ventral to dura.
- the cannula was secured to the skull with jeweler's screws and dental cement.
- cannula placement was tested by infusion of 1 ⁇ l Angiotensin II at 10 ng/ ⁇ l concentration. Animals drinking 5 ml or more of water in one-hour period were retained for the study.
- a sterile IV injectable formulation is made from a derivatized polypetide (e.g., SEQ ID NO: 28 linked to a 43 kD PEG) having equivalent of 4 mg polypeptide content, and 1 liter of sterile saline, using any manufacturing process well known in the art. Higher concentration of derivatized polypeptide may be needed for SC formulation.
- a derivatized polypetide e.g., SEQ ID NO: 28 linked to a 43 kD PEG
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Diabetes (AREA)
- Hematology (AREA)
- Endocrinology (AREA)
- Obesity (AREA)
- Heart & Thoracic Surgery (AREA)
- Genetics & Genomics (AREA)
- Emergency Medicine (AREA)
- Child & Adolescent Psychology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Cardiology (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2003273300A AU2003273300A1 (en) | 2002-09-06 | 2003-09-04 | Modified glp-1 receptor agonists and their pharmacological methods of use |
| CA002497794A CA2497794A1 (en) | 2002-09-06 | 2003-09-04 | Modified glp-1 receptor agonists and their pharmacological methods of use |
| EP03755799A EP1539210A4 (en) | 2002-09-06 | 2003-09-04 | GLP-1 RECEPTOR MODIFIED AGONISTS AND THEIR PHARMACOLOGICAL METHODS OF USE |
| JP2004534751A JP2006501820A (ja) | 2002-09-06 | 2003-09-04 | 修飾glp−1受容体アゴニストおよびそれらの薬理学的使用法 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US40869602P | 2002-09-06 | 2002-09-06 | |
| US60/408,696 | 2002-09-06 | ||
| US43936903P | 2003-01-09 | 2003-01-09 | |
| US60/439,369 | 2003-01-09 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2004022004A2 true WO2004022004A2 (en) | 2004-03-18 |
| WO2004022004A3 WO2004022004A3 (en) | 2004-12-23 |
Family
ID=31981605
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2003/028093 Ceased WO2004022004A2 (en) | 2002-09-06 | 2003-09-04 | Modified glp-1 receptor agonists and their pharmacological methods of use |
Country Status (5)
| Country | Link |
|---|---|
| EP (1) | EP1539210A4 (enExample) |
| JP (1) | JP2006501820A (enExample) |
| AU (1) | AU2003273300A1 (enExample) |
| CA (1) | CA2497794A1 (enExample) |
| WO (1) | WO2004022004A2 (enExample) |
Cited By (89)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004085471A3 (en) * | 2003-03-24 | 2004-11-04 | Novo Nordisk As | Glp-2 derivatives |
| WO2005058954A1 (en) * | 2003-12-18 | 2005-06-30 | Novo Nordisk A/S | Novel glp-1 compounds |
| WO2006074600A1 (en) * | 2005-01-14 | 2006-07-20 | Wuxi Grandchamp Pharmaceutical Technology Co., Ltd. | Modified exendins and uses thereof |
| EP1854455A1 (en) * | 2006-05-10 | 2007-11-14 | Biocompatibles UK Limited | Spherical microcapsules comprising GLP-1 peptides, their production and use |
| EP1768686A4 (en) * | 2004-06-12 | 2007-11-14 | Bayer Pharmaceuticals Corp | PEGYLATION OF VASOACTIVE INTESTINAL PEPTIDE (VIP) / HYPOPHYDE-ADENYLATE CYCLASE-ACTIVATING PEPTIDE (PACAP) RECEPTOR 2 (VPAC2) AGONISTS AND METHOD OF USE |
| GB2448895A (en) * | 2007-05-01 | 2008-11-05 | Activotec Spp Ltd | GLP-1 like compounds and uses thereof |
| EP1942115A4 (en) * | 2005-10-26 | 2009-03-18 | Chugai Pharmaceutical Co Ltd | AGGLUTINABLE GLP-1 ANALOGUE AND PROLONGED RELEASE PHARMACEUTICAL COMPOSITION |
| WO2007056362A3 (en) * | 2005-11-07 | 2009-04-23 | Univ Indiana Res & Tech Corp | Glucagon analogs exhibiting physiological solubility and stability |
| US7557183B2 (en) | 2003-03-19 | 2009-07-07 | Eli Lilly And Company | Polyethylene glycol linked GLP-1 compounds |
| US7589169B2 (en) | 2002-02-27 | 2009-09-15 | Pharmain Corporation | Compositions for treatment with glucagon-like peptide, and methods of making and using the same |
| US7635463B2 (en) | 2002-02-27 | 2009-12-22 | Pharmain Corporation | Compositions for delivery of therapeutics and other materials |
| WO2010047982A1 (en) | 2008-10-22 | 2010-04-29 | Merck Sharp & Dohme Corp. | Novel cyclic benzimidazole derivatives useful anti-diabetic agents |
| WO2010051206A1 (en) | 2008-10-31 | 2010-05-06 | Merck Sharp & Dohme Corp. | Novel cyclic benzimidazole derivatives useful anti-diabetic agents |
| EP1883419A4 (en) * | 2005-05-06 | 2010-08-04 | Bayer Pharmaceuticals Corp | GLUCAGON-LIKE PEPTIDE-1 (GLP-1) RECEPTOR AGONISTS AND THEIR PHARMACOLOGICAL USES |
| US7790140B2 (en) | 2002-02-27 | 2010-09-07 | Pharmain Corporation | Compositions for delivery of therapeutics and other materials, and methods of making and using the same |
| WO2010124547A1 (en) * | 2009-03-26 | 2010-11-04 | The Hong Kong Polytechnic University | Site-directed pegylation of arginases and the use thereof as anti-cancer and anti-viral agents |
| US7932364B2 (en) | 2003-05-09 | 2011-04-26 | Novo Nordisk A/S | Compositions and methods for the preparation of human growth hormone glycosylation mutants |
| US7960336B2 (en) | 2007-08-03 | 2011-06-14 | Pharmain Corporation | Composition for long-acting peptide analogs |
| WO2011106273A1 (en) | 2010-02-25 | 2011-09-01 | Merck Sharp & Dohme Corp. | Novel cyclic benzimidazole derivatives useful anti-diabetic agents |
| WO2011143209A1 (en) | 2010-05-13 | 2011-11-17 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
| US8063015B2 (en) | 2003-04-09 | 2011-11-22 | Novo Nordisk A/S | Glycopegylation methods and proteins/peptides produced by the methods |
| WO2011163012A2 (en) | 2010-06-24 | 2011-12-29 | Indiana University Research And Technology Corporation | Amide based glucagon superfamily peptide prodrugs |
| US8207112B2 (en) | 2007-08-29 | 2012-06-26 | Biogenerix Ag | Liquid formulation of G-CSF conjugate |
| US8247381B2 (en) | 2003-03-14 | 2012-08-21 | Biogenerix Ag | Branched water-soluble polymers and their conjugates |
| WO2012116145A1 (en) | 2011-02-25 | 2012-08-30 | Merck Sharp & Dohme Corp. | Novel cyclic azabenzimidazole derivatives useful as anti-diabetic agents |
| CN101125207B (zh) * | 2006-11-14 | 2012-09-05 | 上海华谊生物技术有限公司 | 带有聚乙二醇基团的艾塞丁或其类似物及其制剂和用途 |
| US8268967B2 (en) | 2004-09-10 | 2012-09-18 | Novo Nordisk A/S | Glycopegylated interferon α |
| US8288339B2 (en) | 2006-04-20 | 2012-10-16 | Amgen Inc. | GLP-1 compounds |
| US8293869B2 (en) | 2005-12-16 | 2012-10-23 | Nektar Therapeutics | Polymer conjugates of GLP-1 |
| US8361961B2 (en) | 2004-01-08 | 2013-01-29 | Biogenerix Ag | O-linked glycosylation of peptides |
| US8426358B2 (en) | 2006-06-26 | 2013-04-23 | Amgen Inc. | Methods for treating atherosclerosis |
| US8431533B2 (en) | 2005-09-22 | 2013-04-30 | Biocompatibles Uk Ltd. | GLP-1 fusion peptides, their production and use |
| WO2013074910A1 (en) | 2011-11-17 | 2013-05-23 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting glucocorticoid receptor activity |
| US20130137645A1 (en) * | 2010-07-19 | 2013-05-30 | Mary S. Rosendahl | Modified peptides and proteins |
| US8454971B2 (en) | 2007-02-15 | 2013-06-04 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US8507428B2 (en) | 2010-12-22 | 2013-08-13 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
| US8546327B2 (en) | 2008-06-17 | 2013-10-01 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US8551946B2 (en) | 2010-01-27 | 2013-10-08 | Indiana University Research And Technology Corporation | Glucagon antagonist-GIP agonist conjugates and compositions for the treatment of metabolic disorders and obesity |
| US8563527B2 (en) | 2007-08-20 | 2013-10-22 | Pharmain Corporation | Oligonucleotide core carrier compositions for delivery of nucleic acid-containing therapeutic agents, methods of making and using the same |
| US8633157B2 (en) | 2003-11-24 | 2014-01-21 | Novo Nordisk A/S | Glycopegylated erythropoietin |
| US20140023628A1 (en) * | 2009-03-26 | 2014-01-23 | The Hong Kong Polytechnic University | Site-directed pegylation of arginases and the use thereof as anti-cancer and anti-viral agents |
| WO2014022528A1 (en) | 2012-08-02 | 2014-02-06 | Merck Sharp & Dohme Corp. | Antidiabetic tricyclic compounds |
| US8669228B2 (en) | 2007-01-05 | 2014-03-11 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting enhanced solubility in physiological pH buffers |
| US8703701B2 (en) | 2009-12-18 | 2014-04-22 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US8716221B2 (en) | 2005-01-14 | 2014-05-06 | Wuxi Grandchamp Pharmaceutical Technology Co., Ltd. | Modified exendins and uses thereof |
| US8716240B2 (en) | 2001-10-10 | 2014-05-06 | Novo Nordisk A/S | Erythropoietin: remodeling and glycoconjugation of erythropoietin |
| US8729017B2 (en) | 2011-06-22 | 2014-05-20 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US8759290B2 (en) * | 2005-10-18 | 2014-06-24 | Biocon Limited | Oral glucagon-like peptide conjugates for metabolic diseases |
| US8791066B2 (en) | 2004-07-13 | 2014-07-29 | Novo Nordisk A/S | Branched PEG remodeling and glycosylation of glucagon-like peptide-1 [GLP-1] |
| WO2014130608A1 (en) | 2013-02-22 | 2014-08-28 | Merck Sharp & Dohme Corp. | Antidiabetic bicyclic compounds |
| WO2014139388A1 (en) | 2013-03-14 | 2014-09-18 | Merck Sharp & Dohme Corp. | Novel indole derivatives useful as anti-diabetic agents |
| US8841439B2 (en) | 2005-11-03 | 2014-09-23 | Novo Nordisk A/S | Nucleotide sugar purification using membranes |
| WO2014091316A3 (en) * | 2012-12-11 | 2014-10-30 | Medimmune Limited | Glucagon/glp-1 agonists for the treatment of obesity |
| US8911967B2 (en) | 2005-08-19 | 2014-12-16 | Novo Nordisk A/S | One pot desialylation and glycopegylation of therapeutic peptides |
| US8916360B2 (en) | 2003-11-24 | 2014-12-23 | Novo Nordisk A/S | Glycopegylated erythropoietin |
| EP2727605A4 (en) * | 2011-06-28 | 2014-12-24 | Theraly Pharmaceuticals Inc | A POLYETHYLENE GLYCOL OR A DERIVATIVELY PEGYLATED EXENDIN-4-ANALOGONE, METHOD OF MANUFACTURING THEREOF AND PHARMACEUTICAL COMPOSITION FOR PREVENTING OR TREATING DIABETES THEREFOR AS AN ACTIVE AGENT |
| US20150017232A1 (en) * | 2008-02-22 | 2015-01-15 | Apim Therapeutics As | Oligopeptidic compounds and uses thereof |
| US8969532B2 (en) | 2006-10-03 | 2015-03-03 | Novo Nordisk A/S | Methods for the purification of polypeptide conjugates comprising polyalkylene oxide using hydrophobic interaction chromatography |
| US8981047B2 (en) | 2007-10-30 | 2015-03-17 | Indiana University Research And Technology Corporation | Glucagon antagonists |
| US8999930B2 (en) | 2008-01-09 | 2015-04-07 | Pharmain Corporation | Soluble hydrophobic core carrier compositions for delivery of therapeutic agents, methods of making and using the same |
| US9005625B2 (en) | 2003-07-25 | 2015-04-14 | Novo Nordisk A/S | Antibody toxin conjugates |
| WO2015051725A1 (en) | 2013-10-08 | 2015-04-16 | Merck Sharp & Dohme Corp. | Antidiabetic tricyclic compounds |
| US9029331B2 (en) | 2005-01-10 | 2015-05-12 | Novo Nordisk A/S | Glycopegylated granulocyte colony stimulating factor |
| EP2742061A4 (en) * | 2011-08-08 | 2015-05-27 | Two To Biotech Ltd | NOVEL PEPTIDES, COMPOSITIONS COMPRISING THEM AND USES THEREOF IN METHODS FOR THE TREATMENT OF METABOLIC, CARDIAC AND IMMUNE DISORDERS |
| US9050304B2 (en) | 2007-04-03 | 2015-06-09 | Ratiopharm Gmbh | Methods of treatment using glycopegylated G-CSF |
| WO2015081891A1 (en) | 2013-12-06 | 2015-06-11 | Baikang (Suzhou) Co., Ltd | Bioreversable promoieties for nitrogen-containing and hydroxyl-containing drugs |
| US9062124B2 (en) | 2008-06-17 | 2015-06-23 | Indiana University Research And Technology Corporation | GIP-based mixed agonists for treatment of metabolic disorders and obesity |
| US9145451B2 (en) | 2010-05-13 | 2015-09-29 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhbiting G protein coupled receptor activity |
| US9187532B2 (en) | 2006-07-21 | 2015-11-17 | Novo Nordisk A/S | Glycosylation of peptides via O-linked glycosylation sequences |
| US9187546B2 (en) | 2005-04-08 | 2015-11-17 | Novo Nordisk A/S | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
| US9200049B2 (en) | 2004-10-29 | 2015-12-01 | Novo Nordisk A/S | Remodeling and glycopegylation of fibroblast growth factor (FGF) |
| US9321825B2 (en) | 2006-06-12 | 2016-04-26 | Theraly Pharmaceuticals Inc. | N-terminal modified PEG-TRAIL |
| US9340600B2 (en) | 2012-06-21 | 2016-05-17 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
| US9493499B2 (en) | 2007-06-12 | 2016-11-15 | Novo Nordisk A/S | Process for the production of purified cytidinemonophosphate-sialic acid-polyalkylene oxide (CMP-SA-PEG) as modified nucleotide sugars via anion exchange chromatography |
| US9737615B2 (en) | 2005-12-19 | 2017-08-22 | PharmalN Corporation | Hydrophobic core carrier compositions for delivery of therapeutic agents, methods of making and using the same |
| US9758562B2 (en) | 2011-06-22 | 2017-09-12 | Indiana University and Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| WO2017161174A1 (en) * | 2016-03-16 | 2017-09-21 | Prolynx Llc | Extended release conjugates of exenatide analogs |
| US9790263B2 (en) | 2009-06-16 | 2017-10-17 | Indiana University Research And Technology Corporation | GIP receptor-active glucagon compounds |
| WO2018106518A1 (en) | 2016-12-06 | 2018-06-14 | Merck Sharp & Dohme Corp. | Antidiabetic heterocyclic compounds |
| WO2018118670A1 (en) | 2016-12-20 | 2018-06-28 | Merck Sharp & Dohme Corp. | Antidiabetic spirochroman compounds |
| US10046058B2 (en) | 2014-12-02 | 2018-08-14 | Rezolute, Inc. | Use of hydrophobic organic acids to increase hydrophobicity of proteins and protein conjugates |
| US10220075B2 (en) | 2015-06-04 | 2019-03-05 | Rezolute, Inc. | Amine pegylation methods for the preparation of site-specific protein conjugates |
| US10414811B2 (en) | 2015-06-10 | 2019-09-17 | Medimmune Limited | Protease-resistant lipidated GLP-1 analogs |
| US11007251B2 (en) | 2015-12-17 | 2021-05-18 | The Johns Hopkins University | Ameliorating systemic sclerosis with death receptor agonists |
| US11084879B2 (en) | 2016-04-07 | 2021-08-10 | The Johns Hopkins University | Compositions and methods for treating pancreatitis and pain with death receptor agonists |
| US11123405B2 (en) | 2015-12-23 | 2021-09-21 | The Johns Hopkins University | Long-acting GLP-1R agonist as a therapy of neurological and neurodegenerative conditions |
| US11299528B2 (en) | 2014-03-11 | 2022-04-12 | D&D Pharmatech Inc. | Long acting TRAIL receptor agonists for treatment of autoimmune diseases |
| EP4065598A4 (en) * | 2019-11-27 | 2023-11-29 | D&D Pharmatech Inc. | BIOTIN UNIT-CONJUGATED POLYPEPTIDES AND PHARMACEUTICAL COMPOSITION FOR ORAL ADMINISTRATION THEREOF |
| US12364771B2 (en) | 2019-04-05 | 2025-07-22 | Prolynx Llc | Conjugation linkers |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7157277B2 (en) | 2001-11-28 | 2007-01-02 | Neose Technologies, Inc. | Factor VIII remodeling and glycoconjugation of Factor VIII |
| US8791070B2 (en) | 2003-04-09 | 2014-07-29 | Novo Nordisk A/S | Glycopegylated factor IX |
| US20060040856A1 (en) | 2003-12-03 | 2006-02-23 | Neose Technologies, Inc. | Glycopegylated factor IX |
| EP1891231A4 (en) | 2005-05-25 | 2011-06-22 | Novo Nordisk As | GLYCOPEGYLATED FACTOR IX |
| WO2009058734A1 (en) | 2007-10-30 | 2009-05-07 | Indiana University Research And Technology Corporation | Compounds exhibiting glucagon antagonist and glp-1 agonist activity |
| ES2476690T3 (es) | 2008-02-27 | 2014-07-15 | Novo Nordisk A/S | Moléculas conjugadas del Factor VIII |
| CN102325539A (zh) | 2008-12-19 | 2012-01-18 | 印第安纳大学研究及科技有限公司 | 基于酰胺的胰高血糖素超家族肽前药 |
| CA2780460C (en) * | 2009-11-13 | 2018-09-04 | Sanofi-Aventis Deutschland Gmbh | Pharmaceutical composition comprising a glp-1 agonist, an insulin and methionine |
| EP2460527A1 (en) * | 2010-01-21 | 2012-06-06 | Sanofi | Pharmaceutical composition for treating a metabolic syndrome |
| HK1220383A1 (zh) * | 2013-03-14 | 2017-05-05 | Medimmune Limited | 用於治疗肥胖症的聚乙二醇化的胰高血糖素和glp-1共激动剂 |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4423034A (en) * | 1980-10-16 | 1983-12-27 | Toyo Jozo Kabushiki Kaisha | Process for the preparation of antibodies |
| US5614492A (en) * | 1986-05-05 | 1997-03-25 | The General Hospital Corporation | Insulinotropic hormone GLP-1 (7-36) and uses thereof |
| WO1991011457A1 (en) * | 1990-01-24 | 1991-08-08 | Buckley Douglas I | Glp-1 analogs useful for diabetes treatment |
| US5545618A (en) * | 1990-01-24 | 1996-08-13 | Buckley; Douglas I. | GLP-1 analogs useful for diabetes treatment |
| EP0499990B1 (en) * | 1991-02-19 | 1996-05-15 | Takeda Chemical Industries, Ltd. | Method for producing cysteine-free peptides |
| CA2206848A1 (en) * | 1994-12-07 | 1996-06-13 | Bionebraska, Inc. | Production of peptides using recombinant fusion protein constructs |
| DE69942307D1 (de) * | 1998-02-27 | 2010-06-10 | Novo Nordisk As | N-terminal veränderte glp-1 abkömmlinge |
| EP1076066A1 (en) * | 1999-07-12 | 2001-02-14 | Zealand Pharmaceuticals A/S | Peptides for lowering blood glucose levels |
| WO2001068112A2 (en) * | 2000-03-14 | 2001-09-20 | Goeke Burkhard | Effects of glucagon-like peptide-1 (7-36) on antro-pyloro-duodenal motility |
| AR036711A1 (es) * | 2001-10-05 | 2004-09-29 | Bayer Corp | Peptidos que actuan como agonistas del receptor del glp-1 y como antagonistas del receptor del glucagon y sus metodos de uso farmacologico |
-
2003
- 2003-09-04 CA CA002497794A patent/CA2497794A1/en not_active Abandoned
- 2003-09-04 WO PCT/US2003/028093 patent/WO2004022004A2/en not_active Ceased
- 2003-09-04 AU AU2003273300A patent/AU2003273300A1/en not_active Abandoned
- 2003-09-04 JP JP2004534751A patent/JP2006501820A/ja active Pending
- 2003-09-04 EP EP03755799A patent/EP1539210A4/en not_active Withdrawn
Non-Patent Citations (2)
| Title |
|---|
| BYRNE ET AL: 'Glucagon - like peptide 1 improves the ability of the beta - cell to sense and respond to glucose in subjects with impaired glucose tolerance' DIABETES vol. 47, August 1998, pages 1259 - 1265, XP002122531 * |
| See also references of EP1539210A2 * |
Cited By (141)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8716240B2 (en) | 2001-10-10 | 2014-05-06 | Novo Nordisk A/S | Erythropoietin: remodeling and glycoconjugation of erythropoietin |
| US7589169B2 (en) | 2002-02-27 | 2009-09-15 | Pharmain Corporation | Compositions for treatment with glucagon-like peptide, and methods of making and using the same |
| US8277776B2 (en) | 2002-02-27 | 2012-10-02 | Pharmain Corporation | Compositions for delivery of therapeutics and other materials |
| US8257682B2 (en) | 2002-02-27 | 2012-09-04 | Pharmain Corporation | Compositions for delivery of therapeutics and other materials |
| US8231859B2 (en) | 2002-02-27 | 2012-07-31 | Pharmain Corporation | Compositions for delivery of therapeutics and other materials |
| US7790140B2 (en) | 2002-02-27 | 2010-09-07 | Pharmain Corporation | Compositions for delivery of therapeutics and other materials, and methods of making and using the same |
| US7635463B2 (en) | 2002-02-27 | 2009-12-22 | Pharmain Corporation | Compositions for delivery of therapeutics and other materials |
| US8247381B2 (en) | 2003-03-14 | 2012-08-21 | Biogenerix Ag | Branched water-soluble polymers and their conjugates |
| US7557183B2 (en) | 2003-03-19 | 2009-07-07 | Eli Lilly And Company | Polyethylene glycol linked GLP-1 compounds |
| WO2004085471A3 (en) * | 2003-03-24 | 2004-11-04 | Novo Nordisk As | Glp-2 derivatives |
| US8063015B2 (en) | 2003-04-09 | 2011-11-22 | Novo Nordisk A/S | Glycopegylation methods and proteins/peptides produced by the methods |
| US8853161B2 (en) | 2003-04-09 | 2014-10-07 | Novo Nordisk A/S | Glycopegylation methods and proteins/peptides produced by the methods |
| US7932364B2 (en) | 2003-05-09 | 2011-04-26 | Novo Nordisk A/S | Compositions and methods for the preparation of human growth hormone glycosylation mutants |
| US9005625B2 (en) | 2003-07-25 | 2015-04-14 | Novo Nordisk A/S | Antibody toxin conjugates |
| US8916360B2 (en) | 2003-11-24 | 2014-12-23 | Novo Nordisk A/S | Glycopegylated erythropoietin |
| US8633157B2 (en) | 2003-11-24 | 2014-01-21 | Novo Nordisk A/S | Glycopegylated erythropoietin |
| WO2005058954A1 (en) * | 2003-12-18 | 2005-06-30 | Novo Nordisk A/S | Novel glp-1 compounds |
| US9920106B2 (en) | 2003-12-18 | 2018-03-20 | Novo Nordisk A/S | GLP-1 compounds |
| US8361961B2 (en) | 2004-01-08 | 2013-01-29 | Biogenerix Ag | O-linked glycosylation of peptides |
| EP1768686A4 (en) * | 2004-06-12 | 2007-11-14 | Bayer Pharmaceuticals Corp | PEGYLATION OF VASOACTIVE INTESTINAL PEPTIDE (VIP) / HYPOPHYDE-ADENYLATE CYCLASE-ACTIVATING PEPTIDE (PACAP) RECEPTOR 2 (VPAC2) AGONISTS AND METHOD OF USE |
| US8791066B2 (en) | 2004-07-13 | 2014-07-29 | Novo Nordisk A/S | Branched PEG remodeling and glycosylation of glucagon-like peptide-1 [GLP-1] |
| US8268967B2 (en) | 2004-09-10 | 2012-09-18 | Novo Nordisk A/S | Glycopegylated interferon α |
| US9200049B2 (en) | 2004-10-29 | 2015-12-01 | Novo Nordisk A/S | Remodeling and glycopegylation of fibroblast growth factor (FGF) |
| US10874714B2 (en) | 2004-10-29 | 2020-12-29 | 89Bio Ltd. | Method of treating fibroblast growth factor 21 (FGF-21) deficiency |
| US9029331B2 (en) | 2005-01-10 | 2015-05-12 | Novo Nordisk A/S | Glycopegylated granulocyte colony stimulating factor |
| WO2006074600A1 (en) * | 2005-01-14 | 2006-07-20 | Wuxi Grandchamp Pharmaceutical Technology Co., Ltd. | Modified exendins and uses thereof |
| US8097586B2 (en) | 2005-01-14 | 2012-01-17 | Wuxi Grandchamp Pharmaceutical Technology Co., Ltd. | Modified exedins and uses thereof |
| EP2505207A2 (en) | 2005-01-14 | 2012-10-03 | Wuxi Grandchamp Pharmaceutical Technology Co., Ltd. | Modified exendins and uses thereof |
| US8716221B2 (en) | 2005-01-14 | 2014-05-06 | Wuxi Grandchamp Pharmaceutical Technology Co., Ltd. | Modified exendins and uses thereof |
| US9187546B2 (en) | 2005-04-08 | 2015-11-17 | Novo Nordisk A/S | Compositions and methods for the preparation of protease resistant human growth hormone glycosylation mutants |
| EP1883419A4 (en) * | 2005-05-06 | 2010-08-04 | Bayer Pharmaceuticals Corp | GLUCAGON-LIKE PEPTIDE-1 (GLP-1) RECEPTOR AGONISTS AND THEIR PHARMACOLOGICAL USES |
| US8911967B2 (en) | 2005-08-19 | 2014-12-16 | Novo Nordisk A/S | One pot desialylation and glycopegylation of therapeutic peptides |
| US8853159B2 (en) | 2005-09-22 | 2014-10-07 | Biocompatibles Uk Ltd | GLP-1 Fusion Peptides |
| US8431533B2 (en) | 2005-09-22 | 2013-04-30 | Biocompatibles Uk Ltd. | GLP-1 fusion peptides, their production and use |
| US8759290B2 (en) * | 2005-10-18 | 2014-06-24 | Biocon Limited | Oral glucagon-like peptide conjugates for metabolic diseases |
| EP1942115A4 (en) * | 2005-10-26 | 2009-03-18 | Chugai Pharmaceutical Co Ltd | AGGLUTINABLE GLP-1 ANALOGUE AND PROLONGED RELEASE PHARMACEUTICAL COMPOSITION |
| US8841439B2 (en) | 2005-11-03 | 2014-09-23 | Novo Nordisk A/S | Nucleotide sugar purification using membranes |
| WO2007056362A3 (en) * | 2005-11-07 | 2009-04-23 | Univ Indiana Res & Tech Corp | Glucagon analogs exhibiting physiological solubility and stability |
| US8338368B2 (en) | 2005-11-07 | 2012-12-25 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting physiological solubility and stability |
| US8293869B2 (en) | 2005-12-16 | 2012-10-23 | Nektar Therapeutics | Polymer conjugates of GLP-1 |
| US8580919B2 (en) | 2005-12-16 | 2013-11-12 | Nektar Therapeutics | Polymer conjugates of GLP-1 |
| US10507248B2 (en) | 2005-12-19 | 2019-12-17 | Pharmain Corporation | Hydrophobic core carrier compositions for delivery of therapeutic agents, methods of making and using the same |
| US9737615B2 (en) | 2005-12-19 | 2017-08-22 | PharmalN Corporation | Hydrophobic core carrier compositions for delivery of therapeutic agents, methods of making and using the same |
| US8288339B2 (en) | 2006-04-20 | 2012-10-16 | Amgen Inc. | GLP-1 compounds |
| EP1854455A1 (en) * | 2006-05-10 | 2007-11-14 | Biocompatibles UK Limited | Spherical microcapsules comprising GLP-1 peptides, their production and use |
| EP2174655A1 (en) * | 2006-05-10 | 2010-04-14 | Biocompatibles UK Limited | Spherical microcapsules comprising GLP-1 peptides, their production and use |
| US8790705B2 (en) | 2006-05-10 | 2014-07-29 | Biocompatibles Uk Ltd. | Spherical microcapsules comprising GLP-1 peptides, their production and use |
| WO2007128443A3 (en) * | 2006-05-10 | 2008-05-22 | Biocompatibles Uk Ltd | Spherical or non-spherical microcapsules comprising glp-i peptides, their production and use |
| US9321825B2 (en) | 2006-06-12 | 2016-04-26 | Theraly Pharmaceuticals Inc. | N-terminal modified PEG-TRAIL |
| US10046059B2 (en) | 2006-06-12 | 2018-08-14 | D&D Pharmatech Inc. | Methods of administering an N-terminal modified PEG-TRAIL |
| US8426358B2 (en) | 2006-06-26 | 2013-04-23 | Amgen Inc. | Methods for treating atherosclerosis |
| US9187532B2 (en) | 2006-07-21 | 2015-11-17 | Novo Nordisk A/S | Glycosylation of peptides via O-linked glycosylation sequences |
| US8969532B2 (en) | 2006-10-03 | 2015-03-03 | Novo Nordisk A/S | Methods for the purification of polypeptide conjugates comprising polyalkylene oxide using hydrophobic interaction chromatography |
| CN102827284A (zh) * | 2006-11-14 | 2012-12-19 | 上海华谊生物技术有限公司 | 带有聚乙二醇基团的Exendin或其类似物及其制剂和用途 |
| CN102827284B (zh) * | 2006-11-14 | 2015-07-29 | 上海仁会生物制药股份有限公司 | 带有聚乙二醇基团的Exendin或其类似物及其制剂和用途 |
| CN101125207B (zh) * | 2006-11-14 | 2012-09-05 | 上海华谊生物技术有限公司 | 带有聚乙二醇基团的艾塞丁或其类似物及其制剂和用途 |
| US8669228B2 (en) | 2007-01-05 | 2014-03-11 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting enhanced solubility in physiological pH buffers |
| US8454971B2 (en) | 2007-02-15 | 2013-06-04 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US9050304B2 (en) | 2007-04-03 | 2015-06-09 | Ratiopharm Gmbh | Methods of treatment using glycopegylated G-CSF |
| GB2448895A (en) * | 2007-05-01 | 2008-11-05 | Activotec Spp Ltd | GLP-1 like compounds and uses thereof |
| US9493499B2 (en) | 2007-06-12 | 2016-11-15 | Novo Nordisk A/S | Process for the production of purified cytidinemonophosphate-sialic acid-polyalkylene oxide (CMP-SA-PEG) as modified nucleotide sugars via anion exchange chromatography |
| US9090664B2 (en) | 2007-08-03 | 2015-07-28 | Pharmain Corporation | Composition for long-acting peptide analogs |
| US8518876B2 (en) | 2007-08-03 | 2013-08-27 | PharmalN Corporation | Composition for long-acting peptide analogs |
| US7960336B2 (en) | 2007-08-03 | 2011-06-14 | Pharmain Corporation | Composition for long-acting peptide analogs |
| US9657078B2 (en) | 2007-08-03 | 2017-05-23 | Pharmain Corporation | Composition for long-acting peptide analogs |
| US8563527B2 (en) | 2007-08-20 | 2013-10-22 | Pharmain Corporation | Oligonucleotide core carrier compositions for delivery of nucleic acid-containing therapeutic agents, methods of making and using the same |
| US8207112B2 (en) | 2007-08-29 | 2012-06-26 | Biogenerix Ag | Liquid formulation of G-CSF conjugate |
| US8981047B2 (en) | 2007-10-30 | 2015-03-17 | Indiana University Research And Technology Corporation | Glucagon antagonists |
| US9562111B2 (en) | 2008-01-09 | 2017-02-07 | Pharmain Corporation | Soluble hydrophobic core carrier compositions for delivery of therapeutic agents, methods of making and using the same |
| US8999930B2 (en) | 2008-01-09 | 2015-04-07 | Pharmain Corporation | Soluble hydrophobic core carrier compositions for delivery of therapeutic agents, methods of making and using the same |
| US9676822B2 (en) * | 2008-02-22 | 2017-06-13 | Apim Therapeutics As | Oligopeptidic compounds and uses thereof |
| US10213483B2 (en) | 2008-02-22 | 2019-02-26 | Apim Therapeutics As | Oligopeptidic compounds and uses thereof |
| US20150017232A1 (en) * | 2008-02-22 | 2015-01-15 | Apim Therapeutics As | Oligopeptidic compounds and uses thereof |
| US8546327B2 (en) | 2008-06-17 | 2013-10-01 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US9062124B2 (en) | 2008-06-17 | 2015-06-23 | Indiana University Research And Technology Corporation | GIP-based mixed agonists for treatment of metabolic disorders and obesity |
| US8969294B2 (en) | 2008-06-17 | 2015-03-03 | Istituto Di Recerche Di Biologia Molecolare P. Angeletti S.R.L. | Glucagon/GLP-1 receptor co-agonists |
| WO2010047982A1 (en) | 2008-10-22 | 2010-04-29 | Merck Sharp & Dohme Corp. | Novel cyclic benzimidazole derivatives useful anti-diabetic agents |
| WO2010051206A1 (en) | 2008-10-31 | 2010-05-06 | Merck Sharp & Dohme Corp. | Novel cyclic benzimidazole derivatives useful anti-diabetic agents |
| WO2010124547A1 (en) * | 2009-03-26 | 2010-11-04 | The Hong Kong Polytechnic University | Site-directed pegylation of arginases and the use thereof as anti-cancer and anti-viral agents |
| US9382525B2 (en) * | 2009-03-26 | 2016-07-05 | The Hong Kong Polytechnic University | Site-directed pegylation of arginases and the use thereof as anti-cancer and anti-viral agents |
| US8507245B2 (en) | 2009-03-26 | 2013-08-13 | The Hong Kong Polytechnic University | Site-directed pegylation of arginases and the use thereof as anti-cancer and anti-viral agents |
| CN102481345A (zh) * | 2009-03-26 | 2012-05-30 | 香港理工大学 | 精氨酸酶的定向位点聚乙二醇化及其作为抗癌和抗病毒试剂的用途 |
| US20140023628A1 (en) * | 2009-03-26 | 2014-01-23 | The Hong Kong Polytechnic University | Site-directed pegylation of arginases and the use thereof as anti-cancer and anti-viral agents |
| US9790263B2 (en) | 2009-06-16 | 2017-10-17 | Indiana University Research And Technology Corporation | GIP receptor-active glucagon compounds |
| US8703701B2 (en) | 2009-12-18 | 2014-04-22 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US8551946B2 (en) | 2010-01-27 | 2013-10-08 | Indiana University Research And Technology Corporation | Glucagon antagonist-GIP agonist conjugates and compositions for the treatment of metabolic disorders and obesity |
| WO2011106273A1 (en) | 2010-02-25 | 2011-09-01 | Merck Sharp & Dohme Corp. | Novel cyclic benzimidazole derivatives useful anti-diabetic agents |
| WO2011143209A1 (en) | 2010-05-13 | 2011-11-17 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
| US9783592B2 (en) | 2010-05-13 | 2017-10-10 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
| US9127088B2 (en) | 2010-05-13 | 2015-09-08 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting nuclear hormone receptor activity |
| US9145451B2 (en) | 2010-05-13 | 2015-09-29 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhbiting G protein coupled receptor activity |
| WO2011163012A2 (en) | 2010-06-24 | 2011-12-29 | Indiana University Research And Technology Corporation | Amide based glucagon superfamily peptide prodrugs |
| US20130137645A1 (en) * | 2010-07-19 | 2013-05-30 | Mary S. Rosendahl | Modified peptides and proteins |
| US8507428B2 (en) | 2010-12-22 | 2013-08-13 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
| WO2012116145A1 (en) | 2011-02-25 | 2012-08-30 | Merck Sharp & Dohme Corp. | Novel cyclic azabenzimidazole derivatives useful as anti-diabetic agents |
| EP3243385A1 (en) | 2011-02-25 | 2017-11-15 | Merck Sharp & Dohme Corp. | Novel cyclic azabenzimidazole derivatives useful as anti-diabetic agents |
| US9758562B2 (en) | 2011-06-22 | 2017-09-12 | Indiana University and Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US8729017B2 (en) | 2011-06-22 | 2014-05-20 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US10730923B2 (en) | 2011-06-22 | 2020-08-04 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| US10174093B2 (en) | 2011-06-22 | 2019-01-08 | Indiana University Research And Technology Corporation | Glucagon/GLP-1 receptor co-agonists |
| AU2012276478B2 (en) * | 2011-06-28 | 2016-02-25 | D&D Pharmatech Inc. | Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient |
| EP2727605A4 (en) * | 2011-06-28 | 2014-12-24 | Theraly Pharmaceuticals Inc | A POLYETHYLENE GLYCOL OR A DERIVATIVELY PEGYLATED EXENDIN-4-ANALOGONE, METHOD OF MANUFACTURING THEREOF AND PHARMACEUTICAL COMPOSITION FOR PREVENTING OR TREATING DIABETES THEREFOR AS AN ACTIVE AGENT |
| US10406230B2 (en) | 2011-06-28 | 2019-09-10 | D&D Pharmatech Inc. | Exendin-4 analogue pegylated with polyethylene glycol or derivative thereof, preparation method thereof, and pharmaceutical composition for preventing or treating diabetes, containing same as active ingredient |
| EP2742061A4 (en) * | 2011-08-08 | 2015-05-27 | Two To Biotech Ltd | NOVEL PEPTIDES, COMPOSITIONS COMPRISING THEM AND USES THEREOF IN METHODS FOR THE TREATMENT OF METABOLIC, CARDIAC AND IMMUNE DISORDERS |
| US8859491B2 (en) | 2011-11-17 | 2014-10-14 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting glucocorticoid receptor activity |
| WO2013074910A1 (en) | 2011-11-17 | 2013-05-23 | Indiana University Research And Technology Corporation | Glucagon superfamily peptides exhibiting glucocorticoid receptor activity |
| US9340600B2 (en) | 2012-06-21 | 2016-05-17 | Indiana University Research And Technology Corporation | Glucagon analogs exhibiting GIP receptor activity |
| WO2014022528A1 (en) | 2012-08-02 | 2014-02-06 | Merck Sharp & Dohme Corp. | Antidiabetic tricyclic compounds |
| US9765130B2 (en) | 2012-12-11 | 2017-09-19 | Medimmune Limited | Glucagon/GLP-1 agonists for the treatment of obesity |
| RU2671088C2 (ru) * | 2012-12-11 | 2018-10-29 | Медиммьюн Лимитед | Агонисты рецепторов глюкагона/glp-1 для лечения ожирения |
| US11230584B2 (en) | 2012-12-11 | 2022-01-25 | Medimmune Limited | Glucagon/GLP-1 agonists for the treatment of obesity |
| AU2017261505C1 (en) * | 2012-12-11 | 2020-07-30 | Medimmune Limited | Glucagon/glp-1 agonists for the treatment of obesity |
| AU2013356934C1 (en) * | 2012-12-11 | 2018-07-05 | Medimmune Limited | Glucagon/GLP-1 agonists for the treatment of obesity |
| US10556939B2 (en) | 2012-12-11 | 2020-02-11 | Medimmune Limited | Glucagon/GLP-1 agonists for the treatment of obesity |
| WO2014091316A3 (en) * | 2012-12-11 | 2014-10-30 | Medimmune Limited | Glucagon/glp-1 agonists for the treatment of obesity |
| EP3495380A1 (en) * | 2012-12-11 | 2019-06-12 | MedImmune Limited | Glucagon and glp-1 co-agonists for the treatment of obesity |
| CN104822699A (zh) * | 2012-12-11 | 2015-08-05 | 米迪缪尼有限公司 | 用于治疗肥胖症的胰高血糖素/glp-1激动剂 |
| CN109776670A (zh) * | 2012-12-11 | 2019-05-21 | 米迪缪尼有限公司 | 用于治疗肥胖症的胰高血糖素/glp-1激动剂 |
| CN104822699B (zh) * | 2012-12-11 | 2019-03-01 | 米迪缪尼有限公司 | 用于治疗肥胖症的胰高血糖素/glp-1激动剂 |
| AU2017261505B2 (en) * | 2012-12-11 | 2019-10-10 | Medimmune Limited | Glucagon/glp-1 agonists for the treatment of obesity |
| AU2013356934B2 (en) * | 2012-12-11 | 2017-08-17 | Medimmune Limited | Glucagon/GLP-1 agonists for the treatment of obesity |
| WO2014130608A1 (en) | 2013-02-22 | 2014-08-28 | Merck Sharp & Dohme Corp. | Antidiabetic bicyclic compounds |
| WO2014139388A1 (en) | 2013-03-14 | 2014-09-18 | Merck Sharp & Dohme Corp. | Novel indole derivatives useful as anti-diabetic agents |
| WO2015051725A1 (en) | 2013-10-08 | 2015-04-16 | Merck Sharp & Dohme Corp. | Antidiabetic tricyclic compounds |
| WO2015081891A1 (en) | 2013-12-06 | 2015-06-11 | Baikang (Suzhou) Co., Ltd | Bioreversable promoieties for nitrogen-containing and hydroxyl-containing drugs |
| US11299528B2 (en) | 2014-03-11 | 2022-04-12 | D&D Pharmatech Inc. | Long acting TRAIL receptor agonists for treatment of autoimmune diseases |
| US10046058B2 (en) | 2014-12-02 | 2018-08-14 | Rezolute, Inc. | Use of hydrophobic organic acids to increase hydrophobicity of proteins and protein conjugates |
| US10702611B2 (en) | 2014-12-02 | 2020-07-07 | Rezolute, Inc. | Use of hydrophobic organic acids to increase hydrophobicity of proteins and protein conjugates |
| US10220075B2 (en) | 2015-06-04 | 2019-03-05 | Rezolute, Inc. | Amine pegylation methods for the preparation of site-specific protein conjugates |
| US10414811B2 (en) | 2015-06-10 | 2019-09-17 | Medimmune Limited | Protease-resistant lipidated GLP-1 analogs |
| US11007251B2 (en) | 2015-12-17 | 2021-05-18 | The Johns Hopkins University | Ameliorating systemic sclerosis with death receptor agonists |
| US12233109B2 (en) | 2015-12-23 | 2025-02-25 | The Johns Hopkins University | Long-acting GLP-1r agonist as a therapy of neurological and neurodegenerative conditions |
| US11123405B2 (en) | 2015-12-23 | 2021-09-21 | The Johns Hopkins University | Long-acting GLP-1R agonist as a therapy of neurological and neurodegenerative conditions |
| WO2017161174A1 (en) * | 2016-03-16 | 2017-09-21 | Prolynx Llc | Extended release conjugates of exenatide analogs |
| CN109414469A (zh) * | 2016-03-16 | 2019-03-01 | 普罗林科斯有限责任公司 | 艾塞那肽类似物的缓释偶联物 |
| RU2764547C2 (ru) * | 2016-03-16 | 2022-01-18 | ПРОЛИНКС ЭлЭлСи | Конъюгаты аналогов эксенатида с замедленным высвобождением |
| US11084879B2 (en) | 2016-04-07 | 2021-08-10 | The Johns Hopkins University | Compositions and methods for treating pancreatitis and pain with death receptor agonists |
| WO2018106518A1 (en) | 2016-12-06 | 2018-06-14 | Merck Sharp & Dohme Corp. | Antidiabetic heterocyclic compounds |
| WO2018118670A1 (en) | 2016-12-20 | 2018-06-28 | Merck Sharp & Dohme Corp. | Antidiabetic spirochroman compounds |
| US12364771B2 (en) | 2019-04-05 | 2025-07-22 | Prolynx Llc | Conjugation linkers |
| EP4065598A4 (en) * | 2019-11-27 | 2023-11-29 | D&D Pharmatech Inc. | BIOTIN UNIT-CONJUGATED POLYPEPTIDES AND PHARMACEUTICAL COMPOSITION FOR ORAL ADMINISTRATION THEREOF |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2006501820A (ja) | 2006-01-19 |
| AU2003273300A8 (en) | 2004-03-29 |
| EP1539210A2 (en) | 2005-06-15 |
| WO2004022004A3 (en) | 2004-12-23 |
| EP1539210A4 (en) | 2006-06-07 |
| CA2497794A1 (en) | 2004-03-18 |
| AU2003273300A1 (en) | 2004-03-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2004022004A2 (en) | Modified glp-1 receptor agonists and their pharmacological methods of use | |
| US7378494B2 (en) | Pituitary adenylate cyclase activating peptide (PACAP) receptor (VPAC2) agonist peptide | |
| AU2007319066B2 (en) | Selective glucagon-like-peptide-2 (GLP-2) analogues | |
| US20040002442A1 (en) | Peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists and their pharmacological methods of use | |
| US20060003417A1 (en) | Peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists and their pharmacological methods of use | |
| CA2607566A1 (en) | Glucagon-like peptide 1 (glp-1) receptor agonists and their pharmacological methods of use | |
| WO2006121904A1 (en) | Glucose-dependent insulinotropic polypeptide (gip) receptor agonists and their pharmacological methods of use | |
| US20080261863A1 (en) | Pegylation of Vasoactive Intestinal Peptide (Vip) / Pituitary Adenylate Cyclase Activating Peptide (Pacap) Receptor 2 (Vpac2) Agonists and Methods of Use | |
| US20090143283A1 (en) | Pituitary Adenylate Cyclase Activating Peptide (PACAP) Receptor (VPAC2) Agonists and Their Pharmacological Methods of Use | |
| US20090280106A1 (en) | Pituitary adenylate cyclase acivating peptide (pacap) receptor (vpac2) agonists and their pharmacological methods of use | |
| US20240270809A1 (en) | Oral glp receptor agonists | |
| HK1109855A (en) | Pegylation of vasoactive intestinal peptide (vip)/pituitary adenylate cyclase activating peptide (pacap) receptor 2 (vpac2) agonists and methods of use | |
| MXPA06008404A (en) | Pituitary adenylate cyclase activating peptide (pacap) receptor (vpac2) agonists and their pharmacological methods of use | |
| HK1131161A (en) | Pituitary adenylate cyclase activating peptide (pacap) receptor (vpac2) agonists and their pharmacological methods of use | |
| KR20050018988A (ko) | 뇌하수체 아데닐레이트 사이클라제 활성화펩타이드(pacap) 수용체(vpac2) 효능제 및 그의약물학적 사용방법 | |
| AU2002341961A1 (en) | Peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists and their pharmacological methods of use |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2004534751 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2497794 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2003755799 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 2003755799 Country of ref document: EP |