WO2001095919A2 - A recombinant non-replicating virus expressing gm-csf and uses thereof to enhance immune responses - Google Patents
A recombinant non-replicating virus expressing gm-csf and uses thereof to enhance immune responses Download PDFInfo
- Publication number
- WO2001095919A2 WO2001095919A2 PCT/US2001/019201 US0119201W WO0195919A2 WO 2001095919 A2 WO2001095919 A2 WO 2001095919A2 US 0119201 W US0119201 W US 0119201W WO 0195919 A2 WO0195919 A2 WO 0195919A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antigen
- csf
- tumor
- cell
- encoding
- Prior art date
Links
- 241000700605 Viruses Species 0.000 title claims abstract description 95
- 230000028993 immune response Effects 0.000 title claims abstract description 46
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 title abstract description 25
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 title abstract description 23
- 230000003362 replicative effect Effects 0.000 title description 4
- 239000000427 antigen Substances 0.000 claims abstract description 251
- 102000036639 antigens Human genes 0.000 claims abstract description 251
- 108091007433 antigens Proteins 0.000 claims abstract description 251
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 143
- 238000000034 method Methods 0.000 claims abstract description 93
- 230000001900 immune effect Effects 0.000 claims abstract description 73
- 239000000203 mixture Substances 0.000 claims abstract description 57
- 210000000612 antigen-presenting cell Anatomy 0.000 claims abstract description 34
- 238000011282 treatment Methods 0.000 claims abstract description 33
- 239000002671 adjuvant Substances 0.000 claims abstract description 29
- 230000002708 enhancing effect Effects 0.000 claims abstract description 24
- 208000004235 neutropenia Diseases 0.000 claims abstract description 17
- 208000011580 syndromic disease Diseases 0.000 claims abstract description 8
- 238000002560 therapeutic procedure Methods 0.000 claims abstract description 7
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 claims description 235
- 210000004027 cell Anatomy 0.000 claims description 206
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 claims description 117
- 241001068295 Replication defective viruses Species 0.000 claims description 117
- 239000013598 vector Substances 0.000 claims description 84
- 108090000623 proteins and genes Proteins 0.000 claims description 71
- 210000001165 lymph node Anatomy 0.000 claims description 66
- 210000004443 dendritic cell Anatomy 0.000 claims description 60
- 238000002347 injection Methods 0.000 claims description 60
- 239000007924 injection Substances 0.000 claims description 60
- 241000700663 Avipoxvirus Species 0.000 claims description 36
- 229960005486 vaccine Drugs 0.000 claims description 36
- 210000004881 tumor cell Anatomy 0.000 claims description 35
- 206010046865 Vaccinia virus infection Diseases 0.000 claims description 33
- 208000007089 vaccinia Diseases 0.000 claims description 33
- 208000000666 Fowlpox Diseases 0.000 claims description 31
- 230000000139 costimulatory effect Effects 0.000 claims description 27
- 239000008194 pharmaceutical composition Substances 0.000 claims description 25
- 239000013600 plasmid vector Substances 0.000 claims description 25
- 201000011510 cancer Diseases 0.000 claims description 23
- 108010084313 CD58 Antigens Proteins 0.000 claims description 22
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 22
- 201000010099 disease Diseases 0.000 claims description 21
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 claims description 19
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 19
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 18
- 108090000695 Cytokines Proteins 0.000 claims description 16
- 150000007523 nucleic acids Chemical group 0.000 claims description 16
- 102000004127 Cytokines Human genes 0.000 claims description 15
- 230000005867 T cell response Effects 0.000 claims description 15
- 208000015181 infectious disease Diseases 0.000 claims description 15
- 239000002243 precursor Substances 0.000 claims description 15
- 241000700662 Fowlpox virus Species 0.000 claims description 14
- 102000003951 Erythropoietin Human genes 0.000 claims description 13
- 108090000394 Erythropoietin Proteins 0.000 claims description 13
- 229940105423 erythropoietin Drugs 0.000 claims description 13
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 claims description 13
- 230000003612 virological effect Effects 0.000 claims description 13
- 210000001519 tissue Anatomy 0.000 claims description 12
- 238000002255 vaccination Methods 0.000 claims description 12
- 210000004698 lymphocyte Anatomy 0.000 claims description 11
- 102000004169 proteins and genes Human genes 0.000 claims description 11
- 238000004519 manufacturing process Methods 0.000 claims description 10
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 9
- 210000000440 neutrophil Anatomy 0.000 claims description 8
- 238000007920 subcutaneous administration Methods 0.000 claims description 8
- -1 4-lBBL Proteins 0.000 claims description 7
- 108020004414 DNA Proteins 0.000 claims description 7
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 claims description 7
- 108010074328 Interferon-gamma Proteins 0.000 claims description 7
- 239000003242 anti bacterial agent Substances 0.000 claims description 7
- 230000006023 anti-tumor response Effects 0.000 claims description 7
- 210000000481 breast Anatomy 0.000 claims description 7
- 230000002950 deficient Effects 0.000 claims description 7
- 239000012634 fragment Substances 0.000 claims description 7
- 239000013612 plasmid Substances 0.000 claims description 7
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims description 6
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims description 6
- 229940121375 antifungal agent Drugs 0.000 claims description 6
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 6
- 239000000284 extract Substances 0.000 claims description 6
- 210000002950 fibroblast Anatomy 0.000 claims description 6
- 230000008348 humoral response Effects 0.000 claims description 6
- 238000011065 in-situ storage Methods 0.000 claims description 6
- 244000045947 parasite Species 0.000 claims description 6
- 230000003442 weekly effect Effects 0.000 claims description 6
- 101150013553 CD40 gene Proteins 0.000 claims description 5
- 241000178270 Canarypox virus Species 0.000 claims description 5
- 108010065805 Interleukin-12 Proteins 0.000 claims description 5
- 102000013462 Interleukin-12 Human genes 0.000 claims description 5
- 102000043131 MHC class II family Human genes 0.000 claims description 5
- 108091054438 MHC class II family Proteins 0.000 claims description 5
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 5
- 206010033661 Pancytopenia Diseases 0.000 claims description 5
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 5
- 239000003443 antiviral agent Substances 0.000 claims description 5
- 239000003795 chemical substances by application Substances 0.000 claims description 5
- 208000024389 cytopenia Diseases 0.000 claims description 5
- 201000001441 melanoma Diseases 0.000 claims description 5
- 239000003226 mitogen Substances 0.000 claims description 5
- 210000003491 skin Anatomy 0.000 claims description 5
- 238000001356 surgical procedure Methods 0.000 claims description 5
- 230000004083 survival effect Effects 0.000 claims description 5
- 241001529453 unidentified herpesvirus Species 0.000 claims description 5
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 claims description 4
- 206010006187 Breast cancer Diseases 0.000 claims description 4
- 208000026310 Breast neoplasm Diseases 0.000 claims description 4
- 102100037850 Interferon gamma Human genes 0.000 claims description 4
- 108010008707 Mucin-1 Proteins 0.000 claims description 4
- 102100034256 Mucin-1 Human genes 0.000 claims description 4
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 claims description 4
- 230000000735 allogeneic effect Effects 0.000 claims description 4
- 230000003115 biocidal effect Effects 0.000 claims description 4
- 210000001185 bone marrow Anatomy 0.000 claims description 4
- 239000013592 cell lysate Substances 0.000 claims description 4
- 238000002512 chemotherapy Methods 0.000 claims description 4
- 150000004676 glycans Chemical class 0.000 claims description 4
- 229960004443 hemophilus influenzae b vaccines Drugs 0.000 claims description 4
- 238000007912 intraperitoneal administration Methods 0.000 claims description 4
- 238000001990 intravenous administration Methods 0.000 claims description 4
- 210000002540 macrophage Anatomy 0.000 claims description 4
- 201000002528 pancreatic cancer Diseases 0.000 claims description 4
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 4
- 229920001282 polysaccharide Polymers 0.000 claims description 4
- 239000005017 polysaccharide Substances 0.000 claims description 4
- 230000010076 replication Effects 0.000 claims description 4
- 210000000952 spleen Anatomy 0.000 claims description 4
- 230000004936 stimulating effect Effects 0.000 claims description 4
- 241000701161 unidentified adenovirus Species 0.000 claims description 4
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 claims description 3
- 241000894006 Bacteria Species 0.000 claims description 3
- 102100022002 CD59 glycoprotein Human genes 0.000 claims description 3
- 102100025221 CD70 antigen Human genes 0.000 claims description 3
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 claims description 3
- 102000019034 Chemokines Human genes 0.000 claims description 3
- 108010012236 Chemokines Proteins 0.000 claims description 3
- 108010071942 Colony-Stimulating Factors Proteins 0.000 claims description 3
- 102000001301 EGF receptor Human genes 0.000 claims description 3
- 108060006698 EGF receptor Proteins 0.000 claims description 3
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 claims description 3
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 claims description 3
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 claims description 3
- 101000897400 Homo sapiens CD59 glycoprotein Proteins 0.000 claims description 3
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 claims description 3
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 claims description 3
- 101000746373 Homo sapiens Granulocyte-macrophage colony-stimulating factor Proteins 0.000 claims description 3
- 101000764263 Homo sapiens Tumor necrosis factor ligand superfamily member 4 Proteins 0.000 claims description 3
- 102000008070 Interferon-gamma Human genes 0.000 claims description 3
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 3
- 102100021768 Phosphoserine aminotransferase Human genes 0.000 claims description 3
- 241000287219 Serinus canaria Species 0.000 claims description 3
- 101710173693 Short transient receptor potential channel 1 Proteins 0.000 claims description 3
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 claims description 3
- 102000003425 Tyrosinase Human genes 0.000 claims description 3
- 108060008724 Tyrosinase Proteins 0.000 claims description 3
- 239000000556 agonist Substances 0.000 claims description 3
- 239000003429 antifungal agent Substances 0.000 claims description 3
- 150000001720 carbohydrates Chemical class 0.000 claims description 3
- 239000003246 corticosteroid Substances 0.000 claims description 3
- 238000007918 intramuscular administration Methods 0.000 claims description 3
- 150000002632 lipids Chemical class 0.000 claims description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 3
- 210000001616 monocyte Anatomy 0.000 claims description 3
- ZAFUNKXZZPSTLA-MBKDEEHCSA-N n-[(2r,3r,4r,5r)-5,6-dihydroxy-1-oxo-4-{[(2s,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-3-{[(2s,3s,4r,5s,6s)-3,4,5-trihydroxy-6-methyloxan-2-yl]oxy}hexan-2-yl]acetamide Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@H]1O[C@H]([C@@H](NC(C)=O)C=O)[C@@H]([C@H](O)CO)O[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 ZAFUNKXZZPSTLA-MBKDEEHCSA-N 0.000 claims description 3
- 210000005259 peripheral blood Anatomy 0.000 claims description 3
- 239000011886 peripheral blood Substances 0.000 claims description 3
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims description 3
- 206010040882 skin lesion Diseases 0.000 claims description 3
- 231100000444 skin lesion Toxicity 0.000 claims description 3
- 241000894007 species Species 0.000 claims description 3
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 claims description 2
- WEVYNIUIFUYDGI-UHFFFAOYSA-N 3-[6-[4-(trifluoromethoxy)anilino]-4-pyrimidinyl]benzamide Chemical compound NC(=O)C1=CC=CC(C=2N=CN=C(NC=3C=CC(OC(F)(F)F)=CC=3)C=2)=C1 WEVYNIUIFUYDGI-UHFFFAOYSA-N 0.000 claims description 2
- 241000710929 Alphavirus Species 0.000 claims description 2
- 241000228212 Aspergillus Species 0.000 claims description 2
- 241000193738 Bacillus anthracis Species 0.000 claims description 2
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 claims description 2
- 241000222120 Candida <Saccharomycetales> Species 0.000 claims description 2
- 241000606161 Chlamydia Species 0.000 claims description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 2
- 241000702421 Dependoparvovirus Species 0.000 claims description 2
- 108700037122 EWS-FLI fusion Proteins 0.000 claims description 2
- 101710147220 Ent-copalyl diphosphate synthase, chloroplastic Proteins 0.000 claims description 2
- 108010087819 Fc receptors Proteins 0.000 claims description 2
- 102000009109 Fc receptors Human genes 0.000 claims description 2
- 241000233866 Fungi Species 0.000 claims description 2
- 241000606768 Haemophilus influenzae Species 0.000 claims description 2
- 208000005176 Hepatitis C Diseases 0.000 claims description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 claims description 2
- 201000002563 Histoplasmosis Diseases 0.000 claims description 2
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 claims description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 claims description 2
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 claims description 2
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 claims description 2
- 108010073807 IgG Receptors Proteins 0.000 claims description 2
- 102000006992 Interferon-alpha Human genes 0.000 claims description 2
- 108010047761 Interferon-alpha Proteins 0.000 claims description 2
- 241000701372 Iridovirus Species 0.000 claims description 2
- 102100031413 L-dopachrome tautomerase Human genes 0.000 claims description 2
- 101710093778 L-dopachrome tautomerase Proteins 0.000 claims description 2
- 241000589248 Legionella Species 0.000 claims description 2
- 208000007764 Legionnaires' Disease Diseases 0.000 claims description 2
- 241000222722 Leishmania <genus> Species 0.000 claims description 2
- 241000186781 Listeria Species 0.000 claims description 2
- 208000016604 Lyme disease Diseases 0.000 claims description 2
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 claims description 2
- 241001183012 Modified Vaccinia Ankara virus Species 0.000 claims description 2
- 102100023123 Mucin-16 Human genes 0.000 claims description 2
- 102100034263 Mucin-2 Human genes 0.000 claims description 2
- 108010008705 Mucin-2 Proteins 0.000 claims description 2
- 241000187654 Nocardia Species 0.000 claims description 2
- 206010035148 Plague Diseases 0.000 claims description 2
- 241000224016 Plasmodium Species 0.000 claims description 2
- 241000233872 Pneumocystis carinii Species 0.000 claims description 2
- 241000607142 Salmonella Species 0.000 claims description 2
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 claims description 2
- 241001505901 Streptococcus sp. 'group A' Species 0.000 claims description 2
- 241000223997 Toxoplasma gondii Species 0.000 claims description 2
- 241000607479 Yersinia pestis Species 0.000 claims description 2
- 229940037003 alum Drugs 0.000 claims description 2
- 230000005975 antitumor immune response Effects 0.000 claims description 2
- 229960000190 bacillus calmette–guérin vaccine Drugs 0.000 claims description 2
- 229960005004 cholera vaccine Drugs 0.000 claims description 2
- 230000003013 cytotoxicity Effects 0.000 claims description 2
- 231100000135 cytotoxicity Toxicity 0.000 claims description 2
- 239000003937 drug carrier Substances 0.000 claims description 2
- 230000004927 fusion Effects 0.000 claims description 2
- 229940044627 gamma-interferon Drugs 0.000 claims description 2
- 208000002672 hepatitis B Diseases 0.000 claims description 2
- SPSXSWRZQFPVTJ-ZQQKUFEYSA-N hepatitis b vaccine Chemical compound C([C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CC1N=CN=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)OC(=O)CNC(=O)CNC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@@H](N)CCCNC(N)=N)C1=CC=CC=C1 SPSXSWRZQFPVTJ-ZQQKUFEYSA-N 0.000 claims description 2
- 229940124724 hepatitis-A vaccine Drugs 0.000 claims description 2
- 229940124736 hepatitis-B vaccine Drugs 0.000 claims description 2
- 102000046157 human CSF2 Human genes 0.000 claims description 2
- 229960003971 influenza vaccine Drugs 0.000 claims description 2
- 238000001361 intraarterial administration Methods 0.000 claims description 2
- 230000001404 mediated effect Effects 0.000 claims description 2
- 238000013508 migration Methods 0.000 claims description 2
- 230000005012 migration Effects 0.000 claims description 2
- 210000003205 muscle Anatomy 0.000 claims description 2
- 210000000663 muscle cell Anatomy 0.000 claims description 2
- 229940031960 pneumococcal polysaccharide vaccine Drugs 0.000 claims description 2
- 108700042226 ras Genes Proteins 0.000 claims description 2
- 101150047061 tag-72 gene Proteins 0.000 claims description 2
- 241001430294 unidentified retrovirus Species 0.000 claims description 2
- 229960001515 yellow fever vaccine Drugs 0.000 claims description 2
- 230000001580 bacterial effect Effects 0.000 claims 5
- 230000002538 fungal effect Effects 0.000 claims 5
- 230000006044 T cell activation Effects 0.000 claims 4
- 125000003275 alpha amino acid group Chemical group 0.000 claims 4
- 241000713666 Lentivirus Species 0.000 claims 2
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 claims 2
- 108050003738 Neural cell adhesion molecule 1 Proteins 0.000 claims 2
- 208000006454 hepatitis Diseases 0.000 claims 2
- 231100000283 hepatitis Toxicity 0.000 claims 2
- 230000004073 interleukin-2 production Effects 0.000 claims 2
- 206010061289 metastatic neoplasm Diseases 0.000 claims 2
- 102000007644 Colony-Stimulating Factors Human genes 0.000 claims 1
- 101710112752 Cytotoxin Proteins 0.000 claims 1
- 229940032024 DPT vaccine Drugs 0.000 claims 1
- 208000031886 HIV Infections Diseases 0.000 claims 1
- 208000005331 Hepatitis D Diseases 0.000 claims 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 claims 1
- 241000713340 Human immunodeficiency virus 2 Species 0.000 claims 1
- 102000003996 Interferon-beta Human genes 0.000 claims 1
- 108090000467 Interferon-beta Proteins 0.000 claims 1
- 241001631646 Papillomaviridae Species 0.000 claims 1
- 102100040247 Tumor necrosis factor Human genes 0.000 claims 1
- 230000001464 adherent effect Effects 0.000 claims 1
- 230000002141 anti-parasite Effects 0.000 claims 1
- 230000000890 antigenic effect Effects 0.000 claims 1
- 230000003915 cell function Effects 0.000 claims 1
- 230000004663 cell proliferation Effects 0.000 claims 1
- 231100000599 cytotoxic agent Toxicity 0.000 claims 1
- 239000002619 cytotoxin Substances 0.000 claims 1
- 230000000925 erythroid effect Effects 0.000 claims 1
- 208000005252 hepatitis A Diseases 0.000 claims 1
- 201000010284 hepatitis E Diseases 0.000 claims 1
- 239000000568 immunological adjuvant Substances 0.000 claims 1
- 230000001394 metastastic effect Effects 0.000 claims 1
- 208000025440 neoplasm of neck Diseases 0.000 claims 1
- 230000003071 parasitic effect Effects 0.000 claims 1
- 208000023958 prostate neoplasm Diseases 0.000 claims 1
- 230000006433 tumor necrosis factor production Effects 0.000 claims 1
- 241000712461 unidentified influenza virus Species 0.000 claims 1
- 230000003053 immunization Effects 0.000 abstract description 21
- 238000002649 immunization Methods 0.000 abstract description 21
- 230000003308 immunostimulating effect Effects 0.000 abstract description 20
- 230000004044 response Effects 0.000 abstract description 17
- 241000271566 Aves Species 0.000 abstract description 10
- 230000002265 prevention Effects 0.000 abstract description 5
- 230000000259 anti-tumor effect Effects 0.000 abstract 1
- 241000699670 Mus sp. Species 0.000 description 141
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 115
- 210000001744 T-lymphocyte Anatomy 0.000 description 42
- 241001529936 Murinae Species 0.000 description 22
- 241000124008 Mammalia Species 0.000 description 19
- 238000000338 in vitro Methods 0.000 description 18
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 17
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 17
- 230000014509 gene expression Effects 0.000 description 17
- 210000002966 serum Anatomy 0.000 description 17
- 238000003780 insertion Methods 0.000 description 16
- 230000037431 insertion Effects 0.000 description 16
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 15
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 15
- 238000001727 in vivo Methods 0.000 description 15
- 102000015271 Intercellular Adhesion Molecule-1 Human genes 0.000 description 13
- 238000002474 experimental method Methods 0.000 description 13
- 108010005774 beta-Galactosidase Proteins 0.000 description 12
- 101150066555 lacZ gene Proteins 0.000 description 12
- 210000004988 splenocyte Anatomy 0.000 description 12
- 230000009089 cytolysis Effects 0.000 description 11
- 230000003393 splenic effect Effects 0.000 description 11
- 238000003556 assay Methods 0.000 description 10
- 239000000463 material Substances 0.000 description 10
- 239000012981 Hank's balanced salt solution Substances 0.000 description 9
- 230000006801 homologous recombination Effects 0.000 description 9
- 238000002744 homologous recombination Methods 0.000 description 9
- 238000009169 immunotherapy Methods 0.000 description 9
- 238000002955 isolation Methods 0.000 description 9
- 239000000047 product Substances 0.000 description 9
- 239000007787 solid Substances 0.000 description 9
- 241000700618 Vaccinia virus Species 0.000 description 8
- 230000002494 anti-cea effect Effects 0.000 description 8
- WQZGKKKJIJFFOK-FPRJBGLDSA-N beta-D-galactose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-FPRJBGLDSA-N 0.000 description 8
- 230000000875 corresponding effect Effects 0.000 description 8
- 238000011534 incubation Methods 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- OZFAFGSSMRRTDW-UHFFFAOYSA-N (2,4-dichlorophenyl) benzenesulfonate Chemical compound ClC1=CC(Cl)=CC=C1OS(=O)(=O)C1=CC=CC=C1 OZFAFGSSMRRTDW-UHFFFAOYSA-N 0.000 description 7
- 239000012591 Dulbecco’s Phosphate Buffered Saline Substances 0.000 description 7
- 102000004388 Interleukin-4 Human genes 0.000 description 7
- 108090000978 Interleukin-4 Proteins 0.000 description 7
- 230000006052 T cell proliferation Effects 0.000 description 7
- 230000001413 cellular effect Effects 0.000 description 7
- 210000003837 chick embryo Anatomy 0.000 description 7
- 229940028885 interleukin-4 Drugs 0.000 description 7
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 7
- 238000011536 re-plating Methods 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- 230000005809 anti-tumor immunity Effects 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 230000002163 immunogen Effects 0.000 description 6
- VAOCPAMSLUNLGC-UHFFFAOYSA-N metronidazole Chemical compound CC1=NC=C([N+]([O-])=O)N1CCO VAOCPAMSLUNLGC-UHFFFAOYSA-N 0.000 description 6
- 230000003389 potentiating effect Effects 0.000 description 6
- 230000002459 sustained effect Effects 0.000 description 6
- 108010002350 Interleukin-2 Proteins 0.000 description 5
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 5
- 239000012980 RPMI-1640 medium Substances 0.000 description 5
- 230000024932 T cell mediated immunity Effects 0.000 description 5
- 230000000240 adjuvant effect Effects 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 229940023860 canarypox virus HIV vaccine Drugs 0.000 description 5
- 239000013553 cell monolayer Substances 0.000 description 5
- 238000005119 centrifugation Methods 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 230000036541 health Effects 0.000 description 5
- 230000007236 host immunity Effects 0.000 description 5
- 230000002101 lytic effect Effects 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 206010005003 Bladder cancer Diseases 0.000 description 4
- 238000011740 C57BL/6 mouse Methods 0.000 description 4
- 101100328884 Caenorhabditis elegans sqt-3 gene Proteins 0.000 description 4
- 108010062580 Concanavalin A Proteins 0.000 description 4
- 241000287828 Gallus gallus Species 0.000 description 4
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 4
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 4
- 108010008038 Synthetic Vaccines Proteins 0.000 description 4
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 229940088710 antibiotic agent Drugs 0.000 description 4
- 230000001640 apoptogenic effect Effects 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 239000006285 cell suspension Substances 0.000 description 4
- 230000016396 cytokine production Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 239000010432 diamond Substances 0.000 description 4
- 230000008029 eradication Effects 0.000 description 4
- 206010020718 hyperplasia Diseases 0.000 description 4
- 230000002390 hyperplastic effect Effects 0.000 description 4
- 239000013641 positive control Substances 0.000 description 4
- 230000035755 proliferation Effects 0.000 description 4
- 230000009696 proliferative response Effects 0.000 description 4
- 230000000644 propagated effect Effects 0.000 description 4
- 229940124551 recombinant vaccine Drugs 0.000 description 4
- 230000001177 retroviral effect Effects 0.000 description 4
- 210000004927 skin cell Anatomy 0.000 description 4
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 4
- 238000010254 subcutaneous injection Methods 0.000 description 4
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 4
- LINMATFDVHBYOS-MBJXGIAVSA-N (2s,3r,4s,5r,6r)-2-[(5-bromo-1h-indol-3-yl)oxy]-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1OC1=CNC2=CC=C(Br)C=C12 LINMATFDVHBYOS-MBJXGIAVSA-N 0.000 description 3
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 3
- 102100026189 Beta-galactosidase Human genes 0.000 description 3
- 206010057248 Cell death Diseases 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 229930182566 Gentamicin Natural products 0.000 description 3
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 3
- 239000007995 HEPES buffer Substances 0.000 description 3
- 108010013476 HLA-A24 Antigen Proteins 0.000 description 3
- 108060003951 Immunoglobulin Proteins 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- 229930182816 L-glutamine Natural products 0.000 description 3
- 206010025323 Lymphomas Diseases 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 3
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 3
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 3
- 230000000843 anti-fungal effect Effects 0.000 description 3
- 230000002238 attenuated effect Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 230000036755 cellular response Effects 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 230000001461 cytolytic effect Effects 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 229960002518 gentamicin Drugs 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 230000008073 immune recognition Effects 0.000 description 3
- 102000018358 immunoglobulin Human genes 0.000 description 3
- 230000001024 immunotherapeutic effect Effects 0.000 description 3
- 239000002054 inoculum Substances 0.000 description 3
- 210000001821 langerhans cell Anatomy 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 230000001589 lymphoproliferative effect Effects 0.000 description 3
- 210000001161 mammalian embryo Anatomy 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 230000001855 preneoplastic effect Effects 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 230000004614 tumor growth Effects 0.000 description 3
- 201000005112 urinary bladder cancer Diseases 0.000 description 3
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 2
- 108010082808 4-1BB Ligand Proteins 0.000 description 2
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 2
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 2
- SNKUSVNHTCUELQ-UOGODTEOSA-N CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 SNKUSVNHTCUELQ-UOGODTEOSA-N 0.000 description 2
- 101150045267 CEA gene Proteins 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 238000012286 ELISA Assay Methods 0.000 description 2
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 108010035452 HLA-A1 Antigen Proteins 0.000 description 2
- 108010014597 HLA-B44 Antigen Proteins 0.000 description 2
- 108010046732 HLA-DR4 Antigen Proteins 0.000 description 2
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 2
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 description 2
- 241000701806 Human papillomavirus Species 0.000 description 2
- 108090001030 Lipoproteins Proteins 0.000 description 2
- 102000004895 Lipoproteins Human genes 0.000 description 2
- 208000008771 Lymphadenopathy Diseases 0.000 description 2
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 2
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 239000012124 Opti-MEM Substances 0.000 description 2
- 108010058846 Ovalbumin Proteins 0.000 description 2
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 2
- 206010037742 Rabies Diseases 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 241000580858 Simian-Human immunodeficiency virus Species 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 206010043376 Tetanus Diseases 0.000 description 2
- 102000006601 Thymidine Kinase Human genes 0.000 description 2
- 108020004440 Thymidine kinase Proteins 0.000 description 2
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 150000001413 amino acids Chemical class 0.000 description 2
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 2
- 229960003942 amphotericin b Drugs 0.000 description 2
- 230000003302 anti-idiotype Effects 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 230000003190 augmentative effect Effects 0.000 description 2
- 238000004166 bioassay Methods 0.000 description 2
- 201000008275 breast carcinoma Diseases 0.000 description 2
- 229940022399 cancer vaccine Drugs 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000007910 cell fusion Effects 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 229960004397 cyclophosphamide Drugs 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 206010013023 diphtheria Diseases 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 229940121354 immunomodulator Drugs 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 230000003902 lesion Effects 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 229920006008 lipopolysaccharide Polymers 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000006148 magnetic separator Substances 0.000 description 2
- 208000037819 metastatic cancer Diseases 0.000 description 2
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 2
- 244000000010 microbial pathogen Species 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- NQDJXKOVJZTUJA-UHFFFAOYSA-N nevirapine Chemical compound C12=NC=CC=C2C(=O)NC=2C(C)=CC=NC=2N1C1CC1 NQDJXKOVJZTUJA-UHFFFAOYSA-N 0.000 description 2
- 229940092253 ovalbumin Drugs 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 230000037452 priming Effects 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 229940083538 smallpox vaccine Drugs 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 229940054269 sodium pyruvate Drugs 0.000 description 2
- 230000002269 spontaneous effect Effects 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000002123 temporal effect Effects 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 230000001052 transient effect Effects 0.000 description 2
- 239000012646 vaccine adjuvant Substances 0.000 description 2
- 229940124931 vaccine adjuvant Drugs 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- XMAYWYJOQHXEEK-OZXSUGGESA-N (2R,4S)-ketoconazole Chemical compound C1CN(C(=O)C)CCN1C(C=C1)=CC=C1OC[C@@H]1O[C@@](CN2C=NC=C2)(C=2C(=CC(Cl)=CC=2)Cl)OC1 XMAYWYJOQHXEEK-OZXSUGGESA-N 0.000 description 1
- AHOKKYCUWBLDST-QYULHYBRSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s,3s)-2-[[(2s)-2,6-diaminohexanoyl]amino]-3-methylpentanoyl]amino]-3-phenylpropanoyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]-4-methylpentanoyl]amino]propanoyl]amino]-3-phenylpropanoyl]amino Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)[C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=CC=C1 AHOKKYCUWBLDST-QYULHYBRSA-N 0.000 description 1
- GEYOCULIXLDCMW-UHFFFAOYSA-N 1,2-phenylenediamine Chemical compound NC1=CC=CC=C1N GEYOCULIXLDCMW-UHFFFAOYSA-N 0.000 description 1
- WEYNBWVKOYCCQT-UHFFFAOYSA-N 1-(3-chloro-4-methylphenyl)-3-{2-[({5-[(dimethylamino)methyl]-2-furyl}methyl)thio]ethyl}urea Chemical compound O1C(CN(C)C)=CC=C1CSCCNC(=O)NC1=CC=C(C)C(Cl)=C1 WEYNBWVKOYCCQT-UHFFFAOYSA-N 0.000 description 1
- SNKUSVNHTCUELQ-UHFFFAOYSA-N 2-[[4-amino-2-[[2-[[2-[2-[[2-[[2-[[2-[[2-amino-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]acetyl]amino]propanoylamino]-3-carboxypropanoyl]amino]-4-methylpentanoyl]amino]-4-oxobutanoyl]amino]-4-methylpentanoic aci Chemical compound CC(C)CC(C(O)=O)NC(=O)C(CC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(CC(O)=O)NC(=O)C(C)NC(=O)CNC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(N)CC1=CC=C(O)C=C1 SNKUSVNHTCUELQ-UHFFFAOYSA-N 0.000 description 1
- 108020005065 3' Flanking Region Proteins 0.000 description 1
- 238000010600 3H thymidine incorporation assay Methods 0.000 description 1
- 108020005029 5' Flanking Region Proteins 0.000 description 1
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 1
- 206010068873 Adenosquamous cell carcinoma Diseases 0.000 description 1
- 101710137115 Adenylyl cyclase-associated protein 1 Proteins 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 102100037982 Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A Human genes 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 108010045634 B7 Antigens Proteins 0.000 description 1
- 102000005738 B7 Antigens Human genes 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 206010055113 Breast cancer metastatic Diseases 0.000 description 1
- 108010077333 CAP1-6D Proteins 0.000 description 1
- QAGYKUNXZHXKMR-UHFFFAOYSA-N CPD000469186 Natural products CC1=C(O)C=CC=C1C(=O)NC(C(O)CN1C(CC2CCCCC2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-UHFFFAOYSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 102000001327 Chemokine CCL5 Human genes 0.000 description 1
- 241001227713 Chiron Species 0.000 description 1
- 208000003322 Coinfection Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 108010026206 Conalbumin Proteins 0.000 description 1
- 208000032170 Congenital Abnormalities Diseases 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 102000013701 Cyclin-Dependent Kinase 4 Human genes 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- MQJKPEGWNLWLTK-UHFFFAOYSA-N Dapsone Chemical compound C1=CC(N)=CC=C1S(=O)(=O)C1=CC=C(N)C=C1 MQJKPEGWNLWLTK-UHFFFAOYSA-N 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 206010061819 Disease recurrence Diseases 0.000 description 1
- 101000609767 Dromaius novaehollandiae Ovalbumin Proteins 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 description 1
- 239000009484 FIBS Substances 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 206010018785 Gingival infections Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108010018475 HLA-A31 antigen Proteins 0.000 description 1
- 108010059045 HLA-C*06 antigen Proteins 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000773083 Homo sapiens 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 1
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101000946850 Homo sapiens T-lymphocyte activation antigen CD86 Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 241000282560 Macaca mulatta Species 0.000 description 1
- 208000002720 Malnutrition Diseases 0.000 description 1
- 238000000585 Mann–Whitney U test Methods 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 1
- BYBLEWFAAKGYCD-UHFFFAOYSA-N Miconazole Chemical compound ClC1=CC(Cl)=CC=C1COC(C=1C(=CC(Cl)=CC=1)Cl)CN1C=NC=C1 BYBLEWFAAKGYCD-UHFFFAOYSA-N 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 1
- DDUHZTYCFQRHIY-UHFFFAOYSA-N Negwer: 6874 Natural products COC1=CC(=O)CC(C)C11C(=O)C(C(OC)=CC(OC)=C2Cl)=C2O1 DDUHZTYCFQRHIY-UHFFFAOYSA-N 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 208000007117 Oral Ulcer Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 208000005141 Otitis Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 102100034640 PWWP domain-containing DNA repair factor 3A Human genes 0.000 description 1
- 108050007154 PWWP domain-containing DNA repair factor 3A Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 229940124939 Pox vaccine Drugs 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 241001510071 Pyrrhocoridae Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- NCDNCNXCDXHOMX-UHFFFAOYSA-N Ritonavir Natural products C=1C=CC=CC=1CC(NC(=O)OCC=1SC=NC=1)C(O)CC(CC=1C=CC=CC=1)NC(=O)C(C(C)C)NC(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-UHFFFAOYSA-N 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 241000270295 Serpentes Species 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 230000037453 T cell priming Effects 0.000 description 1
- 210000000173 T-lymphoid precursor cell Anatomy 0.000 description 1
- 102100033082 TNF receptor-associated factor 3 Human genes 0.000 description 1
- 241001067453 Therion Species 0.000 description 1
- WKDDRNSBRWANNC-UHFFFAOYSA-N Thienamycin Natural products C1C(SCCN)=C(C(O)=O)N2C(=O)C(C(O)C)C21 WKDDRNSBRWANNC-UHFFFAOYSA-N 0.000 description 1
- 108010046722 Thrombospondin 1 Proteins 0.000 description 1
- 102100036034 Thrombospondin-1 Human genes 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- GLNADSQYFUSGOU-GPTZEZBUSA-J Trypan blue Chemical compound [Na+].[Na+].[Na+].[Na+].C1=C(S([O-])(=O)=O)C=C2C=C(S([O-])(=O)=O)C(/N=N/C3=CC=C(C=C3C)C=3C=C(C(=CC=3)\N=N\C=3C(=CC4=CC(=CC(N)=C4C=3O)S([O-])(=O)=O)S([O-])(=O)=O)C)=C(O)C2=C1N GLNADSQYFUSGOU-GPTZEZBUSA-J 0.000 description 1
- 241000223104 Trypanosoma Species 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 108010059993 Vancomycin Proteins 0.000 description 1
- 108010000134 Vascular Cell Adhesion Molecule-1 Proteins 0.000 description 1
- 101001120215 Vipera ammodytes ammodytes Basic phospholipase A2 homolog ammodytin L Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 201000008395 adenosquamous carcinoma Diseases 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 108700025316 aldesleukin Proteins 0.000 description 1
- 108010034034 alpha-1,6-mannosylglycoprotein beta 1,6-N-acetylglucosaminyltransferase Proteins 0.000 description 1
- 229940126575 aminoglycoside Drugs 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000001430 anti-depressive effect Effects 0.000 description 1
- 230000002001 anti-metastasis Effects 0.000 description 1
- 230000000244 anti-pseudomonal effect Effects 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 1
- 239000000935 antidepressant agent Substances 0.000 description 1
- 229940125687 antiparasitic agent Drugs 0.000 description 1
- 239000003096 antiparasitic agent Substances 0.000 description 1
- WZPBZJONDBGPKJ-VEHQQRBSSA-N aztreonam Chemical compound O=C1N(S([O-])(=O)=O)[C@@H](C)[C@@H]1NC(=O)C(=N/OC(C)(C)C(O)=O)\C1=CSC([NH3+])=N1 WZPBZJONDBGPKJ-VEHQQRBSSA-N 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 230000002146 bilateral effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 239000010836 blood and blood product Substances 0.000 description 1
- 229940125691 blood product Drugs 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 231100001018 bone marrow damage Toxicity 0.000 description 1
- 238000010322 bone marrow transplantation Methods 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 229960002100 cefepime Drugs 0.000 description 1
- HVFLCNVBZFFHBT-ZKDACBOMSA-N cefepime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1C[N+]1(C)CCCC1 HVFLCNVBZFFHBT-ZKDACBOMSA-N 0.000 description 1
- ORFOPKXBNMVMKC-DWVKKRMSSA-N ceftazidime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC(C)(C)C(O)=O)C=2N=C(N)SC=2)CC=1C[N+]1=CC=CC=C1 ORFOPKXBNMVMKC-DWVKKRMSSA-N 0.000 description 1
- 229960000484 ceftazidime Drugs 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000007969 cellular immunity Effects 0.000 description 1
- 230000007541 cellular toxicity Effects 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 210000003711 chorioallantoic membrane Anatomy 0.000 description 1
- 229960004022 clotrimazole Drugs 0.000 description 1
- VNFPBHJOKIVQEB-UHFFFAOYSA-N clotrimazole Chemical compound ClC1=CC=CC=C1C(N1C=NC=C1)(C=1C=CC=CC=1)C1=CC=CC=C1 VNFPBHJOKIVQEB-UHFFFAOYSA-N 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 229940002316 combination nystatin Drugs 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 229960000860 dapsone Drugs 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 230000001079 digestive effect Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002934 diuretic Substances 0.000 description 1
- 230000001882 diuretic effect Effects 0.000 description 1
- 208000019258 ear infection Diseases 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 230000002550 fecal effect Effects 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 229960004884 fluconazole Drugs 0.000 description 1
- RFHAOTPXVQNOHP-UHFFFAOYSA-N fluconazole Chemical compound C1=NC=NN1CC(C=1C(=CC(F)=CC=1)F)(O)CN1C=NC=N1 RFHAOTPXVQNOHP-UHFFFAOYSA-N 0.000 description 1
- 229960004413 flucytosine Drugs 0.000 description 1
- XRECTZIEBJDKEO-UHFFFAOYSA-N flucytosine Chemical compound NC1=NC(=O)NC=C1F XRECTZIEBJDKEO-UHFFFAOYSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- VVIAGPKUTFNRDU-ABLWVSNPSA-N folinic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-ABLWVSNPSA-N 0.000 description 1
- 235000008191 folinic acid Nutrition 0.000 description 1
- 239000011672 folinic acid Substances 0.000 description 1
- 229960002963 ganciclovir Drugs 0.000 description 1
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 108010072094 gp100(280-288) melanoma antigen peptide Proteins 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 230000009036 growth inhibition Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 210000004524 haematopoietic cell Anatomy 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 201000003911 head and neck carcinoma Diseases 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 230000005745 host immune response Effects 0.000 description 1
- 102000049849 human CD86 Human genes 0.000 description 1
- 102000043559 human ICAM1 Human genes 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- ZSKVGTPCRGIANV-ZXFLCMHBSA-N imipenem Chemical compound C1C(SCC\N=C\N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 ZSKVGTPCRGIANV-ZXFLCMHBSA-N 0.000 description 1
- 229960002182 imipenem Drugs 0.000 description 1
- 239000012642 immune effector Substances 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000001571 immunoadjuvant effect Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003365 immunocytochemistry Methods 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 230000008902 immunological benefit Effects 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 229960001936 indinavir Drugs 0.000 description 1
- CBVCZFGXHXORBI-PXQQMZJSSA-N indinavir Chemical compound C([C@H](N(CC1)C[C@@H](O)C[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H]2C3=CC=CC=C3C[C@H]2O)C(=O)NC(C)(C)C)N1CC1=CC=CN=C1 CBVCZFGXHXORBI-PXQQMZJSSA-N 0.000 description 1
- 229940055742 indium-111 Drugs 0.000 description 1
- APFVFJFRJDLVQX-AHCXROLUSA-N indium-111 Chemical compound [111In] APFVFJFRJDLVQX-AHCXROLUSA-N 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 201000006747 infectious mononucleosis Diseases 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000004941 influx Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- VHVPQPYKVGDNFY-ZPGVKDDISA-N itraconazole Chemical compound O=C1N(C(C)CC)N=CN1C1=CC=C(N2CCN(CC2)C=2C=CC(OC[C@@H]3O[C@](CN4N=CN=C4)(OC3)C=3C(=CC(Cl)=CC=3)Cl)=CC=2)C=C1 VHVPQPYKVGDNFY-ZPGVKDDISA-N 0.000 description 1
- 229960004125 ketoconazole Drugs 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 229960001691 leucovorin Drugs 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- KBEMFSMODRNJHE-JFWOZONXSA-N lodenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)C[C@@H]1F KBEMFSMODRNJHE-JFWOZONXSA-N 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 208000018555 lymphatic system disease Diseases 0.000 description 1
- 210000003563 lymphoid tissue Anatomy 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 230000001071 malnutrition Effects 0.000 description 1
- 235000000824 malnutrition Nutrition 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 208000021039 metastatic melanoma Diseases 0.000 description 1
- HOVAGTYPODGVJG-UHFFFAOYSA-N methyl beta-galactoside Natural products COC1OC(CO)C(O)C(O)C1O HOVAGTYPODGVJG-UHFFFAOYSA-N 0.000 description 1
- 229960002509 miconazole Drugs 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000007799 mixed lymphocyte reaction assay Methods 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 229960000884 nelfinavir Drugs 0.000 description 1
- QAGYKUNXZHXKMR-HKWSIXNMSA-N nelfinavir Chemical compound CC1=C(O)C=CC=C1C(=O)N[C@H]([C@H](O)CN1[C@@H](C[C@@H]2CCCC[C@@H]2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-HKWSIXNMSA-N 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 229960000689 nevirapine Drugs 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 208000015380 nutritional deficiency disease Diseases 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 229960003540 oxyquinoline Drugs 0.000 description 1
- 230000000242 pagocytic effect Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 208000014081 polyp of colon Diseases 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 230000036515 potency Effects 0.000 description 1
- 244000144977 poultry Species 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229940087463 proleukin Drugs 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000012827 research and development Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000006335 response to radiation Effects 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 229960000311 ritonavir Drugs 0.000 description 1
- NCDNCNXCDXHOMX-XGKFQTDJSA-N ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 1
- 239000011435 rock Substances 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000009987 spinning Methods 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 238000011272 standard treatment Methods 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 238000012353 t test Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229940126622 therapeutic monoclonal antibody Drugs 0.000 description 1
- 208000008732 thymoma Diseases 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 210000003437 trachea Anatomy 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 229940030325 tumor cell vaccine Drugs 0.000 description 1
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 1
- 230000002476 tumorcidal effect Effects 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 210000001635 urinary tract Anatomy 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 229960003165 vancomycin Drugs 0.000 description 1
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 1
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 210000005135 veiled cell Anatomy 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 229960002555 zidovudine Drugs 0.000 description 1
- 150000003952 β-lactams Chemical class 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001136—Cytokines
- A61K39/001139—Colony stimulating factors [CSF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/53—Colony-stimulating factor [CSF]
- C07K14/535—Granulocyte CSF; Granulocyte-macrophage CSF
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1816—Erythropoietin [EPO]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/21—Retroviridae, e.g. equine infectious anemia virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/46448—Cancer antigens from embryonic or fetal origin
- A61K39/464482—Carcinoembryonic antigen [CEA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
- A61P31/22—Antivirals for DNA viruses for herpes viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/02—Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P41/00—Drugs used in surgical methods, e.g. surgery adjuvants for preventing adhesion or for vitreum substitution
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55522—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/50—Colon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/24011—Poxviridae
- C12N2710/24041—Use of virus, viral particle or viral elements as a vector
- C12N2710/24043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention relates to recombinant replication-defective virus expressing the cytokine, granulocyte-monocyte colony stimulating factor (GM-CSF) for use in enhancing immune responses and for treating neutropenia and myeloidysplastic syndromes. More specifically, the invention relates to recombinant replication-defective avian poxvirus expressing GM-CSF for use as a biological adjuvant for enhancing immune responses, in particular anti-tumor responses, and for treating neutropenia and myeloidysplastic syndromes and compositions comprising same.
- GM-CSF granulocyte-monocyte colony stimulating factor
- GM-CSF 5 is thought to function as a biological vaccine adjuvant.
- Experimental and clinical studies suggest that recombinant GM-CSF protein can boost host immunity directed at a variety of immunogens (4-14).
- the recombinant GM-CSF protein (recGM-CSF) was administered for 4-5 consecutive days, beginning with co-injection with the antigen (15).
- Other approaches have delivered GM- CSF in DNA plasmids (16, 17), fusion proteins (18), retroviral vectors (19, 20) and replication competent vaccinia vectors (45), all of which have, for the most part, augmented host immunity.
- vaccinia-GM-CSF recombinant virus is questionable since repeated injections may be problematical (23) due to host anti-vector immune responses.
- Replication-defective avian poxviruses have been constructed to express cytokine gene products (24, 25) and shown herein to be more suitable to deliver GM-CSF to a site of immunization than prior art methods.
- An aspect of the invention is a composition comprising a recombinant replication-defective virus encoding GM-CSF, alone or in combination with a source of antigen or epitope source.
- a further aspect of the invention is a composition comprising a recombinant replication-defective virus encoding both the GM-CSF and an antigen or immunological epitope thereof, in particular one or more tumor associated antigens.
- compositions comprising a recombinant replication-defective virus encoding GM-CSF in combination with a vector expressing an antigen, alone or in combination with at least one immunostimulatory molecule.
- An additional aspect of the invention is a composition comprising a recombinant replication-defective poxvirus encoding GM-CSF alone or in combination with a vector expressing at least one antigen or immunological epitope thereof, with or without a gene encoding at least one immunostimulatory molecule.
- Another aspect of the invention is a composition comprising a recombinant avipox virus encoding GM-CSF alone or in combination with a vector expressing at least one tumor-associated antigen or immunological epitope thereof, with or without a gene encoding at least one immunostimulatory molecule.
- One aspect of the invention is a composition comprising a recombinant replication-defective virus encoding GM-CSF in combination with a recombinant replication-defective virus expressing at least one antigen or immunological epitope thereof, with or without a gene encoding at least one immunostimulatory molecule.
- compositions comprising a recombinant replication-defective avian poxvirus encoding GM-CSF in combination with a recombinant replication-defective avian poxvirus expressing at least one antigen or immunological epitope thereof.
- compositions comprising a recombinant replication defective virus encoding GM-CSF in combination with an antibiotic, antifungal agent, anti-parasitic agent, anti-viral agent, or combination thereof.
- composition comprising a recombinant replication-defective virus encoding GM-CSF in combination with erythropoietin.
- the invention further provides a composition comprising a recombinant replication-defective virus encoding GM-CSF in combination with a bispecific antibody.
- the present invention provides host cells infected with a first vector of a recombinant replication-defective virus encoding GM-CSF molecules causing expression of the GM-CSF in the host cells.
- a second vector may further provide a foreign gene encoding at least one target antigen or immunological epitope thereof to the host cell, and/or foreign genes encoding one or more costimulatory molecules.
- the present invention provides antigen-presenting cells (APCs) or tumor cells infected with a first vector of a recombinant replication-defective virus encoding GM- CSF causing expression of GM-CSF.
- a second vector may further provide a foreign gene encoding at least one target antigen or immunological epitope thereof to the host cell, and/or genes encoding one or more costimulatory molecules.
- the present invention further provides host cells infected with a recombinant avipox virus causing expression of GM-CSF.
- the host cell may also be infected with a recombinant vector encoding at least one target antigen or immunological epitope thereof, and/or encoding at least one immunostimulatory molecule.
- Another aspect of the invention is a dendritic cell (DC) and precursor thereof infected with a replication-defective virus encoding GM-CSF.
- the DCs and precursors thereof may further be engineered to express foreign genes encoding at least one target antigen or immunological epitope thereof, and/or engineered to express at least one immunostimulatory molecule.
- Yet another aspect of the invention is a DC and precursors thereof genetically engineered to co-express GM-CSF and at least three exogenous costimulatory molecules.
- the DCs and precursor thereof may further be engineered to express foreign genes encoding at least one target antigen or immunological epitope thereof.
- the present invention further provides a DC and precursors thereof genetically engineered to co-express GM-CSF, at least one B7 molecule, ICAM-1 and LFA- 3.
- the DCs and precursor thereof may further be engineered to express foreign genes encoding at least one target antigen or immunological epitope thereof.
- the invention further provides host cells infected with the recombinant replication-defective virus encoding GM-CSF as a source for commericial production of GM-CSF.
- An object of the invention is to provide a method of enhancing an immune response to an antigen or epitope thereof comprising administration of a recombinant replication-defective virus expressing GM-CSF in an amount sufficient to enhance the immune response to the antigen or epitope thereof.
- Another object of the invention is to provide a method of enhancing an immune response to an antigen or epitope thereof comprising administration of a recombinant replication-defective poxvirus expressing GM-CSF, alone or in combination with at least one antigen or immunological epitope source in an amount sufficient to enhance the immune response to the antigen or epitope thereof.
- Another object of the invention is to provide a method of enhancing an immune response to at least one antigen or immunological epitope thereof comprising administration of a first recombinant vector encoding GM-CSF followed by administration of a second recombinant vector encoding GM-CSF, wherein at least one recombinant vector is a replication-defective virus.
- a further object of the invention is to provide a method of enriching regional lymph nodes with antigen presenting cells (APCs) using recombinant replication-defective virus encoding GM-CSF.
- the present invention further provides a method of generating antitumor immunity comprising administration of a recombinant replication-defective virus encoding GM-CSF, alone or in combination with at least one tumor antigen source, preferably a recombinant virus encoding at least one tumor antigen or immunological epitope thereof.
- APCs or tumor cells infected with a recombinant replication-defective virus encoding GM-CSF are provided to a mammal in an effective amount to enhance immunological responses.
- the APC or tumor cell may further express foreign genes encoding at least one target antigen or immunological epitope thereof, alone or in combination with a gene encoding at least one costimulatory molecule for enhancement of immune responses.
- a target antigen or immunological epitope thereof may be administered to the mammal prior to, concurrently with or subsequent to the administration of the APC or tumor cell.
- APCs or tumor cells are pulsed with at least one target antigen or immunological epitope thereof prior to administration to the mammal.
- Another object of the invention is to provide a method' for prevention or treatment of neutropenia using a recombinant replication-defective virus encoding GM- CSF.
- a further object of the invention is to provide a method for treating myeloidysplastic syndromes using a recombinant replication-defective virus encoding GM- CSF in combination with erythropoietin.
- Another aspect of the invention is a plasmid encoding GM-CSF for use in making a replication-defective virus encoding GM-CSF.
- Figure 1 Shows plasmid vector pT5091 for generation of rF-muGM-CSF.
- Figure 2 Shows plasmid vector pT5052 for generation of rF-huGM-CSF.
- Figure 3 Shows plasmid vector pT5051 for generation of rN-huGM-CSF.
- Figure 4A-4E Shows the genomic structure of recombinant poxvirases expressing GM-CSF.
- BarnHI J is the site of insertion in the fowlpox genome of the foreign genes.
- Hind III J or Hindlll M is the site of insertion in the vaccinia virus genome.
- Deletion III is the site of insertion in the MVA genome.
- 40K, Cl, PI and P2 are poxviral promoters.
- FIG. 5A-5C Shows the genomic structure of recombinant poxviruses co- expressing GM-CSF with a tumor-associate antigen (TAA).
- BamHI J is the site of insertion in the fowlpox genome of the foreign genes.
- Hind III J is the site of insertion in the vaccinia virus genome.
- Deletion III is the site of insertion in the MNA genome.
- PI, P2 and P3 are poxviral promoters.
- FIG. 6 Production of murine GM-CSF by recombinant avipox-GM-CSF viruses.
- MC-38 cells were infected with of 5 MOI of either avipox(F)-GM-CSF, avipox(F)- WT, avipox(A)-GM-CSF or avipox(A)-RG as outlined in the Materials and Methods.
- Control cells received no virus.
- Cells were grown for 3 days and supernatants were collected every 24 hr.
- Murine GM-CSF levels were measured using the GM-CSF-dependent FDCP-1 indicator cell line and are presented as ng GM-CSF produced/10 6 cells/24h. Data are the mean ⁇ SE from triplicate wells from a representative experiment that was repeated with similar results.
- FIG 7A to 7D MHC class II-expressing cells in regional lymph nodes of mice treated with recombinant avipox viruses expressing GM-CSF.
- groups of B6 mice (20-30 mice) were given a single s.c. injection (day 1, arrows) of either 10 7 pfu (2 A) or 10 s pfu (2B) avipox(F)-GM-CSF (closed circles) or avipox(F)-WT (open circles).
- B6 mice received avipox(A)-GM-CSF (closed circles) or avipox(A)-RG (open circles) at 10 7 pfu and 10 8 pfu, respectively.
- Other B6 mice received daily injections of 20 ⁇ g recGM-CSF ( Figure 7 A, dashed line, closed triangles) for four days (solid horizontal line).
- Control mice (open triangles, all panels) received 100 ⁇ l HBSS. Mice (4-6/group) were sacrificed at each time point, inguinal lymph nodes were removed, combined and the total lymph node cells were counted using a hemocytometer.
- FIG 8. Total number of APC per regional lymph node in mice treated with avipox-GM-CSF or recGM-CSF.
- B6 mice (8-12/group) were administered 10 8 pfu (indicated by the arrow) of avipox(F)-GM-CSF (solid triangles), avipox(F)-WT (open triangles), avipox(A)-GM-CSF (solid squares) or avipox(A)-rabies glycoprotein (RG) (open squares) as outlined in Figures 7A-7D.
- Control mice received HBSS. Regional lymph nodes were removed at the indicated time points and the total number of CDllc + /I-Ab + cells determined as summarized in the Materials and Methods. Data represent the mean ⁇ SE of a composite of findings from 3-4 separate experiments in which each time point was examined 2-3 times.
- Figures 9A-9B Effects of avipox (Figure 10A)-GM-CSF on the generation of an alloreactive CTL.
- B6 mice were treated with 10 8 pfu of either avipox(A)-GM- CSF (closed triangles), avi ⁇ ox(A)-RG (closed squares), as previously described.
- Control mice received HBSS (closed circles).
- a 1:1 ratio between responders (BALB/C splenocytes) and stimulators (irradiated B6 lymph node cells) was incubated in 10 ml medium in T-25 flasks for 5 days @ 37°C.
- the cells were harvested and cytotoxicity measured as described in the Materials and Methods. Cytolysis is shown for the allogenic H-2b target cells (MC-38), whereas, that for the syngeneic H-2d cells (P815) was ⁇ 8% for all groups.
- Data represent the mean ⁇ SE from quadruplicate determinations from a single experiment which was repeated with the same results.
- FIGS 10A and 10B (A) Changes in lymph node class II-expressing cells following multiple injections of avi ⁇ ox(A)-GM-CSF or avipox(A)-RG.
- B6 mice (15/group) were injected with 10 7 pfu of either avipox(A)-GM-CSF (solid circles), avipox(A)-RG (open circles) or HBSS (closed triangles).
- 2-5 mice/group were sacrificed, bilateral inguinal nodes were isolated and the total class II expressing cells determined as outlined for Figures 7A-7D. Data represent the results from a single experiment.
- CEA.Tg mice were vaccinated (2x) with avipox(A)-CEA alone (10 pfu, panel B) or in combination with recGM-CSF (20 ⁇ g, panel C) or avipox(A)-GM-CSF ( 10 8 , pfu, panel D) as outlined in the Materials and Methods. Other mice received 2 injections of either avipox(A)-RG (10 8 pfu) or HBSS (panel A). Two weeks after the final treatment, mice were bled and serum tested for the presence of anti-CEA IgG antibodies as previously described. Data represent the serum antibody titers for individual mice. Titers which were ⁇ 100 were considered negative.
- FIGS 12A - 12B Generation of CEA- 526-433 specific CTL responses in CEA.Tg mice vaccinated with avipox(A)-CEA in combination with avipox(A)-GM-CSF or recGM-CSF.
- CEA.Tg mice were vaccinated as outlined in the Materials and Methods. Purified splenic T cells were subjected to 3 rounds of in vitro stimulation in the presence of 10 units IL-2 and 1 ⁇ g CEA peptide/ml.
- T cell lines grew from those CEA.Tg mice vaccinated with avipox(A)-CEA alone (O, •), avipox(A)-CEA + avipox(A)-GM-CSF ( ⁇ , D) and avipox(A)-CEA + recGM-CSF (A, ⁇ ).
- Cytolytic activity was tested against EL4 targets cells incubated in the presence of 0.2 ⁇ g of CEA 526-522 (solid symbols) ( Figure 12A) or a control peptide (i.e., Flu NP 366-374 ) (open symbols).
- Figure 13A and 13B the growth of MC-38-CEA-2 tumors in individual CEA.Tg mice that were vaccinated with avipox-CEA combined with either avipox (A)-GM-CSF (13 A, arrow) or rGM-CSF (13B, arrow, solid horizontal line).
- N number of tumor-free mice at day 56. Data are combined with two separate experiments. Solid lines in Figure 13A and 13B indicate mice in which tumor regression was observed.
- FIG. 13C survival of the CEA.Tg mice vaccinated with avipox (A), CEA.Tg mice vaccinated with avipox (A)-CEA alone ( • ), or combined with avipox (A)-GM-CSF ( ⁇ ) or rGM-CSF (A).
- Untreated CEA.Tg mice received HBSS.
- Vaccination with avipox (A)-RG alone or combined with either avipox (A)-GM-CSF or rGM-CSF did not alter overall survival (data not shown).
- Figure 13D survival of the CEA.Tg mice vaccinated with avipox (A), CEA.Tg mice vaccinated with avipox (A)-CEA alone ( • ), or combined with avipox (A)-GM-CSF ( ⁇ ) or rGM-CSF (A).
- Untreated CEA.Tg mice received HBSS.
- FIG 14A-14C Avipox(F)-GM-CSF enhances CEA-specific T-cell responses to CEA vaccines.
- Figure 14A T-cell responses from mice vaccinated with buffer (closed boxes), avipox(F)-WT (closed diamonds), or avipox (F)-WT plus avipox(F)-GM- CSF (closed circles).
- Figure 14B T-cell responses from mice vaccinated with avipox (F)- CEA (closed diamonds), or avipox(F)-CEA plus avipox(F)-GM-CSF (closed circles).
- FIG. 14C T-cell responses from mice vaccinated with avipox(F)-CEA/TRICOM (i.e. avipox expressing CEA, B7.1, ICAM-1, and LFA-3; closed diamonds), or avipox(F)- CEA/TRICOM plus avipox(F)-GM-CSF (closed circles). Inserts in each panel demonstrate that T-cell responses to Con A (positive control) and ovalbumin (negative control) were the same for all groups.
- avipox(F)-CEA/TRICOM i.e. avipox expressing CEA, B7.1, ICAM-1, and LFA-3; closed diamonds
- avipox(F)- CEA/TRICOM plus avipox(F)-GM-CSF
- FIG. 15 Lymphoproliferative response to the whole protein, ⁇ - galactosidase ( ⁇ -gal) by splenocytes isolated from mice immunized with ⁇ -gal combined with incomplete Freund's adjuvant (IFA with or without fowlpox murine GM-CSF (Fp- u GM-CSF).
- IFA incomplete Freund's adjuvant
- the present invention is a recombinant replication-defective virus encoding
- GM-CSF for use in enhancing immunological responses to an antigen or immunological epitope thereof.
- Recombinant replication-defective virus for use in the present invention include but are not limited to replication-defective poxvirus, herpes virus, adenovirus, adeno-associated virus (AAV) and other vectors incapable of replicating in mammalian cells, preferably human cells, hi particular, the present invention is a recombinant replication-defective avian poxvirus, including fowlpox, canary pox virus and Modified Vaccinia Ankara strain (MVA) encoding GM-CSF for use as a biological adjuvant in enhancing immunological response to an antigen.
- MVA Modified Vaccinia Ankara strain
- the recombinant replication-defective virus encoding GM-CSF of the present invention has utility in providing enhanced immunological response to cells of the immune system including antigen-presenting cells (APCs), T lymphocytes, B lymphocytes, NK cells and the like.
- the immunological response may be a generalized immune enhancing or upregulating effect as demonstrated by increased cytokine release, increase proliferation by immune cells, increased mitogen responsiveness and the like.
- APCs antigen-presenting cells
- the recombinant replication-defective virus encoding GM-CSF may be used in combination with an antigen source for enhancement of antigen specific immunological responses.
- Such responses may include a cellular and or a humoral response directed to a specific antigen or epitope thereof.
- the recombinant-replication defective virus encoding GM-CSF provides an enhanced immunological response and advantages which are superior to those of natural GM-CSF protein, recombinant GM-CSF protein, GM-CSF-DNA plasmids, GM-CSF-fusion proteins, retroviral vectors encoding GM-CSF and vaccinia vectors encoding GM-CSF.
- the enhancement provided by the recombinant replication defective virus encoding GM- CSF is manifest both in the magnitude of the immune response and in the duration of the immune response.
- recombinant replication-defective fowlpox viruses and recombinant replication-defective canary pox viruses for delivery of a gene encoding GM-CSF to a host cell.
- Construction of recombinant replication-defective fowlpox virus encoding GM-CSF is disclosed herein. Construction of a recombinant canarypox virus encoding GM-CSF is disclosed in Human Gene Therapy 1998 Nov:9(17):2481-92.
- the recombinant replication-defective virus of the present invention comprises the gene encoding full length human GM-CSF (Gen Bank No. Ml 0663) or a mammalian gene encoding GM-CSF.
- compositions preferably pharmaceutically acceptable compositions comprising at least one recombinant replication- defective virus encoding GM-CSF alone or in combination with a source of antigen or epitope thereof.
- the composition may further comprise a conventional adjuvant.
- Sources of antigen or immunological epitopes thereof include but are not limited to proteins, peptides, lipids, lipoproteins, carbohydrates, polysaccharides, lipopolysaccharides, cells, cell fragments, cell extracts, antibodies, anti-idiotypic antibodies, apoptotic bodies and the like.
- the antigen or epitope source may be isolated from naturally occurring sources, chemically synthesized or genetically produced.
- a source of genetically produced antigen or epitope thereof include vectors encoding at least one antigen or epitope thereof, and the like.
- Cell sources of antigen or an immunological epitope thereof include but are not limited to bacteria, fungi, yeast, protozoans, virus, tumor cells, APCs, dendritic cells (DC), DC-tumor cell fusions and the like, as well as cells transfected or transduced with a gene encoding at least one antigen or epitope thereof.
- the antigen source is provided by one or more genes encoding one or more antigens or immunologically epitopes thereof, incorporated into the recombinant replication-defective virus encoding GM-CSF, for coexpression of the one or more antigens along with GM-CSF.
- genes encoding tumor antigens or tumor-associated antigens are also included.
- the composition comprises a recombinant replication-defective avipox virus encoding GM-CSF and an antigen source alone or in combination with a conventional adjuvant.
- compositions preferably pharmaceutically acceptable compositions comprising at least one recombinant replication- defective virus encoding GM-CSF, alone or in combination with at least one vector encoding an antigen or epitope thereof, and/or encoding one or more immunostimulatory molecules and a pharmaceutically acceptable carrier.
- the composition comprises a recombinant replication-defective avipox virus encoding GM-CSF in combination with a vector encoding at least one antigen or immunological epitope thereof.
- the vector for use in providing the gene(s) encoding the antigen or immunological epitope thereof having utility in the present invention include any vector capable of causing functional expression of one or more gene products in a mammalian host cell, preferably a human cell.
- Vectors useful in providing genes encoding the antigen include but are not limited to viral vectors, nucleic acid based vectors and the like, including but not limited to poxvirus, Herpes virus, adenovirus, alphavirus, retrovirus, picomavirus, iridovirus and the like.
- Poxviruses having utility in providing genes encoding antigens and/or genes encoding immunostimulatory molecules include replicating and non-replicating vectors.
- the composition comprises a recombinant replication- defective fowlpox encoding GM-CSF in combination with a recombinant fowlpox encoding at least one antigen or epitope thereof alone or in combination with a gene encoding one or more costimulatory molecules.
- the composition comprises a recombinant replication-defective avipox encoding GM-CSF in combination with a recombinant replication-defective avipox encoding at least one antigen and encoding a B7 molecule.
- the recombinant replication-defective avipox virus encoding at least one antigen also encodes multiple costimulatory molecules such as B7/LFA-3/ICAM-1.
- the magnitude of the immune response to the antigen, epitope, or cells expressing the antigen resulting from administration of the composition of the present invention is significantly greater than that achieved using recGM-CSF in combination with a recombinant virus encoding an antigen.
- the target antigen is an antigen or immunological epitope on the antigen which is crucial in immune recognition and ultimate elimination or control of the disease-causing agent or disease state in a mammal.
- the immune recognition may be cellular and or humoral. In the case of intracellular pathogens and cancer, immune recognition is preferably a T lymphocyte response.
- Target antigen includes an antigen associated with a preneoplastic or hyperplastic state.
- Target antigen may also be associated with, or causative of cancer.
- Such target antigen may be a tumor cell, tumor specific antigen, tumor associated antigen (TAA) or tissue specific antigen, epitope thereof, and epitope agonist thereof.
- TAA tumor specific antigen
- TAA tumor associated antigen
- target antigens include but are not limited to carcinoembryonic antigen (CEA) and epitopes thereof such as CAP-1, CAP-1-6D (46) and the like (GenBank Accession No. M29540), MART-1 (Kawakami et al, J. Exp. Med. 180:347-352, 1994), MAGE-1 (U.S. Patent No.
- PSMA (Israeli et al Cancer Res. 53:227-230, 1993), tyrosinase (Kwon et al PNAS 84:7473- 7477, 1987, TRP-1 (gp75) (Cohen et al Nucleic Acid Res. 18:2807-2808, 1990; U.S. Patent No. 5,840,839), NY-ESO-1 (Chen et al PNAS 94: 1914-1918, 1997), TRP-2 (Jackson et al EMBOJ. 11:527-535, 1992), TAG72, KSA, CA-125, PSA, HER-2/neu/c-erb/B2, (U.S. Patent No.
- TAAs may be identified, isolated and cloned by methods known in the art such as those disclosed in U.S. Patent No. 4,514,506.
- Target antigen may also include one or more growth factors and splice variants of each. Possible human tumor antigens and tissue specific antigens as well as immunological epitopes thereof for targeting using the present invention include but are not limited to those exemplified in Table 1.
- Human target tumor antigens recognized bv T cells gp lOO HLA-A2 KTWGQYWZY 1
- TRP-1 HLA-A31 MSLQRQFLR 8
- PSA A2 A3 F FLLTTPPKKKKLLQQCCVVDDLLHHVVIISSNNDDVVC CAA- 3322
- the target antigen may be cell associated, derived or isolated from a pathogenic microorganism such as viruses including HIN, (Korber et al, eds HIN Molecular Immunology Database, Los Alamos National Laboratory, Los Alamos, New Mexico 1977) influenza, Herpes simplex, human papilloma virus (U.S. Patent No. 5,719,054), Hepatitis B (U.S. Patent No. 5,780,036), Hepatitis C (U.S. Patent No. 5,709,995), EBV, Cytomegalovirus (CMN) and the like.
- viruses including HIN, (Korber et al, eds HIN Molecular Immunology Database, Los Alamos National Laboratory, Los Alamos, New Mexico 1977) influenza, Herpes simplex, human papilloma virus (U.S. Patent No. 5,719,054), Hepatitis B (U.S. Patent No. 5,780,036), Hepatitis C
- Target antigen may be cell associated, derived or isolated from pathogenic bacteria such as from Chlamydia (U.S. Patent No. 5,869,608), Mycobacteria, Legionella, Meningiococcus, Group A Streptococcus, Salmonella, Listeria, Hemophilus in ⁇ uenzae (U.S. Patent No. 5,955,596) and the like.
- Target antigen may be cell associated, derived or isolated from pathogenic yeast including Aspergillus, invasive Candida (U.S. Patent No. 5,645,992), Nocardia, Histoplasmosis, Cryptosporidia and the like.
- Target antigen may be cell associated, derived or isolated from a pathogenic protozoan and pathogenic parasites including but not limited to Pneumocystis carinii, Trypanosoma, Leishmania (U.S. Patent No. 5,965,242), Plasmodium (U.S. Patent No. 5,589,343) and Toxoplasma gondii.
- Immunostimulatory molecules as used herein include but are not limited to the costimulatory molecules: B7, ICAM-1, LFA-3, 4-1BBL, CD59, CD40, CD70, VCAM- 1, OX-40L and the like, as well as cytokines and chemokines including but not limited to IL-2, TNF ⁇ , IFN ⁇ , IL-12, RANTES, MlP-l ⁇ , Flt-3L (U.S. Patent No. 5,554,512; 5,843,423) and the like.
- murine B7.1 The gene sequence of murine B7.1 is disclosed in Freeman et al (J. Immunol. 143:2714-2722, 1989) and in GENBANK under Accession No. X60958.
- the gene sequence of murine B7.2 is disclosed in Azuma et al (Nature 366:76-79, 1993) and in GENBANK under Accession No. L25606 and MUSB72X.
- the human homolog of the murine B7 costimulatory molecules include CD80, the homolog of murine B7.1, and CD86, the homolog of B7.2.
- the gene sequence of human B7.1 (CD80) is disclosed in GENBANK under Accession No. M27533, and the gene sequence of human B7.2 (CD86) is disclosed under Accession No. U04343 and AF099105.
- the gene for murine ICAM-1 is disclosed in GenBank under Accession No. X52264 and the gene for the human ICAM-1 homolog, (CD54), is disclosed in Accession No. J03132.
- the gene for murine LFA-3 is disclosed in GenBank under Accession No. X53526 and the gene for the human homolog is disclosed in Accession No. Y00636.
- the gene for the murine 4-1BBL is disclosed in GenBank under Accession No. U02567.
- the gene for the human homolog, hu4-lBBL is disclosed in GenBank under Accession No. U03397.
- the immunostimulatory molecules may be provided by a recombinant vector encoding the immunostimulatory molecule alone, or in combination with a nucleic acid sequence encoding a target antigen.
- the composition provides recombinant vector encoding a target antigen and encoding the multiple costimulatory molecules B7/IC AM- l/LFA-3 (TRICOM) in combination with a recombinant replication- defective virus encoding GM-CSF.
- a conventional adjuvant as used herein includes but is not limited to alum, Ribi DETOXTM, Freund's adjuvant, Freund's complete adjuvant, QS21 and the like.
- Diseases may be treated or prevented by use of the present invention and include diseases caused by viruses, bacteria, yeast, parasites, protozoans, cancer cells and the like.
- the recombinant replication-defective virus encoding GM-CSF may be used as a generalized immune enhancer and as such has utility in treating diseases of no known etiological cause.
- Preneoplastic or hyperplastic states which may be treated or prevented using a recombinant replication-defective virus encoding GM-CSF of the present invention include but are not limited to preneoplastic or hyperplastic states such as colon polyps, Crohn's disease, ulcerative colitis, breast lesions and the like.
- Cancers which may be treated using the recombinant replication-defective virus encoding GM-CSF of the present invention include but are not limited to primary or metastatic melanoma, adenocarcinoma, squamous cell carcinoma, adenosquamous cell carcinoma, thymoma, lymphoma, sarcoma, lung cancer, liver cancer, non-Hodgkins lymphoma, Hodgkins lymphoma, leukemias, uterine cancer, breast cancer, prostate cancer, ovarian cancer, pancreatic cancer, colon cancer, multiple myeloma, neuroblastoma, NPC, bladder cancer, cervical cancer and the like.
- Adjuvant I With an Antigen (Ag) - protein, peptide, cell extract, etc., carbohydrate, Ab, anti-id Ab all +/- conventional adjuvant (Freund's complete adjuvant,
- tumor cells can be from the same patient (autologous) or a cell line(s) from different patients (allogeneic) infect with rRDV-GM-CSF - infect with rRDV-GM-CSF + r vector-B7 infect with rRDV-GM-CSF + r vector-TRICOM infect with rRDN-GM-CSF + r vector-IF ⁇ (gamma or alpha) infect with rRDV-GM-CSF + r vector-any cytokine
- Recombinant Replication Defective Virus Encoding GM-CSF rRDV-GM-CSF Table 2 (CON'D) Uses of the Recombinant Replication-Defective Virus Encoding GM-CSF
- DC Dendritic Cells
- the present invention provides methods of enhancing immune responses using a recombinant replication-defective virus encoding GM-CSF for recruitment of antigen presenting cells into an injection site. Moreover, the method provides enrichment of regional lymph nodes with antigen presenting cells. The methods of the present invention provides enhancement of immune responses to a target antigen or epitope thereof.
- the present invention also encompasses methods of treatment or prevention of a disease caused by pathogenic microorganisms or by cancer using a recombinant replication-defective virus encoding GM-CSF alone or in combination with an antigen source.
- the administration of the recombinant vector of the invention may be for either "prophylactic" or "therapeutic" purpose.
- the recombinant replication-defective virus encoding GM-CSF of the present invention is provided in advance of any symptom alone or prior to concurrently or preceding the administration of an antigen source.
- the prophylactic administration of the recombinant vector serves to prevent or ameliorate any subsequent infection or disease.
- the recombinant replication-defective virus encoding GM- CSF is provided at or after the onset of a symptom of infection or disease.
- the present invention may be provided either prior to the anticipated exposure to a disease-causing agent or disease state or after the initiation of the infection or disease.
- unit dose refers to physically discrete units suitable as unitary dosages for mammals, each unit containing a predetermined quantity of recombinant vector calculated to produce the desired adjuvant and immunogenic effect in association with the required diluent.
- the specifications for the novel unit dose of an inoculum of this invention are dictated by and are dependent upon the unique characteristics of the recombinant replication-defective virus encoding GM-CSF and the particular adjuvant and immunologic effect to be achieved.
- the inoculum is typically prepared as a solution in tolerable (acceptable) diluent such as saline, phosphate-buffered saline or other physiologically tolerable diluent and the like to form an aqueous pharmaceutical composition.
- tolerable (acceptable) diluent such as saline, phosphate-buffered saline or other physiologically tolerable diluent and the like to form an aqueous pharmaceutical composition.
- the route of inoculation may be scarification, intravenous (IN.), intramuscular (I.M.), subcutaneous (S.C), intradermal (I.D.), intraperitoneal (IP.), intratumor, topical, intranodal, intranasal, intraarterial, intravesical, and the like, which results in migration of APC into the injection site and regional lymph nodes and upregulation of APC functions to enhance an immune response against the disease causing agent.
- the dose is administered at least once. Subsequent doses may be administered as indicated.
- the host is immunized at least once with a recombinant replication-defective virus encoding GM-CSF to elicit optimal concentration of APCs at a target site. Subsequent immunizations are provided with one or more antigens or epitopes sources.
- the host is first immunized with an antigen source such as proteins, peptides, polysaccharides, lipids, lipoproteins, lipopolysaccharides, antibodies, anti-idiotypic antibodies, cells, cell fragments, cell extracts, apoptotic bodies, attenuated or inactivated virus and the like, followed by administration of a recombinant replication- defective virus encoding GM-CSF.
- the recombinant replication-defective virus encoding GM-CSF is administered concurrently with an antigen or epitope source.
- a conventional adjuvant may optionally be provided.
- the host is immunized at least one with a recombinant replication-defective virus encoding GM-CSF as a primary dose.
- Boosting doses may comprise any recombinant vector encoding GM-CSF, preferably a recombinant virus encoding GM-CSF.
- the second recombinant vector encoding GM-CSF may be replication-competent or replication-defective.
- the priming dose is provided by replication-defective recombinant avipox virus encoding GM-CSF followed by a boosting dose of replication-competent recombinant vaccinia virus encoding GM-CSF.
- a replication-competent vector encoding GM-CSF may be provided as a priming dose, followed by one or more injections of a replication-defective virus encoding GM-CSF.
- the vectors may also provide a gene encoding one or more antigens, with or without a gene encoding one or more immunostimulatory molecules.
- the recombinant replication-defective virus encoding GM-CSF may be provided in combination with a vaccine including but not limited to the standard childhood vaccines such as Diphtheria-Tetanus-Pertusis (DPT), Tetanus-Diphtheria (Td), DtaP, Haemophilus influenza type b (Hib) vaccine, DTaP-Hib vaccine, DTaP-IP V-Hib vaccine, mumps-measles-rubella (MMR) vaccine, as well as vaccines such as Hepatitis A vaccine, Hepatitis B vaccine, Lyme's disease vaccine, influenza vaccine, meningococcal polysaccharide (tetravalent A, C, W135 and Y), pneumococcal polysaccharide vaccine (23 valent), anthrax vaccine, cholera vaccine, plague vaccine, yellow fever vaccine, Bacillus Calmette-Guerin vaccine and the like.
- a vaccine including but not limited to the standard childhood vaccines
- the dosage of administered recombinant vector will vary depending upon such factors as the mammal's age, weight, height, sex, general medical condition, previous medical history, disease progression, tumor burden and the like. In general, it is desirable to provide the recipient with a dosage of recombinant replication-defective virus encoding GM-CSF in the range of about 10 5 to about 10 10 plaque forming units per mammal, preferably a human, although a lower or higher dose may be administered.
- the genetic definition of tumor-associated and tumor-specific antigens allows for the development of targeted antigen-specific vaccines for cancer therapy.
- the recombinant replication-defective viruses encoding GM-CSF in combination with a recombinant vector encoding a tumor associated or tumor specific antigen is a powerful system to elicit a specific immune response in terms of prevention in individuals with an increased risk of cancer development (preventive immunization), to shrink tumors prior to surgery, to prevent disease recurrence after primary surgery (anti-metastatic vaccination), or to expand the number of cytotoxic lymphocytes (CTL) in vivo, thus improving their effectiveness in eradication of diffuse tumors (treatment of established disease).
- CTL cytotoxic lymphocytes
- Autologous lymphocytes either cytotoxic T lymphocytes and/or CD4 helper T cells or NK cells may be generated ex vivo to a particular tumor antigen and transferred back to the tumor bearing patient (adoptive immunotherapy) in combination with the recombinant replication-defective virus encoding GM-CSF, along with a tumor antigen source.
- an antigen source such as a recombinant vector comprising a nucleic acid sequence encoding a target antigen or immunological epitope thereof may additionally comprise genes encoding one or multiple costimulatory molecules, preferably B7 or B7/TCAM-1/LFA-3.
- the target antigen or immunological epitope thereof may be provided by a host cell infected with the recombinant vector as or a tumor cell endogenously expressing a tumor associated antigen or epitope thereof.
- a tumor associated antigen is absent, not expressed or expressed at low levels in a host cell
- a foreign gene encoding an exogenous tumor associated antigen may be provided.
- genes encoding several different tumor associated antigens may be provided.
- the quantity of recombinant vector encoding one or more tumor associated antigens (TAAs) and optionally encoding multiple costimulatory molecules in conjunction with a recombinant replication-defective virus encoding GM-CSF to be administered is based on the titer of virus particles.
- a preferred range of the immunogen to be administered is 10 5 to 10 10 virus particles per mammal, preferably a human. If the mammal to be immunized is already afflicted with cancer or metastatic cancer, the vaccine can be administered in conjunction with other therapeutic treatments.
- the recombinant replication-defective virus, itself may encode one or more TAAs, along with encoding GM- CSF.
- recombinant replication-defective virus encoding GM-CSF is administered in vivo to a patient with cancer and autologous cytotoxic lymphocytes or tumor infiltrating lymphocytes may be obtained from blood, lymph nodes, tumor and the like.
- the lymphocytes are grown in culture and target antigen-specific lymphocytes are expanded by culturing in the presence of specific target antigen and either antigen presenting cells or target antigen pulsed APCs.
- the target antigen-specific lymphocytes are then reinfused back into the patient.
- the efficacy of the vaccine can be assessed by production of antibodies or immune cells that recognize the antigen, as assessed by specific lytic activity or specific cytokine production or by tumor regression.
- One skilled in the art would know the conventional methods to assess the aforementioned parameters.
- mammals are immunized with recombinant replication- defective virus encoding GM-CSF in combination with an rF- or rV-HIV-1 epitope/B7- 1/IC AM- l/LFA-3 construct.
- the efficacy of the treatment may be monitored in vitro and/or in vivo by determining target antigen-specific lymphoproliferation, target antigen-specific cytolytic response, cytokine production, clinical responses and the like.
- the method of enhancing antigen-specific T-cell responses may be used for any target antigen or immunological epitope thereof.
- target antigen or immunological epitope thereof Of particular interest are tumor associated antigens, tissue specific antigens and antigens of infectious agents.
- exogenous immunomodulators or immunostimulatory molecules include exogenous IL-2, IL-6, alpha-, beta- or garnma-interferon, tumor necrosis factor, Flt-3L, cyclophosphamide, cisplatinum, gancyclovir, amphotericin B, 5 fluorouracil, leucovorin, CPT-11, and the like, and combinations thereof.
- avipox avian poxviruses
- F fowlpox
- AVAC canarypox
- Changes in the regional lymph nodes were compared with the administration of 4 daily doses of recGM- CSF.
- Time-course studies showed that the cellular/phenotypic and functional changes occurring within the regional nodes of mice injected with a recombinant avipox-GM-CSF virus were sustained for 21-28 days. Moreover, upon repeated injections (3x) of the avipox-GM-CSF recombinant virus, the total number of class II-expressing lymph node cells was increased after each injection, despite the presence of anti-avipox antibody titers in the mice sera.
- the present invention also examined whether GM-CSF administered in a recombinant avipox virus or as a recombinant protein could function as a biological adjuvant in a vaccine protocol designed to generate host immunity to a self, tumor antigen.
- the self, tumor antigen was CEA, a M r l 80,000-200,000 glycoprotein, whose overexpression on a large percentage of human adenocarcinomas (colon, pancreatic, breast, lung) has made it an attractive target for immunotherapy (26, 27). Since no CEA homologue has been identified in rodents, mice expressing human CEA as a transgene (28-30) are being used to study different vaccine strategies (31). In the present invention, avipox-CEA immunized CEA.Tg mice developed CEA-specific cellular immunity which could be enhanced by the addition of GM-CSF either as a recombinant avipox virus or recombinant protein.
- the recombinant replication-defective virus encoding GM-CSF of the present invention are useful in methods of stimulating an enhanced humoral response both in vivo and in vitro. Such an enhanced humoral response may be monoclonal or polyclonal in nature.
- the enhancement of a humoral response may be determined by increased activation, proliferation and/or cytokine secretion by CD4 + T cells, increased proliferation or antibody production by B cells, increased antibody dependent cellular toxicity (ADCC), increased complement-mediated lysis, and the like.
- Antibody elicited using the recombinant replication-defective virus encoding GM-CSF of the present invention are expected to be higher affinity and/or avidity and higher titer than antibody elicited by standard methods.
- the antibody elicited by methods using the recombinant replication- defective virus encoding GM-CSF may recognize immunodominant target epitopes or nondominant target epitopes.
- This invention further comprises an antibody or antibodies elicited by immunization with the recombinant replication-defective virus encoding GM-CSF in combination with an antigen source of the present invention.
- the antibody has specificity for and reacts or binds with the target antigen or immunological epitope thereof of interest.
- the antibodies are monoclonal or polyclonal in origin.
- Exemplary antibody molecules are intact immmioglobulin molecules, substantially intact immunoglobulin molecules or those portions of an immunoglobulin molecule that contain the antigen binding site, including those portions of immunoglobulin molecules known in the art as F(ab), F(ab ), F(ab 7 ) 2 and F(v).
- Polyclonal or monoclonal antibodies may be produced by methods known in the art. (Kohler and Milstein (1975) Nature 256, 495-497; Campbell “Monoclonal Antibody Technology, the Production and Characterization of Rodent and Human Hybridomas” in Burdon et al. (eds.) (1985) "Laboratory Techniques in Biochemistry and Molecular Biology," Volume 13, Elsevier Science Publishers, Amsterdam).
- the antibodies or antigen binding fragments may also be produced by genetic engineering.
- the technology for expression of both heavy and light chain genes in E. coli is the subject of the PCT patent applications: publication number WO 901443, WO 901443 and WO 9014424 and in Huse et al. (1989) Science 246:1275-1281.
- the antibodies of this invention are used in immunoassays to detect the novel antigen of interest in biological samples.
- the antibodies of this invention generated by immunization with a recombinant replication-defective virus encoding GM-CSF in combination with a recombinant virus expressing a TAA and expressing B7-1, ICAM-1 and LFA-3 are used to assess the presence of the a TAA from a tissue biopsy of a mammal afflicted with a cancer expressing TAA using immunocytochemistry. Such assessment of the delineation of the a TAA antigen in diseased tissue can be used to prognose the progression of the disease in a mammal afflicted with the disease or the efficacy of immunotherapy.
- examples of TAAs include but are not limited to CEA, PSA, and MUC-1.
- the antibodies of the present invention are used for immunotherapy.
- the antibodies of the present invention may be used in passive immunotherapy.
- the dosage of administered antibodies or antigen binding fragments will vary depending upon such factors as the mammal's age, weight, height, sex, general medical condition, previous medical condition and the like.
- the antibodies or antigen-binding fragments of the present invention are intended to be provided to the recipient subject in an amount sufficient to prevent, lessen or attenuate the severity, extent or duration of the disease or infection.
- Anti-idiotypic antibodies arise normally during the course of immune responses, and a portion of the anti-idiotype antibody resembles the epitope that induced the original immune response.
- the immunoglobulin gene or portion thereof of an antibody whose binding site reflects a target antigen of a disease state is incorporated into the genome or portion thereof of a virus genome, alone or in combination with a gene or portion thereof of multiple immunostimulatory molecules, the resulting recombinant virus is able to elicit enhanced cellular and humoral immune response to the antigen used in combination with a recombinant replication-defective virus encoding GM- CSF.
- the present invention provides for host cells infected with the recombinant replication-defective virus encoding GM-CSF and expressing the GM-CSF into the surrounding mileau.
- the host cells may also express one or more endogenous target antigens or immunological epitopes thereof or may be engineered to express one or more exogenous, foreign target antigens or immunological epitopes thereof which may be provided by a second recombinant vector.
- the recombinant vector encoding one or more target antigens or immunological epitopes thereof may also have foreign nucleic acid sequences encoding one or more costimulatory molecules and/or cytokines.
- the host cells of the present invention included but are not limited to tumor cells, antigen presenting cells, such as PBMC, dendritic cells, cells of the skin or muscle, and the like.
- Antigen presenting cells include, but are not limited to, monocytes, macrophages, dendritic cells, progenitor dendritic cells, Langerhans cells, splenocytes, B- cells, tumor cells, muscle cells, epithelial cells and the like.
- the host cells are tumor cells in which the tumor cells are exposed to the recombinant replication-defective virus encoding GM-CSF in situ or in vitro to cause expression and secretion of GM-CSF by the tumor cells.
- the tumor cells may express an endogenous target antigen or the tumor cells may be further genetically engineered using a recombinant vector to express a target antigen such as TAA or immunological epitope thereof, and optionally to express one or more immunostimulatory molecules.
- Tumor cells expressing GM-CSF provided by the recombinant replication- defective virus along with an endogenous or exogenously provided TAA, and optionally expressing one with multiple immunostimulatory molecules are administered to a mammal in an effective amount to result in tumor reduction or elimination in the mammal afflicted with a cancer.
- the recombinant replication-defective virus encoding GM-CSF is directly injected into a tumor in situ such as in melanoma or metastatic breast cancer skin lesions.
- the recombinant replication-defective virus encoding GM-CSF may also be administered in situ during the time of surgery for cancers such as colorectal and pancreatic cancers.
- a vector encoding one or more immunostimulatory molecules may be provided for enhanced anti-tumor response.
- the vector is a recombinant avipox encoding B7.1 or recombinant avipox encoding B7.1/LFA-3/ICAM- 1.
- the recombinant replication-defective virus encoding GM-CSF is provided in combination with a cytokine such as IL-12 or a vector encoding IL-12.
- the recombinant replication-defective virus encoding GM-CSF is provided by infra-lymph node injection.
- the lymph node site may be either distal to or draining a tumor site.
- the recombinant replication-defective virus encoding GM-CSF may be provided alone, or in combination with an target antigen or immunological epitope thereof, or a recombinant vector encoding a target antigen or immunological epitope thereof.
- the recombinant vector encoding a target antigen or immunological epitope thereof may further encode one or more immunostimulatory molecules.
- the combination thereapy comprises recombinant replication-defective virus encoding GM-CSF and a recombinant vector encoding a target antigen or immunological epitope thereof and further encoding the costimulatory molecule B7.1.
- a recombinant vector encoding a target antigen or immunological epitope thereof and further encoding B7.1/LFA-3/ICAM-1 is provided intranodally in combination with the recombinant replication-defective virus encoding GM- CSF.
- Tumor cells may also be infected ex vivo using the recombinant replication- defective virus encoding GM-CSF, alone, or in combination with a recombinant vector encoding at least one or more immunostimulatory molecules for use as a vaccine.
- the recombinant vector is a recombinat avipox encoding B7.1.
- the recombinant vector encodes B7.1/LFA-3/ICAM-1.
- the recombinant vector encodes a cytokine such as gamma or alpha interferon.
- the tumor cells may be from the same patient (autologous) or a cell line(s) from different patients (allogeneic).
- Administration of the tumor cells of the present invention provide an anti- tumor immune response to an individual.
- the tumor cells may be provided subcutaneously, intradermally, intravenously, and the like.
- the present invention also provides progenitor dendritic cells, dendritic cells (DC), DC subpopulations, and derivatives thereof expressing GM-CSF in which the GM- CSF is exogenously provided by a recombinant replication-defective virus having nucleic acid sequences encoding GM-CSF.
- the APCs such as progenitor dendritic cells and dendritic cells may also express one or more endogenous target antigens or immunological epitopes thereof or exogenous target antigens may be provided by a recombinant vector.
- the recombinant vector may additionally encode one or more costimulatory molecules.
- the dendritic cells are infected with a replication-defective virus encoding- GM-CSF and a recombinant vector encoding at least one target antigen.
- the dendritic cells are infected with a replication-defective virus encoding- GM-CSF and with a recombinant avipox encoding at least one target antigen and encoding B7.1.
- the dendritic cells are infected with a replication- defective virus encoding GM-CSF and a recombinant avipox encoding target antigen and encoding B7.1/LFA-3/ICAM-1.
- the present invention further provides methods of using the APCs, in activating T cells in vivo or in vitro for vaccination and immunotherapeutic responses against one or more target cells, target antigens and immunological epitopes thereof.
- the APCs such as progenitor dendritic cells, dendritic cells, DC subpopulations and derivatives thereof isolated from a source infected with a recombinant replication-defective virus encoding GM-CSF, alone or in combination with a recombinant vector encoding B7 or B7/LFA-3/ICAM-1 may also be pulsed or incubated with at least one peptide, protein, antibody, target cell, target cell lysate, cell extract, target cell membrane, apoptotic bodies, target antigen, or immunological epitope thereof, or with RNA or DNA of at least one target cell and administered to a species in an amount sufficient to activate the relevant T cell responses in vivo.
- Host cells may be provided in a dose of 10 to 10 cells.
- Routes of administration that may be used include intravenous, subcutaneous, intralymphatic, intratumoral, intradermal, intramuscular, intraperitoneal, intrarectal, intravaginal, intranasal, oral, via bladder instillation, via scarification, and the like.
- the GM-CSF expressing antigen presenting progenitor dendritic cells or dendritic cells are exposed to a target cell, target cell lysates, target cell membranes, target antigen or immunological epitope thereof or with DNA or RNA from at least one target cell in vitro and incubated with primed or unprimed T cells to activate the relevant T cell responses in vitro.
- the activated T cells alone or in combination with the progenitor DC or DC are then administered to a species such as a human for vaccination or immunotherapy against a target cell, target antigen or immunological epitope thereof.
- a species such as a human for vaccination or immunotherapy against a target cell, target antigen or immunological epitope thereof.
- the progenitor dendritic cells or dendritic cells are advantageously used to elicit an immunotherapeutic growth inhibiting response against cancer cells.
- the GM-CSF expressing antigen-presenting cell preferably a precursor DC or DC is fused with a target cell expressing a relevant target antigen or immunological epitope thereof to form a heterokaryon of APC and target cell by methods known in the art (Gong, J. et al Proc. Natl. Acad. Sci. USA 95:6279-6283, 1998).
- a fusion cell or chimeric APC/target antigen cell expresses both GM-CSF and target antigen or immunological epitopes thereof.
- the APC may also be infected with a recombinant vector encoding at least one costimulatory molecule, preferably encoding B7.1 or B7.1/LFA-3/ICAM-1.
- the target cell is a hyperplastic cell, premalignant or malignant cell.
- the chimeric APC/target antigen cell may be used both in vivo and in vitro to enhance immune responses of T and B lymphocytes.
- Progenitor dendritic cells are obtained from bone marrow, peripheral blood and lymph nodes from a patient. The patient may have been previously vaccinated, or treated with a compound such as Flt-3L to enhance the number of antigen-presenting cells.
- Dendritic cells are obtained from any tissue such as the epidermis of the skin (Langerhans cells) and lymphoid tissues such as found in the spleen, bone marrow, lymph nodes, and thymus as well as the circulatory system including blood and lymph (veiled cells).
- Cord blood is another source of dendritic cells.
- Dendritic cells may be enriched or isolated for use in the present invention using methods known in the art such as those described in U.S. Patent No. 5,788,963.
- the progenitor dendritic cells, dendritic cells and derivatives thereof are obtained, they are cultured under appropriate culture conditions to expand the cell population and/or maintain the cells in a state for optimal infection, transfection or transduction by a recombinant vector and for optimal target antigen uptake, processing and presentation.
- Particularly advantageous for maintenance of the proper state of maturity of dendritic cells in in vitro culture is the presence of both the granulocyte/macrophage colony stimulating factor (GM- CSF) and interleukin 4 (IL-4).
- GM- CSF granulocyte/macrophage colony stimulating factor
- IL-4 interleukin 4
- Subpopulations of dendritic cells may be isolated based in adherence and/or degree of maturity based on cell surface markers.
- the phenotype of the progenitor DC, DC and subpopulations thereof are disclosed in Banchereau and Steinman Nature 392:245-252. 1998.
- GM-CSF and IL-4 are each provided in a concentration of about 500 units/ml for a period of about 6 days.
- TNF ⁇ and/or CD40 is used to cause precursor DC or DC to mature.
- the progenitor dendritic cells or dendritic cells may be obtained from the individual to be treated and as such are autologous in terms of relevant HLA antigens or the cells may be obtained from an individual whose relevant HLA antigens (both class I and II, e.g. HLA- A, B, C and DR) match the individual that is to be treated.
- the progenitor dendritic cell is engineered to express the appropriate, relevant HLA antigens of the individual receiving treatment.
- the progenitor dendritic cells and dendritic cells may be further genetically modified to extend their lifespan by such methods as EBV-fransformation as disclosed in U.S. Patent No. 5,788,963.
- the dendritic cells and precursors thereof may be provided in the form of a pharmaceutical composition in a physiologically acceptable medium.
- the composition may further comprise a target cell, target cell lysate, target cell membrane, target antigen or immunological epitope thereof.
- the composition may additionally comprise cytokines and/or chemokines such as IL-4 and GM-CSF for additional synergistic enhancement of an immune response.
- neutropenia is the medical term for an abnormally low number of neutrophils in the circulating blood.
- neutropenia There are many potential causes of neutropenia which include: bone marrow damage from certain types of leukemias, lymphomas or metastatic cancers; an adverse reaction to a medication such as a diuretic or anti-depressant; response to radiation treatment or chemotherapy; the presence of an indwelling IN.
- a viral infection such as infectious mononucleosis or HIN infection
- a bacterial infection such as tuberculosis, an autoimmune disease such as systemic lupus erythematosus, congenital defects; impaired phagocytic, microbial and tumoricidal function of neutrophils, monocytes and macrophages; malnutrition; neoplastic obstruction of respiratory, digestive or urinary tracts complicated by secondary infections.
- Individuals with neutropenia get infections easily and often. Most of the infections occur in the lungs, mouth and throat (mucositosis), sinuses and skin. Painful mouth ulcers, gum infections, ear infections and peridontal disease are common.
- the recombinant replication-defective virus encoding GM-CSF is useful in methods of preventing or treating neutropenia.
- the replication-defective virus encoding GM-CSF provides a quick and sustained concentration of GM-CSF, superior to administration of naturally-derived or recombinantly produce GM-CSF (Mangi, M.H. and Newland, A.C. 1999, European J. of Cancer. Vol. 35; Suppl. 3, pp. S4-S7).
- the recombinant replication-defective virus encoding GM-CSF may be provided prior to (prophylactic) or after the development of neutropenia.
- a dose is administered in an amount effective to increase the numbers of neutrophils, preferably to increase the number of neutrophils to within a normal range.
- the dose may be provided one or more times.
- the recombinant replication-defective virus encoding GM-CSF may be provided alone, or in combination with another therapy such as an antibiotic, antifungal, antiviral, and the like for treatment of infections.
- Another therapy such as an antibiotic, antifungal, antiviral, and the like for treatment of infections.
- antibiotics which may be included in a composition with the recombinant replication-defective virus encoding GM- CSF include but are not limited to ceftazidime, cefepime, imipenem, aminoglycoside, vancomycin, antipseudomonal ⁇ -lactam, and the like.
- One or more antifungal which may be included in a composition with the recombinant replication-defective virus encoding GM-CSF include but are not limited to amphotericin B, dapsone, fluconazole, flucytosine, griseofluvin, intraconazole, ketoconazole, miconazole, clotrimazole, nystatin, combinations thereof and the like.
- One or more antiviral agents may be included in a composition with the recombinant replication-defective virus encoding GM-CSF and include but are not limited to 2'-beta-fluoro-2',3'-dideoxyadenosine, indinavir, nelfinavir, ritonavir, nevirapine, AZT, ddl, ddC, combinations thereof and the like.
- the recombinant replication-defective virus encoding GM- CSF may be provided prior to the initiation of the irradiation, chemotherapy or corticosteroid therapy, concurrently with the therapy, or the recombinant replication- defective virus encoding GM-CSF may be provided after the irradiation, chemotherapeutic or corticosteriod treatment.
- the dose of the recombinant replication-defective virus encoding GM-CSF is provided in an amount to maintain normal numbers of neutrophils in the blood or to increase the number of neutrophils to prevent or inhibit neutropenia and its sequelae.
- the composition comprising the recombinant-replication defective virus encoding GM-CSF may also comprise a chemotherapeutic agent, a corticosteriod, or combinations thereof.
- Another aspect of the invention is the use of the recombinant replication- defective virus encoding GM-CSF for the treatment of myeloidysplastic syndromes and cytopenias associated with myeloidysplastic syndromes in combination with erythropoietin (EPO) or preferably recombinant erythropoietin (rhEPO).
- EPO erythropoietin
- rhEPO recombinant erythropoietin
- Myelodysplastic syndromes are a group of clonal stem cell disorders characterized by abnormal bone marrow differentiation and maturation, with quantitative as well as qualitative abnormalities within one or more haemopoietic cell lineages in the peripheral blood. The standard treatment for these individuals has been supportive care with blood products, antibiotics, and allogeneic bone marrow transplantation in selected younger individuals.
- recombinant GM-CSF recombinant GM-CSF
- erythropoietin recombinant GM-CSF
- rhGM-CSF recombinant replication-defective virus encoding GM-CSF is used in place of rec GM-CSF, in combination with EPO, for treatment of cytopenia associated with MDS.
- the recombinant replication-defective virus encoding GM-CSF is administered at a dose in the range of about 10 5 to about 10 10 pfu and provided once or at multiple intervals.
- the EPO is administered at a dose in the range of about 150-300 u/kg body weight and is provided at multiple intervals.
- the combined dose is effective in preventing or treating neutropenia, increase haemoglobin levels and/or reduce blood transfusion needs of the individual with MDS.
- the use of replication-defective virus encoding GM-CSF at weekly or monthly injections alleviates the need to administer recombinant GM-CSF protein daily.
- GM-CSF has been shown to be useful as an adjuvant for immunotherapy with bispecific antibodies in cancer patients. (Elsasser, D. et al European J. Cancer. Vol. 35, Suppl. 3, pp. S25-S28, 1999).
- recombinant replication- defective virus encoding GM-CSF replaces GM-CSF for a superior adjuvant effect in combination with a bispecific antibody alleviating the need to administer recombinant GM- CSF protein daily.
- Bispecific antibodies are chemically or genetically-constructed molecules that combine specificity for the tumor cell antigen/epitope with reactivity for cytotoxic trigger molecules found on immune effector cells.
- the recombinant replication- defective virus encoding GM-CSF is provided in a dose range of about 10 5 to about 10 10 pfu at multiple intervals.
- a bispecific antibody is provided in a dose of about 0.2-200 mg/m at multiple intervals such as weekly, monthly and the like.
- the criteria for enhanced immunotherpeutic response includes specific lytic activity, specific cytokine production, antibody-mediated cellular cytotoxicity, tumor regression, protection from tumor.
- Bispecific antibodies which may be used in combination with the recombinant replication- defective virus encoding GM-CSF include but are not limited to Fc ⁇ RI (CD64), Fc ⁇ RII (CD32), Fc ⁇ RIII (CD 16), anti-CD3 -directed bispecific antibodies with tumor-directed specificities for HER-2/neu, EGF-receptor, CD 15 antigen or the EpCAM molecule.
- Fc ⁇ RI CD64
- Fc ⁇ RII CD32
- Fc ⁇ RIII CD 16
- anti-CD3 -directed bispecific antibodies with tumor-directed specificities for HER-2/neu, EGF-receptor, CD 15 antigen or the EpCAM molecule.
- Example 1 Generation of Recombinant Viruses The generation of recombinant poxviruses is accomplished via homologous recombination in vivo between poxvirus genomic DNA and a plasmid vector that carries the heterologous sequences to be inserted. Plasmid vectors for the insertion of foreign sequences into poxviruses are constructed by standard methods of recombinant DNA technology (Sambrook et al 1989). The plasmid vectors contain one or more chimeric genes, each comprising a poxvirus promoter linked to a protein coding sequence, flanked by viral sequences from a non-essential region of the poxvirus genome.
- the plasmid is transfected into cells infected with the parental poxvirus, and recombination between poxvirus sequences on the plasmid and the corresponding DNA in the viral genome results in the insertion into the viral genome of the chimeric genes on the plasmid.
- Recombinant viruses are selected and purified using any of a variety of selection or screening systems (Mazzara et al, 1993; Jenkins et al, 1991; Sutter et al, 1994), several of which are described below. Insertion of the foreign genes into the vaccinia genome is confirmed by polymerase chain reaction (PCR) analysis. Expression of the foreign genes is demonstrated by Western analysis.
- the parental fowlpox virus used for the generation of recombinants was plaque-purified from a vial of USDA-licensed poultry vaccine, POXVAC-TC, which is manufactured by Schering-Plough Corporation.
- the starting material for the production of POXVAC-TC was a vial of Vineland Laboratories' chicken embryo origin Fowl Pox vaccine, obtained by Schering-Plough.
- the virus was passaged twice on the chorioallantoic membrane of chicken eggs to produce a master seed virus.
- the master seed virus was passaged 27 additional times in chicken embryo fibroblasts to prepare the POXVAC-TC master seed.
- POXVAC-TC master seed was passaged twice on chicken embryo fibroblasts.
- the virus is the New York City Board of Health strain and was obtained by Wyeth from the New York City Board of Health and passaged in calves to create the Smallpox Vaccine Seed.
- Flow Laboratories received a lyophilized vial of the Smallpox Vaccine Seed, Lot 3197, Passage 28 from Drs. Chanock and Moss (National Institutes of Health). This seed virus was ether-treated and plaque-purified three times.
- VMA Modified Vaccinia Virus Ankara
- Parental Virus MVA was derived from the Ankara vaccinia strain CVA (Mayr et al, 1975). Virus attenuation was carried out by terminal dilution in chick embryo fibroblasts (CEFs). After 360 passages, the virus was plaque-purified three times and then further passaged in CEFs. At passage 516, the attenuated CVA virus was renamed MVA. After 570 passages, the virus was again plaque-purified and further passaged. Seed virus passage 575 was obtained from Dr. Anton Mayr and was plaque-purified twice on primary chick embryo dermal cells.
- a plasmid vector designated pT5091 (Fig. 1), was constructed to direct insertion of the foreign sequences into the BamHI J region of the fowlpox genome.
- the murine GM-CSF gene is under the control of the vaccinia 40K promoter (Gritz et al, 1990).
- the E. coli lacZ gene under the control of the fowlpox virus Cl promoter (Jenkins et al, 1991), is included as a screen for recombinant progeny.
- These foreign sequences are flanked by DNA sequences from the BamHI J region of the fowlpox genome.
- a plaque-purified isolate from the POXVAC-TC strain of fowlpox was used as the parental virus for this recombinant vaccine.
- the generation of recombinant fowlpox virus was accomplished via homologous recombination between fowlpox sequences in the fowlpox genome and the corresponding sequences in pT5091 in fowlpox-infected primary chick embryo dermal cells transfected with pT5091.
- Recombinant virus was identified using a chromogenic assay, performed on viral plaques in situ, that detects expression of the lacZ gene product in the presence of halogenated indolyl- beta-D-galactoside (Bluo-gal), as described previously (Chakrabarti et al, 1985). Viral plaques expressing lacZ appear blue against a clear background. Positive plaques, designated vT277 (Fig. 4A), were picked from the cell monolayer and their progeny were replated. Four rounds of plaque isolation and replating in the presence of Bluo-Gal resulted in the purification of the desired recombinant.
- a chromogenic assay performed on viral plaques in situ, that detects expression of the lacZ gene product in the presence of halogenated indolyl- beta-D-galactoside (Bluo-gal), as described previously (Chakrabarti et al, 1985). Viral plaques expressing lacZ appear blue against a clear
- Plasmid vector pT5052 was constructed to direct insertion of the foreign sequences into the BamHI J region of the fowlpox genome.
- Plasmid vector pT5052 was deposited with the American Type Culture Collection, 10801 University Boulevard, Manassas, VA 20110 under the terms of the Budapest Treaty on June 15 , 2000 under Accession No. PTA-2099.
- the human GM-CSF gene is under the control of the vaccinia 40K promoter and the lacZ gene is under the control of the Cl promoter.
- a plaque-purified isolate from the POXVAC-TC (Schering-Plough Corporation) strain of fowlpox was used as the parental virus for this recombinant vaccine.
- the generation of recombinant vaccinia virus was accomplished via homologous recombination between fowlpox sequences in the fowlpox genome and the corresponding sequences in pT5052 in fowlpox-infected primary chick embryo dermal cells transfected with pT5052.
- Recombinant virus was identified using the chromogenic assay for the lacZ gene product described above. Viral plaques expressing lacZ appear blue against a clear background. Positive plaques, designated vT215 (Fig. 4B), were picked from the cell monolayer and their progeny were replated. Five rounds of plaque isolation and replating in the presence of Bluo-Gal resulted in the purification of the desired recombinant.
- a plasmid vector is constructed to direct insertion of the foreign sequences into the fowlpox virus genome.
- the TAA gene and GM-CSF gene are under the control of a multiplicity of promoters. These foreign sequences are flanked by DNA sequences from the fowlpox virus genome into which the foreign sequences are to be inserted.
- the generation of recombinant fowlpox virus is accomplished via homologous recombination between fowlpox virus sequences in the fowlpox virus genome and the corresponding sequences in the plasmid vector in fowlpox virus-infected cells transfected with the plasmid vector.
- Recombinant plaques are picked from the cell monolayer under selective conditions, as described above, and their progeny are further propagated. Additional rounds of plaque isolation and replating result in the purification of the desired recombinant virus (Fig. 5 A).
- a plasmid vector was constructed to direct insertion of the foreign sequences into the M2L (3 OK) gene, which is located in the Hind III M region of the vaccinia genome.
- the murine GM-CSF gene is under the transcriptional control of the vaccinia 40K promoter and the lacZ gene is under the control of the Cl promoter.
- These foreign sequences are flanked by DNA sequences from the Hind III M region of the vaccinia genome.
- a plaque-purified isolate from the Wyeth (New York City Board of Health) strain of vaccinia was used as the parental virus for this recombinant vaccine.
- recombinant vaccinia virus was accomplished via homologous recombination between vaccinia sequences in the Wyeth vaccinia genome and the corresponding sequences in the plasmid vector in vaccinia-infected cells transfected with the plasmid vector.
- Recombinant virus was identified using the chromogenic assay for the lacZ gene product described above. Viral plaques expressing lacZ appeared blue against a clear background. Several rounds of plaque isolation and replating resulted in the purification of the desired recombinant (Fig. 4C).
- a plasmid vector designated pT5051 (Fig. 3) was constructed to direct insertion of the foreign sequences into the thymidine kinase (TK) gene, which is located in the Hind III J region of the vaccinia genome.
- TK thymidine kinase
- the murine GM-CSF gene is under the transcriptional control of the vaccinia 40K promoter and the E. coli lacZ gene is under the control of the fowlpox virus Cl promoter.
- These foreign sequences are flanked by DNA sequences from the Hind III J region of the vaccinia genome.
- a plaque-purified isolate from the Wyeth (New York City Board of Health) strain of vaccinia is used as the parental virus for this recombinant vaccine.
- the generation of recombinant vaccinia virus is accomplished via homologous recombination between vaccinia sequences in the Wyeth vaccinia genome and the corresponding sequences in pT5051 in vaccinia-infected cells transfected with pT5051.
- Recombinant virus are identified using the chromogenic assay for the lacZ gene product described above. Viral plaques expressing lacZ appear blue against a clear background. Recombinant plaques are picked from the cell monolayer under selective conditions and their progeny are further propagated. Additional rounds of plaque isolation and replating result in the purification of the desired recombinant virus (Fig. 4D).
- a plasmid vector is constructed to direct insertion of the foreign sequences into the vaccinia genome.
- the TAA gene and the GM-CSF gene are under the control of a poxvirus promoter. These foreign sequences are flanked by DNA sequences from the vaccinia genome into which the foreign sequences are to be inserted.
- the generaton of recombinant vaccinia virus is accomplished via homologous recombination between vaccinia sequences in the vaccinia genome and the corresponding sequences in the plasmid vector in vaccinia-infected cells transfected with the plasmid vector.
- Recombinant plaques are picked from the cell monolayer under selective conditions, as described above, and their progeny are further propagated. Additional rounds of plaque isolation and replating result in the purification of the desired recombinant virus (Fig. 5B).
- a plasmid vector is constructed to direct insertion of the foreign sequences into the MVA genome.
- the GM-CSF gene is under the control of a poxviral promoter. These foreign sequences are flanked by DNA sequences from the MVA genome into which the foreign sequences are to be inserted, for example, deletion III (Sutter et al, 1994).
- the generation of recombinant MVA is accomplished via homologous recombination between MVA sequences in the MVA genome and the corresponding sequences in the plasmid vector in MVA-infected cells transfected with the plasmid vector.
- Recombinant plaques are picked from the cell monoloayer under selective conditions and their progeny are further propagated. Additional rounds of plaque isolation and replating result in the purification of the desired recombinant virus (Fig. 4E).
- the genomic structure of a recombinant MVA coexpressing GM-CSF with a tumor-associated antigen (TAA) is shown in Figure 5C.
- TAA tumor-associated antigen
- CEA.Tg mice H-2 (line 2682) were provided by Dr. John Thompson, Institute of Immunobiology, University of Freiburg, Freiburg, Germany (24). A cosmid clone containing the complete coding region of the human CEA gene, including 3.3 kb of the 5'-flanking region and 5 kb of the 3'-flanking region, was used to generate the CEA. Tg mice (30). CEA protein expresison was found predominately in the gastrointestinal tract, whereas other sites, such the trachea, esophagus, small intestine, and lung, also expressed CEA. The mice were housed and maintained in microisolator cages under specific pathogen-free conditions.
- CEA-positive offspring were identified by the presence of fecal CEA detected using a solid-phase, double- determinant anti-CEA ELISA kit (AMDL, Inc. Tustin, CA).
- the CEA-expressing MC-38 cells designated MC-38-CEA-2 (H-2 ), were produced by transducing the human CEA gene using the retroviral expression vector pBNC (32). The line was cloned and routinely examined by flow cytometry for stable CEA expression as measured by COL-1 (33) reactivity. Both the parental MC-38 and MC-38- CEA-2 cell lines were grown in DMEM containing high glucose and 10% heat-inactivated FBS. FDCP-1 cells were kindly provided by Dr. Jim lhle (St.
- GM-CSF Lyophilized recombinant murine GM-CSF was obtained from PeproTech, Inc. (Rock Hill, NJ) and stored at -80°C until use. Prior to use, recGM-CSF was reconstituted to the appropriate concentration with saline containing 1% mouse serum. Reconstituted recGM-CSF was also stored at -20°C and its biological activity was checked every 3-6 months using the GM-CSF-dependent FDCP-1 indicator cells (34).
- the recombinant avian poxviruses used in the study were fowlpox and canarypox (ALNAC) virus-based vectors. To simplify the narrative, they are collectively referred to as recombinant avipox viruses.
- the individual recombinant avipox viruses used to generate the data presented in each Table and Figure are identified as avipox(F)- and avipox(A) for the fowlpox and canarypox (ALNAC) vectors, respectively.
- Avipox(F)-GM-CSF The parental virus used for the generation of rF-GM- CSF (i.e., avipox(F)-GM-CSF) was plaque-purified from a tissue-culture adapted vaccine strain of fowlpox virus. Avipox(F)-GM-CSF was constructed via homologous recombination in vivo between the parental fowlpox D A and a plasmid vector that contains the murine GM-CSF gene. The recombinant virus, produced at Therion Biologies Corp. (Cambridge, MA), was then used to generate a seed stock, which was characterized by genomic and protein expression analysis.
- the parental virus used for the generation of rF-GM- CSF i.e., avipox(F)-GM-CSF
- Avipox(F)-GM-CSF was constructed via homologous recombination in vivo between the parental fowlpox D A and
- Avipox(A)-recombinants Avipox(A) is a canarypox virus-based Vector that is restricted to avian species for productive replication (35).
- the canary pox strain was isolated from a pox lesion on an infected canary and attenuated by 200 serial passages in chick embryo fibroblasts and was subjected to four successive rounds of plaque purification under agarose. All amplifications and plaque titrations were performed on primary chick embryo fibroblasts.
- Avipox(A)-GM-CSF (vCP319), avipox(A)-rabies glycoprotein G (designated avipox(A)-RG, vCP65) and avipox(A)-CEA (vCP248) were kindly supplied by Nirogenetics Corp (Troy, ⁇ Y). GM-CSF expression was confirmed by a bioassay (see below) and CEA expression by Western blot analysis using the murine monoclonal antibody COL-1 (32).
- MC-38 cells were trypsinized and washed twice in serum-free Opti-MEM (Life Technologies Co., Gaithersburg, MD). Four million cells were placed in 15 ml conical polypropylene tubes and pelleted by centrifugation. The cell pellet was resuspended in 300 ⁇ l Opti-MEM to which 10 ⁇ l of either avipox-GM-CSF or appropriate control viruses at the indicated pfu were added. Infected cells were incubated at 37°C for 1 h and agitated every 10-15 min. Following incubation, the cells were washed 2x in 10 ml growth medium supplemented with 10% FBS. Viable cells were counted using trypan blue exclusion, and 3 x 10 5 cells were added per well in 6-well plates. Supernatants were harvested 24, 48 and 72 h later, and the level of biologically active GM-CSF was determined as outlined above.
- mice Female C57BL/6 (B6) mice (H-2 ) were obtained from the National Cancer Institute, Frederick Cancer Research and Development Facility (Frederick, MD). Six- to eight- week-old mice were housed and maintained in microisolator cages under pathogen-free conditions. Recombinant avipox-GM-CSF viruses, appropriate control viruses (i.e., F-WT, avipox-RG) and recombinant GM-CSF protein were administered by s.c. injections at the base of the tail. Subiliac, para-aortic and sacral lymph nodes were surgically isolated, cells mechanically dispersed and transferred to a 50 ml conical tube.
- the cells were allowed to stand on ice for 10 minutes after which the supernatant was removed.
- the cells were pelleted by centrifugation (500 x g) and washed twice in cold Ca -Mg -free DPBS. After the second wash, the cells were resuspended in Ca -Mg free DPBS at a concentration of 0.5-1.0 x 10 6 cells/ml. They were aliquoted and approximately 10 6 cells were incubated with 1 ⁇ g FiTc-labeled anti-I-A b (BALB/c mouse, IgG2a,-k) or appropriate control antibody (PharMingen, Inc., San Diego, CA) for 1 h at 4°C.
- Samples also contained 1 ⁇ g of the unlabeled 2.2G2 antibody (CD 16) to block Fc receptors. After incubation, the cells were washed twice and immediately analyzed using a Becton - Dickinson FACScan equipped with a blue laser with an excitation of 15 mW at 488 nm. Data were gathered from 10,000 cells using a live gate, stored, and used for analysis. Isolation of CDllc + Cells.
- Regional lymph nodes consisting of the subiliac, para-aortic and sacral nodes, were surgically removed and pooled from groups of untreated and treated mice and placed in RPMI-1640 containing 15mM HEPES (pH 7.4 and 10% heat inactivated FBS.
- Cells were mechanically dispersed through a 70- ⁇ m cell stainer, transferred to a 50 ml conical tube and placed on ice. The cell suspensions were washed twice by centrifugation (500 xg) in cold DPBS and incubated at 4°C for 1 h in cold DPBS containing 1.5 ml/10 cells of biotin-anti-CDll c (clone B-ly6, PharMingen, Inc., San Diego, CA).
- the column was rinsed 3x with 3 ml buffer and removed from the magnetic separator, and the MACS + cell fraction was eluted from the column.
- the MACS + cell fraction was enriched with another application to the column and the number of cells in the MACS + fraction was counted using a hemocytometer and by FACS.
- H-2 d purified splenic BALB/c T cells were grown in an RPMI-1640 medium containing 10% heat-inactivated FIBS in the presence of irradiated C57BL/6 (H-2 6 ) lymph node cells (1:1 ratio). After incubation for 5 days @ 37°C in T-25 flasks, viable T cells were recovered from culture by density centrifugation over a Ficoll-Hypaque gradient and used in a unidirectional CTL assay with MC-38 (H-2 ) and P815 (H-2 d ) serving as targets.
- CEA.Tg mice were immunized by s.c. injection of avipox- CEA or avipox-RG in 100 ⁇ l near the base of the tail. Where indicated, recombinant avipox-GM-CSF viruses or recGM-CSF were mixed with avipox-CEA prior to injection. Recombinant GM-CSF protein was subsequently administered to mice daily for 3-4 consecutive days at the immunization site.
- Serum Antibody Responses Serum samples were collected from wild-type B6 as well as CEA.Tg and analyzed for the presence of antibodies to the appropriate target antigen by ELISA. Microtiter plates were sensitized overnight at 4°C with 100 ng/well CEA (International Enzymes, Fallbrook, CA), OVA (Sigma Chemicals), murine recGM-CSF or 5 x 10 5 pfu/well ALVAC. Wells were blocked with PBS containing 5% BSA, followed by a 1 h incubation of diluted mouse serum (1: 10 to 1:31,250). After incubation, excess liquid was aspirated and plates were washed 3-5x with buffer (PBS containing 1% BSA).
- Antibodies bound to the wells were detected with HRP-conjugated goat anti-mouse IgG (Kirkegaard & Perry Labs., Inc., Gaithersburg, MD) or IgM (Jackson hnmunoResearch, West Grove, PA). After a 1 h incubation, the level of reactivity was detected with the addition of chromogen, o-phenylenediamine, for 10 min and read using an ELISA microplate autoreader EL310 (Bio-Tek Instruments, Inc., Winooski, NT) at A4 9 0 n m- Triplicates of positive and negative controls and serum samples were run for all assays.
- Positive controls for CEA and ALVAC were a murine IgG2a anti-CEA MAb, COL-1 (35), and a polyclonal rabbit anti-ALNAC IgG, respectively, which were developed in the laboratory.
- a commercially available rat anti-mouse GM-CSF monoclonal antibody (clone MP1-22E9, PharMingen, Inc., San Diego, CA) was used as a positive control in the anti-GM-CSF ELISA assays.
- Antibody titers were determined as the reciprocal of the serum dilution that results in an A 49 o m n of 0.5.
- T-cell Proliferation Assay Mouse splenocytes were enriched for T cells by magnetic murine pan B (B220) Dynabeads (Dynal, A.S., Oslo, Norway), and FACS analysis showed that the resulting cell population was >95% CD3 + .
- the isolated T lymphocytes were resuspended in RPMI 1640 containing 15 mM HEPES (pH 7.4), 10% heat- inactivated FBS, 2 mM L-glutamine, 0.1 mM non-essential amino acids, 1 mM sodium pyruvate, 50 u/ml gentamicin, and 50 ⁇ M ⁇ -mercaptoethanol.
- the assay consisted of coincubating 5 x 10 5 irradiated splenocytes from nonimmune, syngeneic B6 mice (serving as APC) and 1.5 x l ⁇ ' purified splenic T lymphocytes in the presence of 50 ⁇ g/ml either CEA (Vitro Diagnostics, Littleton, CO), OVA or medium in each well of flat-bottom, 96-well plates. After 5 days in culture, the cells were pulsed with [3H]-thymidine (1 ⁇ Ci/well; Amersham Corp., Arlington Heights, IL) and harvested 24 hr later, and the incorporated radioactivity was measured by liquid scintillation spectroscopy (Wallac, Inc., Gaithersburg, MD).
- splenocytes Twenty-five million splenocytes were added in 10ml to T-25 flasks along with 10 ⁇ g/ml of a CEA 526-533 (EAQNTTYL). T cell cultures were stimulated twice at weekly intervals by harvesting the T cells over a Ficoll-Hypaque gradient to remove dead cells and erythrocytes and incubating 2 x 10 5 T-cells in the presence of 5 x 10 6 irradiated syngeneic splenocytes, 10 ⁇ g CEA5 26-533 /ml and 10 U/ml recombinant human IL-2 (Proleukin, Chiron Corp., Emeryville, CA). Cytolytic activity was assessed following 2 in vitro stimulations using EL-4, a murine lymphoma cell line, pulsed with either CEA 526-533 or Flu NP 366-374.
- CTL activity was assessed by using a modification of a previously described method (36).
- Overnight indium-111 ( m In) release assays were performed. Briefly, 4 X 10 6 EL-4 target cells were radiolabeled with 50 ⁇ Ci in ( ⁇ In)-Oxyquinoline (Amersham, Chicago, IL) for 30 min at 37°C. Peptide-pulsed target cells were incubated with 1 ⁇ g peptide/ml following labeling. Target and effector cells were mixed at the appropriate ratios and incubated for 18 hr at 37°C. The amount of ⁇ ⁇ In released was measured in a gamma counter (Cobra Autogamma, Packard Instruments, Downers Grove, IL) and the percentage of specific lysis was calculated as follows:
- % specific lysis [(experimental cpm - spontaneous cpm)/(maximal cpm - spontaneous cpm)] x 100.
- Lytic units (LU 30 ) indicate the number of effector cells required to obtain 30% lysis of 10,000 peptide-pulsed EL-4 cells. Cytokine Production Assays. The T cell lines were incubated in flat- bottomed, 96-well plates at a cell density of 2 x 10 4 cells/well, 5 x 10 5 irradiated (2000 rad) syngeneic CEA.Tg mouse splenocytes/well and different concentrations of CEA 526-533 peptide.
- mice received the primary immunization of 10 pfu avipox-CEA/RG alone or in combination with 10 pfu avipox-GM- CSF or 20 ⁇ g recGM-CSF in 200 ⁇ l which was divided into 100 ⁇ l and injected s.c. on either side of the tail. RecGM-CSF was administered at the immunization site daily for 4 consecutive days. The immunization was boosted two weeks later at the same site. Tumors were measured 2-3x/week and the volumes calculated as: [(mm, short axis) 2 X (mm, long axis)] 12.
- mice bearing tumors >2 CM 3 were sacrificed for humane reasons and the day of death recorded.
- tumor volumes decrease, presumably due to immunization
- tumor eradication which were defined as a measured decrease in tumor volume and the complete disappearance of tumor, respectively.
- Mice in which the tumors were completely eradicated were challenged with a second s.c. injection of 3 x 10 5 cells MC-38-CEA-2 tumor cells (in 100 ⁇ l) in the opposite flank.
- T-cell proliferation/lysis data were based on Student's two-tailed t test. Differences in the growth rate of the MC-38-CEA- 2 tumors as measured by changes in tumor volume for each treatment group were compared using the Mann- Whitney U test.
- tumor growth in individual CEA.Tg mice was divided into two categories: (i) tumor regression, defined by a measured reduction in tumor volume and (ii) tumor eradication, defined as the inability to measure or palpate tumor at the site of injection. AU ⁇ ? values reported are two-sided and have not been adjusted for the multiplicity of evaluation performed on the data. Ap value of ⁇ .05 was considered significant.
- EXAMPLE 3 GM-CSF Production by Recombinant Avipox Viruses.
- Recombinant avipox viruses expressing murine GM-CSF were generated and their ability to produce GM-CSF in vitro was assessed following infection of MC-38 tumor cells (Fig. 6).
- the recombinant avipox-GM-CSF viruses produced approximately equivalent amounts of GM-CSF (i.e., 225-250 ng/10 6 cells/day) as determined in a bioassay using a GM-CSF-dependent cell line. Infection of the same cells with the same MOI of the control viruses produced no detectable GM-CSF.
- Table 3 Cellular chang es in regional nodes of B6 mice following the administration of avipox-GM-CSF or rGM-CSF 1 a
- HBSS N/A N/A 2.1 ⁇ 0.1 25.4 ⁇ 1.1 320-377 2.4 ⁇ 0.1 28.9 ⁇ 1.5 332-368 avipox(F)-GM-CSF 10 7 piu 1 6.0 ⁇ 0.4 b ' c 44.5 ⁇ 6.2 b ' c 881-998 7.5 ⁇ 0.8' c 36.3 ⁇ 2.2 b ' c 586-797
- mice 20 ⁇ g 4 7.1 ⁇ 0.4 b ' d 39.8 ⁇ 2.1 b,d 844-1020 2.3 ⁇ 0.2 26.1 ⁇ 0.8 344-398 a B6 mice (6-10 mice/group) were injected with the indicated recombinant avipox virus or with rGM-CSF as outlined in the Materials and Methods. Control mice received HBSS. Lymph nodes were removed on days 7 and 21 from the avipox-treated mice, and 24h after the final injection from the rGM-CSF- treated mice. Total number of lymph node cells and class II expression levels were determined. Data are the mean ⁇ SEM from two separate experiments. MFI values are expressed as a range of 4-6 determinations.
- b ⁇ 0.05 [vs control (HBSS-treated) mice].
- mice injected with 10 8 pfu of either of the GM-CSF-expressing recombinant viruses were a selective increase in the percentage of class II-expressing cells in mice treated with the recombinant avipox viruses expressing GM-CSF as compared with the control viruses (Table 3).
- mice treated with the recombinant avipox viruses expressing GM-CSF were compared with the control viruses (Table 3).
- mice usually, 25-29% of the lymph node cells from untreated mice or mice injected with either avipox- WT or avipox-RG express MHC class II antigens.
- mice were injected with 10 7 or 10 8 pfu either recombinant avipox virus or the appropriate control viruses and the total number of class II-expressing cells in the regional lymph nodes were determined at weekly intervals. Elevated levels in the total number of class II + cells/lymph node were observed in mice injected with 10 7 or 10 8 pfu of either recombinant avipox-GM-CSF virus by day 7 (Fig. 7).
- the CDllc7I-Ab + cells were also CD3 ⁇ CD19 " , Terll9 _ , NK1.1 " , CD11 b + , DEC205 + , CD80 + and CD86 + , a cell-surface phenotype profile consistent with that of APC, particularly macrophages and dendritic cells (37).
- Figure 8 summarizes the temporal changes in the APC population in the regional lymph nodes isolated from mice treated with 10 8 pfu of either recombinant avipox-GM-CSF virus or the appropriate control viruses. Approximately 1-2% of lymph node cells from untreated mice were APC as defined by their antigen phenotype.
- mice received 3 monthly injections of avipox-GM-CSF and the regional lymph nodes examined for changes in total class II- expressing cells following each injection. Serum samples were also analyzed for the development of anti-avipox and anti-GM-CSF antibody titers. Seven days after the initial avipox-GM-CSF injection, the absolute number of class II cells was increased approximately 10-fold - from 0.5 to 4.9 x 10 6 /lymph node (Fig. 10A). By day 28, that number had fallen to 1.7 x 10 6 , but after the second injection of avipox-GM-CSF on day 28, rose to 4.8 x 10 6 by day 35.
- a third injection of avipox-GM-CSF was administered on day 56 once again increased the number of class II + cells/node from 2.8 to 5.7 x 10 6 .
- Fig. 10A hrjection of avipox (A)-RG resulted in no observable change in the number of class it lymph node cells.
- Serum samples were taken on days 7, 28, 35, 56, 63 and 84 and analyzed for the presence of anti-avipox and -GM-CSF IgG titers. Measurable anti-avipox antibody titers were observed on days 7 and 28 (Fig. 10B).
- the serum anti-avipox IgG titers were boosted >100,000.
- the third injection of avipox-GM-CSF resulted, in yet, another increase of serum anti-avipox IgG titers to >200,000. No detectable serum anti-GM-CSF IgG titers were found at any of the time points (Fig. 10B).
- CEA Adjuvant Effects Avipox-GM-CSF on Antigen-Specific Immunity.
- CEA. Tg mice were vaccinated twice at monthly intervals with avipox-CEA alone or combined with a either a single injection of avipox-GM-CSF or recGM-CSF administered for 4 consecutive days.
- the presence of anti-CEA IgG serum titers in 60% of the mice vaccinated with avipox-CEA alone or avipox-CEA combined with recGM-CSF Fig. 1 IB and 11C).
- CEA-specific T cell proliferation was measured by [ 3 H]thymidine incorporation following a five- day incubation of splenic T cells isolated from vaccinated CEA.Tg mice.
- CEA-specific T cell proliferation was demonstrated by the inability (i) of OVA to stimulate T cell proliferation and (ii) of splenic T cells isolated from mice immunized with a control avipox virus to proliferate in the presence of soluble CEA (Table 2).
- Table 4 3 H-Thymidine incorporation by splenic T cells isolated from nonimmune and immune CEA.Tg mice.
- mice (2-3/group) were administered 10 8 pfu of avipox(A)-CEA or avipox(A)-RG s.c. (100 ⁇ l) 2x at monthly intervals.
- GM- CSF was administered as a recombinant protein or in a recombinant avipox(A) virus as described in the Materials and Methods.
- mice Four-6 weeks after the second immunization, mice were sacrificed, splenic T cells isolated and pooled according to treatment group, the T cell proliferative responses to soluble CEA, OVA and Con A were measured by 3 H-tymidine incorporation.
- CEA peptide-specific T-Cell Lysis Since repeated attempts to detected primary peptide-specific CTL responses in vaccinated CEA.Tg mice failed (data not shown), splenic T cells were isolated from immune CEA.Tg mice and subsequently stimulated in vitro in the presence of an 8-mer peptide spanning CEA amino acids 526-533 and IL-2. T cell proliferation in response to CEA 526-533 , IL-2 and irradiated APC was observed in those CEA-Tg mice immunized with avipox-CEA alone or in combination with avipox-GM-CSF or recGM-CSF.
- T cells were CD8 + .
- those T cells were capable of killing syngeneic (EL-4) targets pulsed with the CEA 526 _ 533 peptide (Fig. 12A).
- CEA peptide-specific EL-4 lysis was highest (p ⁇ .05 vs. either avipox-CEA or avipox-CEA + recGM-CSF-irnmunized mice), as measured by lytic units, for the T cell line that was obtained from CEA.Tg mice vaccinated with avipox-CEA in combination with avipox-GM- CSF (Fig. 12A).
- CEA.Tg mice bearing MC-38-CEA-2 tumors were vaccinated with avipox- CEA alone or in combination with avipox-GM-CSF or rGM-CSF as well as the control virus, avipox-RG alone, or combined with GM-CSF.
- MC-38-CEA-2 tumors grow progessively in na ⁇ ve CEA.Tg mice and mice that were vaccinated with avipox-RG alone or in combination with GM-CSF, and those mice were sacrificed 6-7 weeks after tumor inoculation (Table 3).
- Avipox-CEA vaccination resulted in a transient slowing of tumor growth in some CEA.Tg mice; however, survival was not prolonged (Figure 13C).
- GM-CSF avi ⁇ ox(A)-RG + rec-GM-CSF 5 none 1663.2 ⁇ 505.2 none none a CEA.Tg mice were immunized with the approximate avipox recombinants ⁇ either avipox-GM-CSF or recGM-CSF at two week intervals as described in the Materials and Methods. Data were compiled from two separate experiments with the exception of the avipox(A)-RG + recGM-CSF group which represents data from a single experiment. p ⁇ 0.5 (vs. control CEA.Tg mice). c p ⁇ 0.05 (vs. avipox(A)-CEA vaccinated CEA.Tg mice).
- mice Female C57BL/6 mice were vaccinated with 1 time with lxl 0 8 pfu/mouse with avipox(F)-WT, rF-CEA, or rF-CEA/TRICOM, as disclosed herein and in Cancer Research 59:5800-5807, 1999.
- splenocytes from vaccinated groups were collected for analysis of cellular immune responses.
- T cells from vaccinated mice were incubated with irradiated splenocytes in the presence of several concentrations of CEA protein for 5 days. T cells were also incubated with Con A or ovalbumin for positive and negative proliferation controls. During the final 18 hours of incubation, 3 H-Thymidine was added to measure T-cell proliferation.
- Lymphoproliferative responses to ⁇ -gal by splenocytes isolated from mice immunized with ⁇ -gal combined with incomplete Freunds adjuvant with or without Fp-mu- GM-CSF were determined.
- Mice were initially vaccinated with 100 ⁇ g ⁇ -gal combined with incomplete Freunds adjuvant (triangles) (mixed in a 1 : 1 per volume ratio) or adjuvant alone (circles).
- Fp-mu-GM-CSF (10 7 pfu) (diamonds) or Fp-WT (10 7 pfu) (squares) was added with the immunogen and injected s.c.
- Avipox-GM-CSF is administered intravesically to patients with bladder cancer. Patients are administered between 10 6 and 10 11 pfu of avipox-GM-CSF via a catheter to infect bladder carcinoma cells. Avipox-GM-CSF is administered from 1 to 10 times at intervals of 1 day, 1 week, or 1 month. Efficacy of treatment is evaluated clinically.
- EXAMPLE 11 Direct Intratumor Injection of Avipox-GM-CSF In Patients With Head and Neck Carcinoma
- Avipox-GM-CSF is directly injected into tumors such as head and neck, melanoma and breast metastasis of the skin.
- tumors such as head and neck, melanoma and breast metastasis of the skin.
- pfu of avipox-GM-CSF is administered from one to 10 times at daily, weekly, or monthly intervals.
- Avipox-GM-CSF is used in combination with an avipox-CEA-TRICOM vaccine to treat any CEA expressing tumor.
- Avipox-CEA-TRICOM is a vaccine in which the fowlpox recombinant expresses the tumor antigen CEA and three different costimulatory molecules: B7-1, ICAM-1 and LFA-3.
- the avipox-GM-CSF is given at doses of 10 6 to 10 10 pfu/injection.
- the avipox-GM-CSF is administered either before (1 day to 1 week), at the same time of, or after (1 day to 1 week) administration of avipox-CEA- TRICOM.
- the avipox-CEA-TRICOM is given at a dose of 10 6 to 10 10 pfu/injection.
- EXAMPLE 13 Avipox-GM-CSF in Combination with Recombinant Poxvirus Expressing HIV and SIV Antigens in SIV and SHIV Challenge Models in Rhesus Macaques
- the avipox-GM-CSF is given at doses of 10 6 to 10 10 pfu/injection subcutaneously.
- the avipox-GM-CSF is administered either before (1 day to 1 week), at the same time of, or after administration (1 day to 1 week) of avipox-HIV antigen- TRICOM, avipox-SIV antigen-TRICOM, avipox-HFN antigen-B7, or avipox-SIV antigen- B7 subcutaneously at 10 6 to 10 10 pfu/injection.
- GM-CSF is believed to act as a potent biological adjuvant for vaccines by its ability to attract professional APC to a local injection site which then migrate into the regional lymph nodes to mediate host immune responses (15, 21, 22).
- Different vehicles have been used to deliver GM-CSF to an immunization site. Some of those approaches include the introduction of the GM-CSF gene via retroviral vectors into tumor cell vaccines (19, 20), fusion proteins (18) and replication-deficient (25) recombinant poxviruses.
- avipox viruses fowlpox and canarypox (ALVAC), expressing GM-CSF were compared and no apparent differences were observed.
- AVAC canarypox
- the use of recombinant avipox viruses to deliver GM-CSF to an immunization site may have several advantages over using recGM-CSF.
- the magnitude of the increase in the absolute number of CD1 lc + /I-Ab + cells in the regional lymph nodes was much greater in mice injected with the avipox-GM-CSF viruses than with recGM-CSF.
- the number of CDllc + /I-Ab + lymph node cells was increased by approximately 6-fold when compared with untreated mice (0.71 vs. 0.12 x 10 6 /node, Fig. 3).
- a single injection of either recombinant avipox-GM-CSF virus 10 8 pfu boosted the absolute number of CDllc + /I-Ab + lymph node cells by almost 70-fold (1.44 vs. 0. 12 x 10 6 /node, Fig. 3).
- the second advantage of using recombinant avipox viruses to deliver GM-CSF may be the temporal changes associated with the enrichment of APC within the regional nodes.
- recGM-CSF needs to be administered for 4-5 days to increase APC concentration within the regional nodes.
- the changes within the injection site rapidly disappear (approx. 4-5 days).
- the elevations in the absolute number of class II and CD11 c /I- Ab + lymph node cells were sustained in the regional lymph nodes of mice injected with either recombinant avipox-GM-CSF virus for 21-28 days (Fig. 8).
- lymph nodes cells isolated 21 days after avipox(A)-GM-CSF injection generated a more robust allospecific CTL response in vitro, indicating their functional integrity (Fig. 9B).
- avipox-GM-CSF viruses produce a depot of GM-CSF after injection and the prolonged changes seen in the regional node would represent the slow release of the cytokine. That seems unlikely since the in vivo half-life of GM-CSF is on the order of 2-3 days. While not being bound by theory, a more plausible explanation is that the replication- defective avipox viruses remain at the injection site and continuously produces GM-CSF which, in turn, mediates the sustained changes seen in the regional nodes. If these recombinant avipox viruses are to be used to deliver biologically active GM-CSF to a vaccination site, they must be compatible with certain anticancer vaccines.
- recombinant avipox-GM-CSF viruses as well as recGM- CSF were evaluated for their abilities to augment CEA-specific host immuriity in CEA.Tg mice when using avipox-CEA as a tumor vaccine.
- Vaccination of CEA.Tg mice with avipox-CEA or, as previously reported, a recombinant vaccinia-CEA virus (29), induces CEA-specific humoral and cell-mediated immunity.
- the CEA-specific immunity generated in CEA.Tg mice vaccinated with a recombinant poxvirus-CEA vaccine was relatively weak.
- avipox-CEA vaccination induced a transient growth inhibition of CEA-expressing subcutaneous tumors in the CEA.Tg mice (Fig. 13B).
- Inco ⁇ orating GM-CSF either as a recombinant avipox virus or recombinant protein, increased the CEA-specific CD4 + - proliferative (Table 4) and CD8 + -mediatedTytic (Fig. 12 A) responses in avipox-CEA- vaccinated CEA.Tg mice.
- the anti-CEA-specific cellular immune responses were significantly more potent in those CEA.Tg mice in which avipox-GM-CSF, not recGM-CSF, was the biological vaccine adjuvant.
- avipox-GM-CSF not recGM-CSF
- the biological vaccine adjuvant was the biological vaccine adjuvant.
- recombinant avipox viruses expressing a tumor antigen and GM-CSF are compatible and can be injected simultaneously.
- the recombinant avipox-CEA virus produces CEA continuously for 21-28 days, then the co-existence of antigen with elevated local GM- CSF levels might result in a continuous loading of dendritic cells with tumor antigen.
- mice vaccinated with avipox-CEA and avipox-GM-CSF While that may explain the improved cellular response to CEA, one is left to speculate why those changes did not mediate more potent antitumor responses in the CEA.Tg mice vaccinated with avipox-CEA and avipox-GM-CSF.
- One possible explanation is that the use of an experimental model in which the cell-mediated immunity is generated against a self antigen may introduce host/tumor factors that would counterbalance the antitumor response.
- recombinant avipox viruses are attractive candidates for cancer vaccines.
- Previous exposure to vaccinia does not alter the immune response to recombinant avipox viruses (43) and in diversified prime-and-boost protocols the two viruses induce antitumor immunity in murine models (36).
- the present findings expand the use of recombinant avipox viruses to include GM-CSF delivery to enrich an immunization site with APC, thereby, augmenting the generation of antigen-specific antitumor immunity.
- Another finding was the ability of avipox(A)-GM-CSF to enrich the regional lymph nodes with APC after repeated injections.
- a third advantage of using a recombinant avipox-GM-CSF virus would be the ease of mixing it with an immunogen, such as avipox- CEA, and administering the vaccine as a single injection as compared with 4-5 daily injections of recGM-CSF. That would simplify vaccine design, reduce treatment costs, while, possibly, maximizing the adjuvant effects of GM-CSF.
- CEA carcinoembryonic antigen
- Nonreplicating viral vectors as potential vaccines Recombinant canarypox virus expressing measles virus fusion (F) and hemagglutinin (HA) glycoproteins. Virology, 187: 321-328, 1992.
- AVAC AVAC-mediated cytokine expression on murine prostate tumor growth. J. Natl. Cancer Inst, 891:428-436, 1997.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Organic Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Virology (AREA)
- Oncology (AREA)
- Immunology (AREA)
- Communicable Diseases (AREA)
- Epidemiology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Hematology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Surgery (AREA)
- AIDS & HIV (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Pulmonology (AREA)
- Diabetes (AREA)
- Gynecology & Obstetrics (AREA)
- Pregnancy & Childbirth (AREA)
Abstract
Description
Claims
Priority Applications (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/297,168 US20040091995A1 (en) | 2001-06-15 | 2001-06-15 | Recombinant non-replicating virus expressing gm-csf and uses thereof to enhance immune responses |
EP01946395A EP1292694A2 (en) | 2000-06-15 | 2001-06-15 | A recombinant non-replicating virus expressing gm-csf and uses thereof to enhance immune responses |
CA2412050A CA2412050C (en) | 2000-06-15 | 2001-06-15 | A recombinant non-replicating virus expressing gm-csf and uses thereof to enhance immune responses |
AU2001268452A AU2001268452B2 (en) | 2000-06-15 | 2001-06-15 | A recombinant non-replicating virus expressing GM-CSF and uses thereof to enhance immune responses |
JP2002510097A JP2004507231A (en) | 2000-06-15 | 2001-06-15 | Recombinant non-replicating virus expressing GM-CSF and use thereof for enhancing an immune response |
AU6845201A AU6845201A (en) | 2000-06-15 | 2001-06-15 | A recombinant non-replicating virus expressing GM-CSF and uses thereof to enhance immune responses |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US21171700P | 2000-06-15 | 2000-06-15 | |
US60/211,717 | 2000-06-15 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2001095919A2 true WO2001095919A2 (en) | 2001-12-20 |
WO2001095919A3 WO2001095919A3 (en) | 2002-11-28 |
Family
ID=22788060
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2001/019201 WO2001095919A2 (en) | 2000-06-15 | 2001-06-15 | A recombinant non-replicating virus expressing gm-csf and uses thereof to enhance immune responses |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP1292694A2 (en) |
JP (1) | JP2004507231A (en) |
AU (2) | AU6845201A (en) |
CA (1) | CA2412050C (en) |
WO (1) | WO2001095919A2 (en) |
Cited By (27)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6684646B2 (en) | 2001-05-22 | 2004-02-03 | Integrated Biosystems, Inc. | Systems and methods for freezing, storing and thawing biopharmaceutical material |
WO2005047483A2 (en) | 2003-11-12 | 2005-05-26 | Medical Research Council | Renta: an hiv immunogen and uses thereof |
JP2005523318A (en) * | 2002-04-19 | 2005-08-04 | バヴァリアン・ノルディック・アクティーゼルスカブ | Mutant vaccinia virus Ankara for newborn immunization |
JP2007524573A (en) * | 2003-02-21 | 2007-08-30 | セイント ヴィンセンツ ホスピタル シドニー リミテッド | Idiotype vaccine |
WO2007143606A2 (en) | 2006-06-02 | 2007-12-13 | International Aids Vaccine Initiative | Hiv-1 clade a consensus sequences, antigens, and transgenes |
US7455846B2 (en) | 2000-05-17 | 2008-11-25 | Stephen John Ralph | Immune potentiating compositions of cancer cells |
US20090053223A1 (en) * | 2004-07-16 | 2009-02-26 | . | Expression-enhanced polypeptides |
WO2010050913A1 (en) * | 2008-10-31 | 2010-05-06 | The Brigham And Women's Hospital, Inc. | Vaccination with poxvirus vectors via mechanical epidermal disruption |
US7892533B2 (en) | 2000-11-23 | 2011-02-22 | Bavarian Nordic A/S | Modified vaccinia virus ankara for the vaccination of neonates |
AU2011200127B2 (en) * | 2003-09-05 | 2012-06-21 | Sanofi Pasteur Limited | Multi-antigen vectors for melanoma |
WO2012149038A1 (en) | 2011-04-25 | 2012-11-01 | Advanced Bioscience Laboratories, Inc. | Truncated hiv envelope proteins (env), methods and compositions related thereto |
WO2012170765A2 (en) | 2011-06-10 | 2012-12-13 | Oregon Health & Science University | Cmv glycoproteins and recombinant vectors |
EP2586461A1 (en) | 2011-10-27 | 2013-05-01 | Christopher L. Parks | Viral particles derived from an enveloped virus |
WO2013093629A2 (en) | 2011-12-20 | 2013-06-27 | Netherlands Cancer Institute | Modular vaccines, methods and compositions related thereto |
EP2644701A1 (en) | 2012-03-29 | 2013-10-02 | Christopher L. Parks | Methods to improve vector expression and genetic stability |
EP2679596A1 (en) | 2012-06-27 | 2014-01-01 | Simon Hoffenberg | HIV-1 env glycoprotein variant |
WO2014040025A2 (en) | 2012-09-10 | 2014-03-13 | International Aids Vaccine Initiative | Immunogens of hiv-1 broadly neutralizing antibodies, methods of generation and uses thereof |
US8691502B2 (en) | 2008-10-31 | 2014-04-08 | Tremrx, Inc. | T-cell vaccination with viral vectors via mechanical epidermal disruption |
EP2848937A1 (en) | 2013-09-05 | 2015-03-18 | International Aids Vaccine Initiative | Methods of identifying novel HIV-1 immunogens |
EP2873423A2 (en) | 2013-10-07 | 2015-05-20 | International Aids Vaccine Initiative | Soluble hiv-1 envelope glycoprotein trimers |
WO2015171975A1 (en) | 2014-05-09 | 2015-11-12 | The Regents Of The University Of Michigan | Use of modified banana lectin in purification of glycoproteins |
EP2975053A1 (en) | 2014-06-11 | 2016-01-20 | International Aids Vaccine Initiative | Broadly neutralizing antibody and uses thereof |
EP3072901A1 (en) | 2015-03-23 | 2016-09-28 | International Aids Vaccine Initiative | Soluble hiv-1 envelope glycoprotein trimers |
EP3150223A1 (en) | 2015-10-02 | 2017-04-05 | International AIDS Vaccine Initiative | Replication-competent vsv-hiv env vaccines |
WO2017100338A1 (en) * | 2015-12-07 | 2017-06-15 | Nant Holdings Ip, Llc | Improved compositions and methods for viral delivery of neoepitopes and uses thereof |
US10603351B2 (en) | 2008-08-21 | 2020-03-31 | Turnstone Limited Partnership | Engineered synergistic oncolytic viral symbiosis |
WO2021168318A1 (en) | 2020-02-21 | 2021-08-26 | International Aids Vaccine Initiative Inc. | Vaccine compositions for preventing coronavirus disease |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20160271239A1 (en) * | 2013-11-05 | 2016-09-22 | Bavarian Nordic A/S | Combination Therapy for Treating Cancer with a Poxvirus Expressing a Tumor Antigen and an Antagonist and/or Agonist of an Immune Checkpoint Inhibitor |
JP5917626B2 (en) * | 2014-07-28 | 2016-05-18 | トレムアールエックス, インコーポレイテッド | Vaccination with poxvirus vectors via mechanical epidermal destruction |
CN108567977B (en) | 2017-03-13 | 2022-04-12 | 复旦大学 | Immunopotentiator, immunotherapy pharmaceutical composition, preparation and application thereof |
WO2020072833A1 (en) * | 2018-10-04 | 2020-04-09 | Sqz Biotechnologies Company | Intracellular delivery of biomolecules to enhance antigen presenting cell function |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1994016716A1 (en) * | 1993-01-21 | 1994-08-04 | Virogenetics Corporation | Recombinant virus immunotherapy |
WO1996011279A2 (en) * | 1994-10-03 | 1996-04-18 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Enhanced immune response by introduction of cytokine gene and/or costimulatory molecule b7 gene in a recombinant virus expressing system |
WO1998015635A2 (en) * | 1996-10-04 | 1998-04-16 | Connaught Laboratories Limited | Treatment of cancer using a recombinant poxvirus containing a nucleic acid sequence encoding a cytokine |
-
2001
- 2001-06-15 JP JP2002510097A patent/JP2004507231A/en active Pending
- 2001-06-15 EP EP01946395A patent/EP1292694A2/en not_active Ceased
- 2001-06-15 AU AU6845201A patent/AU6845201A/en active Pending
- 2001-06-15 WO PCT/US2001/019201 patent/WO2001095919A2/en active Application Filing
- 2001-06-15 CA CA2412050A patent/CA2412050C/en not_active Expired - Lifetime
- 2001-06-15 AU AU2001268452A patent/AU2001268452B2/en not_active Expired
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1994016716A1 (en) * | 1993-01-21 | 1994-08-04 | Virogenetics Corporation | Recombinant virus immunotherapy |
WO1996011279A2 (en) * | 1994-10-03 | 1996-04-18 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Enhanced immune response by introduction of cytokine gene and/or costimulatory molecule b7 gene in a recombinant virus expressing system |
WO1998015635A2 (en) * | 1996-10-04 | 1998-04-16 | Connaught Laboratories Limited | Treatment of cancer using a recombinant poxvirus containing a nucleic acid sequence encoding a cytokine |
Non-Patent Citations (7)
Title |
---|
GROSENBACH DOUGLAS W ET AL: "Synergy of vaccine strategies to amplify antigen-specific immune responses and antitumor effects." CANCER RESEARCH, vol. 61, no. 11, 1 June 2001 (2001-06-01), pages 4497-4505, XP002189175 ISSN: 0008-5472 * |
GROSENBACH DOUGLAS WILLIAM ET AL: "Synergy of vaccine strategies to optimize antigen-specific immune responses and anti-tumor effects." PROCEEDINGS OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH ANNUAL, vol. 42, March 2001 (2001-03), page 818 XP002189174 92nd Annual Meeting of the American Association for Cancer Research;New Orleans, LA, USA; March 24-28, 2001, March, 2001 ISSN: 0197-016X * |
HODGE JAMES W ET AL: "Diversified prime and boost protocols using recombinant vaccinia virus and recombinant non-replicating avian pox virus to enhance T-cell immunity and antitumor responses." VACCINE, vol. 15, no. 6-7, 1997, pages 759-768, XP002189173 ISSN: 0264-410X * |
KASS ERIK ET AL: "Granulocyte/macrophage-colony stimulating factor produced by recombinant avian poxviruses enriches the regional lymph nodes with antigen-presenting cells and acts as an immunoadjuvant." CANCER RESEARCH, vol. 61, no. 1, 1 January 2001 (2001-01-01), pages 206-214, XP002189176 ISSN: 0008-5472 * |
PUISIEUX I ET AL: "CURATIVE AND PROTECTIVE EFFECTS AGAINST MURINE TUMORS BY IL12 GENE THERAPY USING A CANARYPOX VIRUS VECTOR" CANCER GENE THERAPY, NORWALK, CT, US, vol. 4, no. 6, 20 November 1997 (1997-11-20), page S53 XP002062564 ISSN: 0929-1903 * |
PUISIEUX ISABELLE ET AL: "Canarypox virus-mediated interleukin 12 gene transfer into murine mammary adenocarcinoma induces tumor suppression and long-term antitumoral immunity." HUMAN GENE THERAPY, vol. 9, no. 17, 20 November 1998 (1998-11-20), pages 2481-2492, XP002205540 ISSN: 1043-0342 cited in the application * |
RAO G S ET AL: "CANARY-FOX (ALVAC) VIRUS-MEDIATED CYTOKINE GENE THERAPY INDUCES TUMOR SPECIFIC IMMUNITY AGAINST MOUSE BLADDER TUMOR" JOURNAL OF UROLOGY, BALTIMORE, MD, US, vol. 155, no. 5, 1 May 1996 (1996-05-01), page 570A XP002062560 ISSN: 0022-5347 * |
Cited By (44)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7964400B2 (en) | 2000-05-17 | 2011-06-21 | Stephen John Ralph | Immune potentiating compositions of cancer cells |
US7455846B2 (en) | 2000-05-17 | 2008-11-25 | Stephen John Ralph | Immune potentiating compositions of cancer cells |
US8372622B2 (en) | 2000-11-23 | 2013-02-12 | Bavarian Nordic A/S | Modified vaccinia virus ankara for the vaccination of neonates |
US8163293B2 (en) | 2000-11-23 | 2012-04-24 | Bavarian Nordic A/S | Modified Vaccinia Virus Ankara for the vaccination of neonates |
US7892533B2 (en) | 2000-11-23 | 2011-02-22 | Bavarian Nordic A/S | Modified vaccinia virus ankara for the vaccination of neonates |
US6684646B2 (en) | 2001-05-22 | 2004-02-03 | Integrated Biosystems, Inc. | Systems and methods for freezing, storing and thawing biopharmaceutical material |
US7897156B2 (en) | 2001-11-22 | 2011-03-01 | Bavarian Nordic A/S | Modified vaccinia virus ankara for the vaccination of neonates |
JP2010120955A (en) * | 2002-04-19 | 2010-06-03 | Bavarian Nordic As | Modified vaccinia virus ankara for vaccination of newborn animal |
JP2005523318A (en) * | 2002-04-19 | 2005-08-04 | バヴァリアン・ノルディック・アクティーゼルスカブ | Mutant vaccinia virus Ankara for newborn immunization |
JP2011157400A (en) * | 2002-04-19 | 2011-08-18 | Bavarian Nordic As | Modified vaccinia virus ankara for vaccination of neonate |
JP2015061876A (en) * | 2002-04-19 | 2015-04-02 | バヴァリアン・ノルディック・アクティーゼルスカブ | Modified vaccinia virus ankara for vaccination of neonate |
JP2007524573A (en) * | 2003-02-21 | 2007-08-30 | セイント ヴィンセンツ ホスピタル シドニー リミテッド | Idiotype vaccine |
AU2011200127B2 (en) * | 2003-09-05 | 2012-06-21 | Sanofi Pasteur Limited | Multi-antigen vectors for melanoma |
WO2005047483A2 (en) | 2003-11-12 | 2005-05-26 | Medical Research Council | Renta: an hiv immunogen and uses thereof |
US20090053223A1 (en) * | 2004-07-16 | 2009-02-26 | . | Expression-enhanced polypeptides |
US8518403B2 (en) * | 2004-07-16 | 2013-08-27 | Amgen Research (Munich) Gmbh | Expression-enhanced polypeptides |
WO2007143606A2 (en) | 2006-06-02 | 2007-12-13 | International Aids Vaccine Initiative | Hiv-1 clade a consensus sequences, antigens, and transgenes |
EP2399602A1 (en) | 2006-06-02 | 2011-12-28 | International AIDS Vaccine Initiative | HIV-1 Clade A consensus sequences, antigens, and transgenes |
US10603351B2 (en) | 2008-08-21 | 2020-03-31 | Turnstone Limited Partnership | Engineered synergistic oncolytic viral symbiosis |
US9416371B2 (en) | 2008-10-31 | 2016-08-16 | Tremrx, Inc. | T-cell vaccination with viral vectors via mechanical epidermal disruption |
EP2352520A1 (en) * | 2008-10-31 | 2011-08-10 | The Brigham and Women's Hospital, Inc. | Vaccination with poxvirus vectors via mechanical epidermal disruption |
US8691502B2 (en) | 2008-10-31 | 2014-04-08 | Tremrx, Inc. | T-cell vaccination with viral vectors via mechanical epidermal disruption |
WO2010050913A1 (en) * | 2008-10-31 | 2010-05-06 | The Brigham And Women's Hospital, Inc. | Vaccination with poxvirus vectors via mechanical epidermal disruption |
EP2352520A4 (en) * | 2008-10-31 | 2012-03-14 | On Cyte Inc | Vaccination with poxvirus vectors via mechanical epidermal disruption |
WO2012149038A1 (en) | 2011-04-25 | 2012-11-01 | Advanced Bioscience Laboratories, Inc. | Truncated hiv envelope proteins (env), methods and compositions related thereto |
WO2012170765A2 (en) | 2011-06-10 | 2012-12-13 | Oregon Health & Science University | Cmv glycoproteins and recombinant vectors |
EP2586461A1 (en) | 2011-10-27 | 2013-05-01 | Christopher L. Parks | Viral particles derived from an enveloped virus |
WO2013093629A2 (en) | 2011-12-20 | 2013-06-27 | Netherlands Cancer Institute | Modular vaccines, methods and compositions related thereto |
EP2644701A1 (en) | 2012-03-29 | 2013-10-02 | Christopher L. Parks | Methods to improve vector expression and genetic stability |
EP2679596A1 (en) | 2012-06-27 | 2014-01-01 | Simon Hoffenberg | HIV-1 env glycoprotein variant |
WO2014040025A2 (en) | 2012-09-10 | 2014-03-13 | International Aids Vaccine Initiative | Immunogens of hiv-1 broadly neutralizing antibodies, methods of generation and uses thereof |
EP2848937A1 (en) | 2013-09-05 | 2015-03-18 | International Aids Vaccine Initiative | Methods of identifying novel HIV-1 immunogens |
EP2873423A2 (en) | 2013-10-07 | 2015-05-20 | International Aids Vaccine Initiative | Soluble hiv-1 envelope glycoprotein trimers |
WO2015171975A1 (en) | 2014-05-09 | 2015-11-12 | The Regents Of The University Of Michigan | Use of modified banana lectin in purification of glycoproteins |
EP3438127A1 (en) | 2014-06-11 | 2019-02-06 | International AIDS Vaccine Initiative | Broadly neutralizing antibody and uses thereof |
EP2975053A1 (en) | 2014-06-11 | 2016-01-20 | International Aids Vaccine Initiative | Broadly neutralizing antibody and uses thereof |
EP4001304A1 (en) | 2014-06-11 | 2022-05-25 | International Aids Vaccine Initiative | Broadly neutralizing antibody and uses thereof |
EP3072901A1 (en) | 2015-03-23 | 2016-09-28 | International Aids Vaccine Initiative | Soluble hiv-1 envelope glycoprotein trimers |
EP3150223A1 (en) | 2015-10-02 | 2017-04-05 | International AIDS Vaccine Initiative | Replication-competent vsv-hiv env vaccines |
WO2017100338A1 (en) * | 2015-12-07 | 2017-06-15 | Nant Holdings Ip, Llc | Improved compositions and methods for viral delivery of neoepitopes and uses thereof |
US10793875B2 (en) | 2015-12-07 | 2020-10-06 | Nant Holdings Ip, Llc | Compositions and methods for viral delivery of neoepitopes and uses thereof |
TWI733719B (en) | 2015-12-07 | 2021-07-21 | 美商河谷控股Ip有限責任公司 | Improved compositions and methods for viral delivery of neoepitopes and uses thereof |
US11441160B2 (en) | 2015-12-07 | 2022-09-13 | Nant Holdings Ip, Llc | Compositions and methods for viral delivery of neoepitopes and uses thereof |
WO2021168318A1 (en) | 2020-02-21 | 2021-08-26 | International Aids Vaccine Initiative Inc. | Vaccine compositions for preventing coronavirus disease |
Also Published As
Publication number | Publication date |
---|---|
EP1292694A2 (en) | 2003-03-19 |
AU6845201A (en) | 2001-12-24 |
AU2001268452B2 (en) | 2006-08-17 |
CA2412050C (en) | 2011-03-22 |
WO2001095919A3 (en) | 2002-11-28 |
JP2004507231A (en) | 2004-03-11 |
CA2412050A1 (en) | 2001-12-20 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2001268452B2 (en) | A recombinant non-replicating virus expressing GM-CSF and uses thereof to enhance immune responses | |
US20040091995A1 (en) | Recombinant non-replicating virus expressing gm-csf and uses thereof to enhance immune responses | |
AU2001268452A1 (en) | A recombinant non-replicating virus expressing GM-CSF and uses thereof to enhance immune responses | |
Kass et al. | Granulocyte/macrophage-colony stimulating factor produced by recombinant avian poxviruses enriches the regional lymph nodes with antigen-presenting cells and acts as an immunoadjuvant | |
Bocchia et al. | Antitumor vaccination: where we stand | |
US7211432B2 (en) | Recombinant vector expressing multiple costimulatory molecules and uses thereof | |
AU774076C (en) | A recombinant vector expressing multiple costimulatory molecules and uses thereof | |
CA2732570C (en) | Use of mhc class ii ligands as adjuvant for vaccination and of lag-3 in cancer treatment | |
Kass et al. | Comparative studies of the effects of recombinant GM-CSF and GM-CSF administered via a poxvirus to enhance the concentration of antigen-presenting cells in regional lymph nodes | |
WO1998008947A1 (en) | Enhancement of dna immunization through the use of cytokines | |
US20050063952A1 (en) | Immunogenic CEA | |
US20050100558A1 (en) | Heterologous boosting immunizations | |
CA2252406A1 (en) | Heterologous boosting immunizations | |
Behboudi et al. | Dendritic cells infected by recombinant modified vaccinia virus Ankara retain immunogenicity in vivo despite in vitro dysfunction | |
US20110104101A1 (en) | Immunotherapy for Unresectable Pancreatic Cancer | |
US20020022017A1 (en) | Regulation of systemic immune responses utilizing soluble CD40 | |
JP2004522789A (en) | Papillomavirus vaccine | |
EP1865065A1 (en) | A recombinant vector expressing multiple costimulatory molecules and uses thereof | |
HODGE et al. | CARCEVOEMBRYONIC ANTIGEN (CEA) AS A MODEL FOR IMMUNOTHERAPY USING RECOMBINANT VACCINES | |
Stanners | CARCEVOEMBRYONIC ANTIGEN (CEA) AS A MODEL FOR IMMUNOTHERAPY USING RECOMBINANT VACCINES |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
AK | Designated states |
Kind code of ref document: A3 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2001946395 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2412050 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2001268452 Country of ref document: AU |
|
ENP | Entry into the national phase |
Ref country code: JP Ref document number: 2002 510097 Kind code of ref document: A Format of ref document f/p: F |
|
WWP | Wipo information: published in national office |
Ref document number: 2001946395 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 10297168 Country of ref document: US |