WO2001062942A2 - MATERIALS AND METHODS INVOLVING HYBRID VASCULAR ENDOTHELIAL GROWTH FACTOR DNAs AND PROTEINS AND SCREENING METHODS FOR MODULATORS - Google Patents

MATERIALS AND METHODS INVOLVING HYBRID VASCULAR ENDOTHELIAL GROWTH FACTOR DNAs AND PROTEINS AND SCREENING METHODS FOR MODULATORS Download PDF

Info

Publication number
WO2001062942A2
WO2001062942A2 PCT/US2001/006113 US0106113W WO0162942A2 WO 2001062942 A2 WO2001062942 A2 WO 2001062942A2 US 0106113 W US0106113 W US 0106113W WO 0162942 A2 WO0162942 A2 WO 0162942A2
Authority
WO
WIPO (PCT)
Prior art keywords
vegf
vegfr
polypeptide
seq
ofthe
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2001/006113
Other languages
English (en)
French (fr)
Other versions
WO2001062942A3 (en
Inventor
Kari Alitalo
Markku Michael Jeltsch
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ludwig Institute for Cancer Research Ltd
Licentia Oy
Ludwig Cancer Research
Original Assignee
Ludwig Institute for Cancer Research Ltd
Licentia Oy
Ludwig Cancer Research
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ludwig Institute for Cancer Research Ltd, Licentia Oy, Ludwig Cancer Research filed Critical Ludwig Institute for Cancer Research Ltd
Priority to EP01914501A priority Critical patent/EP1259626B1/en
Priority to JP2001561752A priority patent/JP4981229B2/ja
Priority to AU3988401A priority patent/AU3988401A/xx
Priority to DE60131146T priority patent/DE60131146T2/de
Priority to AU2001239884A priority patent/AU2001239884B2/en
Priority to CA002400948A priority patent/CA2400948A1/en
Publication of WO2001062942A2 publication Critical patent/WO2001062942A2/en
Publication of WO2001062942A3 publication Critical patent/WO2001062942A3/en
Anticipated expiration legal-status Critical
Priority to AU2006235995A priority patent/AU2006235995A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7042Compounds having saccharide radicals and heterocyclic rings
    • A61K31/7052Compounds having saccharide radicals and heterocyclic rings having nitrogen as a ring hetero atom, e.g. nucleosides, nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0647Haematopoietic stem cells; Uncommitted or multipotent progenitors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/069Vascular Endothelial cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/069Vascular Endothelial cells
    • C12N5/0692Stem cells; Progenitor cells; Precursor cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/10Growth factors
    • C12N2501/165Vascular endothelial growth factor [VEGF]

Definitions

  • the PDGF proteins and their receptors are involved in regulation of cell proliferation, survival and migration of several cell types.
  • the VEGF proteins and their receptors play important roles in both vasculogenesis, the development ofthe embryonic vasculature from early differentiating endothelial cells, and angiogenesis, the process of forming new blood vessels from pre-existing ones [Risau et al, Dev Biol 725:441-450 (1988); Zachary, Ml J Biochem Cell Bio 30:1169-1174 (1998); Neufeld et al, FASEB J 13:9-22 (1999); Ferrara, J Mol Med
  • the PDGF/VEGF family of growth factors includes at least the following members: PDGF-A (see e.g., GenBank Ace. No. X06374), PDGF-B (see e.g., GenBank Ace. No. M12783), VEGF (see e.g., GenBank Ace. No. Q16889 referred to herein for clarity as VEGF-A or by particular isoform), PIGF (see e.g., GenBank Ace.
  • VEGF-B see e.g., GenBank Ace. No. U48801; also known as VEGF-related factor (VRF)
  • VEGF-C see e.g., GenBank Ace. No. X94216; also known as VEGF related protein (VRP)
  • VEGF-D also known as c-fos- induced growth factor (FIGF); see e.g., Genbank Ace. No. AJ000185
  • VEGF-E also known as NZ7 VEGF or OV NZ7; see e.g., GenBank Ace. No.
  • NZ2 VEGF also known as OV NZ2; see e.g., GenBank Ace. No. S67520
  • D1701 VEGF-like protein see e.g., GenBank Ace. No. AF106020; Meyer et al, EMBO J 18:363-314
  • NZ10 VEGF-like protein described in International Patent Application PCT/US99/25869 [Stacker and Achen, Growth Factors 17:1-11 (1999); Neufeld et al, FASEB J 13:9-22 (1999); Ferrara, J Mol Me d 77:521-543 (1999)].
  • PDGF/VEGF Members ofthe PDGF/VEGF family are characterized by a number of structural motifs including a conserved PDGF motif defined by the sequence: P-[PS]- C-V-X(3)-R-C-[GSTA]-G-C-C.
  • the brackets indicate that this position within the polypeptide can be any one ofthe amino acids contained within the brackets.
  • the number contained within the parentheses indicates the number of amino acids that separate the "V and "R" residues.
  • This conserved motif falls within a large domain of 70-150 amino acids defined in part by eight highly conserved cysteine residues that form inter- and intramolecular disulfide bonds.
  • This domain forms a cysteine knot motif composed of two disulfide bonds which form a covalently linked ring structure between two adjacent ⁇ strands, and a third disulfide bond that penetrates the ring [see for example, Fig 1 in Muller et al, Structure 5:1325-1338 (1997)], similar to that found in other cysteine knot growth factors, e.g., transforming growth factor- ⁇ (TGF- B).
  • TGF- B transforming growth factor- ⁇
  • the PDGF/VEGF family proteins are predominantly secreted glycoproteins that form either disulfide-linked or non- covalently bound homo- or heterodimers whose subunits are arranged in an anti- parallel manner [Stacker and Achen, Growth Factors 77:1-11 (1999); Muller et al, Structure 5:1325-1338 (1997)].
  • the PDGF subfamily The PDGFs regulate cell proliferation, cell survival and chemotaxis of many cell types in vitro (reviewed in [Heldin et al, Biochimica et Biophysica Acta 7375:F79-113 (1998)].
  • the two chains that make up PDGF, PDGF-A and PDGF-B, can homo- or heterodimerize producing three different isoforms: PDGF-AA, PDGF- AB, or PDGF-BB.
  • PDGF-A is only able to bind the PDGF ⁇ -receptor (PDGFR- ⁇ )
  • PDGF-B can bind both the PDGF- ⁇ and a second PDGF receptor (PDGF- ⁇ ).
  • the PDGF proteins exert their effects in a paracrine manner since they often are expressed in epithelial (PDGF-A) or endothelial (PDGF-B) cells in close apposition to the PDGF receptor-expressing mesenchyme (reviewed in Ataliotis et al, Int Rev Cytology 172:95-121 (1997) ].
  • PDGF-A epithelial
  • PDGF-B endothelial
  • mice Homozygous null mutations for either PDGF-A or PDGF-B are lethal in mice. Approximately 50 % of the homozygous PDGF-A deficient mice have an early lethal phenotype, while the surviving animals have a complex postnatal phenotype with lung emphysema due to improper alveolar septum formation, and a dermal phenotype characterized by thin dermis, misshapen hair follicles, and thin hair. PDGF-A is also required for normal development of oligodendrocytes and subsequent myelination ofthe central nervous system.
  • the PDGF-B deficient mice develop renal, hematological and cardiovascular abnormalities; where the renal and cardiovascular defects, at least in part, are due to the lack of proper recruitment of mural cells (vascular smooth muscle cells, pericytes or mesangial cells) to blood vessels.
  • mural cells vascular smooth muscle cells, pericytes or mesangial cells
  • the VEGF subfamily is composed of PDGF/VEGF members which share a VEGF homology domain (VHD) characterized by the sequence: C-X(22-24)-P- [PSR]-C-V-X(3)-R-C-[GSTA]-G-C-C-X(6)-C-X(32-41)-C.
  • VHD domain determined through analysis ofthe VEGF subfamily members, comprises the PDGF motif but is more specific.
  • VEGF-A was originally purified from several sources on the basis of its mitogenic activity toward endothelial cells, and also by its ability to induce microvascular permeability, hence it is also called vascular permeability factor (VPF).
  • VPF vascular permeability factor
  • VEGF-A has subsequently been shown to induce a number of biological processes including the mobilization of intracellular calcium, the induction of plasminogen activator and plasminogen activator inhibitor- 1 synthesis, promotion of monocyte migration in vitro, induction of antiapoptotic protein expression in human endothelial • cells, induction of fenestrations in endothelial cells, promotion of cell adhesion molecule expression in endothelial cells and induction of nitric oxide mediated vasodilation and hypotension [Ferrara, J Mol Med 77: 527-543 (1999); Neufeld et al, FASEB J 13: 9-22 (1999); Zachary, Intl J Biochem Cell Bio 30: 1169-1174 (1998)].
  • VEGF-A is a secreted, disulfide-linked homodimeric glycoprotein composed of 23 kD subunits.
  • each isoform differs in biological activity, receptor specificity, and affinity for cell surface- and extracellular matrix-associated heparan-sulfate proteoglycans, which behave as low affinity receptors for VEGF-A.
  • VEGF 121 does
  • VEGF ]45 and VEGF 165 (GenBank Ace. No. M32977) are both capable of binding to heparin; and VEGF 189 and VEGF 206 show the strongest affinity for heparin and heparan-sulfates.
  • VEGF 121 , VEGF, 45 , and VEGF 165 are secreted in a soluble form , although most of VEGF 165 is confined to cell surface and extracellular matrix proteoglycans, whereas VEGF 1S9 and VEGF 206 remain associated with extracellular matrix.
  • Both VEGF lg9 and VEGF 206 can be released by treatment with heparin or heparinase, indicating that these isoforms are bound to extracellular matrix via proteoglycans.
  • Cell-bound VEGF 1S9 can also be cleaved by proteases such as plasmin, resulting in release of an active soluble VEGF U0 .
  • Most tissues that express VEGF are observed to express several VEGF isoforms simultaneously, although VEGF ]21 and VEGF 165 are the predominant forms, whereas VEGF 206 is rarely detected [Ferrara, J Mol Med 77:527-543 (1999)].
  • VEGF 145 differs in that it is primarily expressed in cells derived from reproductive organs [Neufeld et al, FASEB J 13:9-22 (1999)].
  • VEGF-A The pattern of VEGF-A expression suggests its involvement in the development and maintenance ofthe normal vascular system, and in angiogenesis associated with tumor growth and other pathological conditions such as rheumatoid arthritis.
  • VEGF-A is expressed in embryonic tissues associated with the developing vascular system, and is secreted by numerous tumor cell lines. Analysis of mice in which VEGF-A was Icnocked out by targeted gene disruption indicate that VEGF-A is critical for survival, and that the development ofthe cardiovascular system is highly sensitive to VEGF-A concentration gradients. Mice lacking a single copy of VEGF-A die between day 11 and 12 of gestation. These embryos show impaired growth and several developmental abnormalities including defects in the developing cardiovasculature.
  • VEGF-A is also required post-natally for growth, organ development, regulation of growth plate morphogenesis and endochondral bone formation. The requirement for VEGF-A decreases with age, especially after the fourth postnatal week. In mature animals, VEGF-A is required primarily for active angiogenesis in processes such as wound healing and the development ofthe corpus luteum. [Neufeld et al, FASEB J 13:9-22 (1999); Ferrara, J Mol Med 77:527-543 (1999)] . VEGF-A expression is influenced primarily by hypoxia and a number of hormones and cytokines including epidermal growth factor (EGF), TGF- ⁇ , and various interleukins.
  • EGF epidermal growth factor
  • TGF- ⁇ various interleukins.
  • PIGF a second member ofthe VEGF subfamily, is generally a poor stimulator of angiogenesis and endothelial cell proliferation in comparison to VEGF- A, and the in vivo role of PIGF is not well understood.
  • Three isoforms of PIGF produced by alternative mRNA splicing have been described [Hauser et al, Growth Factors P:259-268 (1993); Maglione et al, Oncogene 5:925-931 (1993)].
  • PIGF forms both disulfide-liked homodimers and heterodimers with VEGF-A.
  • VEGF-A heterodimers are more effective at inducing endothelial cell proliferation and angiogenesis than PIGF homodimers.
  • PIGF is primarily expressed in the placenta, and is also co-expressed with VEGF-A during early embryogenesis in the trophoblastic giant cells ofthe parietal yolk sac [Stacker and Achen, Growth Factors 77:1-11 (1999)].
  • VEGF-B described in detail in International Patent Publication No. WO
  • VEGF-A vascular endothelial growth factor-A
  • VEGF-B the biological functions of VEGF-B in vivo remain incompletely understood, it has been shown to have angiogenic properties, and may also be involved in cell adhesion and migration, and in regulating the degradation of extracellular matrix. It is expressed as two isoforms of 167 and
  • VEGF-B ]67 is associated with the cell surface or extracellular matrix via a heparin-binding domain, whereas VEGF-B 186 is secreted. Both VEGF-B 167 and VEGF-B 186 can form disulfide-linked homodimers or heterodimers with VEGF-A. The association to the cell surface of VEGF I65 -VEGF-B, 67 heterodimers appears to be determined by the VEGF-B component, suggesting that heterodimerization may be important for sequestering VEGF-A.
  • VEGF-B is expressed primarily in embryonic and adult cardiac and skeletal muscle tissues [Joukov et al., J Cell Physiol 173:211-215 (1997); Stacker and Achen, Growth Factors 77:1-11 (1999)]. Mice lacking VEGF-B survive but have smaller hearts, dysfunctional coronary vasculature, and exhibit impaired recovery from cardiac ischemia [Bellomo et al, Circ Res 2000;E29-E35].
  • a fourth member ofthe VEGF subfamily, VEGF-C comprises a VHD that is approximately 30% identical at the amino acid level to VEGF-A.
  • VEGF-C is originally expressed as a larger precursor protein, prepro-VEGF-C, having extensive amino- and carboxy-terminal peptide sequences flanking the VHD, with the C- terminal peptide containing tandemly repeated cysteine residues in a motif typical of Balbiani ring 3 protein.
  • Prepro-VEGF-C undergoes extensive proteolytic maturation involving the successive cleavage of a signal peptide, the C-terminal pro-peptide, and the N-terminal pro-peptide.
  • VEGF-C protein consists of a non-covalently- linked homodimer, in which each monomer contains the VHD.
  • the intermediate forms of VEGF-C produced by partial proteolytic processing show increasing affinity for the VEGFR-3 receptor, and the mature protein is also able to bind to the VEGFR- 2 receptor.
  • a mutant VEGF-C in which a single cysteine at position 156 is either substituted by another amino acid or deleted, loses the ability to bind VEGFR-2 but remains capable of binding and activating VEGFR-3
  • VEGF-C vascular endothelial growth factor-C mRNA
  • allantois jugular area
  • metanephros VEGF-C mRNA
  • VEGF-C is involved in the regulation of lymphatic angiogenesis: when VEGF-C was overexpressed in the skin of transgenic mice, a hyperplastic lymphatic vessel network was observed, suggesting that VEGF-C induces lymphatic growth [Jeltsch et al, Science, 276:1423-1425 (1997)].
  • VEGF-C also shows angiogenic properties: it can stimulate migration of bovine capillary endothelial (BCE) cells in collagen and promote growth of human endothelial cells [see, e.g., International Patent Publication No. WO 98/33917, incorporated herein by reference].
  • BCE bovine capillary endothelial
  • VEGF-D is structurally and functionally most closely related to VEGF-C [see International Patent Publ. No. WO 98/07832, incorporated herein by reference]. Like VEGF-C, VEGF-D is initially expressed as a prepro-peptide that undergoes N- terminal and C-terminal proteolytic processing, and forms non-covalently linked dimers. VEGF-D stimulates mitogenic responses in endothelial cells in vitro. During embryogenesis, VEGF-D is expressed in a complex temporal and spatial pattern, and its expression persists in the heart, lung, and skeletal muscles in adults. Isolation of a biologically active fragment of VEGF-D designated VEGF-D ⁇ N ⁇ C, is described in
  • VEGF-D ⁇ N ⁇ C consists of amino acid residues 93 to 201 of VEGF-D linked to the affinity tag peptide FLAG .
  • VEGF-E and NZ2 VEGF are potent mitogens and permeability enhancing factors. Both show approximately 25% amino acid identity to mammalian VEGF-A, and are expressed as disulfide-liked homodimers. Infection by these viruses is characterized by pustular dermititis which may involve endothelial cell proliferation and vascular permeability induced by these viral VEGF proteins. [Ferrara, J Mol Med 77:527-543 (1999); Stacker and Achen, Growth Factors 17:1-11 (1999)] .
  • VEGF-like proteins have also been identified from two additional strains ofthe orf virus, D1701 [GenBank Ace. No. AF106020; described in Meyer et al, EMBO J 18:363-314 (1999)] and NZ10 [described in International Patent Application PCT/US99/25869, mcorporated herein by reference]. These viral VEGF-like proteins have been shown to bind VEGFR-2 present on host endothelium, and this binding is important for development of infection and viral induction of angiogenesis [Meyer et al, EMBO J 18:363-314 (1999); International Patent Application PCT/US99/25869].
  • PDGF/VEGF Receptors Seven cell surface receptors that interact with PDGF/VEGF family members have been identified. These include PDGFR- (see e.g., GenBank Ace. No. NM006206) , PDGFR- ⁇ (see e.g., GenBanlc Ace. No. NM002609), VEGFR-l/Flt-1 ( fms-like tyrosine kinase-1; GenBanlc Ace. No. X51602; De Vries et al, Science 255:989-991 (1992)); VEGFR-2/KDR/Flk-l (kinase insert domain containing receptor/fetal liver kinase-1 ; GenBank Ace. Nos. X59397 (Flk-1) and L04947 (KDR);
  • VEGF 121 , VEGF j65 , VEGF-B, P1GF-1 and P1GF-2 bind VEGF-R1; VEGF 121 , VEGF 145 , VEGF 165 , VEGF- C, VEGF-D, VEGF-E, and NZ2 VEGF bind VEGF-R2; VEGF-C and VEGF-D bind VEGFR-3; VEGF 165 , P1GF-2, and NZ2 VEGF bind neuropilin-1; and VEGF I65 binds neuropilin-2. [Neufeld et al, FASEB J 13:9-22 (1999); Stacker and Achen, Growth
  • the PDGF receptors are protein tyrosine kinase receptors (PTKs) that contain five immuno globulin-like loops in their extracellular domains.
  • PTKs protein tyrosine kinase receptors
  • VEGFR-1, VEGFR-2, and VEGFR-3 comprise a subgroup ofthe PDGF subfamily of PTKs, distinguished by the presence of seven Ig domains in their extracellular domain and a split kinase domain in the cytoplasmic region.
  • Both neuropilin-1 and neuropilin-2 are non-PTK VEGF receptors.
  • NP-1 has an extracellular portion includes a MAM domain; regions of homology to coagulation factors V and VIII, MFGPs and the DDR tyrosine kinase; and two CUB-like domains.
  • VEGFR-1 vascular endothelial growth factor-1
  • VEGFR-1 a soluble isoform of VEGFR-1 lacking the seventh Ig-like loop, transmembrane domain, and the cytoplasmic region is expressed in human umbilical vein endothelial cells.
  • This VEGFR-1 isoform binds VEGF-A with high affinity and is capable of preventing VEGF-A-induced mitogenic responses [Ferrara, J Mol Med 77:521-543
  • VEGFR-3 A C-terminal truncated from of VEGFR-2 has also been reported [Zachary, Intl J Biochem Cell Bio 30:1169-1174 (1998)].
  • isoforms ofthe VEGFR-3 protein which differ in the length of their C-terminal ends. Studies suggest that the longer isoform is responsible for most ofthe biological properties of VEGFR-3.
  • the receptors for the PDGFs, PDGF ⁇ -receptor (PDGFR- ⁇ ) and the ⁇ -receptor (PDGFR- ⁇ ), are expressed by many in vitro grown cell lines, and they are mainly expressed by mesenchymal cells in vivo (reviewed in [Raines et al., Peptide growth factors and their receptors, Heidelberg, Springer- Verlag (1990)].
  • PDGF-B binds both PDGFRs, while PDGF-A selectively binds PDGFR- ⁇ .
  • PDGFR- ⁇ deficient mice die during embryogenesis at elO, and show incomplete cephalic closure, impaired neural crest development, cardiovascular defects, skeletal defects, and odemas.
  • the PDGFR- ⁇ deficient mice develop similar phenotypes to animals deficient in PDGF-B, that are characterized by renal, hematological and cardiovascular abnormalities; where the renal and cardiovascular defects, at least in part, are due to the lack of proper recruitment of mural cells (vascular smooth muscle cells, pericytes or mesangial cells) to blood vessels.
  • mural cells vascular smooth muscle cells, pericytes or mesangial cells
  • VEGFR-1 vascular endothelial cells
  • monocytes trophoblast cells
  • renal mesangial cells vascular endothelial cells
  • High levels of VEGFR-1 mRNA are also detected in adult organs, suggesting that VEGFR-1 has a function in quiescent endothelium of mature vessels not related to cell growth.
  • VEGFR-1-/- mice die in utero between day 8.5 and 9.5. Although endothelial cells developed in these animals, the formation of functional blood vessels was severely impaired, suggesting that VEGFR-1 may be involved in cell-cell or cell-matrix interactions associated with cell migration.
  • mice expressing a mutated VEGFR-1 in which only the tyrosine kinase domain was missing show normal angiogenesis and survival, suggesting that the signaling capability of VEGFR-1 is not essential.
  • VEGFR-2 expression is similar to that of VEGFR-1 in that it is broadly expressed in the vascular endothelium, but it is also present in hematopoietic stem cells, megakaryocytes, and retinal progenitor cells [Neufeld et al, FASEB J 13:9-22 (1999)]. Although the expression pattern of VEGFR-1 and VEGFR-2 overlap extensively, evidence suggests that, in most cell types, VEGFR-2 is the major receptor through which most ofthe VEGFs exert their biological activities. Examination of mouse embryos deficient in VEGFR-2 further indicate that this receptor is required for both endothelial cell differentiation and the development of hematopoietic cells [Joukov et al, J Cell Physiol 173:211-215 (1997)].
  • VEGFR-3 is expressed broadly in endothelial cells during early embryogenesis. During later stages of development, the expression of VEGFR-3 becomes restricted to developing lymphatic vessels [Kaipainen, A., et al, Proc. Natl
  • VEGFR-3 In adults, the lymphatic endothelia and some high endothelial venules express VEGFR-3, and increased expression occurs in lymphatic sinuses in metastatic lymph nodes and in lymphangioma. VEGFR-3 is also expressed in a subset of CD34 + hematopoietic cells which may mediate the myelopoietic activity of VEGF-C demonstrated by overexpression studies [WO 98/33917]. Targeted disruption ofthe VEGFR-3 gene in mouse embryos leads to failure ofthe remodeling ofthe primary vascular network, and death after embryonic day 9.5 [Dumont et al., Science, 282: 946-949 (1998)].
  • VEGFR-3 in the development ofthe embryonic vasculature, and also during lymphangiogenesis.
  • Structural analyses ofthe VEGF receptors indicate that the VEGF-A binding site on VEGFR-1 and VEGFR-2 is located in the second and third Ig-like loops.
  • the VEGF-C and VEGF-D binding sites on VEGFR-2 and VEGFR-3 are also contained within the second Ig-l op [Taipale et al, Curr Top Microbiol Immunol 237:85-96 (1999)].
  • the second Ig-like loop also confers ligand specificity as shown by domain swapping experiments [Ferrara, J Mol Med 77:521-543 (1999)].
  • VEGFR-1 and also possibly on VEGFR-2, acts as the receptor dimerization domain that links two receptor molecules upon binding ofthe receptors to a ligand dimer [Ferrara, J Mol Med.77:521-543 (1999)].
  • VEGF-A that bind VEGFR-1 and VEGFR-2 overlap to a large extent, studies have revealed two separate domains within VEGF-A that interact with either VEGFR-1 or VEGFR-2, as well as specific amino acid residues within these domains that are critical for ligand-receptor interactions. Mutations within either VEGF receptor- specific domain that specifically prevent binding to one particular VEGF receptor have also been recovered [Neufeld et al, FASEB J 13:9-22 (1999)].
  • VEGFR-1 and VEGFR-2 are structurally similar, share common ligands (VEGF 121 and VEGF 165 ), and exhibit similar expression patterns during development. However, the signals mediated through VEGFR-1 and VEGFR-2 by the same ligand appear to be slightly different. VEGFR-2 has been shown to undergo autophosphorylation in response to VEGF-A, but phosphorylation of VEGFR-1 under identical conditions was barely detectable.
  • VEGFR-2 mediated signals cause striking changes in the morphology, actin reorganization, and membrane Riffling of porcine aortic endothelial cells recombinantly overexpressing this receptor, hi these cells, VEGFR-2 also mediated ligand-induced chemotaxis and mitogenicity; whereas VEGFR-1 -transfected cells lacked mitogenic responses to VEGF-A. Mutations in
  • VEGF-A that disrupt binding to VEGFR-2 fail to induce proliferation of endothelial cells, whereas VEGF-A mutants that are deficient in binding VEGFR-1 are still capable of promoting endothelial proliferation.
  • VEGF stimulation of cells expressing only VEGFR-2 leads to a mitogenic response whereas comparable stimulation of cells expressing only VEGFR-1 also results in cell migration, but does not induce cell proliferation.
  • phosphoproteins co-precipitating with VEGFR-1 and VEGFR-2 are distinct, suggesting that different signaling molecules interact with receptor-specific intracellular sequences.
  • VEGFR-1 in angiogenesis may be to negatively regulate the activity of VEGF-A by binding it and thus preventing its interaction with VEGFR-2, whereas VEGFR-2 is thought to be the main transducer of VEGF-A signals in endothelial cells.
  • mice deficient in VEGFR-1 die as embryos while mice expressing a VEGFR-1 receptor capable of binding VEGF-A but lacking the tyrosine kinase domain survive and do not exhibit abnormal embryonic development or angiogenesis.
  • analyses of VEGF-A mutants that bind only VEGFR-2 show that they retain the ability to induce mitogenic responses in endothelial cells.
  • VEGF-mediated migration of monocytes is dependent on VEGFR-1, indicating that signaling through this receptor is important for at least one biological function.
  • the ability of VEGF-A to prevent the maturation of dendritic cells is also associated with
  • VEGFR-1 signaling suggesting that VEGFR-1 may function in cell types other than endothelial cells.
  • Neuropilin-1 was originally cloned as a receptor for the collapsin/semaphorin family of proteins involved in axon guidance [Stacker and Achen, Growth Factors
  • Neuropilin-2 was identified by expression cloning and is a collapsin/semaphorin receptor closely related to neuropilin-1.
  • Neuropilin-2 is an isoform-specific VEGF receptor in that it only binds VEGF 165 .
  • VEGF 165 Like neuropilin-1 , neuropilin-2 is expressed in both endothelia and specific neurons, and is not predicted to function independently due to its relatively short intracellular domain. The function of neuropilin-2 in vascular development is unknown [Neufeld et al, FASEB J 13:9-22 (1999); WO 99/30157].
  • VEGF-A as a key regulator of vascular development has spurred active research using VEGF-based therapeutic angiogenesis in cardiovascular medicine, as well as for treating diseases characterized by pathological angiogenesis with VEGF antagonists. Subsequent identification of additional VEGF family proteins and their roles in vascularization have also led to the development of therapies based on these growth factors [Ferrara and Alitalo, Nature Med 5:1359-1364 (1999)]. Animal studies of hindlimb ischemia, and myocardial ischemia using VEGF- A or VEGF-C, delivered by administration of recombinant protein or gene transfer using naked DNA or adenoviral vectors, implicate these molecules in promoting vascularization and increasing coronary blood flow.
  • VEGF growth factors include using VEGF-C to promote lymphangiogenesis in patients whose axillary lymph nodes were removed during breast carcinoma surgery.
  • therapies using combinations of growth factors to promote vascularization in tissues may also prove to be preferable in treating certain diseases [Ferrara and Alitalo, Nature Med 5:1359-1364 (1999)].
  • Therapies based on inhibiting the activity of VEGF growth factors are being tested to treat disease states characterized by pathological angiogenesis. VEGF expression is upregulated in most human tumors including primary breast cancer and gastric carcinoma.
  • Phase II studies using rhuMAb VEGF to treat non-small cell lung carcinoma, colorectal carcinoma, breast, and renal cell carcinoma are currently ongoing.
  • Compounds targeting inhibition of VEGF-C activity are also being tested for therapeutic uses in cancer patients: small molecule inhibitors of VEGF-C are in Phase II trials, and monoclonal antibodies against VEGF-C are entering clinical trials.
  • Retinopathy associated with diabetes mellitus, occlusion of central retinal vein or prematurity has been correlated with increased levels of VEGF-A.
  • Animal studies using monoclonal antibodies against VEGF-A or soluble VEGFR-1 or VEGFR-2 mutants containing only the extracellular domain fused to immunoglobulin ⁇ Fc domain show suppression of retinal angiogenesis.
  • VEGF-A is also detected in age- related macular degeneration (AMD), and its expression is thought to be the cause of neovascularization in this disease.
  • AMD age-related macular degeneration
  • Intravitreal delivery of recombinant humanized anti-VEGF-A Fab antibody fragment or injection of 2'-fluoropyrimidine RNA oligonucleotide ligands (aptamers) to treat AMD are currently in clinical trials.
  • Compounds that inhibit the activity of VEGF growth factors may also be used to treat other disease states involving abnormal angiogenesis.
  • ischemic- reperfusion related brain edema and injury include ischemic- reperfusion related brain edema and injury, conditions associated with ovarian hyperplasia and hypervascularity such as the polycystic ovary syndrome, endometriosis, and ovarian hyperstimulation syndrome [Ferrara and Alitalo, Nature Med 5:1359-1364 (1999)].
  • VEGF family of growth factors, and inhibitors thereof have tremendous potential as therapeutics.
  • growth factors and inhibitors are useful to promote or inhibit angiogenesis where needed, such as in the treatment of ischemic disorders, the promotion of wound healing, or the inhibition or elimination of neoplastic disorders that are angiogenesis-dependent.
  • the various naturally-occumng members of this growth factor family often bind multiple receptors, and the various known receptors are expressed on multiple cell types and have expression patterns that may vary depending on stage of development and the presence or absence of pathological conditions.
  • the biological effects of any particular growth factor may be receptor- dependent, isoform dependent, and cell-type dependent.
  • a desirable therapeutic effect mediated through one receptor may be accompanied by undesirable side-effects mediated through another receptor.
  • a desirable therapeutic effect might be enhanced through stimulation of multiple receptors that cannot be stimulated with any single known growth factor that occurs in nature. Therefore, a need exists for novel peptide growth factors with their own unique profile of receptor binding and receptor-stimulating or receptor-inhibiting activities.
  • the present invention satisfies needs identified above by providing novel polypeptide binding molecules for naturally occurring vascular endothelial growth factor receptors, and polynucleotides that encode the novel polypeptides and are useful for recombinant expression ofthe polypeptides.
  • vascular endothelial growth factor and the abbreviation
  • VEGF Vascular Endothelial Growth Factor-A
  • VEGF-B Vascular Endothelial Growth Factor-B
  • VEGF-C Vascular Endothelial Growth Factor-C
  • VEGF-D Vascular Endothelial Growth Factor-D
  • PDGF-A Platelet Derived Growth Factor-A
  • VEGF-A is commonly referred to in the art as "Vascular Endothelial Growth Factor” or as "VEGF,” but for clarity shall be referred to herein as VEGF-A or referred to as specific isoforms (e.g., VEGF 165 ) of VEGF-A.
  • the invention provides a chimeric polypeptide comprising a plurality of peptide subunits derived from two or more naturally-occurring vertebrate vascular endothelial growth factor polypeptides that have different vascular endothelial growth factor receptor binding profiles, wherein the chimeric polypeptide binds at least one receptor of one ofthe naturally-occurring vascular endothelial growth factor polypeptides, and wherein the chimeric polypeptide has a different receptor binding profile than the naturally-occurring growth factor polypeptides. Isolated and purified chimeric polypeptides are preferred.
  • naturally-occurring vertebrate vascular endothelial growth factor polypeptides means polypeptides having the following characteristics: (1) the polypeptide is encoded by genomic DNA of a vertebrate (e.g. , a reptile, amphibian, bird, or mammal, preferably a bird or mammal, most preferably a mammal; especially a primate mammal such as a monkey, ape, or human) or is encoded by the genome of a vertebrate pathogen such as mammalian pox viruses;
  • a vertebrate e.g. , a reptile, amphibian, bird, or mammal, preferably a bird or mammal, most preferably a mammal; especially a primate mammal such as a monkey, ape, or human
  • a vertebrate pathogen such as mammalian pox viruses
  • the polypeptide comprises all or a portion of an amino acid sequence that is expressed by a vertebrate (i.e., from transcription/translation ofthe vertebrate's genomic DNA or from virally-induced transcription/translation, in the case of polypeptides encoded by viral nucleic acids);
  • the polypeptide or portion comprises a VEGF/PDGF homology domain (V/PHD) of about 70-150 amino acids that binds to naturally-occurring receptors and that is characterized in part by the amino acid motif: C-X(18-28)-P-X-C-X(4)-R-C-X- G-C(l-2)-X(6-12)-C-X(30-46)-C, where X represents any amino acid and numbers in parentheses represent a permissible range of amino acids (e.g., X(18-28) represents a stretch of any 18-28 amino acids; C(l-2) represents one or two cysteine residues).
  • V/PHD VEGF/PDGF homology domain
  • the V/PHD usually includes eight conserved cysteines which form a cysteine knot motif similar to that found in human Vascular Endothelial Growth Factors A, B, C, and D (VEGF-A, -B, -C, and -D), and human platelet-derived growth factors
  • Preferred polypeptides or portions comprise a V/PHD that is characterized by the more particular amino acid motif C-X(22-24)-P-[PSR]-C-V-X(3)-R-C-X-G-C- C-X(6)-C-X(32-41)-C, where amino acids in brackets (e.g., [PSR]) represent alternatives for a single position in the amino acid sequence; and (4) the polypeptide binds to at least one cell surface receptor that is expressed on endothelial cells that line vertebrate blood or lymphatic vessels or pericytes/smooth muscle cells that line and support blood vessels. Preferred polypeptides bind to a least one cell surface receptor that is expressed on endothelial cells.
  • naturally-occurring vertebrate VEGF polypeptides means polypeptides that have certain specified structural and functional properties. The term is not intended in this context to imply a source of origin. Thus, recombinantly produced polypeptides that satisfy the above criteria because they have an amino acid sequences and receptor binding properties of VEGF polypeptides that exist in nature are considered “naturally-occurring”.
  • vascular endothelial growth factor polypeptides are already known in the art, including but not limited to human Vascular Endothelial Growth Factor-A (VEGF-A), Vascular Endothelial Growth Factor-B (VEGF-B), Vascular Endothelial Growth Factor-C (VEGF-C), Vascular Endothelial Growth Factor-D (VEGF-D), Platelet Derived Growth Factor-A (PDGF-A), Platelet Derived Growth Factor-B (PDGF-B), Placenta Growth Factor (PIGF); mammalian and avian orthologs thereof (where the tenn "ortholog” means species homolog); and Vascular Endothelial Growth Factor E
  • VEGF-E vascular endothelial growth factor-like protein
  • NZ2 VEGF NZ2 VEGF
  • the two VEGF-like proteins identified in strains D1701 and NZ10 which have been identified in poxviruses.
  • the use of naturally occurring human VEGF's is preferred for the purposes of developing chimeric molecules that are useful as human therapeutics, in order to minimize the likelihood of developing chimerics that generate an immune response in humans.
  • non-human naturally occurring VEGFs also can be used to generate chimeric molecules for use in treating humans.
  • VEGF-A/VEGF- C chimeric polypeptides chimeric polypeptides derived from any pair, or three, or four, or more ofthe VEGFs described herein or their species orthologs is particularly contemplated.
  • the tenn "chimeric requires that the amino acid sequence ofthe chimeric molecule include at least one stretch of one or more amino acids (preferably stretches of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13,
  • chimeric polypeptide is a "hybrid'Or “mosaic” of two or more polypeptides.
  • “chimeric” is meant that the polypeptide of the invention is not identical to any naturally occurring VEGF sequence (or fragment of a natural VEGF sequence).
  • the te ⁇ ri "derived from” means that, when the amino acid sequences ofthe chimeric polypeptide and the two or more naturally occurring VEGF's are aligned using a standard algorithm, substantially all of the amino acids in the chimeric polypeptide are aligned with an identical residue in one or more ofthe naturally occurring VEGF's from which the chimeric was derived.
  • Standard protein alignment algorithms for example, the clustral method [Nucl Acids Res 22:4673-80 (1994)], the Jotun-Hein method [Methds Enzymol 753:626-645 (1990)], or the Feng-Doolittle method [JMol Evol 25:351-360 (1987)], can be used to align naturally-occurring vertebrate vascular endothelial growth factor polypeptides, such alignments being greatly facilitated by the presence ofthe eight highly conserved cysteines dispersed through the V/PHD.
  • a chimeric polypeptide is "derived from" two or more naturally occurring VEGF's by performing an alignment using any generally accepted protein alignment algorithm.
  • the use ofthe term "substantially all” reflects the fact that techniques described herein for making chimeric polypeptides will sometimes introduce mutations such as insertions, deletions, or substitutions, preventing 100%) correlation to parent sequences, i such cases, at least about 90%, 92%, 94%, 95%. 96%, 97%, 98%, or 99%> ofthe residues of the chimeric polypeptide will align with identical residues from at least one ofthe natural VEGF's.
  • the te ⁇ n "plurality of peptide subunits” means two or more peptide subunits.
  • chimeric polypeptides obtained by fragmenting two naturally occurring VEGF cDNA's (human VEGF-A and human VEGF-C) into nine subunits of about 8-16 codons each, recombining these fragments into all 512 penr tations ofthe nine subunits (maintaining subunit order), and expressing the resultant chimeric cDNAs.
  • the number and the size of fragments is not intended as a critical feature, hi prefened embodiments, plurality comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
  • vascular endothelial growth factor receptor binding profile means the detenriination ofthe receptors to which a polypeptide will bind and the receptors to which it will not.
  • VEGF receptors including VEGFR-1, VEGFR-2, and VEGFR-3, are described in greater detail elsewhere herein.
  • Known PDGF receptors are also described in greater detail elsewhere herein.
  • a chimeric polypeptide has been derived in part from a naturally occurring PDGF sequence
  • screening the chimeric polypeptide for binding to PDGF receptors is contemplated as part ofthe receptor binding profile determination.
  • the chimeric polypeptide has a different receptor binding profile than either of its parent molecules if it binds to only one ofthe three receptors, or if it binds to all three receptors, or if it binds to VEGFR-1 and VEGFR-3 but not VEGFR-2.
  • the invention provides chimeric polypeptides wherein the chimeric polypeptide binds to at least two VEGF receptors bound by the two or more naturally occuning vertebrate VEGF polypeptides, and wherein each ofthe naturally-occurring VEGF polypeptides from which the chimeric polypeptide was derived fail to bind to one or more ofthe at least two VEGF polypeptides.
  • NP-1 binding is mediated by amino acid residues 142 to 185 of SEQ ID NO: 2 for VEGF-A, and amino acid residues 138 to 182 for VEGF-B [Soker et al, J Biol Chem 271:5161-1 (1996); Makinen et al, J Biol Chem 274:21211-22 (1999)].
  • addition of upstream or downstream sequences to chimeric polypeptides ofthe invention is contemplated, and some added sequences are contemplated to result in NP-1 or NP-2 binding.
  • VEGF polypeptides that are capable of binding to all of VEGFR-1, VEGFR-2, and VEGFR-3. All polypeptides having this receptor binding profile are intended as within the scope ofthe invention.
  • Naturally occuning VEGF polypeptides generally bind their respective receptors with high affinity, which is generally understood in this context to mean binding with a sub-nanomolar dissociation constant.
  • VEGF-A binds VEGFR-1 and VEGFR-2 with Kd of approximately 16 pM and 760 pM, respectively
  • VEGF-C binds VEGFR-2 and VEGFR-3 with Kd of approximately 410 pM and 135 pM, respectively.
  • chimeric polypeptides having less receptor affinity i.e., higher dissociation constants
  • a 50 nanomolar dissociation constant cutoff is selected.
  • Chimeric polypeptides ofthe invention include chimeric (hybrid) receptor binding domains as explained in the preceding paragraphs, and optionally may include additional upstream or downstream sequences from naturally occuning VEGF's, including upstream and downstream sequences that are present in mature isofonns of naturally occuning circulating VEGF's; and/or upstream or downstream pro-peptide sequences that are removed during normal intracellular or extracellular processing.
  • Chimeric polypeptides described in Example 1 were prepared using residues 34-135 (SEQ ID NO: 2) of VEGF-A and using 112- 216 of human prepro-VEGF-C (SEQ FD NO: 22).
  • Chimeric polypeptides ofthe invention include the peptides actually exemplified, and also include such peptides modified by the addition of upstream or downstream VEGF-A or VEGF-C sequences from SEQ FD NOs: 2 or 22.
  • VEGF-A/VEGF-C chimeric polypeptides as exemplified herein, the addition of upstream and downstream sequences that conespond with amino- and/or carboxyl- terminal sequences characteristic of natural VEGF-A or VEGF-C isoforms is particularly contemplated. It is also well known in the literature to recombinantly express proteins with an initiator methionine, with a heterologous signal peptide, with one or more tag sequences to facilitate purification, as fusions with other polypeptides, and the like.
  • Chimeric polypeptides according to the invention may comprise any such modifications and additions to the amino acid sequence derived from two or more naturally-occu ⁇ ing vertebrate vascular endothelial growth factor polypeptides. h addition to chimeric molecules having different receptor binding profiles, an additional aspect ofthe invention includes chimeric molecules having increased receptor binding affinity.
  • the invention provides a chimeric polypeptide comprising a plurality of peptide subunits derived from two or more naturally- occuning vertebrate vascular endothelial growth factor polypeptides, wherein the chimeric polypeptide binds at least one naturally-occu ⁇ ing vascular endothelial growth factor receptor with an increased binding affinity compared to the binding affinity ofthe two or more naturally-occurring vascular endothelial growth factors for the receptor.
  • Chimeric molecules that bind a receptor with greater affinity than naturally occuning VEGF's are among the prefened chimeric molecules ofthe invention, even if the receptor binding profile for the chimeric molecules is identical to that of a naturally occuning VEGF.
  • K d dissociation constants
  • Chimeras that show a twenty percent reduction in K d (i.e., increased binding affinity) with respect to a VEGF receptor are prefened. Reductions of 33% or 50% are highly prefened.
  • a 3-fold reduction e.g., a K j of 33.3 pM for a chimeric polypeptide compared to a 100 pM K d of a naturally occurring VEGF
  • Another related prefened class of chimeric molecules are those molecules that display any reduction in EC 50 concentration that is statistically significant at a level of p ⁇ 0.05 in side-by-side tests compared to naturally-occurring molecules from which the chimera was derived.
  • Chimeras that show a twenty percent reduction in EC 50 (i.e., increased binding affinity) with respect to a VEGF receptor are prefened. Reductions of 33% or 50% are highly prefened.
  • EC 50 or the half effective concentration, is the concentration that produces 50% of a maximal effect.
  • An exemplary assay for determining the EC 50 of a putative ligand for a specific receptor is set forth in Example 6, below.
  • hybrid polypeptides ofthe invention are polypeptides that comprise an amino acid sequence ofthe formula:
  • X comprises an amino acid sequence selected from the group consisting of amino acids 3-11 of SEQ FD NO: 128 and amino acids 3-11 of SEQ ID NO:137; wherein X 2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 129 and 138; wherein X 3 comprises an amino acid sequence selected from the group consisting of SEQ FD NOs: 130 and 139; wherein X 4 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 131 and 140; wherein X 5 comprises an amino acid sequence selected from the group consisting of SEQ FD NOS: 132 and 141; wherein X 6 comprises an amino acid sequence selected from the group consisting of SEQ FD NOs: 133 and 142; wherein X 7 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:
  • X 8 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 135 and 144
  • X 9 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 136 and 145; wherein NH 2 -X r X 2 -X 3 -X 4 - X 5 -X 6 -X 7 -X 8 -X 9 -COOH is not identical to amino acids 34 to 135 of SEQ ID NO: 2 or amino acids 112 to 216 of SEQ ID NO: 22; and wherein the polypeptide binds to at least one receptor selected from the group consisting of human VEGFR-1, human VEGFR-2, and human VEGFR-3.
  • each ofthe specified amino acid sequence pairs (e.g., SEQ ID NO: 128 and 137) are encoded by a VEGF-A cDNA fragment or a VEGF-C cDNA fragment that align with each other when the receptor binding domains of VEGF-A and VEGF-C are aligned to maximize sequence homology, using standard alignment algorithms.
  • one prefened subgenus comprises those polypeptides which bind to exactly one receptor selected from the group consisting of human VEGFR-1, human VEGFR-2, and human VEGFR-3.
  • Another prefened subgenus comprises those hybrid polypeptides that bind to VEGFR-1 and VEGFR-3, but not to VEGFR-2.
  • Initial screens suggest that the following specific constmcts satisfy this criteria: 12-9, 12-13, 14-9, 82-9, 82-13, 84-9.
  • a highly prefened subgenus comprises hybrid polypeptides ofthe invention that bind VEGFR- 1 , VEGFR-2, and VEGFR-3.
  • Initial screens suggest that the following specific constmcts satisfy this criteria: 12-7, 12-11, 82-11, 84-11.
  • hybrid polypeptides that bind VEGFR-1 and VEGFR-2 both of which are bound by VEGF-A
  • VEGFR-3 hybrid polypeptides that bind VEGFR-2 and VEGFR-3 (both of which are bound by fully processed VEGF-C) but not VEGFR- 1.
  • the fourth fragment (X 4 ) appears to include residues that are important for conferring VEGFR-3 binding affinity.
  • another prefened genus ofthe hybrid polypeptides are those wherein X 4 comprises SEQ JJD NO: 140, and wherein the polypeptide binds to VEGFR-3. Fragments 5 and 8 of VEGF-C also appear to contribute to VEGFR-3 binding.
  • highly prefened are polypeptides further characterized by X 5 comprising SEQ ID NO: 141, and/or X 8 comprising SEQ ID NO: 144.
  • X 2 comprises SEQ ID NO: 129
  • X 7 comprises SEQ ID NO: 134
  • a prefened constmct is one wherein X 4 comprises SEQ ID NO: 140.
  • X 5 comprises SEQ ID NO: 141
  • X 8 comprises SEQ ID NO: 144.
  • the invention provides a polypeptide comprising an amino acid sequence of the formula X N - V/PHD - X c , wherein X N is selected from the group consisting of amino acids 1-34 of SEQ ID NO: 2, amino acids 1-111 of SEQ ID NO: 22, amino acids 1-34 of SEQ FD NO: 147, or fragments thereof; wherein V/PHD is a chimeric polypeptide as described elsewhere herein; wherein X c is selected from the group consisting of amino acids 136-191 of SEQ ID NO: 2, amino acids 217-419 of SEQ ID NO: 22, amino acids 136-232 of SEQ ID NO: 147, or fragments thereof; and ⁇ wherein X N and X c are each identical to amino acid sequence in a naturally occuning human VEGF-A or VEGF-C precursor protein or a naturally occuning human VEGF-A or VEGF-C isoform.
  • the invention provides hybrid polypeptides as described above, wherein the polypeptide further includes one or more amino acid sequences selected from the group consisting of a prepro-VEGF-C signal peptide, a prepro-VEGF-C amino-te ⁇ ninal propeptide, and a prepro-VEGF-C carboxy-terminal pro-peptide.
  • hybrid polypeptides ofthe invention is not restricted to expression only with naturally-occurring flanking VEGF-A or VEGF-C sequences, however.
  • Expression of polypeptides ofthe invention in bacteria may be accomplished by including an initiator methionine or methionine-lysine upstream of the hybrid VEGF sequences, whereas expression and secretion in mammalian cells is most conveniently accomplished by including at least a signal peptide.
  • the invention provides a polypeptide as described above, wherein the polypeptide further includes an amino terminal methionine residue or an amino- terminal Met-Lys sequence.
  • the polypeptide further includes a signal peptide amino acid sequence connected to the amino acid sequence ofthe formula NH 2 -X , -X 2 -X X 4 -X 5 -X 6 -X 7 -X 8 -X 9 -COOH.
  • polypeptides of the invention as fusions with other heterologous sequences, such as tag sequences to facilitate purification or expression as part of larger fusion peptides also is contemplated.
  • An exemplary tag of this type is a poly- histidine sequence, generally around six histidine residues, that permits isolation of a compound so labeled using nickel chelation.
  • Other labels and tags such as the FLAG tag (Eastman Kodak, Rochester, NY), well known and routinely used in the art, are embraced by the invention.
  • Exemplary fusions include use of commercially available vectors that express a desired polypeptide as part of glutathione-S-transferase (GST) fusion product.
  • GST glutathione-S-transferase
  • the present application also provides variants (analogs) ofthe hybrid polypeptides ofthe invention, wherein one or more amino acids ofthe hybrid peptide amino acid sequence has been added, deleted, or substituted by another amino acid, and wherein the hybrid retains the receptor binding and/or a biological activity characteristic ofthe hybrid polypeptide.
  • substitution variants wherein merely conservative substitutions have been introduced (e.g., by modification of polynucleotides encoding polypeptides ofthe invention) are intended as equivalents of hybrid polypeptides ofthe invention.
  • Amino acids can be classified according to physical properties and contribution to secondary and tertiary protein stmcture.
  • a conservative substitution is recognized in the art as a substitution of one amino acid for another amino acid that has similar properties.
  • Exemplary conservative substitutions based on amino acid side chain properties are set out in the table immediately below, using standard one letter abbreviations.
  • conservative amino acids can be grouped as described in Lehninger, [Biochemistiy, Second Edition; Worth Publishers, Inc. NY:NY (1975), pp.71-77] as set out in the table immediately below.
  • the effects of any individual or small group of amino acid changes is unlikely to significantly alter biological properties, especially if the changes are conservative substitutions, provided the changes are not introduced at critical residues.
  • Prefened variants ofthe hybrid polypeptides ofthe invention share at least about 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid identity with hybrids that consist entirely of amino acid sequences derived from naturally occurring VEGF's.
  • Prefened methods to determine identity and/or similarity are designed to give the largest match between the sequences tested. Methods to determine identity and similarity are described in publicly available computer programs. Prefened computer program methods to determine identity and similarity between two sequences include, but are not limited to, the GCG program package, including GAP (Devereux et al., Nucl. Acid. Res., 12:387 (1984); Genetics Computer Group, University of Wisconsin, Madison, WI), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol. Biol., 215:403-410 (1990)). The BLASTX program is publicly available from the National GCG program package, including GAP (Devereux et al., Nucl. Acid. Res., 12:387 (1984); Genetics Computer Group, University of Wisconsin, Madison, WI), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol. Biol., 215:403-410 (1990
  • NCBI Biotechnology Infonnation
  • Other sources BLAST Manual, Altschul et al. NCB/NLM/NIH Bethesda, MD 20894; Altschul et al., supra.
  • the well known Smith Waterman algorithm may also be used to determine identity.
  • Prefened parameters for a polypeptide sequence comparison include the following:
  • the invention provides a polypeptide comprising a non-naturally occuning vascular endothelial growth factor amino acid sequence, wherein said non-naturally occurring vascular endothelial growth factor amino acid sequence consists of an amino acid sequence that is at least 95% identical to an amino acid sequence ofthe formula:
  • X comprises an amino acid sequence selected from the group consisting of amino acids 3-11 of SEQ ID NO: 128 and amino acids 3-11- of SEQ ID NO: 137; wherein X 2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 129 and 138; wherein X 3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 130 and 139; wherein X 4 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 131 and 140; wherein X 5 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 132 and 141; wherein X 6 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 133 and 142; wherein X 7 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 134
  • NH 2 -X r X 2 -X 3 - X 4 -X 5 -X 6 -X 7 -X 8 -X 9 -COOH is not identical to amino acids 34 to 135 of SEQ ID NO: 2 or amino acids 112 to 216 of SEQ ID NO: 22.
  • non-naturally occuning vascular endothelial growth factor amino acid sequence is meant a sequence that is not identical to any known, naturally occurring amino acid sequence, such as, in this case, receptor binding domains from known VEGF-A or VEGF-C sequences.
  • the invention provides a polypeptide that comprises an amino acid sequence that is at least about 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identical to any specific amino acid sequence ofthe invention, and that binds at least one ofthe naturally-occurring vascular endothelial growth factor or platelet derived growth factor receptors, and that has a different receptor binding profile or an improved receptor binding affinity than a naturally-occurring growth factor polypeptide.
  • Polypeptides that satisfy the percent identity criteria and that display the same receptor binding profile as the referent polypeptide are especially contemplated.
  • the invention provides a polypeptide that comprises an amino acid sequence that is at least about 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequences encoded by constmcts 12-7 (SEQ ID NO: 63),
  • the invention provides a dimeric protein molecule comprising a first polypeptide associated with a second polypeptide, wherein at least one ofthe polypeptides is a polypeptide according to the present invention.
  • the association between the polypeptides may be by way of covalent bonding (e.g., disulfide bonding) or non-covalent bonding of polypeptide chains (e.g, hydrogen bonding, bonding due to stable or induced dipole-dipole interactions, bonding due to hydrophobic or hydrophilic interactions, combinations of these bonding mechanisms, and the like).
  • the invention provides polynucleotides (e.g., cDNA, cDNA with introns introduced to facilitate expression in eukaryotic systems, synthetic DNA, RNA, or combinations thereof, single or double stranded) that comprise a nucleotide sequence encoding the amino acid sequence ofthe polypeptides ofthe invention.
  • Purified and isolated polynucleotides are prefened. Due to the well- known degeneracy ofthe genetic code, several polynucleotides sequences exist that encode each polypeptide amino acid sequence ofthe invention. Such polynucleotides are useful for recombinantly expressing the polypeptides ofthe invention.
  • the invention also embraces polynucleotides that encode VEGF receptor binding polypeptides and that hybridize under moderately stringent or high stringency conditions to the complete non-coding strand, or complement, ofthe polynucleotides
  • VEGF receptor binding polypeptides This genus of polynucleotides embraces polynucleotides that encode polypeptides with one or a few amino acid differences (additions, insertions, or deletions) relative to amino acid sequences specifically taught herein. Such changes are easily introduced by performing site directed mutagenesis, for example, or by substituting a fragment from a non-human ortholog VEGF-A or VEGF-C polypeptide for a fragment of a human VEGF-A or VEGF-C polypeptide used to construct the hybrid polypeptides of the invention.
  • Exemplary highly stringent hybridization conditions are as follows: hybridization at 65°C for at least 12 hours in a hybridization solution comprising 5X
  • Low stringency washes can be achieved by using IX SSPE for the 15 minute wash at 65 °C, and omitting the final 10 minute wash. It is understood in the art that conditions of equivalent stringency can be achieved through variation of temperature and buffer, or salt concentration as described Ausubel, et al. (Eds.),
  • hybridization conditions can be empirically determined or precisely calculated based on the length and the percentage of guanosine/cytosine (GC) base pairing ofthe probe.
  • the hybridization conditions can be calculated as described in Sambrook et al, (Eds.), Molecular Cloning: A Laboratory Manual, Cold Spring
  • the invention provides a polynucleotide that comprises a nucleotide sequence that hybridizes under moderately stringent or high stringency hybridization conditions to any specific nucleotide sequence ofthe invention, and that encodes a polypeptide that binds at least one ofthe naturally-occurring vascular endothelial growth factor or platelet derived growth factor receptors, and that has a different receptor binding profile or an improved receptor binding affinity than a naturally- occu ⁇ ing growth factor polypeptide.
  • Polynucleotides that satisfy the hybridization criteria and that display the same receptor binding profile as the referent polynucleotide are especially contemplated.
  • the invention provides a polynucleotide that comprises. a nucleotide sequence that hybridizes under moderately stringent or high stringency hybridization conditions to the nucleotide sequences taught herein for constmcts 12-7 (SEQ ID NO: 62), 12-11 (SEQ ID NO: 70), 82-11, or 84-11, wherein the polynucleotide encodes a polypeptide that binds VEGFR-1, VEGFR-2, and VEGFR-3.
  • the invention provides a polynucleotide that comprises a nucleotide sequence that is at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to any specific nucleotide sequence ofthe invention, and that encodes a polypeptide that binds at least one ofthe naturally-occurring vascular endothelial growth factor or platelet derived growth factor receptors, and that has a different receptor binding profile or an improved receptor binding affinity than a naturally- occurring growth factor polypeptide.
  • Polynucleotides that satisfy the percent identity criteria and that display the same receptor binding profile as the referent polynucleotide are especially contemplated.
  • the invention provides a polynucleotide that comprises a nucleotide sequence that is at least 95% identical to the nucleotide sequences taught herein for constmcts 12-7 (SEQ ID NO: 62), 12-11
  • polynucleotide encodes a polypeptide that binds VEGFR-1, VEGFR-2, and VEGFR-3.
  • the invention provides vectors comprising a polynucleotide ofthe invention.
  • Such vectors are useful, e.g., for amplifying the polynucleotides in host cells to create useful quantities thereof.
  • the vector is an expression vector wherein the polynucleotide ofthe invention is operatively linked to a polynucleotide comprising an expression control sequence.
  • Autonomously replicating recombinant expression constmcts such as plasmid and viral DNA vectors incorporating polynucleotides ofthe invention are specifically contemplated.
  • Expression control DNA sequences include promoters, enhancers, and operators, and are generally selected based on the expression systems in which the expression constract is to be utilized.
  • Prefened promoter and enhancer sequences are generally selected for the ability to increase gene expression, while operator sequences are generally selected for the ability to regulate gene expression.
  • Expression vectors are useful for recombinant production of polypeptides ofthe invention.
  • Expression constmcts ofthe invention may also include sequences encoding one or more selectable markers that perc ⁇ it identification of host cells bearing the construct.
  • Expression constmcts may also include sequences that facilitate, and preferably promote, homologous recombination in a host cell.
  • Prefened constmcts ofthe invention also include sequences necessary for replication in a host cell.
  • Vectors also are useful for "gene therapy" treatment regimens, wherein a polynucleotide that encodes a polypeptide ofthe invention is introduced into a subject in need of treatment involving the modulation (stimulation or blockage) of vascular endothelial growth factor receptors, in a form that causes cells in the subject to express the polypeptide ofthe invention in vivo.
  • the invention provides host cells, including prokaryotic and eukaryotic cells, that are transformed or transfected (stably or transiently) with polynucleotides ofthe invention or vectors ofthe invention.
  • Polynucleotides ofthe invention maybe introduced into the host cell as part of a circular plasmid, or as linear DNA comprising an isolated protein coding region or a viral vector.
  • Methods for introducing DNA into the host cell well known and routinely practiced in the art include transformation, transfection, electroporation, nuclear injection, or fusion with carriers such as liposomes, micelles, ghost cells, and protoplasts.
  • host cells are useful for amplifying the polynucleotides and also for expressing the polypeptides ofthe invention encoded by the polynucleotide.
  • Such host cells are useful in assays as described herein.
  • any host cell is acceptable, including but not limited to bacterial, yeast, plant, invertebrate (e.g., insect), vertebrate, and mammalian host cells.
  • invertebrate e.g., insect
  • vertebrate e.g., and mammalian host cells.
  • mammalian host cells for developing therapeutic preparations, expression in mammalian cell lines, especially human cell lines, is prefened.
  • mammalian host cells Use of mammalian host cells is expected to provide for such post-translational modifications (e.g., glycosylation, tmncation, lipidation, and phosphorylation) as may be desirable to confer optimal biological activity on recombinant expression products ofthe invention.
  • Glycosylated and non-glycosylated forms of polypeptides are embraced by the present invention.
  • the invention further embraces polypeptides described above that have been covalently modified to include one or more water soluble polymer attachments- such as polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol.
  • Polypeptides ofthe invention also maybe chemically synthesized.
  • the invention provides a method for producing a vascular endothelial growth factor receptor binding protein, comprising the steps of growing a host cell ofthe invention in a nutrient medium and isolating the polypeptide or variant thereof from the cell or the medium. Isolation ofthe polypeptide from the cells or from the medium in which the cells are grown is accomplished by purification methods known in the art, e.g., conventional chromatographic methods including immunoaffinity chromatography, receptor affinity chromatography, hydrophobic interaction chromatography, lectin affinity chromatography, size exclusion filtration, cation or anion exchange chromatography, high pressure liquid chromatography (HPLC), reverse phase HPLC, and the like.
  • HPLC high pressure liquid chromatography
  • Still other methods of purification include those wherein the desired protein is expressed and purified as a fusion protein having a specific tag, label, or chelating moiety that is recognized by a specific binding partner or agent.
  • the purified protein can be cleaved to yield the desired protein, or be left as an intact fusion protein. Cleavage ofthe fusion component may produce a form ofthe desired protein having additional amino acid residues as a result ofthe cleavage process.
  • compositions comprising polypeptides or polynucleotides ofthe invention.
  • compositions comprise one or more polynucleotides or polypeptides ofthe invention that have been fonmilated with a pha ⁇ naceutically acceptable (e.g., sterile and nontoxic) diluent or canier.
  • a pha ⁇ naceutically acceptable e.g., sterile and nontoxic
  • Liquid, semisolid, or solid diluents that serve as pharmaceutical vehicles, excipients, or media are prefened. Any diluent Icnown in the art may be used.
  • Exemplary diluents include, but are not limited to, water, saline solutions, polyoxyethylene sorbitan monolaurate, magnesium stearate, methyl- and propylhydroxybenzoate, talc, alginates, starches, lactose, sucrose, dextrose, sorbitol, mannitol, glycerol, calcium phosphate, mineral oil, and cocoa butter.
  • Such formulations are useful, e.g., for administration of polypeptides or polynucleotides of the invention to mammalian (including human) subjects in therapeutic regimens.
  • the invention provides for the use of polypeptides or polynucleotides ofthe invention in the manufacture of a medicament for the treatment of disorders described herein, including but not limited to disorders characterized by undesirable endothelial cell proliferation and/or disorders characterized by ischemia and/or vessel occlusion, wherein neovascularization is desirable.
  • the invention provides a kit comprising a polynucleotide, polypeptide, or composition ofthe invention packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents ofthe container and providing indications and/or instructions regarding use ofthe contents ofthe container to treat one or more disease states as described herein.
  • the present invention provides methods of producing polypeptides having novel VEGF receptor binding and stimulation properties, and methods for producing polynucleotides that encodes such polypeptides.
  • the invention provides a method for making a polynucleotide that encodes a polypeptide that modulates the growth of mammalian endothelial cells or mammalian pericytes/smooth muscle cells; comprising the steps of: preparing polynucleotides that encode amino acid fragments of at least two vertebrate vascular endothelial growth factor polypeptides; commingling the polynucleotides under conditions wherein the polynucleotides recombine to form hybrid polynucleotides; expressing the hybrid polynucleotides to make hybrid polypeptides encoded by the hybrid polynucleotides; screening the hybrid polypeptides to identify a hybrid polypeptide that binds to a receptor for a vertebrate vascular endothelial
  • modulate the growth of mammalian endothelial cells means stimulate such growth by inducing a mitogenic signal through binding cell surface receptors expressed on vascular endothelial cells, or inhibiting such growth.
  • inhibition maybe due to blockage of vascular endothelial growth factor receptors, or the formation of heterodimers with endogenous growth factors that prevent stimulation of endogenous receptors by the endogenous growth factors.
  • Inhibition also may be achieved by conjugating cytotoxic agents to polypeptides ofthe invention that bind VEGF receptors. Exemplary toxins are Icnown in the art and described elsewhere herein. Polypeptides ofthe invention conjugated to cytotoxic agents or other agents that modulate cell growth are contemplated as another aspect ofthe invention.
  • vertebrate vascular endothelial growth factor polypeptides again means polypeptides having the following characteristics:
  • the polypeptide is encoded by genomic DNA of a vertebrate (e.g., a reptile, amphibian, bird, or mammal, preferably a bird or mammal, most preferably a mammal; especially a primate mammal such as a monkey, ape, or human) or is encoded by the genome of a vertebrate pathogen such as mammalian pox viruses;
  • a vertebrate e.g., a reptile, amphibian, bird, or mammal, preferably a bird or mammal, most preferably a mammal; especially a primate mammal such as a monkey, ape, or human
  • a vertebrate pathogen such as mammalian pox viruses
  • the polypeptide comprises all or a portion of a coding sequence that is expressed by a vertebrate (i.e., from transcription/translation ofthe vertebrate's genomic DNA or from virally-induced transcription/translation, in the case of polypeptides encoded by viral nucleic acids);
  • the polypeptide or portion comprises a VEGF homology domain (V/PHD) of about 70-150 amino acids that binds to naturally occuning receptors and that is characterized in part by the amino acid motif: C-X(18-28)-P-X-C-X(4)-R-C-X-G-C(l- 2)-X(6-12)-C-X(30-46)-C, where X represents any amino acid and numbers in parentheses represent a permissible range of amino acids (e.g., X(18-28) represents a stretch of any 18-28 amino acids; C(l-2) represents one or two cysteine residues).
  • V/PHD VEGF homology domain
  • the V/PHD includes eight conserved cysteines which form a cysteine knot motif similar to that found in human vascular endothelial growth factors A, B, C, and D (VEGF-A, -B, -C, and -D, and human platelet-derived growth factor (PDGF).
  • Prefened polypeptides or portions comprise a VPHD that is characterized by the more particular amino acid motif C-X(22-24)-P-[PSR]-C-V-X(3)-R-C-X-G-C-C-X(6)-C- X(32-41)-C, where amino acids in brackets (e.g., [PSR]) represent alternatives for a single position in the amino acid sequence; and
  • polypeptide binds to at least one cell surface receptor that is expressed on endothelial cells that line vertebrate blood or lymphatic vessels or pericytes/smooth muscle cells that line and support blood vessels.
  • Prefened polypeptides bind to a least one cell surface receptor that is expressed on endothelial cells.
  • single- stranded oligonucleotides are prepared based on knowledge of mammalian VEGF polypeptide sequences and the universal genetic code and using conventional chemical synthesis techniques.
  • Example 1 below demonstrates such a technique, wherein synthetic oligonucleotide pairs were prepared and annealed to prepare double-stranded polynucleotides having single-stranded cohesive ends that encoded fragments of human VEGF-A and human VEGF-C.
  • cDNAs or genomic DNAs (preferably cDNAs) encoding natural VEGF's are fragmented using one or more restriction endonucleases, using DNasel, or using Exonuclease HI.
  • DNasel restriction endonucleases
  • Exonuclease HI Exonuclease HI
  • a cDNA (coding or non-coding strand) is used as a template to synthesize complementary fragments, using DNA poiymerase and chain- termination reagents.
  • the polynucleotides are prepared with complementary cohesive single- stranded ends, to facilitate annealing of fragments in a desired order under conventional annealing and ligation conditions for polynucleotides.
  • Example 1 below provides a demonstration of this technique to generate 510 human VEGF-AJVEGF-C hybrids.
  • Such a technique also may be suitable for annealing fragment mixtures of two or more VEGF cDNAs that have been digested with restriction endonucleases.
  • the commingling step is accomplished by mixing the polynucleotides and subjecting them to a self-priming PCR reaction that involves successive steps of denaturation, annealing, and extension.
  • a self-priming PCR reaction that involves successive steps of denaturation, annealing, and extension.
  • the PCR is 'perfonried under conditions that introduce enors (mutations) in the PCR products. Such mutations introduce additional molecular variation, and are expected to reduce the overall percentage of biologically active molecules, but also may produce molecules with unexpectedly superior activities.
  • the molecules are expressed by any means known in the art. h one variation the molecules are cloned into expression vectors, which are in turn used to transform or transfect cells to express the polypeptides. In another variation, the polynucleotides are cloned into a phage display vector system for screening. [See, e.g., Chang et al (1999).]
  • the screening assay may entail a direct receptor binding assay as described below in Example 3. Alternatively, receptor binding may be assayed indirectly by assaying for a biological activity induced by receptor binding.
  • the screening step comprises contacting the hybrid polypeptide to a cell that expresses the receptor, wherein changes in cell growth or cell survival induced by the hybrid polypeptide is indicative of binding between the hybrid polypeptide and the receptor.
  • the screening and selecting steps are designed to select polynucleotides that encode polypeptides that have novel receptor binding profiles not possessed by the naturally occurring VEGFs from which the polypeptide was derived.
  • the method is practiced wherein the screening step comprises screening to identify a hybrid polypeptide that binds human VEGFR-1 and human VEGFR-3, and the selecting step comprises selecting a hybrid polypeptide that binds human VEGFR-1 and human VEGFR-3, but fails to bind human VEGFR-
  • the method is practiced whereby the screening step comprises screening to identify a hybrid polypeptide that binds human VEGFR-1, VEGFR-2, and human VEGFR-3, and the selecting step comprises selecting a hybrid polypeptide that binds human VEGFR-1, VEGFR-2, and human VEGFR-3.
  • the invention provides a method for making a
  • polynucleotide that encodes a polypeptide that modulates the growth of mammalian endothelial cells comprising the steps of: (a) preparing a set of polynucleotide fragments having the following characteristics: (i) the set includes a first subset of coding polynucleotide fragments, wherein each coding polynucleotide fragment ofthe first subset encodes at least four amino acids ofthe amino acid sequence of a first mammalian vascular endothelial growth factor; (ii) the set includes a second subset of coding polynucleotide fragments, wherein each coding polynucleotide fragment, of the second subset encodes at least four amino acids ofthe amino acid sequence of a second mammalian vascular endothelial growth factor; (b) commingling the polynucleotide fragments which comprise the set under conditions wherein the coding polynucleotide fragments from the first and second subsets
  • VEGF-A Endothelial Growth Factor A
  • VEGF-B human Vascular Endothelial Growth Factor B
  • VEGF-C human Vascular Endothelial Growth Factor C
  • VEGF-D human Vascular Endothelial Growth Factor D
  • AF091434 (SEQ ID NO: 149), which has structural characteristics ofthe PDGF/VEGF family of growth factors.
  • fallotein in generating hybrid proteins together with other mammalian VEGFs.
  • the invention provides numerous in vitro and in vivo methods of using polypeptides and polynucleotides ofthe invention. Such methods are described in greater detail below in the Detailed Description.
  • polypeptides ofthe invention are useful for modulating (stimulating or inhibiting) cellular processes that are mediated through any ofthe PDGF/VEGF family of receptors, such as PDGFR- ⁇ , PDGFR- ⁇ , VEGFR-1, VEGFR-2, and/or VEGFR-3. These receptors may be involved singularly in certain processes and in combination, to varying extents, in other processes.
  • Polypeptides ofthe invention possess many different receptor binding profiles, and one ofthe advantages ofthe invention is the ability to select a polypeptide with a receptor binding profile that matches the receptor expression profile ofthe biological process to be modulated.
  • the invention provides a method of modulating the signaling of one or more of PDGFR- ⁇ , PDGFR- ⁇ , VEGFR-1, VEGFR-2, and/or VEGFR-3 in a cell, comprising the step of contacting a cell that expresses one or more of PDGFR- ⁇ , PDGFR- ⁇ , VEGFR-1, VEGFR-2, and/or VEGFR-3 with a composition comprising a polypeptide ofthe invention.
  • modulation to activate signaling is contemplated, and the cell is contacted with a polypeptide of the invention that stimulates receptor signaling in an amount sufficient to bind to the one or more receptors and induce receptor signaling, hi another variation, modulation to inhibit signaling is contemplated.
  • the cell is contacted with a polypeptide that inhibits ligand-induced receptor activation (or a polypeptide conjugated to a cytotoxin), in an amount sufficient to inhibit signaling that is induced by receptor ligand growth factor polypeptides that exist endogenously in the cell's environment.
  • Dose-response studies pennit accurate determination of a proper quantity of polypeptide to employ.
  • Effective quantities can be estimated from measurements of the binding affinity of a polypeptide for a target receptor, ofthe quantity of receptor present on target cells, ofthe expected dilution volume (e.g., patient weight and blood volume for in vivo embodiments), and of polypeptide clearance rates.
  • the invention provides a method of modulating the signaling of one or more of PDGFR- ⁇ , PDGFR- ⁇ , VEGFR-1, VEGFR-2, and/or
  • VEGFR-3 comprising the step or administering to a patient in need of modulation of the signaling of one or more of these receptors a composition comprising a polynucleotide ofthe invention, under conditions in which cells ofthe patient are transformed or transfected by the polynucleotide and express the polypeptide ofthe invention encoded thereby, wherein the expressed polypeptide modulates signaling of the one or more receptors.
  • the invention provides molecules designed using these core residues and other substituents to modulate VEGFR-3 biological activity.
  • the invention provides a molecule comprising the peptide sequence TNTFX n P, wherein X n comprises from one to seven amino acids, and wherein the molecule inhibits VEGF-
  • the molecule may include additional residues or organic moieties, hi one variation, it is contemplated that this epitope will be linked by a non- VEGF-C amino acid sequence to other epitopes involved in receptor binding, thereby creating a molecule capable of interacting with receptor loci involved in ligand binding and blocking ligand-mediated activation ofthe receptor.
  • X n comprises three amino acids, which represents the same amino acid spacing as native VEGF-C.
  • the invention provides a molecule comprising the human VEGF-C peptide sequence EFGVATNTFFKPPCVSVYRCG or a fragment or variant thereof, wherein the molecule inhibits VEGF-C-mediated activation of VEGFR-3.
  • the fragment is such that the molecule comprises the amino acid sequence EFGVATNTFFKPPCVSVYRCG
  • the fragment is such that the molecule comprises the amino acid sequence TNTFFKPP.
  • the fragment or variant comprises the amino acid sequence TNTFFKPPCVxxxR, or the amino acid sequence TNTFFKPPCVxxxRCGGCC.
  • the invention provides a method for identifying a modulator of VEGFR- 1 binding to VEGF-A comprising the steps of (i) measuring binding between VEGFR-1 and VEGF-A in the presence and absence of a test compound under conditions that allow binding of VEGFR-1 to VEGF-A, and (ii) identifying as a modulator a test compound which alters VEGFR-1 binding to VEGF-A and which binds VEGF-A at a site defined by Phe 43 , Met 44 , Tyr 47 , Gin 48 , Tyr 51 , Gin 105 , and Met 107 of SEQ ID NO: 2, or which binds VEGFR-1 at VEGFR-1 residues which interface with said residues of SEQ ID NO: 2.
  • the invention provides a method for identifying a modulator of VEGFR-1 binding to VEGF-A comprising the steps of (i) measuring binding between VEGFR-1 and VEGF-A in the presence and absence of a test compound under conditions that allow binding of VEGFR-1 to VEGF-A, and (ii) identifying as a modulator a test compound which alters VEGFR-1 binding to VEGF- A and which binds VEGF-A at a site defined by Lys 42 , Phe 43 , Met 44 , Tyr 47 , Gin 48 , Tyr 51 , He 72 , Lys 74 , Asp 89 , Gly 91 , Leu 92 , Gin 105 , Met 107 , He 109 , Phe 111 , His 112 , Gin 115 , He 117 , Glu 129 , Arg 131 , and Pro 132 of SEQ FD NO: 2, or which binds VEGFR-1 at VEGFR-1 residues
  • the invention provides a method for identifying a modulator of VEGFR-3 binding to VEGF-C comprising the steps of (i) measuring binding between VEGFR-3 and VEGF-C in the presence and absence of a test compound under conditions that allow binding of VEGFR-3 to VEGF-C, and (ii) identifying as a modulator a test compound which alters VEGFR-3 binding to VEGF-C and which binds VEGF-C at a site defined by Lys 120 , Ser 121 , He 122 , Trp 126 , Arg 127 , Gin 130 , Phe 151 , Lys 153 , Ser ,6S , Gly 170 , Leu 171 , Tyr 184 , Phe 186 , He 190 , Pro 191 , Pro' 96 , Pro 198 , Arg 210 , Met 212 , and Ser 213 of SEQ ID NO: 22, or which binds VEGFR-3 at VEGFR-3 residues which
  • the invention also provides a method for identifying a modulator of VEGFR-3 binding to VEGF-C comprising the steps of (i) measuring binding between VEGFR-3 and VEGF-C in the presence and absence of a test compound under conditions that allow binding of VEGFR-3 to VEGF-C, and (ii) identifying as a modulator a test compound which alters VEGFR-3 binding to VEGF-C and which binds VEGF-C at a site defined by Thr 148 , Asn 149 , Thr 150 , Phe 151 , and Pro 155 of SEQ ID NO: 22, or which binds VEGFR-3 at VEGFR-3 residues which interface with said residues of SEQ ID NO: 22.
  • compositions that comprise modulators identified by the foregoing methods, especially compositions comprising substantially purified modulators in a pharmaceutically acceptable canier.
  • modulators in the manufacture of a medicament for the treatment of disease states characterized by abnormal vascular endothelial growth factor receptor activity is contemplated.
  • any ofthe foregoing methods optionally include the additional step of administering the identified modulator to a patient in need of treatment for a disease state characterized by undesirable levels of receptor activity; or a step of contacting cells that express the receptor to modulate the level of receptor activity in the cells.
  • the invention includes, as an additional aspect, all embodiments ofthe invention narrower in scope in any way than the variations specifically mentioned above.
  • the applicant(s) invented the full scope ofthe claims appended hereto, the claims appended hereto are not intended to encompass within their scope the prior art work of others. Therefore, in the event that statutory prior art within the scope of a claim is brought to the attention ofthe applicants by a Patent Office or other entity or individual, the applicant(s) reserve the right to exercise amendment rights under applicable patent laws to redefine the subject matter of such a claim to specifically exclude such statutory prior art or obvious variations of statutory prior art from the scope of such a claim. Variations ofthe invention defined by such amended claims also are intended as aspects ofthe invention.
  • FIG. 1 depicts a perspective view of a three-dimensional model of a VEGF-
  • a VEGF- A-encoding polynucleotide was divided into nine segments for constmction of VEGF- A/ VEGF-C chimeras, and labels 1-9 identify the location ofthe peptides encoded by each ofthe nine segments.
  • Figure 2 is a schematic diagram ofthe 9 VEGF-A and 9 VEGF-C DNA fragments used to constmct the VEGF-A/VEGF-C hybrid molecules. These fragments are numbered 1 tlirough 9 on top.
  • the N123, N45, C67 and C89 groups of fragments are also indicated.
  • N123 consists of 3 VEGF-A fragments and 3 VEGF-C fragments (fragments 1-3), whereas N45 (fragments 4-5), C67 (fragments 6-7), and C89 (fragments 8-9) each consist of 2 VEGF-A fragments and 2 VEGF-C fragments. Selected restriction endonuclease sites also are depicted.
  • Figure 3 schematically depicts all 8 possible DNA molecules conesponding to the N123 region, resulting from ligating different combinations of fragments 1,2, and 3 from VEGF-A (Al, A2, and A3) and VEGF-C (Cl, C2, and C3).
  • Figure 4 schematically depicts all 4 possible DNA molecules conesponding to the N45 region resulting from ligating different combinations of fragments 4 and 5 from VEGF-A and VEGF-C.
  • Figure 5 schematically depicts all 4 possible DNA molecules conesponding to the C67 region resulting from ligating different combinations of fragments 6 and 7 from VEGF-A and VEGF-C.
  • Figure 6 schematically depicts all 4 possible DNA molecules conesponding to the C89 region resulting from ligating different combinations of fragments 8 and 9 from VEGF-A and VEGF-C.
  • Figures 7A-7D depict in boxes the amino acid sequences encoded by DNA fragments A1-A9 (SEQ ID NOs: 128 - 136) and C1-C9 (SEQ ID NOs: 137 - 145), and depict the manner in which longer encoded amino acid sequences were fo ⁇ ned through the joining of fragments A1-A3 and C1-C3 in the N123 ligation (Fig 7A); of fragments A4-A5 and C4-C5 in the N45 ligation (Fig. 7B); of fragments A6-A7 and C6-C7 in the C67 ligation; and of fragments A8-A9 and C8-C9 in the C89 ligation.
  • Figure 8 is a three-dimensional model showing the interaction of a VEGF-A dimer with two VEGFR-1 molecules. Residues within the VEGF-A monomers important for interfacing with VEGFR-1 are clustered at the two ends ofthe VEGF-A dimer and include the N-terminal helix and part ofthe ⁇ 5 strand.
  • Figure 9 is a three-dimensional model depicting the groove formed by a
  • VEGF-C dimer The entry and the sides of this groove are fonxied by the fragments, described in Example 4, that appear to be important for confening VEGFR-3 specificity.
  • Figure 10 is a three-dimensional model of a the interaction between a VEGF-C dimer and a single VEGFR-3 molecule, extrapolated from the VEGF-A/VEGFR-A model.
  • the present invention provides novel polypeptides that bind cellular receptors for vascular endothelial growth factor polypeptides; polynucleotides encoding such polypeptides; compositions comprising the polypeptides and polynucleotides; and methods and uses involving the foregoing. These materials and methods are described in detail in the preceding Summary of Invention section, which is hereby incorporated into the Detailed Description in its entirety. Some polypeptides ofthe invention exhibit unique receptor binding profiles compared to Icnown, naturally occurring vascular endothelial growth factors.
  • the peptides ofthe present invention may be synthesized using a variety of methods, including those described in the summary of invention and the examples.
  • the peptides ofthe present invention can be synthesized in solution or on a solid support in accordance with conventional techniques.
  • Various automatic synthesizers are commercially available and can be used in accordance with Icnown protocols. See, for example, Stewart and Young, Solid Phase Peptide Synthesis, 2d. ed., Pierce Chemical Co., (1984);Tam et al, J. Am. Chem. Soc, 105:6442, (1983); Merrifield,
  • Solid phase peptide synthesis methods use a copoly(styrene-divinylbenzene) containing 0.1-1.0 mMol amines/g polymer. These methods for peptide synthesis use butyloxycarbonyl (t-BOC) or 9-fluorenylmethyloxy-carbonyl(FMOC) protection of alpha-amino groups.
  • Both methods involve stepwise syntheses whereby a single amino acid is added at each step starting from the C-terminus ofthe peptide (See, Coligan, et al., Cunent Protocols in hnmunology, Wiley Interscience, 1991, Unit 9)
  • the peptides can be deprotected to remove the t- t-BOC or FMOC amino acid blocking groups and cleaved from the polymer by treatment with acid at reduced temperature (e.g., liquid HF-10% anisole for about 0.25 to about 1 hours at 0°C).
  • the peptides are extracted from the polymer with 1% acetic acid solution which is then lyophilized to yield the crade material.
  • acetic acid solution which is then lyophilized to yield the crade material.
  • This can normally be purified by such techniques as gel filtration on Sephadex G-15 using 5% acetic acid as a solvent. Lyophilization of appropriate fractions ofthe column will yield the homogeneous peptide or peptide derivatives, which can then be characterized by such standard techniques as amino acid analysis, thin layer chromatography, high performance liquid chromatography, ultraviolet absorption spectroscopy, molar rotation, solubility, and quantitated by the solid phase Edman degradation.
  • phage display libraries can be prepared from sets of amino acids as described herein. Phage display can be particularly effective in identifying binding peptides useful according to the invention.
  • a phage library (using e.g. ml 13, fd, or lambda phage), displaying inserts from 4 to about 80 amino acid residues.
  • the inserts may represent, for example, a completely degenerate or biased anay.
  • One then can select phage- bearing inserts which bind to the target VEGF receptor(s). This process can be repeated through several cycles of reselection of phage that bind to the target receptor(s). Repeated rounds lead to enrichment of phage bearing particular sequences.
  • DNA sequence analysis can be conducted to identify the sequences ofthe expressed polypeptides. The minimal linear portion ofthe sequence that binds to the target receptor(s) can be determined.
  • These techmques may identify peptides of the invention with still greater receptor binding affinity than peptides already identified herein. Screening resultant peptide against multiple receptors will identify peptides with multiple receptor binding affinities.
  • Yeast two-hybrid screening methods also may be used to identify polypeptides that bind to the target receptor(s).
  • expression vector/host systems may be utilized to contain and express the chimeric peptides ofthe present invention.
  • microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with vims expression vectors
  • Mammalian cells that are useful in recombinant protein productions include but are not limited to VERO cells, HeLa cells, Chinese hamster ovary (CHO) cell lines, COS cells (such as COS-7), W138, BHK, HepG2, 3T3, RIN, MDCK, A549, PC12, K562 and 293 cells. Exemplary protocols for the recombinant expression ofthe protein are described herein below.
  • the chimeric peptide may be recombinantly expressed in yeast using a commercially available expression system, e.g. , the Pichia Expression System
  • the secreted peptide is purified from the yeast growth medium by, e.g., the methods used to purify the chimeric peptide from bacterial and mammalian cell supernatants.
  • the cDNA encoding the peptide may be cloned into the baculoviras expression vector pVLl 393 (PharMingen, San Diego, CA).
  • This vector is then used according to the manufacturer's directions (PharMingen) to infect Spodoptera frugiperda cells in sF9 protein-free media and to produce recombinant protein.
  • the protein is purified and concentrated from the media using a heparin-
  • Sepharose column Panacia, Piscataway, NJ
  • sequential molecular sizing columns Amicon, Beverly, MA
  • resuspended in PBS SDS-PAGE analysis shows a single band and confirms the size of the protein
  • Edman sequencing on a Porton 2090 Peptide Sequencer confirms its N-terminal sequence.
  • the peptide may be expressed in an insect system. Insect systems for protein expression are well Icnown to those of skill in the art. In one such system, Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to • express foreign genes in Spodoptera frugiperda cells or in Trichoplusia larvae.
  • AcNPV Autographa californica nuclear polyhedrosis virus
  • the peptide coding sequence is cloned into a nonessential region ofthe vims, such as the polyhedrin gene, and placed under control of the polyhedrin promoter. Successful insertion ofthe peptide will render the polyhedrin gene inactive and produce recombinant vims lacking coat protein coat. The recombinant vimses are then used to infect S. frugiperda cells or Trichoplusia larvae in which peptide is expressed (Smith et al, J Virol 46: 584, 1983; Engelhard EK et al, Proc Nat Acad Sci 91: 3224-7, 1994).
  • the DNA sequence encoding the peptide is amplified by PCR and cloned into an appropriate vector for example, pGEX-3X (Pharmacia, Piscataway, NJ).
  • the pGEX vector is designed to produce a fusion protein comprising glutathione-S-transferase (GST), encoded by the vector, and a protein encoded by a DNA fragment inserted into the vector's cloning site.
  • the primers for the PCR may be generated to include for example, an appropriate cleavage site.
  • the recombinant fusion protein may then be cleaved from the GST portion ofthe fusion protein.
  • the pGEX-3X/chimeric peptide construct is transformed into E. coli XL-1 Blue cells
  • Plasmid DNA from individual transfonriants is purified and partially sequenced using an automated sequencer to confirm the presence ofthe desired chimeric peptide encoding nucleic acid insert in the proper orientation.
  • Particularly prefened peptide compositions ofthe present invention are those which are conjugated to any anti-tumor peptide such as a tumor necrosis factor (TNF).
  • TNF tumor necrosis factor
  • the TNF-peptides chimeras are generated as recombinant fusions with peptide-encoding sequences fused in frame to TNF (Novagen) encoding sequences.
  • Peptide-TNF cDNA is cloned into pET-1 lb vector (Novagen) and the expression of TNF-peptides in BL21 E. coli is induced according to the pETl lb manufacturer's instruction.
  • Soluble TNF-peptides are purified from bacterial lysates by ammonium sulfate preparation, hydrophobic interaction chromatography on Phenyl-Sepharose 6 Fast Flow, ion exchange chromatography on DEAE-Sepharose Fast Flow and gel filtration cliromatography on Sephacryl-S-300 HR. It is contemplated that recombinant protein production also may be used to produce the chimeric peptide compositions.
  • induction ofthe GST/ehimeric peptide is achieved by growing the transformed XL-1 Blue culture at 37°C in LB medium (supplemented with carbenicillin) to an optical density at wavelength 600 nm of 0.4, followed by further incubation for 4 hours in the presence of 0.5 mM Isopropyl ⁇ -D-Thiogalactopyranoside (Sigma Chemical Co., St. Louis).
  • the fusion protein expected to be produced as an insoluble inclusion body in the bacteria, may be purified as follows. Cells are harvested by centrifugation; washed in 0.15 M NaCl, 10 mM Tris, pH 8, 1 mM EDTA; and treated with 0.1 mg/ml lysozyme (Sigma Chemical Co.) for 15 minutes at room temperature. The lysate is cleared by sonication, and cell debris is pelleted by centrifugation for 10 minutes at 12,000 X g. The fusion protein-containing pellet is resuspended in 50 mM Tris, pH 8, and 10 mM EDTA, layered over 50% glycerol, and centrifuged for 30 min. at 6000 X g.
  • the pellet is resuspended in standard phosphate buffered saline solution (PBS) free of Mg "1"1" and Ca 4"1" .
  • PBS phosphate buffered saline solution
  • the fusion protein is further purified by fractionating the resuspended pellet in a denaturing SDS polyacrylamide gel (Sambrook et al, supra). The gel is soaked in 0.4 M KCl to visualize the protein, which is excised and electroeluted in gel-ranning buffer lacking SDS. If the GST/chimeric peptide fusion protein is produced in bacteria as a soluble protein, it may be purified using the GST Purification Module (Pharmacia Biotech).
  • the fusion protein may be subjected to digestion to cleave the GST from the chimeric peptide o the invention.
  • the digestion reaction (20-40 ⁇ g fusion protein, 20-30 units human thrombin (4000 U/mg (Sigma) in 0.5 ml PBS) is incubated 16-48 hrs. at room temperature and loaded on a denaturing SDS-PAGE gel to fractionate the reaction products. The gel is soaked in 0.4 M KCl to visualize the protein bands.
  • the identity of the protein band conesponding to the expected molecular weight of chimeric peptide may be confirmed by amino acid sequence analysis using an automated sequencer (Applied Biosystems Model 473 A, Foster City, CA).
  • the identity may be confirmed by performing HPLC and/or mass spectometry ofthe peptides.
  • the DNA sequence encoding the chimeric peptide may be cloned into a plasmid containing a desired promoter and, optionally, a leader sequence (see, e.g., Better et al, Science, 240:1041-43, 1988). The sequence of this constmct may be confirmed by automated sequencing.
  • the plasmid is then transfonned into E. coli strain MCI 061 using standard procedures employing CaCl 2 incubation and heat shock treatment ofthe bacteria (Sambrook et al, supra).
  • the transformed bacteria are grown in LB medium supplemented with carbenicillin, and production ofthe expressed protein is induced by growth in a suitable medium. If present, the leader sequence will effect secretion ofthe chimeric peptide and be cleaved during secretion.
  • the secreted recombinant protein is purified from the bacterial culture media by the method described herein below.
  • Mammalian host systems for the expression of the recombinant protein also are well Icnown to those of skill in the art.
  • Host cell strains may be chosen for a particular ability to process the expressed protein or produce certain post-translation modifications that will be useful in providing protein activity.
  • modifications of the polypeptide include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation and acylation.
  • Different host cells such as CHO, HeLa, MDCK, 293, WI38, and the like have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the conect modification and processing ofthe introduced, foreign protein.
  • the transfonried cells are used for long-term, high-yield protein production and as such stable expression is desirable.
  • the cells Once such cells are transformed with vectors that contain selectable markers along with the desired expression cassette, the cells may be allowed to grow for 1-2 days in an enriched media before they are switched to selective media.
  • the selectable marker is designed to confer resistance to selection and its presence allows growth and recovery of cells that successfully express the introduced sequences. Resistant clumps of stably transfonried cells can be proliferated using tissue culture techniques appropriate to the cell.
  • selection systems may be used to recover the cells that have been transfonried for recombinant protein production.
  • selection systems include, but are not limited to, HSV thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes, in tic-, hgprt- or aprt- cells, respectively.
  • anti-metabolite resistance can be used as the basis of selection for dhfr, that confers resistance to methotrexate; gpt, that confers resistance to mycophenohc acid; neo, that confers resistance to the aminoglycoside G418; also that confers resistance to chlorsulfuron; and hygro, that confers resistance to hygromycin.
  • Additional selectable genes that may be useful include trpB, which allows cells to utilize indole in place of tryptophan, or hisD, which allows cells to utilize histinol in place of histidine.
  • Markers that give a visual indication for identification of transformants include anthocyanins, beta-glucuronidase and its substrate, GUS, and luciferase and its substrate, luciferin.
  • peptides or polypeptides ofthe present invention which are resistant to proteolytic digestion.
  • Such peptides may include non-hydrolyzable peptide bonds, and peptides having end modifications such as an amide (e.g., CONH 2 ) at the C-terminus or a acetyl group at the N-terminus. It is contemplated that the peptides ofthe invention are modified such that their in vivo half life is increased, their physical stability is increased, rate of in vivo release and rate of in vivo clearance also may be affected.
  • an amide e.g., CONH 2
  • non-hydrolyzable peptides To prepare non-hydrolyzable peptides, one may select peptides from a library non-hydrolyzable peptides, or introduce modifications to select peptides, such as one or more D-amino acids or one or more non-hydrolyzable peptide bonds linking amino acids. For example, one can select peptides having a desired receptor binding profile and then modify such peptides as necessary to reduce the potential for hydrolysis by proteases.
  • peptides may be labeled and incubated with cell extracts or purified proteases and then isolated to determine which peptide bonds are susceptible to proteolysis, e.g., by sequencing peptides and proteolytic fragments.
  • potentially susceptible peptide bonds can be identified by comparing the amino acid sequence ofthe peptides ofthe present invention with the known cleavage site specificity of a panel of proteases. Based on the results of such assays, individual peptide bonds which are susceptible to proteolysis can be replaced with non-hydrolyzable peptide bonds by in vitro synthesis ofthe peptide.
  • Non-hydrolyzable bonds include ⁇ [CH 2 NH] ⁇ reduced amide peptide bonds, — [COCH 2 ]-- lcetomethylene peptide bonds, ⁇ [CH(CN)NH]— (cyanomethylene)amino peptide bonds, ⁇ [CH 2
  • Peptides useful in the invention can be linear, or maybe circular or cyclized by natural or synthetic means. For example, disulfide bonds between cysteine residues may cyclize a peptide sequence. Bifunctional reagents can be used to provide a linkage between two or more amino acids of a peptide. Other methods for cyclization of peptides, such as those described by Anwer et al. (Int. J Pep. Protein Res. 36:392- 399, 1990) and Rivera-Baeza et al. (Neuropeptides 30:327-333, 1996) are also known in the art.
  • nonpeptide analogs of peptides which provide a stabilized stmcture or lessened biodegradation, are also contemplated.
  • Peptide mimetic analogs can be prepared based on a selected peptide by replacement of one or more residues by nonpeptide moieties.
  • the nonpeptide moieties permit the peptide to retain its natural confirmation, or stabilize a prefened, e.g., bioactive, confmnation.
  • a prefened e.g., bioactive, confmnation.
  • polypeptides ofthe invention include polypeptides that are modified, for instance, by glycosylation, amidation, carboxylation, or phosphorylation, or by the creation of acid addition salts, amides, esters, in particular C-terminal esters, and N- acyl derivatives.
  • the invention embraces polypeptides modified by forming covalent or noncovalent complexes with other moieties.
  • Covalently-bound complexes can be prepared by linking the chemical moieties to functional groups on the side chains of amino acids comprising the peptides, or at the N- or C-terminus.
  • the aforementioned peptides can be conjugated to a reporter group, including, but not limited to a radiolabel, a fluorescent label, an enzyme (e.g., that catalyzes a colorimetric or fluorometric reaction), a substrate, a solid matrix, or a carrier (e.g., biotin or avidin).
  • the invention accordingly provides a molecule comprising a chimeric polypeptide comprising a plurality of peptide subunits derived from two or more vascular endothelial growth factor polypeptides, wherein the chimeric polypepitde preferably further comprises a reporter group selected from the group consisting of a radiolabel, a fluorescent label, an enzyme, a substrate, a solid matrix, and a carrier.
  • a reporter group selected from the group consisting of a radiolabel, a fluorescent label, an enzyme, a substrate, a solid matrix, and a carrier.
  • labels that will be useful include but are not limited to radioactive labels, fluorescent labels and chemiluminescent labels.
  • U.S. Patents concerning use of such labels include for example U.S. Patent No. 3,817,837; U.S. Patent No. 3,850,752; U.S. Patent No. 3,939,350 and U.S. Patent No. 3,996,345. Any ofthe peptides ofthe present invention may comprise one, two, or more of any of these labels.
  • the many biological activities mediated tlirough the PDGF/VEGF receptor family (including but not limited to affecting growth and migration of vascular endothelial cells and blood vessels; promoting growth of lymphatic endothelial cells and lymphatic vessels; increasing vascular permeability; and affecting myelopoiesis) support numerous diagnostic and in vitro and in vivo clinical utilities for polypeptides of the invention that are capable of binding one of more members ofthe VEGF receptor family, for modulating (stimulating or inhibiting) these biological activities.
  • polypeptides ofthe invention that form homodimers that bind and activate one or more members of the VEGF receptor family will be useful as vascular endothelial growth factors.
  • polypeptides ofthe invention that form heterodimers with endogenous growth factor polypeptides (VEGF-A or VEGF-C or other family members) will also be effective agonists, provided that the heterodimers so formed are capable of binding and activating receptors to induce signal transduction.
  • polypeptides ofthe invention will act as inhibitors (antagonists) of growth factors ofthe VEGF family.
  • Polypeptides of the invention that bind but fail to stimulate one or more receptors will inhibit stimulation ofthe receptor by endogenous growth factor, thereby acting as an inhibitor of endogenous growth factor.
  • Such failure to stimulate may be due, in whole or in part, to an inability to dimerize the receptor, perhaps due to an inability ofthe hybrid polypeptide ofthe invention to form growth factor homodimers.
  • Polypeptides ofthe invention that form heterodimers with endogenous growth factor polypeptides will inhibit stimulation of VEGF receptors if the heterodimer fails to bind receptors, or if the heterodimer binds only to an individual receptor or a heterologous receptor pair in a manner that prevents receptor activation and signal transduction.
  • polypeptides ofthe invention that form activity-destroying heterodimers with endogenous VEGF polypeptides (and that do not form active homodimers) are useful as antagonists of natural endogenous VEGF activity.
  • any polypeptide that binds a receptor can be conjugated to a cytotoxic or cytostotic agent in order to deliver such agents to target cells.
  • VEGF polypeptides exhibit a mitogenic response.
  • exemplary toxins include chemotherapeutic, radionuclide, ricin A chain, cholera toxin, pertussis toxin, etc. It also will be apparent that two or more hybrid polypeptides ofthe invention can be mixed, and that heterodimers so formed will be useful as modulators depending upon their receptor binding and stimulating properties. Because polypeptides ofthe invention are hybrids derived from naturally-occurring vascular endothelial growth factors that may have different receptor binding profiles, it is contemplated that some ofthe hybrids will act as activators of one or more receptors, and some will act as inhibitors of one or more receptors.
  • polypeptides ofthe invention that bind and activate one or more VEGF receptors may be useful for promoting angiogenesis and/or lymphangiogenesis, for example, to promote wound healing, to facilitate tissue transplantation, and to promote the formation of collateral vessels around arterial stenoses, and into injured tissues after infarction, to treat ischemia.
  • polypeptides ofthe invention that behave as antagonists of endogenous VEGF proteins can be used in therapeutic applications to treat diseases such as neoplasias, retinopathy, rheumatoid arthritis, and psoriasis, in which suppression of angiogenesis is desirable.
  • Polypeptides ofthe present invention differ from natural VEGF receptor ligands in that some of them selectively bind one ofthe VEGF receptors and can thus be used to specifically induce signaling through one particular VEGF receptor.
  • polypeptides that solely induce VEGFR-3 signaling can be used therapeutically to target the lymphatic endothelia of individuals affected with lymphatic disorders, to improve the stmcture and function ofthe lymphatic vasculature of such individuals.
  • Such polypeptides also can be used to target neoplasia characterized by cells expressing VEGFR-3 on their surfaces. Chemotaxis of monocytes/macrophages [Barleon et al, Blood 57:3336-3343 (1996)] due to
  • VEGFR-1 vascular endothelial growth factor-1
  • molecules that specifically target the VEGFR-1 receptor can be used to direct therapeutic effects on this particular VEGF receptor.
  • inhibitors of VEGFR-1 may be used to prevent virally induced angiogenesis
  • molecules that specifically activate VEGFR-1 can be used to enhance monocyte/macrophage migration.
  • VEGFR-2 is essential for angiogenesis and sufficient for virally-induced angiogenesis.
  • inhibitors of VEGFR-2 may be used for inhibiting angiogenesis, including that induced by viral VEGFs., whereas molecules that stimulate VEGFR-2 can be useful for promoting angiogenesis.
  • a subset ofthe polypeptides ofthe present invention can bind combinations of VEGF receptors not demonstrated for known natural VEGF ligands, or are able to bind all three known VEGF receptors VEGFR-1, R-2, and R-3. These polypeptides may be useful for therapies in which the activation or inhibition of different combinations of VEGF receptors is desired.
  • Polypeptides ofthe invention that can activate VEGFR-3 can be used to promote the endothelial functions of lymphatic vessels and tissues such as to treat loss of lymphatic vessels, occlusions of lymphatic vessels, lymphangiomas, and primary idiopathic lymphedemas, including Milroy's disease and lymphedema praecox, as well as secondary lymphedemas, including those resulting from removal of lymph nodes and vessels, radiotherapy and surgery in treatment of cancer, trauma and infection.
  • Polynucleotides or polypeptides ofthe invention could be administered purely as a prophylactic treatment to prevent lymphedema in subjects at risk for developing lymphedema, or as a therapeutic treatment to subjects afflicted with lymphedema, for the purpose of ameliorating its symptoms (e.g., swelling due to the accumulation of lymph).
  • polynucleotides and polypeptides ofthe invention that activate VEGFR-3 can also be used to promote re-growth or permeability of lymphatic vessels in patients whose axillary lymphatic vessels were removed during surgical interventions in the treatment of cancer (e.g., breast cancer).
  • Polynucleotides and polypeptides ofthe invention can be used to treat vascularization in, for example, organ transplant patients.
  • a composition containing the polypeptide(s) ofthe invention may be directly applied to the isolated vessel segment prior to its being grafted in vivo to minimize rejection ofthe transplanted material and to stimulate vascularization ofthe transplanted materials.
  • Polypeptides ofthe invention that activate VEGF receptor activity may be used to treat wounds, surgical incisions, sores, and other indications where healing is reasonably expected to be promoted if the process of neovascularization can be induced and/or accelerated.
  • polynucleotides or polypeptides according to the invention may be used to treat or prevent inflammation, infection, or immune disorders by modulating the proliferation, differentiation and maturation, or migration of immune cells or hematopoietic cells.
  • Polynucleotides or polypeptides according to the invention may also be useful to promote or inhibit trafficking of leukocytes between tissues and lymphatic vessels and migration in and out ofthe thymus.
  • Polynucleotides and polypeptides ofthe invention can be used for stimulating myelopoiesis (especially growth of neutrophilic granuloctyes) or inhibiting it.
  • the invention includes a method for modulating myelopoiesis in a mammalian subject comprising administering to a mammalian subject in need of modulation of myelopoiesis an amount of a polypeptide ofthe invention that is effective to modulate myelopoiesis.
  • a mammalian subject suffering from granulocytopenia is selected, and the method comprises administering to the subject an amount of a polypeptide effective to stimulate myelopoiesis.
  • a polypeptide ofthe invention is administered in an amount effective to increase the neutrophil count in blood ofthe subject.
  • the invention includes a method of increasing the number of neutrophils in the blood of a mammalian subject comprising the step of expressing in a cell in a subject in need of an increased number of blood neutrophils a DNA encoding a polynucleotide ofthe invention that is able to activate signaling through VEGF receptors, the DNA operatively linked to a promoter or other control sequence that promotes expression ofthe DNA in the cell.
  • the invention includes a method of modulating the growth of neutrophilic granulocytes in vitro or in vivo comprising the step of contacting mammalian stem cells with a polypeptide of the invention in an amount effective to modulate the growth of mammalian endothelial cells.
  • the invention also includes a method for modulating the growth of CD34+ progenitor cells (especially hematopoietic progenitor cells and endothelial progenitor cells) in vitro or in vivo comprising the step of contacting mammalian CD34+ progenitor cells with a polypeptide ofthe invention in an amount effective to modulate the growth of mammalian endothelial cells.
  • CD34+ progenitor cells isolated from cord blood or bone manow are specifically contemplated.
  • in vitro and in vivo methods ofthe invention for stimulating the growth of CD34+ precursor cells also include methods wherein polypeptides ofthe invention are employed together (simultaneously or sequentially) with other polypeptide factors for the purpose of modulating hematopoiesis/myelopoiesis or endothelial cell proliferation.
  • CSFs colony stimulating factors
  • G-CSF granulocyte-CSF
  • M- CSF macrophage-CSF
  • GM-CSF granulocyte-macrophage-CSF
  • IL-3 interleukin-3
  • SCF stem cell factor
  • a polypeptide ofthe invention as a progenitor cell or myelopoietic cell growth factor or co-factor with one or more ofthe foregoing factors may potentiate previously unattainable myelopoietic effects and/or potentiate previously attainable myelopoietic effects while using less ofthe foregoing factors than would be necessary in the absence of a polypeptide ofthe invention.
  • Polynucleotides and polypeptides ofthe invention may also be used in the treatment of lung disorders to improve blood circulation in the lung and/or gaseous exchange between the lungs and the blood stream; to improve blood circulation to the heart and O 2 gas permeability in cases of cardiac insufficiency; to improve blood flow and gaseous exchange in chronic obstmctive airway disease; and to treat conditions such as congestive heart failure, involving accumulations of fluid in, for example, the lung resulting from increases in vascular permeability, by exerting an offsetting effect on vascular permeability in order to counteract the fluid accumulation.
  • Polynucleotides and polypeptides ofthe invention could be used to treat malabsorptive syndromes in the intestinal tract as a result of its blood circulation increasing and vascular permeability increasing activities.
  • Polypeptides ofthe invention that bind but do not stimulate signaling through one or more ofthe VEGF receptors may be used to treat chronic inflammation caused by increased vascular permeability, retinopathy associated with diabetes, rheumatoid arthritis and psoriasis.
  • Polynucelotides or polypeptides according to the invention that are able to inhibit the function of one or more VEGF receptors can also be used to treat edema, peripheral arterial disease, Kaposi's sarcoma, or abnormal retinal development in premature newbon s.
  • the invention provides a method for modulating the growth of endothelial cells in a mammalian subject comprising the steps of exposing mammalian endothelial cells to a polypeptide according to the invention in an amount effective to modulate the growth ofthe mammalian endothelial cells.
  • the modulation of growth is affected by using a polypeptide capable of stimulating tyrosine phosphorylation of VEGF receptors in a host cell expressing the VEGF receptors.
  • the invention contemplates the modulation of endothelial cell-related disorders.
  • the subject, and endothelial cells are human.
  • the endothelial cells may be provided in vitro or in vivo, and they may be contained in a tissue graft.
  • An effective amount of a polypeptide is an amount necessary to achieve a reproducible change in cell growth rate (as determined by microscopic or macroscopic visualization and estimation of cell doubling time, or nucleic acid synthesis assays). Since angiogenesis and neovascularization are essential for tumor growth, inhibition of angiogenic activity can prevent further growth and even lead to regression of solid tumors. Likewise inhibition of lymphangrogenesis may be instrumental in preventing metastases.
  • Polynucleotides and polypeptides ofthe invention may be useful to treat neoplasias including sarcomas, melanomas, carcinomas, and gliomas by inhibiting tumor angiogenesis.
  • cancers including cancers of the brain (ghoblastoma, astrocytoma, oligodendroglioma, ependymomas), lung, liver, spleen, kidney, lymph node, pancreas, small intestine, blood cells, colon, stomach, breast, endometrium, prostate, testicle, ovary, skin, head and neck, esophagus, bone marrow, blood or other tissue.
  • the tumor cell be killed or induced to undergo normal cell death or "apoptosis. " Rather, to accomplish a meaningful treatment, all that is required is that the tumor growth be slowed to some degree or localized to a specific area and inhibited from spread to disparate sites. It may be that the tumor growth is completely blocked, however, or that some tumor regression is achieved. Clinical terminology such as “remission” and “reduction of tumor” burden also are contemplated given their normal usage.
  • the therapeutic effect may result from an inhibition of angiogenesis and/or an inhibition of lymphangiogenesis.
  • the invention includes a method of treating a mammalian organism suffering from a neoplastic disease characterized by expression of one or more VEGF receptor(s) in cells, comprising the steps of: identifying a mammalian organism suffering from a neoplastic disease state characterized by expression of VEGF receptor(s), and administering to the mammalian organism in need of such treatment a composition, the composition comprising one or more polynucleotide(s) or polypeptide(s) ofthe invention effective to inhibit VEGF receptor-mediated proliferation ofthe cells.
  • Such treatment methodologies are particularly indicated for neoplastic disease states that are characterized by neovascularization involving vessels lined with endothelial cells that express increased levels of one or more VEGF receptors, relative to endothelial cells lining quiescent vessels; and disease states characterized by a cancer cells that express VEGF receptors.
  • Targeting VEGFR-3 in tumor imaging and anti-tumor therapy is described in PCT/US99/23525 (WO 00/21560), published 20 April 2000, incorporated herein by reference.
  • Other VEGF receptors e.g., VEGFR-1 also have been implicated in tumor angiogenesis or metastasis.
  • VEGF-C and VEGF-D of the VEGF family of growth factors have utility for preventing stenosis or restenosis of blood vessels. See International Patent Application No. PCT/US99/24054 (WO 00/24412), "Use of VEGF-C or VEGF-D Gene or Protein to Prevent Restenosis,” filed October 26, 1999, incorporated herein by reference in its entirety. Polypeptides and polynucleotides of the invention also will have utility for these indications.
  • the invention provides a method of treating a mammalian subject to prevent stenosis or restenosis of a blood vessel, comprising the step of administering to a mammalian subject in need of treatment to prevent stenosis or restenosis of a blood vessel a composition comprising one or more polypeptide(s) ofthe invention, in an amount effective to prevent stenosis or restenosis of the blood vessel.
  • the administering comprises implanting an intravascular stent in the mammalian subject, where the stent is coated or impregnated with the composition.
  • the composition comprises microparticles composed of biodegradable polymers such as PGLA, non-degradable polymers, or biological polymers (e.g., starch) which particles encapsulate or are impregnated by a polypeptide(s) ofthe invention.
  • biodegradable polymers such as PGLA, non-degradable polymers, or biological polymers (e.g., starch) which particles encapsulate or are impregnated by a polypeptide(s) ofthe invention.
  • Such particles are delivered to the intravascular wall using, e.g., an infusion angioplasty catheter.
  • Other techniques for achieving locally sustained drag delivery are reviewed in Wilensky et al., Trends
  • Administration via one or more intravenous injections subsequent to the angioplasty or bypass procedure also is contemplated.
  • Localization ofthe polypeptides ofthe invention to the site ofthe procedure occurs due to expression of VEGF receptors on proliferating endothelial cells. Localization is further facilitated by recombinantly expressing the polypeptides ofthe invention as a fusion polypeptide (e.g., fused to an apolipoprotein B-100 oligopeptide as described in Shih et al., Proc. Nat'l. Acad. Sci. USA, 87:1436-1440 (1990). Co-administration of polynucleotides and polypeptides ofthe invention is also contemplated.
  • the invention also provides surgical devices that are used to treat circulatory disorders, such as intravascular or endovascular stents, balloon catheters, infusion-perfusion catheters, extravascular collars, elastomeric membranes, and the like, which have been improved by coating with, impregnating with, adhering to, or encapsulating within the device a composition comprising a polynucleotide or polypeptide ofthe invention.
  • Polynucleotides or polypeptides ofthe invention could be administered purely as a prophylactic treatment to prevent stenosis, or shortly before, and/or concunently with, and/or shortly after a percutaneous transluminal coronary angioplasty procedure, for the purpose of preventing restenosis ofthe subject vessel.
  • the polynucleotide or polypeptide is administered before, during, and/or shortly after a bypass procedure (e.g., a coronary bypass procedure), to prevent stenosis or restenosis in or near the transplanted (grafted) vessel, especially stenosis at the location ofthe graft itself.
  • a bypass procedure e.g., a coronary bypass procedure
  • the polynucleotide or " polypeptide is administered before, during, or after a vascular transplantation in the vascular periphery that has been performed to treat peripheral ischemia or intermittent claudication.
  • prevention of stenosis or restenosis is meant prophylactic treatment to reduce the amount/severity of, and/or substantially eliminate, the stenosis or restenosis that frequently occurs in such surgical procedures.
  • the polynucleotide or polypeptide is included in the composition in an amount and in a form effective to promote stimulation of VEGF receptors in a blood vessel ofthe mammalian subject, thereby preventing stenosis or restenosis of the blood vessel.
  • the mammalian subject is a human subject.
  • the subject is a person suffering from coronary artery disease that has been identified by a cardiologist as a candidate who could benefit from a therapeutic balloon angioplasty (with or without insertion of an intravascular stent) procedure or from a coronary bypass procedure.
  • Polypeptides according to the invention may be administered in any suitable manner using an appropriate pharmaceutically-acceptable vehicle, e.g., a pharmaceutically-acceptable diluent, adjuvant, excipient or canier.
  • a pharmaceutically-acceptable canier solution such as water, saline, phosphate-buffered saline, glucose, or other carriers conventionally used to deliver therapeutics mtravascularly.
  • Multi-gene therapy is also contemplated, in which case the composition optionally comprises both the polynucleotide ofthe invention/vector and another polynucleotide/vector selected to prevent restenosis.
  • Exemplary candidate genes/vectors for co-transfection with transgenes encoding polypeptides ofthe invention are described in the literature cited above, including genes encoding cytotoxic factors, cytostatic factors, endothelial growth factors, and smooth muscle cell growth migration inhibitors.
  • the "administering" that is performed according to the present method may be perfomied using any medically-accepted means for introducing a therapeutic directly or indirectly into the vasculature of a mammalian subject, including but not limited to injections (e.g., intravenous, intramuscular, subcutaneous, or catheter); oral ingestion; intranasal or topical administration; and the like, h a prefened embodiment, administration ofthe composition comprising a polynucleotide ofthe invention is performed mtravascularly, such as by intravenous, intra-arterial, or intracoronary arterial injection.
  • the therapeutic composition may be delivered to the patient at multiple sites.
  • the multiple administrations may be rendered simultaneously or may be administered over a period of several hours. In certain cases it may be beneficial to provide a continuous flow of the therapeutic composition. Additional therapy may be administered on a period basis, for example, daily, weekly or monthly.
  • peroral dosage forms for the therapeutic delivery of peptides is ineffective because in order for such a formulation to the efficacious, the peptide must be protected from the enzymatic environment of the gastrointestinal tract. Additionally, the peptide must be formulated such that it is readily absorbed by the epithelial cell barrier in sufficient concentrations to effect a therapeutic outcome.
  • the peptides of the present invention may be formulated with uptake or absorption enhancers to increase their efficacy.
  • enhancer include for example, salicylate, glycocholate/linoleate, glycholate, aprotinin, bacitracin, SDS caprate and the like.
  • peptides for therapeutic delivery, those of skill in the art are referred to Fix (J. Pharm. Sci. , 85(12) 1282- 1285, 1996) and Oliyai and Stella (Ann. Rev. Pharmacol ToxicoL , 32:521-544, 1993).
  • the amounts of peptides in a given dosage will vary according to the size of the individual to whom the therapy is being administered as well as the characteristics of the disorder being treated. In exemplary treatments, it may be necessary to administer about 50mg/day, 75 mg/day, lOOmg/day, 150mg/day, 200mg/day, 250 mg/day. These concentrations may be administered as a single dosage form or as multiple doses.
  • polypeptides may also be employed in accordance with the present invention by expression of such polypeptide in vivo, which is often refened to as gene therapy.
  • the present invention provides a recombinant DNA vector containing a heterologous segment encoding a polypeptide ofthe invention that is capable of being inserted into a microorganism or eukaryotic cell and that is capable of expressing the encoded protein.
  • the composition is administered locally.
  • administration directly to the site of angioplasty or bypass is prefened.
  • the administering comprises a catheter-mediated transfer ofthe transgene-containing composition into a blood vessel ofthe mammalian subject, especially into a coronary artery ofthe mammalian subject.
  • Exemplary materials and methods for local delivery are reviewed in Lincoff et al., Circulation, 90: 2070-2084 (1994); and Wilensky et al., Trends Cardiovasc. Med., 3:163-170 (1993), both incorporated herein by reference.
  • the composition is administered using infusion-perfusion balloon catheters (preferably mircroporous balloon catheters) such as those that have been described in the literature for intracoronary drug infusions.
  • infusion-perfusion balloon catheters preferably mircroporous balloon catheters
  • infusion-perfusion balloon catheters such as those that have been described in the literature for intracoronary drug infusions.
  • infusion-perfusion balloon catheters preferably mircroporous balloon catheters
  • the transgene encoding a polypeptide ofthe invention is administered in an adenovirus vector
  • the vector is preferably administered in a pharmaceutically acceptable canier at a titer of 10 7 - 10 13 viral particles, and more preferably at a titer of 10 9 -10 ⁇ viral particles.
  • the adenoviral vector composition preferably is infused over a period of 15 seconds to 30 minutes, more preferably 1 to 10 minutes.
  • an exemplary protocol involves performing PTCA through a 7F guiding catheter according to standard clinical practice using the femoral approach. If an optimal result is not achieved with PTCA alone, then an endovascular stent also is implanted. (A nonoptimal result is defined as residual stenosis of > 30 % ofthe luminal diameter according to a visual estimate, and B or C type dissection.)
  • Arterial gene transfer at the site of balloon dilatation is perfonried with a replication- deficient adenoviral vector expressing a polypeptide ofthe invention immediately after the angioplasty, but before stent implantation, using an infusion-perfusion balloon catheter.
  • the size ofthe catheter will be selected to match the diameter ofthe artery as measured from the angiogram, varying, e.g., from 3.0 to 3.5F in diameter.
  • the balloon is inflated to the optimal pressure and gene transfer is performed during a 10 minute infusion at the rate of 0.5 ml/min with vims titer of 1.15 X 10 10 .
  • intravascular administration with a gel-coated catheter is contemplated, as has been described in the literature to introduce other transgenes. See, e.g., U.S. Patent No. 5,674,192 (Catheter coated with tenaciously-adhered swellable hydrogel polymer); Riessen et al., Human Gene Therapy, 4: 749-758 (1993); and Steg et al., Circulation, 96: 408-411 (1997) and 90: 1648-1656 (1994); all incorporated herein by reference.
  • DNA in solution e.g., a polynucleotide of the invention
  • a hydrogel polymer e.g., Slider with Hydroplus, Mansfield Boston Scientific Corp., Watertown, MA.
  • the Hydroplus coating is a hydrophilic polyacrylic acid polymer that is cross-linked to the balloon to form a high molecular weight hydrogel tightly adhered to the balloon.
  • the DNA covered hydrogel is permitted to dry before deflating the balloon. Re-inflation ofthe balloon mtravascularly, during an angioplasty procedure, causes the transfer ofthe DNA to the vessel wall.
  • an expandable elastic membrane or similar stmcture mounted to or integral with a balloon angioplasty catheter or stent is employed to deliver the transgene encoding a polypeptide ofthe invention. See, e.g., U.S. Patent Nos. 5,707,385, 5,697,967, 5,700,286, 5,800,507, and 5,776,184, all incorporated by reference herein.
  • composition containing the transgene encoding a polypeptide ofthe invention is administered extravascularly, e.g., using a device to sunound or encapsulate a portion of vessel.
  • a device to sunound or encapsulate a portion of vessel See, e.g., International Patent Publication WO 98/20027, incorporated herein by reference, describing a collar that is placed around the outside of an artery (e.g., during a bypass procedure) to deliver a transgene to the arterial wall via a plasmid or liposome vector.
  • endothelial cells or endothelial progenitor cells are transfected ex vivo with the transgene encoding a polypeptide ofthe invention, and the transfected cells as administered to the mammalian subject.
  • Exemplary procedures for seeding a vascular graft with genetically modified endothelial cells are described in U.S. Patent No. 5,785,965, incorporated herein by reference.
  • polynucleotides ofthe invention further comprises additional sequences to facilitate the gene therapy.
  • a "naked" transgene encoding a polypeptide ofthe invention i.e., a transgene without a viral, liposomal, or other vector to facilitate transfection
  • the polynucleotide ofthe invention preferably comprises a suitable promoter and/or enhancer sequence (e.g., cytomegalovims promoter/enhancer [Lehner et al., J. Clin.
  • the polynucleotides ofthe invention also preferably further includes a suitable polyadenylation sequence (e.g., the SV40 or human growth hormone gene polyadenylation sequence) operably linked downstream (i.e., 3') ofthe polypeptide- coding sequence.
  • the polynucleotides ofthe invention also preferably comprise a nucleotide sequence encoding a secretory signal peptide fused in-frame with the polypeptide sequence.
  • the secretory signal peptide directs secretion ofthe polypeptide ofthe invention by the cells that express the polynucleotide, and is cleaved by the cell from the secreted polypeptide.
  • the signal peptide sequence can be that of another secreted protein, or can be a completely synthetic signal sequence effective to direct secretion in cells ofthe mammalian subject.
  • the polynucleotide may further optionally comprise sequences whose only intended function is to facilitate large-scale production ofthe vector, e.g., in bacteria, such as a bacterial origin of replication and a sequence encoding a selectable marker.
  • sequences whose only intended function is to facilitate large-scale production ofthe vector, e.g., in bacteria, such as a bacterial origin of replication and a sequence encoding a selectable marker.
  • extraneous sequences are at least partially cleaved off prior to administration to humans according to methods ofthe invention.
  • Any suitable vector may be used to introduce the transgene encoding one of the polypeptides ofthe invention, into the host.
  • Exemplary vectors that have been described in the literature include replication-deficient retroviral vectors, including but not limited to lentivirus vectors [Kim et al., J. Virol., 72(1): 811-816 (1998);
  • the expression construct (or indeed the peptides discussed above) may be entrapped in a liposome.
  • Liposomes are vesicular stmctures characterized by a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution.
  • the lipid components undergo self-reanangement before the formation of closed stmctures and entrap water and dissolved solutes between the lipid bilayers (Ghosh and Bachhawat, In: Liver diseases, targeted diagnosis and therapy using specific receptors and ligands, Wu G, Wu C ed., New York: Marcel Delcker, pp. 87-104, 1991).
  • the addition of DNA to cationic liposomes causes a topological transition from liposomes to optically birefringent liquid-crystalline condensed globules (Radler et al, Science, 275(5301):810-4, 1997). These DNA-lipid complexes are potential non- viral vectors for use in gene therapy and delivery.
  • Liposome-mediated nucleic acid delivery and expression of foreign DNA in vitro has been very successful. Also contemplated in the present invention are various commercial approaches involving "lipofection" technology.
  • the liposome may be complexed with a hemagglutinating vims
  • the liposome maybe complexed or employed in conjunction with nuclear nonhistone chromosomal proteins (HMG-1) (Kato et al, J. Biol. Chem., 266:3361-3364, 1991).
  • HMG-1 nuclear nonhistone chromosomal proteins
  • the liposome maybe complexed or employed in conjunction with both HVJ and HMG-1. i that such expression constmcts have been successfully employed in transfer and expression of nucleic acid in vitro and in vivo, then they are applicable for the present invention.
  • Other vector delivery systems that can be employed to deliver a nucleic acid encoding a therapeutic gene into cells include receptor-mediated delivery vehicles.
  • Receptor-mediated gene targeting vehicles generally consist of two components: a cell receptor-specific ligand and a DNA-binding agent.
  • ligands have been used for receptor-mediated gene transfer. The most extensively characterized ligands are asialoorosomucoid (ASOR) (Wu and Wu, 1987, supra) and transfenin (Wagner et al, Proc. Natl Acad Sci. USA, 87(9):3410-3414, 1990).
  • ASOR asialoorosomucoid
  • transfenin Wang and Wang, 1987, supra
  • Recently, a synthetic neoglycoprotein, which recognizes the same receptor as ASOR has been used as a gene delivery vehicle (Ferkol et al, FASEB , 7:1081-1091, 1993;
  • the delivery vehicle may comprise a ligand and a liposome.
  • Nicolau et al. Methods Enzymol, 149:157-176, 1987
  • lactosyl-ceramide a galactose-tenninal asialganglioside, incorporated into liposomes and observed an increase in the uptake ofthe insulin gene by hepatocytes.
  • a nucleic acid encoding a therapeutic gene also may be specifically delivered into a particular cell type by any number of receptor-ligand systems with or without liposomes.
  • the expression construct may simply consist of naked recombinant DNA or plasmids. Transfer ofthe construct may be performed by any ofthe methods mentioned above that physically or chemically penrieabilize the cell membrane. This is applicable particularly for transfer in vitro, however, it may be applied for in vivo use as well. Dubensky et al. (Proc. Nat. Acad.
  • the polynucleotide further includes vector polynucleotide sequences (e.g., adenoviral polynucleotide sequences) operably connected to the sequence encoding a polypeptide ofthe invention.
  • vector polynucleotide sequences e.g., adenoviral polynucleotide sequences
  • the composition to be administered comprises a vector, wherein the vector comprises a polynucleotide ofthe invention.
  • the vector is an adenovims vector
  • the adenovims vector is replication-deficient, i.e., it cannot replicate in the mammalian subject due to deletion of essential viral-replication sequences from the adenoviral genome.
  • the inventors contemplate a method wherein the vector comprises a replication-deficient adenovims, the adenovims comprising the polynucleotide ofthe invention operably connected to a promoter and flanked on either end by adenoviral polynucleotide sequences.
  • kits which comprise compounds or compositions ofthe invention packaged in a manner which facilitates their use to practice methods ofthe invention
  • a kit includes a compound or composition described herein as useful for practice ofthe invention (e.g., polynucleotides or polypeptides ofthe invention), packaged in a container such as a sealed bottle or vessel, with a label affixed to the container or included in the package that describes use ofthe compound or composition to practice the method of the invention.
  • the compound or composition is packaged in a unit dosage fonn.
  • a kit ofthe invention includes a composition of both a polynucleotide or polypeptide packaged together with a physical device useful for implementing methods ofthe invention, such as a stent, a catheter, an extravascular collar, a polymer film, or the like
  • a kit ofthe invention includes compositions of both a polynucleotide or polypeptide of the invention packaged together with a hydrogel polymer, or microparticle polymers, or other earners described herein as useful for delivery ofthe polynucleotides or polypeptides to the patient.
  • the polypeptides ofthe present invention are useful in diagnostic or prognostic assays for detecting VEGF receptor protein expression.
  • Polypeptides of the invention that bind to one or more VEGF receptors may be used for detecting and measuring the presence of specific receptor proteins in samples for purposes such as e.g., medical imaging, detection, screening, or targeted therapy.
  • Detectable labels such as radioactive or non-radioactive labels, including enzyme labels or labels ofthe biotin/avidin system, may be used to tag the polypeptide ofthe invention.
  • the polypeptide may also be covalently or non-covalently coupled to a suitable supermagnetic, paramagnetic, electron dense, ecogenic or radioactive agent for imaging.
  • the present invention also relates to a diagnostic assay for detecting altered levels of VEGF receptor proteins in various tissues since over-expression ofthe proteins compared to normal control tissue samples may detect the presence of a disease or susceptibility to a disease, for example, abnormal cell growth or differentiation.
  • Polypeptides ofthe invention can be used to quantify future metastatic risk by assaying biopsy material for the presence of active receptors or ligands in a binding assay or kit using detectably-labeled polypeptides ofthe invention.
  • a related aspect ofthe invention is a method for the detection of specific cells, e.g., endothelial cells. These cells may be found in vivo, or in ex vivo biological tissue samples.
  • the method of detection comprises the steps of contacting a biological tissue comprising, e.g., endothelial cells, with a hybrid polypeptide according to the invention which is capable of binding to VEGFR(s), under conditions wherein the hybrid polypeptide binds to the cells, optionally washing the biological tissue, and detecting the hybrid polypeptide bound to the cells in the biological tissue, thereby detecting the cells.
  • a biological tissue comprising, e.g., endothelial cells
  • a hybrid polypeptide according to the invention which is capable of binding to VEGFR(s)
  • the hybrid polypeptide binds to the cells
  • optionally washing the biological tissue optionally washing the biological tissue
  • detecting the hybrid polypeptide bound to the cells in the biological tissue thereby detecting the cells.
  • the invention also is directed to a method for imaging vertebrate tissue suspected of containing cells that express a specific VEGFR comprising the steps of: (a) contacting vertebrate tissue with a composition comprising polypeptide(s) ofthe invention that specifically bind the particular VEGFR; and (b) imaging the tissue by detecting the VEGFR- binding polypeptide bound to the tissue.
  • the tissue is human tissue
  • the method further comprises the step of washing the tissue, after the contacting step and before the imaging step, under conditions that remove from the tissue polypeptides that are not bound to the VEGFR in the tissue.
  • the invention provides a method for imaging tumors in tissue from a vertebrate organism, comprising the steps of: (a) contacting vertebrate tissue suspected of containing a tumor with a composition comprising a VEGFR binding compound; (b) detecting the VEGFR binding compound bound to cells in said tissue; and (c) imaging solid tumors by identifying blood vessel endothelial cells bound by the VEGFR binding compound, wherein blood vessels expressing VEGFR are conelated with the presence and location of a tumor in the tissue.
  • the present invention also is directed to the use of hybrid polypeptides ofthe invention that bind VEGF receptors as specific markers for particular tissues and cell types.
  • those polypeptides ofthe invention that specifically bind are particularly useful as antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to antibodies to bind VEGF receptors as specific markers for particular tissues and cell types.
  • VEGFR-3 can serve as markers for lymphatic endothelial cells.
  • polypeptides ofthe invention may be screened for an ability to modulate the growth of isolated cells or cell lines.
  • certain neoplastic disease states are characterized by the appearance of VEGF receptors on cell surfaces [Valtola et al, Am J Path 754:1381-90 (1999)].
  • Polypeptides ofthe invention may be screened to determine the ability ofthe polypeptide to modulate the growth ofthe neoplastic cells.
  • Other disease states are likely characterized by mutations in VEGF receptors [Fe ⁇ ell et al, Hum Mol Genetics 7:2073-78 (1998)].
  • Polypeptides ofthe invention that modulate the activity of the mutant fo ⁇ ns ofthe VEGF receptor in a manner different than naturally-occurring vascular endothelial growth factors will be useful at modulating the symptoms and severity ofthe such disease states.
  • In vivo imaging or tissue biopsy may reveal that certain neoplastic cells are expressing a particular combination of receptors, thereby providing an indication for polypeptides ofthe invention that bind the expressed set of receptors and inhibit ligand mediated growth.
  • the use of such diagnostic imaging is particularly suitable in obtaining an image of, for example, a tumor mass or the neovascularizarion near a tumor mass.
  • the peptides ofthe present invention may be employed for imaging in a manner analogous to the antibody-based methods disclosed in U.S. Patent No. 6,107,046, incorporated herein by reference.
  • imaging agents are known in the art, as are methods of attaching the labeling agents to the peptides ofthe invention (see, e.g., U.S. Patent No. 4,965,392, U.S. Patent No. 4,472,509, U.S. Patent No. 5,021,236 and U.S. Patent No. 5,037,630, incorporated herein by reference).
  • the labeled peptides are administered to a subject in a pharmaceutically acceptable carrier, and allowed to accumulate at a target site having the VEGFR-3 receptor.
  • This peptide imaging agent serves as a contrast reagent for X-ray, magnetic resonance, sonographic or scintigraphic imaging ofthe target site.
  • Paramagnetic ions useful in the imaging agents of the present invention include for example chromium (IH), manganese (II), iron (HI), iron (TT), cobalt (H), nickel (H) copper (H), neodymium (HI), samarium (IH), ytterbium(IH), gadolinium (HI), vanadium (H), terbium (HI), dysprosium (IH), holmium (HI) and erbium (HI).
  • Ions useful for X-ray imaging include but are not limited to lantanum (IH), gold(III), lead (TT) and particularly bismuth (IH).
  • Radioisotopes for diagnostic applications include for example, 211 astatine, 14 carbon, 51 chromium, 36 chlorine, 57 cobalt, 67 copper, 1;>2 Eu, 67 gallium, 3 hydrogen, 123 iodine, 12D iodine, '"indium, 59 iron, 2 phosphoms, l86 rhenium, 7;, selenium, 35 sulphur, 99ra technicium and 90 yttrium.
  • the peptides of the present invention may be labeled according to techniques well known to those of skill in the art.
  • the peptides can be iodinated by contacting the peptide with sodium or potassium iodide and a chemical oxidizing agent such as sodium hypochlorite or an enzymatic oxidant such as lactoperoxidase.
  • Peptides may be labeled with technetium-99m by ligand exchange, for example, by reducing pertechnate with stannous solution, chelating the reduced technetium onto a Sephadex column and applying the peptide to the column.
  • chemo- and radiotherapy Tumor cell resistance to DNA damaging agents represents a major problem in clinical oncology.
  • One goal of cunent cancer research is to find ways to improve the efficacy of chemo- and radiotherapy.
  • the peptides ofthe present invention may be administered in conjunction with chemo- or radiotherapeutic intervention, immunotherapy, or with other anti-angiogenic/anti-lymphangiogenic therapy.
  • a "target" cell or tissue e.g., a tumor and/or its vasculature
  • the therapeutic peptides ofthe present invention either as a peptide composition or as an expression construct that will express the peptide
  • at least one other agent which optionally is conjugated to the peptide ofthe invention.
  • These compositions would be provided in a combined amount effective to kill or inhibit proliferation ofthe cancer by killing and/or inhibiting the proliferation ofthe cancer cells and/or the endothelia of blood and lymphatic vessels supplying and serving the cancer cells.
  • This process may involve contacting the cells with the peptide or expression construct and the agent(s) or factor(s) at the same time. This may be achieved by contacting the cell with a single composition or pha ⁇ nacological formulation that includes both agents, or by contacting the cell with two distinct compositions or fo ⁇ nulations, at the same time, wherein one composition includes the peptide or expression construct and the other includes the second agent.
  • the therapeutic treatment employing the peptides ofthe present invention may precede or follow the other agent treatment by intervals ranging from minutes to weeks.
  • an anti-cancer therapy may be delivered which directly attacks the cancer cells in a manner to kill, inhibit or necrotize the cancer cell, in addition a therapeutic composition based on the peptides ofthe present invention also is administered to the individual in amount effective to have an antiangiogenic and/or anti-lymphangiogenic effect.
  • the peptide compositions may be administered following the other anti-cancer agent, before the other anti-cancer agent or indeed at the same time as the other anti-cancer agent, optionally conjugated to the other agent.
  • Agents or factors suitable for use in a combined therapy are any chemical compound or treatment method that induces DNA damage when applied to a cell.
  • Such agents and factors include radiation and waves that induce DNA damage such as, ⁇ -i ⁇ adiation, X-rays, UV-inadiation, microwaves, electronic emissions, and the like.
  • Chemotherapeutic agents contemplated to be of use include, e.g, adriamycin, 5-fluorouracil (5FU), etoposide (VP-16), camptothecin, actinomycin-D, mitomycin C, cisplatin (CDDP) and even hydrogen peroxide.
  • the invention also encompasses the use of a combination of one or more DNA damaging agents, whether radiation-based or achial compounds, such as the use of X-rays with cisplatin or the use of cisplatin with etoposide. fn treating cancer according to the invention, one would contact the tumor cells and/or the endothelia ofthe hunor vessels with an agent in addition to the therapeutic agent comprising one or more peptide ofthe present invention. This may be achieved by irradiating the localized hunor site with radiation such as X-rays, UV-light, gamma-rays or even microwaves.
  • radiation-based or achial compounds such as the use of X-rays with cisplatin or the use of cisplatin with etoposide.
  • the tumor cells may be contacted with the agent by administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising a compound such as, adriamycin, 5-fluorouracil, etoposide, camptothecin, actinomycin-D, mitomycin C, or cisplatin.
  • a pharmaceutical composition comprising a compound such as, adriamycin, 5-fluorouracil, etoposide, camptothecin, actinomycin-D, mitomycin C, or cisplatin.
  • Kinase inliibitors also • contemplated to be useful combination therapies with the peptides ofthe present invention.
  • the agent may be prepared and used as a combined therapeutic composition, or kit, by combining it with a chimeric peptide ofthe invention, as described above.
  • Agents that directly cross-link nucleic acids, specifically DNA, are envisaged to facilitate DNA damage leading to a synergistic, antineoplastic combination with chimeric peptide -based therapy.
  • Agents such as cisplatin, and other DNA alkylating agents may be used.
  • Cisplatin has been widely used to treat cancer, with efficacious doses used in clinical applications of 20 mg/m 2 for 5 days every three weeks for a total of three courses. Cisplatin is not absorbed orally and must therefore be delivered via injection intravenously, subcutaneously, intratumorally or intraperitoneally.
  • Agents that damage DNA also include compounds that interfere with DNA replication, mitosis and chromosomal segregation.
  • chemotherapeutic compounds include adriamycin, also known as doxorubicin, etoposide, verapamil, podophyllotoxin, and the like. Widely used in a clinical setting for the treatment of neoplasms, these compounds are administered through bolus injections intravenously at doses ranging from 25-75 mg/m 2 at 21 day intervals for adriamycin, to 35-50 mg/m 2 for etoposide intravenously or double the intravenous dose orally. Agents that disrupt the synthesis and fidelity of nucleic acid precursors and subunits also lead to DNA damage.
  • nucleic acid precursors As such a number of nucleic acid precursors have been developed. Particularly useful are agents that have undergone extensive testing and are readily available. As such, agents such as 5-fluorouracil (5-FU), are preferentially used by neoplastic tissue, making this agent particularly useful for targeting to neoplastic cells. Although quite toxic, 5-FU, is applicable in a wide range of carriers, including topical, however intravenous administration with doses ranging from 3 to 15 mg/kg/day being commonly used.
  • 5-FU 5-fluorouracil
  • chemotherapeutic agents m d the cancers which have been shown to be managed by administration of such agents.
  • Combinations of these chemotherapeutics with the peptides ofthe present invention may prove to be useful h amelioration of various neoplastic disorders.
  • these compounds include adriamycin (also known as doxorubicin), VP-16 (also known as etoposide), and the like, daimombicin (intercalates into DNA, blocks DNA-directed RNA poiymerase and inhibits DNA synthesis); mitomycin (also Icnown as mutamycin and/or mitomycin-C) is an antibiotic isolated from the broth of Streptomyces caespitosus which has been shown to have antitumor activity; Actinomycin D also may be a useful drug to employ in combination with the peptides ofthe present invention because tumors which fail to respond to systemic treatment sometimes respond to local perfusion with dactinomycin which also is known to potentiate radiotherapy.
  • adriamycin also known as doxorubicin
  • VP-16 also known as etopo
  • Bleomycin is a mixture of cytotoxic glycopeptide antibiotics isolated from a strain of Streptomyces verticillus, is effective in the management ofthe following neoplasms either as a single agent or in proven combinations with other approved chemotherapeutic agents in squamous cell carcinoma such as head and neck (including mouth, tongue, tonsil, nasopharynx, oropharynx, sinus, palate, lip, buccal mucosa, gingiva, epiglottis, larynx), skin, penis, cervix, and vulva. It has also been used in the treatment of lymphomas and testicular carcinoma.
  • Cisplatin has been widely used to heat cancers such as metastatic testicular or ovarian carcinoma, advanced bladder cancer, head or neck cancer, cervical cancer, lung cancer or other tumors and maybe a useful combination with the peptides ofthe present invention.
  • VP16 etoposide
  • VP16 etoposide
  • bleomycin and cisplatin etoposide
  • cisplatin small- cell carcinoma ofthe lung. It is also active against non-Hodgkin's lymphomas, acute nonlymphocytic leukemia, carcinoma ofthe breast, and Kaposi's sarcoma associated with acquired immunodeficiency syndrome (AIDS).
  • AIDS acquired immunodeficiency syndrome
  • Tumor Necrosis Factor [TNF; Cachectin] glycoprotein that kills some kinds of cancer cells, activates cytolcine production, activates macrophages and endothelial cells, promotes the production of collagen and coUagenases, is an inflammatory mediator and also a mediator of septic shock, and promotes catabolism, fever and sleep.
  • TNF can be quite toxic when used alone in effective doses, so that the optimal regimens probably will use it in lower doses in combination with other drags. Its nnmunosuppressive actions are potentiated by ⁇ -interferon, so that the combmation potentially is dangerous.
  • a hybrid of TNF and interferon- ⁇ also has been found to ' possess anti-cancer activity.
  • Taxol an antimitotic agent original isolated from the bark ofthe ash tree, Taxus brevifolia, and its derivative paclitaxol have proven useful against breats cancer and may be used in the combination therapies ofthe present invention.
  • Beneficial responses to vincristine have been reported in patients with a variety of other neoplasms, particularly
  • Vinblastine also is indicated as a useful therapeutic in the same cancers as vincristine. The most frequent clinical use of vinblastine is with bleomycin and cisplatin in the curative therapy of metastatic testicular tumors. It is also active in Kaposi's sarcoma, neuroblastoma, and
  • Melphalan also known as alkeran, L-phenylalanine mustard, phenylalanine mustard, L-PAM, or L-sarcolysin, is a phenylalanine derivative of nitrogen mustard.
  • Melphalan is a bifunctional alkylating agent which is active against selective human neoplastic diseases.
  • Melphalan is the active L-isomer ofthe D-isomer, known as medphalan, which is less active against certain animal tumors, and the dose needed to produce effects on chromosomes is larger than that required with the L-isomer.
  • Melphalan is available in form suitable for oral adminisfration and has been used to treat multiple myeloma. Available evidence suggests that about one third to one half of the patients with multiple myeloma show a favorable response to oral administration ofthe drug.
  • Melphalan has been used in the treatment of epithelial ovarian carcinoma.
  • Cyclophosphamide is stable in the gastrointestinal tract, tolerated well and effective by the oral and parental routes and does not cause local vesication, necrosis, phlebitis or even pain.
  • Chlorambucil a bifunctional alkylating agent ofthe nitrogen mustard type that has been found active against selected human neoplastic diseases.
  • Chlorambucil is indicated in the treatment of chronic lymphatic (lymphocytic) leukemia, malignant lymphomas including lymphosarcoma, giant follicular lymphoma and Hodgkin's disease. It is not curative in any of these disorders but may produce clinically useful palliation.
  • Other factors that cause DNA damage and have been used extensively include what are commonly Icnown as gamma-rays, X-rays, and/or the directed delivery of radioisotopes to tumor cells.
  • Other forms of DNA damaging factors are also contemplated such as microwaves and UV-irradiation.
  • Dosage ranges for X-rays range from daily doses of 50 to 200 roentgens for prolonged periods of time (3 to 4 weeks), to single doses of 2000 to 6000 roentgens.
  • Dosage ranges for radioisotopes vary widely, and depend on the half-life of the isotope, the strength and type of radiation emitted, and the uptake by the neoplastic cells.
  • peptides ofthe invention may be combined with other angiogenesis inliibitors.
  • the peptides ofthe present invention are expected to have both anti-lymphangiogenic and anti- angiogenic properties.
  • anti-angiogenic drugs also may have anti-lymphangiogenic properties, http://cancertrials.nci.nih.gov/news/angio is a website maintained by the National Institutes of Health which provides current information on the trials presently being conducted with anti-angiogenic agents.
  • Marimastat Bosh Biotech, Annapolis MD; indicated for non-small cell lung, small cell lung and breast cancers
  • AG3340 Agouron, LaJolla, CA; for ghoblastoma multiforme
  • COL-3 Collagenex, Newtown PA; for brain tumors
  • Neovastat Aetema, Quebec, Canada; for kidney and non-small cell lung cancer
  • BMS-275291 Bristol-Myers Squibb, Wallingford CT; for metastatic non-small cell ling cancer
  • Thalidomide Celgen; for melanoma, head and neck cancer, ovarian, metastatic prostate, and Kaposi's sarcoma; recmrent or metastatic colorectal cancer (with adjuvants); gynecologic sarcomas, liver cancer; multiple myeloma; CLL, recurrent or progressive brain cancer, multiple myeloma, non-small cell lung, nonmeta
  • SU5416 (Sugen, San Francisco, CA; recmrent head and neck, advanced solid tumors, stage HTB or TV breast cancer; recunent or progressive brain (pediatric); Ovarian, AML; glioma, advanced malignancies, advanced colorectal, von-Hippel Lindau disease, advanced soft tissue; prostate cancer, colorectal cancer, metastatic melanoma, multiple myeloma, malignant mesothelioma: metastatic renal, advanced or recunent head and neck, metastatic colorectal cancer); SU6668 (Sugen San Francisco, CA; advanced tamors); interferon- ⁇ ; Anti- VEGF antibody (NAtional Cancer histitute, Bethesda MD; Genentech San Franscisco, CA; refractory solid tumors; metastatic renal cell cancer, in untreated advanced colorectal); EMD121974 (Merck KCgaA, Darmstadt, Germany; HIV related Kaposi's Sarcoma, progressive or
  • the nucleotide sequences of VEGF-A and mature VEGF-C were analyzed to determine localized regions of nucleotide identity which would be suitable for designing short DNA fragments which could be synthesized and readily recombined. Eight conesponding regions of identity were selected in each molecule as sites for fragmentization (into nine fragments) and recombination into chimeric (hybrid) molecules. These fragmentation sites were chosen based on nucleotide sequence and also because the resultant fragments would conespond to structural elements (e.g., alpha helix, loop, etc.) based on the crystal structure of VEGF-A (see Fig. 1).
  • VEGF-A Nine pairs of synthetic oligonucleotides were designed based on the coding sequence for VEGF I2I , for the purpose of forming nine DNA fragments that encompass the receptor binding domain encoding region of VEGF-A (conesponding to nucleotides 156 to 461 of SEQ ID NO: 1, which encode amino acid residues 34 to 135 of SEQ ID NO: 2).
  • Each oligonucleotide pair comprised a forward primer containing coding sequence and a reverse primer with nucleotide sequence complementary to a portion of the forward primer, to permit annealing ofthe primers to each other into a double-stranded DNA fragment.
  • Either the forward or reverse primer of each pair also included a short 5' and 3' nucleotide sequence that was not complementary to any sequence of its paired primer. These short additional sequences conespond to the localized regions of nucleotide identity set forth above. Following annealing of primer pairs, this additional sequence formed single-stranded overhangs compatible with annealing with other double- stranded annealed primer pairs, as described in greater detail below.
  • the nucleotide sequences from the VEGF-A forward and reverse primers are set forth below in Tables IA and IB, respectively.
  • the nucleotide sequences of forward primers Al-F to A9-F are set forth in SEQ ID NOs: 3-11, respectively.
  • the top strand shows the DNA sequence and the bottom strand indicates the amino acids encoded by that particular primer, h some instances, only two nucleotides of a given codon is contained in one primer, and the remaining nucleotide ofthe codon is contained in the preceding or following primer. In these cases, the amino acid is listed under the primer that contains 2 out ofthe 3 nucleotides of that particular codon.
  • Boldface type indicate nucleotides coding for amino acids that constitute a protein linker region and are not part ofthe parent VEGF-A or VEGF-C molecule; underlined nucleotides are those that are removed during assembly of the fragments into hybrid constructs; and the lowercase letters are those nucleotides that produce an overhang when the oligonucleotide pahs are annealed to each other to produce the 9 fragments.
  • A9-R GGCCGCGAAGACTCAATCTTTCTTTGGTCTACATTCACATTTGTTATGCTGGAGaaqct
  • fragment Al was created by annealing primer Al-F with primer Al -R
  • fragment A2 was created by annealing A2-F with A2-R
  • Annealing was accomplished by incubating 2 pmol/ ⁇ l of each appropriate primer, 20 mM Tris HCl, 2mM MgCl 2 , and 50 mM NaCl, pH 7.4 at 95°C for 5 minutes, followed by cooling ofthe solution to 37°C at a rate of rC/minute.
  • fragment Al encodes amino acid residues 34 to 42, and part of amino acid 43 of SEQ ID NO: 2; fragment A2 encodes part of amino acid 43, and amino acids 44-53 of SEQ FD NO: 2; fragment A3 encodes amino acids 54 to 63, and part of amino acid 64 of SEQ ID NO: 2; fragment A4 encodes part of amino acid 64, amino acids 65 to 71, and part of amino acid 72 of SEQ ID NO: 2; fragment A5 encodes part of ammo acid 72, amino acids 73 to 83, and part of amino acid 84 of SEQ ID NO: 2; fragment A6 encodes part of amino acid 84, amino acids 85 to 92, and part of amino acid 93 of SEQ ID NO: 2; fragment A7 encodes pait of amino acid 93, amino acids 94 to 107, and pait of amino acid 108 of SEQ ID NO: 2; fragment AS encodes pait of amino acid 108, and amino acids 109 to 122 of SEQ TD NO: 2; and fragment
  • nucleotide sequences ofthe nine forward primers and nine reverse primers are set forth in Table 2A (SEQ ID NOs: 23-31) and Table 2B (SEQ ID NOs: 32-40), respectively.
  • Primer pairs were annealed to form nine double-stranded DNA fragments which together encoded the receptor binding domain of VEGF-C, and which possessed appropriate single stranded overhangs for annealing to other fragments, as described above for VEGF-A.
  • Fragment Cl encodes amino acid residues 112 to 120, and part of amino acid 121 of SEQ ID NO: 22; fragment C2 encodes part of amino acid 121 and amino acids 122 to 132 of SEQ ID NO: 22; fragment C3 encodes amino acids 133 to 142, and part of amino acid 143 of SEQ ID NO: 22; fragment C4 encodes part of amino acid 143, amino acids 144 to 150, and part of amino acid 151 of SEQ ID NO: 22; fragment C5 encodes part of amino acid 151, amino acids 152 to 162, and part of amino acid 163 of SEQ ID NO: 22; fragment C6 encodes part of amino acid 163, and amino acids 164 to 171, and part of amino acid 172 of SEQ JD NO: 22; fragment C7 encodes part of amino acid 172, amino acids 173 to 186, and pait of amino acid 187 of SEQ ID NO: 22; fragment C8 encodes part of amino acid 187, amino acid 188 to 203 of SEQ ID NO: 22; and fragment C
  • Figure 2 is a schematic diagram illustrating the construction ofthe 9 VEGF-A and 9 VEGF-C DNA fragments.
  • the oligonucleotides were designed to produce double-stranded DNA fragments containing unique cohesive ends upon annealing. Ligation ofthe 9 VEGF-A DNA fragments produces a single linear double-stranded DNA encoding amino acids 34-135 of VEGF-A (SEQ ID NO: 2), and ligation ofthe 9 VEGF-C DNA fragments results in a single DNA encoding amino acids 112-216 of VEGF-C (SEQ ID NO: 22).
  • ligation of fragments can also be accomplished without cohesive ends.
  • Blunt-end fragments also can be synthesized and annealed to generate hybrid proteins using the method described above. With a blunt-end strategy, the nucleotide sequences ofthe parent molecules do not need to be examined for the presence of nucleotide identity to enable the creation of cohesive ends. However, additional post-ligation screening may be required to identify hybrids that contain fragments in the desired order and orientation.
  • Al and VEGF-C fragment Cl the first two encoded amino acids, Asp and Pro, constitute a protein linker (encoded by an engineered BamHl recognition site) and do not conespond to either VEGF-A or VEGF-C sequences.
  • fragments were designed to conespond to discrete sfructural elements within the receptor binding domain of VEGF family proteins.
  • Fragment 2 co ⁇ esponds to the N-terminal helix; fragment 4 conesponds to ⁇ 2; fragment 6 co ⁇ esponds to the ⁇ 3- ⁇ 4 loop, fragment 7 conesponds to ⁇ 5; fragment 8 conesponds to the ⁇ 5- ⁇ 6 loop; and fragment 9 conesponds to ⁇ 7.
  • oligonucleotides that were designed do not conespond exactly with native human VEGF-A or VEGF-C cDNA sequences (i.e., DNA counterparts of naturally-occm ⁇ ing human mRNA sequences), notwithstanding the fact that the oligonucleotides were designed to retam encoded amino acid sequences ofthe human VEGF-A and VEGF-C polypeptides.
  • the oligonucleotides were designed such that the native (endogenous) human nucleotide sequence encoding the receptor binding domain for both VEGF-A and VEGF-C were modified to generate new restriction sites, to provide longer stretches of nucleotide identity where overlaps were desired between the "A” and “C” fragments, or to improve codon usage for expression in human cell culture. All nucleotide mutations (relevant to the native sequences) were silent.
  • the amino acid sequences ofthe receptor binding domain of VEGF-A resulting from annealing fragments A1-A9
  • VEGF-C from annealing fragments Cl-
  • each ofthe nine VEGF-A fragments aligns with the conesponding VEGF-C fragment, and has a compatible cohesive end to anneal to adjacent fragments from the other molecule.
  • fragments Al and Cl conespond to the same relative portions of VEGF-A and VEGF-C, respectively, and have identical top strand cohesive ends.
  • These cohesive ends are exactly complementary to bottom strand cohesive ends of both fragments A2 and C2, such that Al could anneal to either A2 or C2, and Cl also could anneal to A2 or C2.
  • Fragments A2 and C2 conespond to the same relative portions of VEGF-A and VEGF-C, and each possesses another bottom strand cohesive end that is exactly complementary to top strand cohesive ends of fragments A3 and C3, and so on.
  • each set of nine fragments was designed not only to anneal to adjacent fragments of its parent VEGF-A/VEGF-C molecule, but also to anneal to adjacent fragments ofthe other molecule.
  • the nine VEGF-A fragments and the nine VEGF-C fragments can be recombined and annealed into 512 distinct hybrids, two of which represent naturally-occurring sequences (A1-A2-A3-A4-A5-A6-A7-A8-A9 and C1-C2-C3-C4-C5-C6-C7-C8-C9) and 510 of which represent novel hybrids. All 512 sequences were reconstructed using the following three step process. First, the receptor binding domains of VEGF-A and VEGF-C were divided into 4 subdomains designated N123, N45, C67 and C89, as shown in Figme 2.
  • N123 consists of the first 3 DNA fragments encoding the receptor binding domain of both VEGF-A and VEGF-C.
  • N45, C67 and C89 each consists of 2 DNA fragments where N45 includes fragments 4 and 5, C67 consists of fragments 6 and 7, and C89 includes fragments 8 and 9.
  • Figme 4 is a schematic diagram illustrating all four possible N45 DNA segments
  • Figure 5 depicts all four possible C67 DNA segments
  • Figure 6 shows all four possible C89 DNA segments.
  • Figures 7A-7D depict the amino acid sequences encoded by each of fragments A1-A9 and C1-C9; and schematically depict all the permutations of encoded peptides that result from recombinations that form the eight N123 constructs (Fig 7 A), four N45 constmcts (Fig. 7B), four C67 constructs (Fig. 7C), and four C89 constructs (Fig. 7D).
  • the N123 fragments were joined withN45 fragments, and the C67 fragments were joined with C89 fragments.
  • the N123 and N45 fragments were removed from their pKO-Scrambler-V912 host vector by digestion with restriction enzymes that allowed ligation of N 123 to N45, and which also achieved removal ofthe non-protein coding regions of fragments 3 and 4 (see Tables IA, IB, 2 A and 2B).
  • restriction enzymes that allowed ligation of N 123 to N45, and which also achieved removal ofthe non-protein coding regions of fragments 3 and 4 (see Tables IA, IB, 2 A and 2B).
  • 32 distinct N-terminal portions ofthe receptor binding domains were obtained.
  • These clones were further inserted into the pSecTagl vector (SEQ ID NO: 41).
  • the pSecTagl vector is a combined E. co/zVmammalian expression vector which was constructed by modifying the pSecTagA vector (Invitrogen).
  • pSecTagA was modified to eliminate specific restriction sites using site-directed mutagenesis and synthetic linkers, and the EM7 promoters from pICZ ⁇ -A (hivitrogen) and pTRACER-CMV were added downstream to the CMV promoter of pSecTagA .
  • Both pSecTagl and it's parent vector, pSecTagA allow high level of expression in mammalian cell culture using suitable cell lines e.g., 293T cells, zeocin selection of stably transfected mammalian cells, contain a mammalian signal peptide for secretion ofthe expressed protein, and contain a C-terminal myc epitope and polyhistidine tag for detection, quantitation and purification ofthe expressed protein.
  • the pSecTagl vector differs from the pSpecTagA vector that expression in E. coli is constitutive and modification ofthe restriction sites facilitated cloning ofthe hybrid constructs.
  • the C67 and C89 fragments were removed from their pKO-Scrambler-V912 host vector by digestion with appropriate restriction enzymes, which also achieved removal of the non-protein coding regions of fragments 6 and 9 (see Tables IA, IB, 2A and 2B). Ligation ofthe four different C67 molecules to the fom different C89 molecules produced 16 distinct C-terminal halves ofthe receptor binding domain, the C67-C89 fragments were cloned into the pKO-Scrambler vector during these ligations.
  • Assembly ofthe hybrid molecules can also be accomplished in fewer ligation steps than outlined above. For example, ligation of N123, N45, C67 and C89 can be completed in a single ligation reaction. By designing fragments with cohesive ends that are perfect complements only with cohesive ends of adjacent fragments, it is possible to ligate multiple fragments in a conect order in a single ligation reaction.
  • Each ofthe 512 constructs were separately transfected transiently into 293 T cells to express the different hybrid constructs.
  • 293T cells were grown according to standard protocols in medium consisting of Dulbecco's modified Eagle's medium (D-MEM), and 10% fetal bovine serum (FBS). Twenty-four horns prior to transfection, confluent dishes were diluted 1:10 with fresh media into 6 wells. Four hours prior to transfection, the medium was changed. For each construct, 3 ug of DNA was transfected using standard protocols for calcium phosphate-mediated transfection [Sambrook et al, Molecular Cloning: A Laboratory Manual pp. 16.33-16.36 (1989)].
  • the supernatant was immmioprecipitated with anti-pentahistidine antibody (Qiagen) by mixing 175 ⁇ l of sample supernatant with 100 ⁇ l IP mix (PBS with 1.5% o
  • VEGF proteins with a polyhistidine tag VEGF proteins with a polyhistidine tag.
  • PBS protein A sepharose
  • Standard buffer was added to each o immunoprecipitation sample and boiled for 5 minutes at 95 C during which the immunopreciptated proteins become dissociated from the protein A sepharose. After centrifugation, 10 ⁇ l of each sample was analyzed on 15% SDS-PAGE under reducing conditions. The gels were dried and exposed for either 12 hours on phosphorimager plates or 4 weeks on X-ray film.
  • fragment 3 from VEGF-A and fragment 7 from VEGF-C may arise from inconect folding ofthe molecule, perhaps caused in part by rapid glycosylation of the VEGF-C-derived fragment 7 when the molecule appears in the endoplasmic reticulum.
  • the glycosylation sites within VEGF-A are located at a distance from the receptor binding domain, whereas the glycosylation sites within VEGF-C are positioned closer towards the region ofthe molecule formed by fragment 3 that is predicted to form contacts with the third domain ofthe receptor.
  • the carbohydrate residues may also be involved in the interaction between ligand and receptor.
  • Example 3 Binding assays of hybrid molecules to soluble VEGF receptor-Fc fusion proteins.
  • hybrid proteins that were expressed in 293T cells were tested for the ability to bind soluble VEGF receptor-Fc fusion proteins. Binding ofthe hybrid proteins to all three VEGF receptors, VEGFR-1, VEGFR-2, and VEGFR-3, was analyzed in this manner. Exemplary binding assays have been described in Achen et al, Proc Natl Acad Sci USA 95:548-53 (1998), incorporated by reference in its entirety.
  • binding assays can be perfonned with any foim of natiirally occuning VEGF receptors that retain the ability to bind their respective ligands, including but not limited to whole cells that naturally express a receptor or that have been recombinantly modified to express the receptor; truncated, solublized extracellular ligand binding domains of receptors; fusions comprising receptor extracellular domains fused to other proteins such as alkaline phosphatase (e.g., VEGFR-2-AP described in Cao et al, J. Biol. Chem.
  • alkaline phosphatase e.g., VEGFR-2-AP described in Cao et al, J. Biol. Chem.
  • immunoglobulin sequences comprising receptor extracellular domains fused to tag sequences (e.g., a polyhistidine tag) useful for capturing the protein with an antibody or with a solid support; and receptor extracellular domains chemically attached to solid supports such as CNBr-activated Sepharose beads.
  • tag sequences e.g., a polyhistidine tag
  • VEGFR-1 VEGFR-2, or VEGFR-3 fused to immunoglobulin constant region chains.
  • the first three Ig domains of VEGFR-1 were fused to the Fc fragment from the Signal-pIgPlus vector (Ingenius/Novagen/R&D Systems).
  • This construct (VEGFR-1 -Fc) was stably expressed in Drosophila Schneider 2 (S2) cells, and purified using Protein A sepharose. Purity was analyzed by silver staining of a PAGE gel and the functionality ofthe fusion protein was tested by its ability to bind 35 S-labeled VEGF protein.
  • the VEGFR-2-Fc receptor comprises the first 3 Ig domains of
  • VEGFR-2 (encoded by nucleotides 64-972 of GenBanlc Ace. No. X61656) fused to the Fc fragment in the pig vector.
  • the VEGFR-3-Fc receptor similarly consists if the first three Ig domains of VEGFR-3 (encoded by nucleotides 20-1005 of GenBanlc Ace. No. X68203) fused to the Fc fragment ofthe pig vector.
  • VEGFR-2-Fc and VEGFR-3-Fc proteins were expressed in 293T cells and purified as described above for VEGFR-1-Fc.
  • the binding assay procedure was identical to the immunoprecipitation using pentahistidine antibody described in Example 2, apart from the composition ofthe immunoprecipitation (IP) mixes.
  • IP immunoprecipitation
  • the IP mixes used for the receptor binding analysis were as follows: For VEGFR-1 binding assays, the IP mix was phosphate buffered sahne (PBS) containing 1.5% BSA, 0.06% Tween 20, 3 ⁇ g/ml heparin and 400 ng ml
  • VEGFR-1-Fc fusion protein (100 ⁇ l of this IP mix was added to 200 ⁇ l of sample supematant); for VEGFR-2 bmding assays, the IP mix was 82% conditioned cell supernatant from 293T cells transiently expressing VEGFR-2-Fc fusion protein in mixture with 18% of a PBS solution that contained 5% BSA, 0.2% Tween 20, and 10 ⁇ g/ml heparin (250 ⁇ l of IP mix was added to 200 ⁇ l of sample supernatant); and for VEGFR-3 bmding assays, the IP mix was 82% conditioned cell supernatant from 293T cells transiently expressing VEGFR-3-Fc fusion protein, 18% of PBS containing 5% BSA, 0.2% Tween 20, and 10 ⁇ g/ml heparin (250 ⁇ l of IP mix was added to 200 ⁇ l of sample supernatant).
  • fragment 7 derived from VEGF-A and fragment 9 from VEGF-A produces two bands of ⁇ 18 and ⁇ 22 kD
  • fragment 7 derived from VEGF-A and fragment 9 from VEGF-C produces an ⁇ 26 kD band (a second band of- 22 kD is sometimes missing, a third extremely weak band of ⁇ 18 kD is sometimes visible)
  • fragment 7 derived from VEGF-C and fragment 9 from VEGF-A produces an ⁇ 22 kD band (a second band of ⁇ 18 lcD is sometimes missing)
  • fragment 7 derived from VEGF-C and fragment 9 from VEGF-C produces one band of ⁇ 23 1cD.
  • Results ofthe binding assays indicate that if both glycosylation sites were derived from VEGF-C, less heterogeneous glycosylation is observed. Molecules containing both fragment 7 from VEGF-A and fragment 9 from VEGF-C appear to promote artificial hyperglycosylation. The VEGF-A glycosylation site contained in fragment 7 is also prone to incomplete glycosylation
  • the binding assay data indicate that several ofthe hybrid molecules exhibit novel binding properties. Although the analysis was not quantitative, some ofthe hybrid molecules show different relative signal strengths. For example, clone 72-10 appears to have lost much of its affinity for VEGFR-3 while retaining most of its affinity for VEGFR-2. These results suggest that among the hybrid proteins that retained the receptor specificities of either parent protein (VEGF-A or VEGF-C), some may have undergone differential changes in their binding affinities towards the conesponding receptors.
  • EXP Column 3 labeled “EXP” lists the results from the experiments to express the constructs in 293T cells, as described in Example 2.
  • “none” indicates that no detectable protein was expressed; “weak” indicates that weak expression was detectable; and “yes” indicates that the expressed protein was readily detectable.
  • the final three columns list results from the receptor binding assays described in Example 3, where binding to VEGFR-1 -Fc; VEGFR-2-Fc; and VEGFR-3 -Fc were examined. For these last three columns, “yes” indicates binding, “none” indicates no detectable binding to the receptor, and "0” indicates that this construct was not expressed in 293T cells, thus, could not be used for binding assays.
  • AAACAACAA none 0 0 0 14-3 AAACACAAA yes yes yes none 14-4 AAACACCAA none 0 0 0 14-5 AAACAAAAC yes yes none none 14-6 AAACAACAC none 0 0 0 1144--77 AAACACAAC yes none yes none 14-8 AAACACCAC none 0 0 0 14-9 AAACAAACA yes yes yes yes yes yes yes yes
  • Receptor binding properties were analyzed only for constructs that were expressed. If a clone was weakly expressed, its receptor binding properties were analyzed only if its size allowed distinction from endogenous VEGF-A expression, or if its amino acid composition allowed removal of endogenous VEGF-A using monoclonal anti- VEGF-A antibodies (R&D Systems) prior to assaying receptor binding. Although the epitope recognized by this anti- VEGF-A antibody has not been characterized, om preliminary results indicate that the epitope is located within one or more of fragments 2, 3, 4, 7, or 9 of VEGF-A.
  • VEGF-A antibody precipitation of endogenous VEGF-A was perforated for all constructs in which fragments 2, 3, 4, 7, and 9 were derived from VEGF-C. Further mapphig ofthe epitope of this antibody may allow similar examination of additional constracts. For example, if subsequent analysis indicates that the epitope does not reside in fragment 2, constracts in which fragment 2 was derived from VEGF-A can also be analyzed by this method. This proceedme was perfonned for binding to VEGFR-1 or VEGFR-2, to assess how many low affinity binding hybrid molecules were not detected due to interference with endogenous VEGF. Fail e to detect a signal or detection of a weak signal in the receptor binding assays does not conclusively demonstrate lack of or low receptor binding affinity.
  • the intrinsic set-up ofthe experiment does not allow detection of low affinity binders of VEGFR-1 and VEGFR-2 that are weakly expressed.
  • the binding assays may have failed to detect low affinity binders of VEGFR-1 and VEGFR-2 for some ofthe hybrid proteins that were weakly expressed.
  • VEGF-A such a heterodimer may be capable of binding one of more receptor(s) with low affinity.
  • Purification of chimeric polypeptides ofthe invention e.g., using immunoaffinity chromatography with an antibody that recognizes either the myc or HA tag sequences
  • the hybrid proteins will be expressed in insect cells, e.g., S9 cells, to avoid contamination with endogenous VEGF-A.
  • Lack of expression or low level expression of a particular construct may be due to properties ofthe hybrid protein itself, variations in DNA quality, or may reflect mutations in the DNA acquired during construction ofthe hybrid clone.
  • all constructs were sequenced after the first ligation step, and selected clones were sequenced after the second ligation step. Analysis of these sequences indicated that no mutations occmred during the first step, and none ofthe sequences examined after the second step of construction contained mutations. Thus, any mutations present in the final clone most probably occurred during the final ligation step.
  • VEGF receptor ligands 12-9 and 12-13 show binding to VEGFR-1 and VEGFR-3 but not VEGFR-2, whereas 12-7 and 12-11 exhibit binding to all three VEGF receptors.
  • the novel molecules constracted in some cases have been shown to have modified biological effects compared to their wild-type ancestors, and thus may be used in applications where specificity and fine-tuning of biological effects are necessary.
  • these experiments demonstrate that it is possible to construct a "super- VEGF", such as clones 12-7 and 12- 11, which binds all three Icnown VEGFRs, and therefore should be uniquely potent i inducing vascular growth.
  • the VEGF-A/VEGF-C hybrid proteins can be used to examine interactions between VEGF-A or VEGF-C, and their receptors. Analysis ofthe results from the receptor binding assays, such as those described in Table 3 and Example 3, enable careful investigation ofthe receptor-binding epitopes of these two VEGF growth factors.
  • the ability of particular hybrid proteins to bind one ofthe VEGF receptors may be conelated with the presence of one or more particular fragments derived from one ofthe parent molecules. Such data can help define the amino acid residues important for binding to a specific VEGF receptor. Knowledge ofthe precise receptor binding epitopes of a particular VEGF protein can facilitate the design of inhibitory molecules useful for therapeutic purposes.
  • VEGF residues important for interfacing with VEGFR-1 are indicated in large bold text: GQNFFHEVVKFMDVYQRSYCHPFFITLVDIFQEYPDEIEYLFKPSCVPLMRCG GCCNDEGLECVPTEESNITMQMRIKPHQGQHIGEMSFLQHNKCECRPK
  • Figure 8 is a tliree-dimensional model ofthe interaction of a VEGF-A dimer with two VEGFR-1 molecules.
  • the two VEGF-A monomers are colored in green and blue, respectively.
  • Domain 2 ofthe two VEGFR-1 receptors are depicted in gray. Red represents the location of residues within the VEGF-A monomers important for VEGFR-1 interfacing. These residues are clustered at the two ends ofthe VEGF dimer and include the N- terminal helix and part ofthe ⁇ 5 strand.
  • VEGF-C-derived fragment 4 (containing the ⁇ 2 strand ofthe molecule) is absolutely required for VEGFR-3 binding specificity.
  • Fragments 5 (wliich includes the ⁇ 3 strand) and 8 appear to represent two other important VEGF-C fragrhents for VEGFR-3 binding.
  • the amino acid sequence of VEGF-C fragments 4 and 5 is EFGVATNT-
  • FIG. 10 is a three-dimensional model of a the interaction between portions of a VEGF-C dimer and a single VEGFR-3 molecule, extrapolated from the VEGF-A/VEGFR-1 model. Blue and green represent the two VEGF-C monomers and grey represents VEGFR-3. Fragment 5 ofthe green VEGF- C monomer is shown in orange and fragment 4 ofthe same monomer is shown in white. Residues in red are those located within fragment 4 or 5 that are probably in contact with the receptor.
  • Figure 9 is a three-dimensional model that depicts the groove formed by the fragments that appear to be important for VEGFR-3 specificity. This groove is speculated to accommodate the linker region between domain 2 and 3 ofthe VEGFR-3 receptor. The entry and the sides of this groove are formed by the fragments that appear to be important for conferring VEGFR-3 specificity. The green and blue indicate the two VEGF-C monomers and the gray indicates the VEGFR-3 receptor molecule. The VEGF- C residues that are believed to participate in binding VEGFR-3 are indicated in yellow. Although fragments 6 and 9 are involved in interaction with the VEGF receptors, these fragments do not appeal- to be involved in determining receptor specificity.
  • the VEGF-A/VEGF-C hybrid proteins may be used for therapeutic applications where either activation of inhibition of one or more VEGF receptors is desired.
  • a candidate hybrid protein can be added to stable cell lines expressing a particular VEGF receptor whose activation is necessary for cell survival. Survival ofthe cell line indicates that the candidate hybrid protein is able to bind and activate that particular VEGF receptor. On the other hand, death ofthe cell line indicates that the candidate hybrid protein fails to activate the receptor.
  • Exemplary examples of such cell- survival assays have been described in International Patent Publication No. WO 98/07832 and in Achen et al, Proc Natl Acad Sci USA J:548-553 (1998), incorporated herein by reference.
  • This assay employs Ba/F3-NYK-EpoR cells, which are Ba F3 pre-B cells that have been fransfected with a plasmid encoding a cliimeric receptor consisting ofthe extracellular domain of VEGFR-2 and the cytoplasmic domain of the erythropoietin receptor (EpoR). These cells are routinely passaged in interleukin-3 (TL-3) and will die in the absence of IL-3. However, if signaling is induced from the cytoplasmic domain ofthe chimeric receptor, these cells survive and proliferate in the absence of DL-3. Such signaling is induced by ligands which bind to the VEGFR-2 extracellular domain ofthe chimeric receptor. For example, binding of VEGF-A or VEGF-D to the VEGFR-2 extracellular domain causes the cells to survive and proliferate in the absence of IL-3.
  • VEGFR-2 ligands such as VEGF-A or VEGF-D
  • VEGF-A or VEGF-D the extracellular domain, or with the activation ofthe cytoplasmic domain, will cause cell death hi the absence of IL-3.
  • Cells are cultured in the presence of IL-3 until required, then washed three times in phosphate buffered saline (PBS), resuspended in IL-3-free cell culture medium
  • PBS phosphate buffered saline
  • DMEM Dulbecco's Modified Eagle's Medium
  • fetal calf serum 10%, L-glutamine (1%), geneticin (lmg/ml), streptomycin (lOO ⁇ g/ml) and penicillin (60 ⁇ g/ml)
  • DMEM Dulbecco's Modified Eagle's Medium
  • fetal calf serum 10%, L-glutamine (1%), geneticin (lmg/ml), streptomycin (lOO ⁇ g/ml) and penicillin (60 ⁇ g/ml)
  • candidate hybrid proteins are added to culture wells at final concentrations of 10 "10 to 10 "5 M and incubated for 1 horn at 37°C in 10% CO 2 .
  • recombinant VEGF-A or VEGF-D is added to the hybrid protein-containing wells at a concentration to produce near-maximal survival ofthe Ba/F3-NYK-EpoR cells (typically 500ng/ml).
  • Positive control cultures contain either VEGF-A or VEGF-D supernatant alone and negative control cultures contain neither hybrid protein nor growth factor.
  • MTT 3-(3,4-dimethyltl ⁇ iazol-2-yl)-2,5-diphenyltetrazolium bromide
  • Data is analyzed by one way analysis of variance (ANOVA), with a Bonfenoni multiple comparisons test earned out post-hoc to test for differences between individual cultures of hybrid protein alone (to assay binding and activation ofthe receptor), or hybrid protein + VEGF-A or VEGF-D (to assay inhibition of receptor activation), with VEGF-A or VEGF-D alone (positive control).
  • ANOVA analysis of variance
  • Repetition ofthe same assay using cells transfected with different chimeric receptors e.g., VEGFR-3 EpoR
  • VEGFR-3 EpoR chimeric receptors
  • VEGFR-2 KDR
  • VEGFR-3 Flt4 autophosphorylation assays
  • a candidate hybrid protein is added to cells expressing a paiticular VEGF receptor.
  • the cells are then lysed and immuoprecipitated with anti- VEGF receptor antiserum and analyzed by Western blotting using anti-phosphotyrosine antibodies to determine hybrid protein- induced phosphorylation ofthe VEGF receptor.
  • An expression vector comprising a polynucleotide encoding a hybrid VEGF molecule of the invention is transfected into an appropriate host cell (e.g., 293-EBNA cells using a calcium phosphate transfection method.
  • the growth medium ofthe transfected cells is changed (e.g., to DMEM medium lacking fetal calf serum) and the cells are incubated (e.g, for 36 more horns) to provide a conditioned medium.
  • the conditioned medium is collected and centrifuged at 5000 x g for 20 minutes, and the supernatant is concentrated.
  • the concentrated conditioned media is used to stimulate cells expressing a VEGF receptor.
  • PAE-KDR cells Pajusola et al, Oncogene, 9:3545-55 (1994); Waltenberger et al, J. Biol. Chem., 269:26988-26995 (1994)
  • FCS fetal calf serum
  • confluent NIH 3T3 cells expressing VEGFR-3 are grown in DMEM medium.
  • the cells are starved overnight in DMEM medium or Ham's F12 supplemented with 0.2% bovine serum albumin (BSA), and then incubated for 5 minutes with the unconcentrated, 2-fold, 5-fold, and/or 10-fold concentrated conditioned media.
  • Recombinant human VEGF-A or VEGF-C and conditioned media from moclc- transfected cells are exemplary controls.
  • purified hybrid polypeptide can be employed in this or other assays described herein.
  • the cells are washed twice with ice-cold Tris-Buffered Saline (TBS) containing 100 mM sodium orthovanadate and lysed in RIP A buffer containing 1 mM phenyhnethylsulfonyl fluoride (PMSF), 0.1 U/ml aprotinin and 1 mM sodium orthovanadate.
  • TBS Tris-Buffered Saline
  • PMSF phenyhnethylsulfonyl fluoride
  • the lysates are sonicated, clarified by centrifugation at 16,000 x g for 20 minutes and incubated for 3-6 hours on ice with 3-5 ⁇ l of antisera specific for VEGFR-3 or VEGFR-2.
  • Immtmoprecipitates are bound to protein A-Sepharose, washed three times with RTPA buffer containing ImM PMSF, ImM sodium orthovanadate, washed twice with 10 mM Tris-HCl (pH 7.4), and subjected to SDS-PAGE using a 7% gel.
  • Polypeptides are transfened to nitrocellulose by Western blotting and analyzed using PY20 phosphotyrosine-specific monoclonal antibodies
  • hybrid polypeptide The ability of a hybrid polypeptide to stimulate autophosphorylation (detected using the anti-phosphotyrosine antibodies) is scored as stimulating the receptor.
  • Polypeptides that have been shown to bind the receptor, but are incapable of stimulating receptor phosphorylation, are scored as inhibitors.
  • Inhibitory activity can be fiirther assayed by mixing a known receptor agonist such as recombinant VEGF-A or VEGF-C with either media alone or with concenfrated conditioned media, to determine if the concenfrated conditioned media inhibits VEGF-A-mediated or VEGF-C- mediated receptor phosphorylation.
  • a known receptor agonist such as recombinant VEGF-A or VEGF-C
  • media alone or with concenfrated conditioned media to determine if the concenfrated conditioned media inhibits VEGF-A-mediated or VEGF-C- mediated receptor phosphorylation.
  • the hybrid protein is expressed in an insect cell system, e.g., S9 cells, to eliminate contamination with endogenous VEGF-A found in mammalian cells.
  • an ELISA-type approach is used.
  • binding affinity for VEGFR-1
  • serial dilutions of competing VEGFR-1 -IgG fusion proteins and a subsaturating concentration ofthe candidate hybrid protein tagged with the myc epitope is added to microtitre plates coated with VEGFR-1, and incubated until equilibrium is established. The plates are then washed to remove unbound proteins. Hybrid molecules that remain bound to the VEGFR-1 coated plates are detected using an anti-myc antibody conjugated to a readily detectable label e.g., horseradish peroxidase.
  • Binding affinities (EC50) can be calculated as the concentration of competing VEGFR-IgG fusion protein that results in half-maximal binding. These values can be compared with those obtained from analysis of VEGF-A or
  • VEGFR-2-IgG fusion protein binding to VEGFR-2 is accomplished by using a VEGFR-2-IgG fusion protein
  • binding to VEGFR-3 is determined using a VEGFR-3 -IgG fusion protein.
  • Both VEGF-A and VEGF-C stimulate endothelial cell migration in collagen gel.
  • the hybrid proteins of the invention are examined to determine if they are also capable of stimulating endothelial cell migration in collagen gel, thus providing another indicia of biological activity. Exemplary examples of such cell migration assays have been described in International Patent Publication No. WO 98/33917, incorporated herein by reference. Briefly, bovine capillary endothelial cells (BCE) are seeded on top of a collagen layer in tissue culture plates. Conditioned media from cells transfected with an expression vector producing the candidate hybrid protein is placed in wells made in collagen gel approximately 4mm away from the location ofthe attached BCE cells. The number of BCE cells that have migrated from the original area of attachment in the collagen gel towards the wells containing the hybrid protein is then counted to assess the ability of the hybrid protein to induce cell migration.
  • BCE bovine capillary endothelial cells
  • BCE cells (Folkman et al, Proc. Natl. Acad. Sci (USA), 76:5211-5221 (1979)) are cultured as described in Pertovaara et al, J. Biol. Chem., 269:6211-14 (1994).
  • Collagen gels are prepared by mixing type I collagen stock solution (5 mg/ml in 1 mM HCI) with an equal volume of 2x MEM and 2 volumes of MEM containing 10% newbom calf serum to give a final collagen concentration of 1.25 mg/ml.
  • Tissue culture plates (5 cm diameter) are coated with about 1 mm tliiclc layer ofthe solution, which is allowed to polymerize at 37°C. BCE cells are seeded atop this layer.
  • the cells are allowed to attach inside a plastic ring (1 cm diameter) placed on top of the first collagen layer. After 30 minutes, the ring is removed and unattached cells are rinsed away. A second layer of collagen and a layer of growth medium (5% newbom calf serum (NCS)), solidified by 0.75% low melting point agar (FMC BioProducts, Rockland, ME), are added. A well (3 mm diameter) is punched through all the layers on both sides ofthe cell spot at a distance of 4 mm, and media containing a hybrid VEGF polypeptide (or media alone or media contahiing VEGF-A or VEGF-C to serve as controls) is pipetted daily into the wells.
  • NCS newbom calf serum
  • FMC BioProducts 0.75% low melting point agar
  • Photomicrographs ofthe cells migrating out from the spot edge are taken, e.g., after six days, through an Olympus CK 2 inverted microscope equipped with phase-contrast optics.
  • the migrating cells are counted after nuclear staining with the fluorescent dye bisbenzimide (1 mg/ml, Hoechst 33258, Sigma).
  • the number of cells migrating at different distances from the original area of attachment towards wells containing media conditioned by the non-transfected (control) or transfected (mock; hybrid; VEGF-C; or VEGF-A) cells are determined 6 days after addition ofthe media.
  • the number of cells migrating out from the original ring of attachment are counted in five adjacent 0.5 mm x 0.5 mm squares using a microscope ocular lens grid and lOx magnification with a fluorescence microscope. Cells migrating fiirther than 0.5 mm are counted in a similar way by moving the grid in 0.5 mm steps.
  • the number of migrating cells in the presence of a hybrid protein versus a similar concentration of VEGF-A or VEGF-C provides an indication of the potency of agonist activity.
  • Polypeptides that have been shown to bind the receptors expressed on BCE cells, but are incapable of stimulating migration, are scored as potential inhibitors.
  • Inhibitory activity can be further assayed by mixing a known receptor agonist such as recombinant VEGF-A or VEGF-C with either media alone or with concentrated conditioned media, to detennine if the concentrated conditioned media inhibits VEGF-A- mediated or VEGF-C-mediated BCE migration.
  • Both VEGF-A and VEGF-C are capable of increasing the penneability of blood vessels.
  • the hybrid proteins ofthe invention are assayed to determine wliich of these proteins possess this biological activity and which inhibit it.
  • vascular permeability assays according to Miles and Miles, J. Physiol 118:228-251 (1952), incorporated herein in its entirety, are used to analyze the hybrid proteins. Briefly, following intravenous injection of a vital dye, such as pontamine sky blue, animals such as guinea pigs are injected intradermally with a composition containing the candidate hybrid protein being examined. For controls, media alone or media containing VEGF-A or VEGF-C is injected in the same manner.
  • a vital dye such as pontamine sky blue
  • hybrid polypeptides that are suspected of being inliibitors of VEGF-A or VEGF-C are first mixed with VEGF-A or with VEGF-C at varying ratios (e.g., 50:1, 10:1, 5:1, 2:1, 1:1, 1:2, 1:5, 1:10) and the mixtures are injected intradermally into the animals, hi this manner, the ability ofthe hybrid polypeptide to inhibit VEGF-A-mediated or VEGF-C-mediated vascular penneability is assayed.
  • Example 9 Endothelial Cell Proliferation Assay The mitogenic activity of hybrid proteins can be examined using endothelial cell proliferation assays such as that described in Breier et al, Dev 114:521-532 (1992), incorporated herein in its entirety.
  • the hybrid proteins are expressed hi a mammalian cell line e.g., COS cells.
  • Culture supernatants are then collected and assayed for mitogenic activity on bovine aortic endothelial (BAE) cells by adding the supernatants to the BAE cells. After three days, the cells are dissociated with trypsin and counted using a cytometer to determine any effects ofthe hybrid protein on the proliferative activity ofthe BAE cells.
  • BAE bovine aortic endothelial
  • DMEM fetal calf serum
  • FCS fetal calf serum
  • conditioned media from untransfected COS cells or from COS cells transfected with vector alone
  • supernatants from cells transfected with constructs expressing proteins that have been shown to induce proliferation of BAE cells e.g., VEGF-A
  • BAE cells e.g., VEGF-A
  • Example 10 Examination of the ability of hybrid proteins expressed through the human K14 keratin promoter to induce growth of lymphatic vessels in skin of transgenic mice
  • a DNA fragment containing the K14 promoter, hybrid protein cDNA, and K14 polyadenylation signal is synthesized, isolated, and injected into fertilized oocytes ofthe
  • FVB-NIH mouse strain The injected zygotes are transplanted to oviducts of pseudopregnant C57BL/6 x DBA/21 hybrid mice. The resulting founder mice are then analyzed for the presence ofthe transgene by poiymerase cham reaction of tail DNA usmg appropriate primers or by Southern analysis. These fransgenic mice are then examined for evidence of angiogenesis or lymphangiogenesis in the skin, such as the lymphangiogenesis seen in transgenic mice that overexpress VEGF-C [see International Publication WO98/33917].
  • VEGF-C Overexpression of VEGF-C in the skin of KI 4- VEGF-C transgenic mice conelates with a distinct alteration in leukocyte populations [see International Publication WO98/33917]. Notably, the measured populations of neutrophils were markedly increased in the transgenic mice .
  • the effects ofthe hybrid proteins on hematopoiesis can be analyzed using fluorescence-activated cell sorting analysis using antibodies that recognize proteins expressed on specific leukocyte cell populations. Leukocytes populations are analyzed in blood samples talcen from the FI fransgenic mice described in Example 13, and from their non-transgenic littermates.
  • Example 12 Effects of hybrid proteins on growth and differentiation of human CD34+ progenitor cells in vitro Addition of VEGF-C to cultures of cord blood CD34+ cells induces cell proliferation. Co-culture of GM-CSF, IL-3, GM-CSF + IL-3, or GM-CSF + SCF with
  • Hybrid proteins ofthe invention can also be examined for their ability to induce growth of CD34+ progenitor cells in vitro.
  • Human CD34+ progenitor cells (HPC, 10 x 10 3 ) are isolated from bone marrow or cord blood mononuclear cells using the MACS CD34 Progenitor cell Isolation Kit (Miltenyi Biotec,
  • hybrid proteins in cultures either supplemented with recombinant human stem cell factor (rhSCF, 20 ng/ml PreproTech, Rocky Hill, NY) alone or a combination of granulocyte macrophage colony stimulating factor (rhGM-CSF, 100 ng/ml, Sandoz, Basel, Switzerland) plus SCF can also be examined.
  • rhSCF human stem cell factor
  • rhGM-CSF granulocyte macrophage colony stimulating factor
  • SCF granulocyte macrophage colony stimulating factor
  • Experiments can also be conducted to analyze the co-stimulatory effects of hybrid protein on total cell yields of seram-free cultures of CB CD34+ HPC cells supplemented with either GM-CSF alone, IL-3 (rf ⁇ IL-3, 100 U/ml, Behring AG, Marburg, Germany) alone; or a combination of GM- CSF plus IL-3.
  • CD34+ cells are cultured in medium supplemented with 50 ng/ml M-CSF, with or without 100 ng/ml hybrid protein, for seven days. After seven days, the cultures were analyzed to determme the percentages of
  • CD 14+ cells and mean fluorescence intensity.
  • Example 13 Analysis of hybrid proteins using CAM assays
  • VEGF growth factors including both VEGF-A and VEGF-C have been shown to induce the development of blood vessels [Oh et al, Dev Biol 188:96-109 (1997)].
  • this method can be used to study the angiogenic properties of the hybrid proteins.
  • a window is cut out into the eggshell of chick or quail eggs.
  • the embryos are checked for normal development, the window in the eggshell is sealed with cellotape, and the eggs are incubated until day 13 of development.
  • Approximately 3.3 ⁇ g of hybrid protein dissolved in 5 ⁇ l of distilled water is added to Thermanox coverslips (Nunc, Naperville, IL), which have been cut into disks with diameters of approximately 5 mm, and air dried. Disks without added protein are used as controls. The dried disks are then applied on the chorioallantoic membrane (CAM) ofthe eggs.
  • CAM chorioallantoic membrane
  • the disks are removed and fixed in 3% glutaraldehyde and 2% formaldehyde and rinsed in 0.12 M sodium cacodylate buffer.
  • the fixed specimens are photographed and embedded in Epon resin (Serva, Germany) for semi- (0.75 ⁇ m) and ultrathin (70 nm) sectioning. Both semi- and ultrathin sections are cut using an Ulfracut S (Leilca, Germany). Ultrathins sections are analyzed by an EM 10 (Zeiss, Germany). Specimens are then analyzed for evidence of growth of new capillaries, which would indicate that the hybrid protein being examined is capable of stimulating angiogenesis.
  • tyrosine receptors Activation of tyrosine receptors is commonly mediated by ligand-induced receptor dimerization. hivestigation of interactions between VEGF and VEGFR-2 indicate that receptor dimerization is accomplished via ligand dimerization in wliich both receptors bind parts of each ofthe two ligand proteins that constitute the homo- or heterodimer.
  • VEGF proteins that can bind to VEGFR-2 but are unable to dimerize, cannot activate the receptor [Fuh et al., JBiol Chem 273:11197-11204 (1998)]. All ofthe VEGF family members are capable of homo- and/or heterodimerization. VEGF-A and VEGF-C fail to heterodimerize with each other. However, some ofthe VEGF-A/VEGF-C hybrid proteins may dimerize with each other or with one or both ofthe parent molecules. The hybrid proteins may also be capable of homodimerization. The following protocols are designed to identify dimerization capabilities ofthe hybrid proteins ofthe invention.
  • a candidate hybrid protem is co-expressed with a different hybrid protein or one ofthe parent molecules in a cell line e.g., 293T or S9 cells. Extracts from these cells are prepared and used for immunoprecipitation using an antibody that recognizes only one of the two proteins being examined. The immimoprecipitated proteins are then subjected to SDS-PAGE and analyzed. If both proteins are detected on the gel, heterodimerization occuned between the two proteins being examined. On the other hand, if only the protein recognized by the antibody used during immunoprecipitation is detected, dimerization failed to occur between the two proteins.
  • hybrid proteins that bind receptor but February 16, 2000fail to dimerize with self or with natural VEGF growth factors endogenously expressed by cells are expected to be mlhbitors of endogenous vascular endothelial growth factor activity.
  • Heterodimers comprising a polypeptide ofthe invention with other polypeptides ofthe invention or with naturally occurring members ofthe VEGF family of growth factors may be generated essentially as described in Cao et al, J. Biol. Chem., 271:3154- 62 (1996).
  • a recombinantly produced hybrid polypeptide is mixed at an equimolar ratio with another recombinantly produced polypeptide of interest, such as a VEGF-A, VEGF-B, VEGF-C, VEGF-D, PIGF, PDGF ⁇ , PDGF ⁇ , or c-fos induced growth factor polypeptide.
  • a VEGF-A, VEGF-B, VEGF-C, VEGF-D PIGF, PDGF ⁇ , PDGF ⁇ , or c-fos induced growth factor polypeptide.
  • the heterodimers are screened to deteixnine their binding affinity with respect to receptors ofthe VEGF/PDGF family (especially VEGFR-1, VEGFR-2, and VEGFR-3), and their ability to stimulate the receptors (e.g., assaying for dimer-stimulated receptor phosphorylation in cells expressing the receptor of interest on their surface).
  • the binding assays may be competitive binding assays such as those described herein and in the art.
  • recombinantly produced proteins comprising the extracellular domains of receptors are employable, as described in preceding examples for VEGFR-2 and VEGFR-3.
  • Heterodimers that bind and stimulate receptors are useful as recombinant growth factor polypeptides.
  • Heterodimers that bind but do not stimulate receptors are useful as growth factor antagonists. Heterodimers that display agonistic or antagonistic activities in the screening assays are further screened using, e.g., endothelial cell migration assays, vascular permeability assays, and in vivo assays. It will also be apparent from the preceding examples that dimers comprising two VEGF-C polypeptides (i.e., dimers of identical VEGF-C polypeptides as well as dimers of different VEGF-C polypeptides) are advantageously screened for agonistic and antagonistic activities using the same assays.
  • Example 15 Determination of biological half-life of the VEGF-A/V ⁇ GF-C hybrid proteins Rnowledge ofthe in vivo biological half-life of a compound is valuable for therapeutic applications. Although the biological half-life ofthe hybrid proteins has not been detemiined in vivo, preliminary results in vitro indicate that the VEGF-A/VEGF-C hybrid proteins described above exhibit different half-lives. Incubation of cell supernatants containing specific hybrid proteins at 4°C for approximately two months reveal different protein stabilities for the various hybrid proteins. Examination ofthe in vivo biological half-life can be determined by injecting iodine-labeled hybrid protein into animals.
  • hybrid protein 50 ⁇ g of hybrid protein are iodinated usmg IODO-GEN (Pierce) according to the manufacturer's instractions to a specific radioactivity of approximately 2- 10 ⁇ Ci/ ⁇ g protein.
  • the iodinated protein is purified using PD-10 Sephadex (Phannacia) according to the manufactiirer's instructions.
  • 12-16 week old mice weighing 20-25 g are anesthetized with sodium pentobarbital (1 mg/20 g body weiglit mouse) during the comse ofthe experiment. 5-10 pmol ofthe radiolabeled protein diluted in 100 ⁇ l sterile saline are is injected into the tail vein over 30 seconds.
  • Example 1 The procedure described in Example 1 can be extended to create hybrid molecules using any ofthe PDGF/VEGF growth factors.
  • Members ofthe PDGF/VEGF family which comprises at least VEGF-A (SEQ ID NOS: 1 and 2), PIGF (SEQ ID NOS: 114 and 115), VEGF-B (SEQ FD NOS: 116 and 117), VEGF-C (SEQ FD NOS: 21 and
  • VEGF-D SEQ FD NOS: 118 and 119
  • VEGF-E SEQ ID NOS: 120 and 121
  • NZ2 VEGF SEQ FD NOS: 122 and 123
  • D1701 VEGF SEQ FD NOS: X and X
  • NZ10 VEGF [described in SEQ TD NO: 11 of International Patent Application PCT/US99/25869, incorporated herein in its entirety]
  • PDGF-A SEQ FD NO: 124 and 125
  • PDGF-B SEQ FD NO: 126 and 127
  • fallotein SEQ ID NO: 148 & 149 share sufficient homology with each otlier within the receptor binding domain to permit designing oligonucleotides with unique cohesive ends as tauglit in Example 1 with respect to VEGF-A and VEFG-C.
  • oligonucleotides designed to provide double-stranded fragments having cohesive ends as short as 3-6 bases in length are sufficient to permit successful recombination into novel hybrid molecules (with very few miintended mutations).
  • ligation of fragments can also be accomplished without cohesive ends.
  • Blunt-end fragments also can be synthesized and annealed to generate hybrid proteins using the method described above. With a blunt-end strategy, the nucleotide sequences ofthe parent molecules do not need to be examined for the presence of nucleotide identity to enable the creation of cohesive ends. However, additional post-ligation screening may be required to identify hybrids that contain fragments in the desired order and orientation.
  • oligonucleotide pairs are designed and annealed as described in Example 1 to provide DNA fragments ofthe receptor for binding domain of two or more VEGF proteins. Combinatorial ligation ofthe various DNA fragments produces novel hybrid polypeptides that are screened for receptor binding and for biological properties such as ability to stimulate or inhibit endothelial cell growth and migration and modulate vascular permeability.
  • Example 17 Generation of hybrid molecules using PCR-driven DNA shuffling.
  • the following protocol provides an alternative "DNA shuffling" methodology for generating hybrid vascular endothelial growth factor-encoding polynucleotides and polypeptides.
  • DNA shuffling proceeds have been described in the literature for enzymes such as antibiotic-resistance-conferring proteins, and a few other protein families.
  • Two or more cDNAs encoding vascular endothelial growth factor polypeptides are first cloned and amplified. Fn a prefened embodiment, only those portions ofthe cDNAs that encode minimum VEGF receptor-binding domains, and optionally small 5' and 3' additional sequences from the cDNAs, are amplified.
  • the purified and isolated cDNAs are digested into fragments of about 10-75 base pairs using restriction endonucleases and/or DNasel, and the fragments of this desired size range are purified and isolated (e.g., by agarose gel electrophoresis, electroelution, and ethanol precipitation).
  • the purified and isolated fragments from the two or more VEGFs are mixed and subjected to a self-priming poiymerase chain reaction to shuffle the fragments in order to form new hybrid molecules.
  • Exemplary PCR protocols are set forth in Kikuchi et al. (1999) and Stemmer (1994).
  • the annealing temperature in the PCR reactions is adjusted based on the level of sequence identity between the original cDNAs, to assure that annealing of heterologous sequences containing imperfect matches is possible.
  • an aliquot from the PCR reaction is selected and used as template for a second round of PCR with primers based on 5' and 3' sequences ofthe original cDNAs.
  • the primers also include restriction endonuclease recognition sequences to facilitate cloning the resultant second-round PCR products into an expression vector.
  • the resultant clones are ligated into an expression vector and transformed or transected into host cells to express the novel hybrid VEGF polypeptides (if any) encoded thereby.
  • the proteins are screened using receptor binding and/or activity assays as set forth in the preceding examples, to select those clones wliich encode polypeptides having desirable receptor agonist/antagonist profiles. INDEX FOR SEQUENCE LISTING
  • SEQ ID NOS: 1 &2 are the nucleotide and amino acid sequences of VEGF-A
  • SEQ FD NOS: 3-11 are VEGF-A forward primers
  • SEQ FD NOS : 12-20 are VEGF-A reverse primers
  • SEQ ID NOS: 21 & 22 are the nucleotide and amino acid sequences of VEGF-C
  • SEQ ID NOS: 23-31 are VEGF-C forward primers
  • SEQ FD NOS: 32-40 are VEGF-C reverse primers
  • SEQ ID NO: 41 is the nucleotide sequence of pSecTagl
  • SEQ HO NOS: 42 & 43 are the nucleotide and amino acid sequences of clone 11-1.
  • VEGF receptor binding domain (derived from VEGF-A and VEGF-C) conespond to amino acids 1-102 of SEQ ID NO: 43.
  • SEQ ID NOS: 44 & 45 are the nucleotide and amino acid sequences of clone 11-16.
  • SEQ ID NOS: 46 & 47 are the nucleotide and amino acid sequences of clone 22-1.
  • SEQ ID NOS: 48 & 49 are the nucleotide and amino acid sequences of clone 22-16.
  • VEGF receptor binding domain amino acids 1-105 of SEQ ID NO: 49
  • SEQ ID NOS: 52-53 are the nucleotide and amino acid sequences of clone 12-2.
  • VEGF receptor binding domain amino acids 1-102 of SEQ ID NO: 53
  • SEQ ID NOS: 54-55 are the nucleotide and amino acid sequences of clone 12-3.
  • SEQ ID NOS: 56-57 are the nucleotide and amino acid sequences of clone 12-4.
  • VEGF receptor binding domain amino acids 1-102 of SEQ ID NO: 57
  • SEQ ID NOS: 58-59 are the nucleotide and amino acid sequences of clone 12-5.
  • VEGF receptor binding domain amino acids 1-102 of SEQ ID NO: 59
  • SEQ ID NOS: 62-63 are the nucleotide and amino acid sequences of clone 12-7.
  • VEGF receptor binding domain amino acids 1-102 of SEQ ID NO: 63
  • SEQ ID NOS: 64-65 are the nucleotide and amino acid sequences of clone 12-8.
  • VEGF receptor binding domain amino acids 1-102 of SEQ ID NO: 65
  • SEQ ID NOS: 66-67 are the nucleotide and amino acid sequences of clone 12-9.
  • VEGF receptor binding domain amino acids 1-104 of SEQ ID NO: 67)
  • SEQ ID NOS: 68-69 are the nucleotide and amino acid sequences of clone 12-10.
  • VEGF receptor binding domain amino acids 1-104 of SEQ ID NO: 69
  • SEQ ID NOS: 70-71 are the nucleotide and amino acid sequences of clone 12-11.
  • VEGF receptor bmding domain amino acids 1-104 of SEQ ID NO: 71
  • SEQ ID NOS: 72-73 are the nucleotide and amino acid sequences of clone 12-12.
  • VEGF receptor binding domain amino acids 1-104 of SEQ ID NO: 73
  • SEQ ID NOS: 74-75 are the nucleotide and amino acid sequences of clone 12 r 13.
  • VEGF receptor binding domain amino acids 1-104 of SEQ ID NO: 75
  • SEQ ID NOS: 76-77 are the nucleotide and amino acid sequences of clone 12-14.
  • VEGF receptor binding domain amino acids 1 - 104 of SEQ ID NO: 77)
  • SEQ ID NOS: 78-79 are the nucleotide and amino acid sequences of clone 12-15.
  • VEGF receptor binding domain amino acids 1-104 of SEQ ID NO: 79
  • SEQ ID NOS: 80-81 are the nucleotide and amino acid sequences of clone 12-16.
  • VEGF receptor binding domain amino acids 1-54 of SEQ ID NO: 81
  • SEQ ID NOS: 82-83 are the nucleotide and amino acid sequences of clone 31-1
  • SEQ ID NOS: 92-93 are the nucleotide and amino acid sequences of clone 31-6
  • SEQ TD NOS: 98-99 are the nucleotide and amino acid sequences of clone 31-9
  • SEQ TD NOS: 106-107 are the nucleotide and amino acid sequences of clone 31-13 (VEGF receptor bmding domain ⁇ amino acids 1-105 of SEQ ID NO: 107)
  • SEQ ID NOS: 108-109 are the nucleotide and amino acid sequences of clone 31-14
  • SEQ ID NOS: 114 & 115 are the nucleotide and amino acid sequences of PIGF
  • SEQ ID NOS: 116 & 117 are the nucleotide and amino acid sequences of VEGF-B
  • SEQ ID NOS: 118 & 119 are the nucleotide and amino acid sequences of VEGF-D
  • SEQ I D NOS: 120 & 121 are the nucleotide and amino acid sequences of VEGF-E
  • 122 & 123 are the nucleotide and amino acid sequences of NZ2 VEGF
  • VEGF receptor binding domain amino acids 1-105 of SEQ ID NO: 155
  • SEQ ID NOS : 156 & 157 are the nucleotide and amino acid sequences of clone 32-14
  • VEGF receptor binding domain amino acids 1-105 of SEQ ID NO: 157
  • SEQ ID NOS : 158 & 159 are the nucleotide and amino acid sequences of clone 52-15 (VEGF receptor binding domain ⁇ amino acids 1-105 of SEQ ID NO: 159)
  • SEQ ID NOS : 164 & 165 are the nucleotide and amino acid sequences of clone 82-9
  • VEGF receptor binding domain amino acids 1-104 of SEQ ID NO: 165
  • SEQ ID NOS : 166 & 167 are the nucleotide and amino acid sequences of clone 82-11
  • VEGF receptor binding domain amino acids 1-104 of SEQ ID NO: 167
  • SEQ ID NOS : 168 & 169 are the nucleotide and amino acid sequences of clone 82-13
  • VEGF receptor binding domain amino acids 1-104 of SEQ ID NO: 169
  • SEQ ID NOS : 174 & 175 are the nucleotide and amino acid sequences of clone 84-11
  • VEGF receptor binding domain amino acids 1-104 of SEQ ED NO: 175)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Engineering & Computer Science (AREA)
  • Cell Biology (AREA)
  • Immunology (AREA)
  • Vascular Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Hematology (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Molecular Biology (AREA)
  • Rheumatology (AREA)
  • Biophysics (AREA)
  • Toxicology (AREA)
  • Urology & Nephrology (AREA)
  • Dermatology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Pain & Pain Management (AREA)
  • Orthopedic Medicine & Surgery (AREA)
PCT/US2001/006113 2000-02-25 2001-02-26 MATERIALS AND METHODS INVOLVING HYBRID VASCULAR ENDOTHELIAL GROWTH FACTOR DNAs AND PROTEINS AND SCREENING METHODS FOR MODULATORS Ceased WO2001062942A2 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
EP01914501A EP1259626B1 (en) 2000-02-25 2001-02-26 Materials and methods involving hybrid vascular endothelial growth factor dnas and proteins and screening methods for modulators
JP2001561752A JP4981229B2 (ja) 2000-02-25 2001-02-26 ハイブリッド血管内皮成長因子DNAsおよびタンパク質に関与する物質および方法
AU3988401A AU3988401A (en) 2000-02-25 2001-02-26 Materials and methods involving hybrid vascular endothelial growth factor dnas and proteins
DE60131146T DE60131146T2 (de) 2000-02-25 2001-02-26 Material und verfahren die hybridvaskularendothelwachstumfaktoren dns und proteine enthalten und screeningverfahren für modulatoren
AU2001239884A AU2001239884B2 (en) 2000-02-25 2001-02-26 Materials and methods involving hybrid vascular endothelial growth factor DNAs and proteins and screening methods for modulators
CA002400948A CA2400948A1 (en) 2000-02-25 2001-02-26 Materials and methods involving hybrid vascular endothelial growth factor dnas and proteins
AU2006235995A AU2006235995A1 (en) 2000-02-25 2006-11-10 Materials and methods involving hybrid vascular endothelial growth factor DNAs and proteins and screening methods for modulators

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US18520500P 2000-02-25 2000-02-25
US60/185,205 2000-02-25
US20533100P 2000-05-18 2000-05-18
US60/205,331 2000-05-18

Publications (2)

Publication Number Publication Date
WO2001062942A2 true WO2001062942A2 (en) 2001-08-30
WO2001062942A3 WO2001062942A3 (en) 2002-03-21

Family

ID=26880920

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2001/006113 Ceased WO2001062942A2 (en) 2000-02-25 2001-02-26 MATERIALS AND METHODS INVOLVING HYBRID VASCULAR ENDOTHELIAL GROWTH FACTOR DNAs AND PROTEINS AND SCREENING METHODS FOR MODULATORS

Country Status (8)

Country Link
US (5) US6965010B2 (https=)
EP (1) EP1259626B1 (https=)
JP (1) JP4981229B2 (https=)
AT (1) ATE377081T1 (https=)
AU (3) AU3988401A (https=)
CA (1) CA2400948A1 (https=)
DE (1) DE60131146T2 (https=)
WO (1) WO2001062942A2 (https=)

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7109167B2 (en) 2000-06-02 2006-09-19 Bracco International B.V. Compounds for targeting endothelial cells, compositions containing the same and methods for their use
WO2007022287A2 (en) 2005-08-15 2007-02-22 Vegenics Limited Modified vegf and pdgf with improved angiogenic properties
US7422741B2 (en) 2004-03-05 2008-09-09 Vegenics Limited VEGFR-3 fusion proteins
US7476654B2 (en) * 2004-03-08 2009-01-13 Ludwig Institute For Cancer Research Method for modulating, regulating and/or stabilizing angiogenesis
CN1903880B (zh) * 2006-08-02 2010-05-12 中国人民解放军军事医学科学院基础医学研究所 抗肿瘤血管内皮生长因子vegf-e抗原及其编码基因与应用
WO2010065995A1 (en) * 2008-12-08 2010-06-17 Vegenics Limited Isolated vegf-c and vegf-d peptides and uses thereof
US8044175B2 (en) 2003-03-03 2011-10-25 Dyax Corp. Peptides that specifically bind HGF receptor (CMET) and uses thereof
WO2011154308A1 (en) 2010-06-08 2011-12-15 Proyecto De Biomedicina Cima, S.L. New compositions and cell therapy methods for the treatment of cirrhosis
WO2012088563A1 (en) * 2010-11-24 2012-07-05 Vegenics Pty Limited Vegfr-2-specific forms of vegf-d and vegf-c and uses thereof
US8263739B2 (en) 2000-06-02 2012-09-11 Bracco Suisse Sa Compounds for targeting endothelial cells, compositions containing the same and methods for their use
US8642010B2 (en) 2002-03-01 2014-02-04 Dyax Corp. KDR and VEGF/KDR binding peptides and their use in diagnosis and therapy
WO2014124487A1 (en) 2013-02-18 2014-08-21 Vegenics Pty Limited Ligand binding molecules and uses thereof
US20160193298A1 (en) * 2013-08-14 2016-07-07 Laurantis Pharma Oy Therapeutic use of vegf-c and ccbe1

Families Citing this family (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1353952B1 (en) * 1994-11-14 2007-04-11 Ludwig Institute For Cancer Research Flt4(vegfr-3) as a target for tumor imaging and anti-tumor therapy
CA2374050A1 (en) * 1999-05-20 2000-11-30 Scios Inc. Vascular endothelial growth factor dimers
US7167615B1 (en) 1999-11-05 2007-01-23 Board Of Regents, The University Of Texas System Resonant waveguide-grating filters and sensors and methods for making and using same
AU3988401A (en) * 2000-02-25 2001-09-03 Ludwig Inst Cancer Res Materials and methods involving hybrid vascular endothelial growth factor dnas and proteins
WO2002014367A1 (fr) * 2000-08-10 2002-02-21 Center For Advanced Science And Technology Incubation,Ltd. Facteur de croissance chimere de cellules endotheliales vasculaires de type humain
US20040132675A1 (en) * 2002-02-08 2004-07-08 Calvin Kuo Method for treating cancer and increasing hematocrit levels
DK1399484T3 (da) * 2001-06-28 2010-11-08 Domantis Ltd Dobbelt-specifik ligand og anvendelse af denne
US7261876B2 (en) 2002-03-01 2007-08-28 Bracco International Bv Multivalent constructs for therapeutic and diagnostic applications
US8623822B2 (en) 2002-03-01 2014-01-07 Bracco Suisse Sa KDR and VEGF/KDR binding peptides and their use in diagnosis and therapy
US7211240B2 (en) 2002-03-01 2007-05-01 Bracco International B.V. Multivalent constructs for therapeutic and diagnostic applications
US7794693B2 (en) 2002-03-01 2010-09-14 Bracco International B.V. Targeting vector-phospholipid conjugates
US20030228283A1 (en) * 2002-05-03 2003-12-11 Ludwig Institute For Cancer Research Preventing secondary lymphedema with VEGF-D DNA
US7696320B2 (en) 2004-08-24 2010-04-13 Domantis Limited Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor
ES2263984T3 (es) * 2002-06-28 2006-12-16 Domantis Limited Ligandos doble-especificos con una vida media serica aumentada.
US9321832B2 (en) * 2002-06-28 2016-04-26 Domantis Limited Ligand
US9453251B2 (en) 2002-10-08 2016-09-27 Pfenex Inc. Expression of mammalian proteins in Pseudomonas fluorescens
AU2003290330A1 (en) * 2002-12-27 2004-07-22 Domantis Limited Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand
EP1635860A2 (en) * 2003-06-12 2006-03-22 Ludwig Institute For Cancer Research Use of vegf-c or vegf-d in reconstructive surgery
WO2005016963A2 (en) * 2003-06-12 2005-02-24 Ludwig Institute For Cancer Research Heparin binding veger-3 ligands
US8603824B2 (en) 2004-07-26 2013-12-10 Pfenex, Inc. Process for improved protein expression by strain engineering
US7553496B2 (en) * 2004-12-21 2009-06-30 University Of Kentucky Research Foundation VEGF-A as an inhibitor of angiogenesis and methods of using same
JP2008537752A (ja) * 2005-04-12 2008-09-25 イントラディグム コーポレイション がんおよび他の新血管形成疾患を処置するためのRNAi治療用の組成物および方法
US7893244B2 (en) * 2005-04-12 2011-02-22 Intradigm Corporation Composition and methods of RNAi therapeutics for treatment of cancer and other neovascularization diseases
CA2632866A1 (en) * 2005-12-01 2007-06-07 Domantis Limited Noncompetitive domain antibody formats that bind interleukin 1 receptor type 1
WO2007089780A2 (en) * 2006-01-30 2007-08-09 Licentia, Ltd. Bmx/etk tyrosine kinase gene therapy materials and methods
WO2008096268A2 (en) * 2007-02-07 2008-08-14 Vegenics Limited Autologous lymph node transfer in combination with vegf-c or vegf-d growth factor therapy to treat secondary lymphedema and to improve reconstructive surgery
JP5444553B2 (ja) 2007-04-27 2014-03-19 フェネックス インコーポレイテッド 微生物宿主を迅速にスクリーニングして、異種タンパク質発現の収率および/または質が改善されている特定の株を同定する方法
US9580719B2 (en) 2007-04-27 2017-02-28 Pfenex, Inc. Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins
WO2008149147A2 (en) 2007-06-06 2008-12-11 Domantis Limited Polypeptides, antibody variable domains and antagonists
US9511097B2 (en) 2012-11-20 2016-12-06 Albert Einstein College Of Medicine, Inc. Regeneration of coronary artery by coronary endothelial specific progenitor cells
WO2016115506A1 (en) * 2015-01-16 2016-07-21 The Board Of Trustees Of The Leland Stanford Junior University Hybrid chimera polypeptides as dual inhibitors of vascular endothelial growth factor receptor and platelet-derived growth factor receptor
US11628190B2 (en) * 2015-08-28 2023-04-18 University Of South Florida Plasma derived from human umbilical cord blood for the treatment of neurodegenerative disorders
US11180535B1 (en) 2016-12-07 2021-11-23 David Gordon Bermudes Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria
CN121293293B (zh) * 2025-12-15 2026-03-20 四川大学 Vegfr3受体特异性结合肽及其应用

Family Cites Families (81)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
NL154598B (nl) 1970-11-10 1977-09-15 Organon Nv Werkwijze voor het aantonen en bepalen van laagmoleculire verbindingen en van eiwitten die deze verbindingen specifiek kunnen binden, alsmede testverpakking.
US3817837A (en) 1971-05-14 1974-06-18 Syva Corp Enzyme amplification assay
US3939350A (en) 1974-04-29 1976-02-17 Board Of Trustees Of The Leland Stanford Junior University Fluorescent immunoassay employing total reflection for activation
US3996345A (en) 1974-08-12 1976-12-07 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4227427A (en) 1977-09-08 1980-10-14 Dana Corporation Drive unit assembly
US4957939A (en) 1981-07-24 1990-09-18 Schering Aktiengesellschaft Sterile pharmaceutical compositions of gadolinium chelates useful enhancing NMR imaging
US4472509A (en) 1982-06-07 1984-09-18 Gansow Otto A Metal chelate conjugated monoclonal antibodies
US5498600A (en) * 1984-10-12 1996-03-12 Zymogenetics, Inc. Biologically active mosaic proteins
US5037630A (en) 1985-01-14 1991-08-06 Neorx Corporation Metal radionuclide labeled proteins for diagnosis and therapy
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US4965392A (en) 1987-03-26 1990-10-23 Neorx Corporation Chelating compounds for metal-radionuclide labeled proteins
US5087244A (en) 1989-01-31 1992-02-11 C. R. Bard, Inc. Catheter and method for locally applying medication to the wall of a blood vessel or other body lumen
US5194596A (en) * 1989-07-27 1993-03-16 California Biotechnology Inc. Production of vascular endothelial cell growth factor
US5585362A (en) 1989-08-22 1996-12-17 The Regents Of The University Of Michigan Adenovirus vectors for gene therapy
US5674192A (en) 1990-12-28 1997-10-07 Boston Scientific Corporation Drug delivery
US5670488A (en) 1992-12-03 1997-09-23 Genzyme Corporation Adenovirus vector for gene therapy
WO1991018088A1 (en) 1990-05-23 1991-11-28 The United States Of America, Represented By The Secretary, United States Department Of Commerce Adeno-associated virus (aav)-based eucaryotic vectors
US5328688A (en) 1990-09-10 1994-07-12 Arch Development Corporation Recombinant herpes simplex viruses vaccines and methods
US5849571A (en) 1990-10-10 1998-12-15 University Of Pittsburgh Of The Commonwealth System Of Higher Education Latency active herpes virus promoters and their use
US5252479A (en) 1991-11-08 1993-10-12 Research Corporation Technologies, Inc. Safe vector for gene therapy
US5955291A (en) 1992-01-09 1999-09-21 Alitalo; Kari Antibodies recognizing tie receptor tyrosine kinase and uses thereof
EP0574048B1 (en) 1992-03-13 2002-08-14 Organon Teknika B.V. Peptides and nucleic acid sequences related to Epstein Barr Virus
DE69326631T2 (de) 1992-03-19 2000-06-08 Medtronic, Inc. Intraluminales Erweiterungsgerät
US5599352A (en) 1992-03-19 1997-02-04 Medtronic, Inc. Method of making a drug eluting stent
US5879934A (en) 1992-07-31 1999-03-09 University Of Pittsburgh Of The Commonwealth System Of Higher Education Herpes simplex virus strains for gene transfer
US5776755A (en) 1992-10-09 1998-07-07 Helsinki University Licensing, Ltd. FLT4, a receptor tyrosine kinase
US6107046A (en) 1992-10-09 2000-08-22 Orion Corporation Antibodies to Flt4, a receptor tyrosine kinase and uses thereof
US5336178A (en) 1992-11-02 1994-08-09 Localmed, Inc. Intravascular catheter with infusion array
US5661033A (en) 1992-11-25 1997-08-26 The Board Of Trustees Of The Leland Stanford Junior University Gene transfer using herpes virus vectors as a tool for neuroprotection
US5631237A (en) 1992-12-22 1997-05-20 Dzau; Victor J. Method for producing in vivo delivery of therapeutic agents via liposomes
DE4311651A1 (de) 1993-04-08 1994-10-13 Boehringer Ingelheim Int Virus für den Transport von Fremd-DNA in höhere eukaryotische Zellen
US5464650A (en) 1993-04-26 1995-11-07 Medtronic, Inc. Intravascular stent and method
US5834441A (en) 1993-09-13 1998-11-10 Rhone-Poulenc Rorer Pharmaceuticals Inc. Adeno-associated viral (AAV) liposomes and methods related thereto
PT733103E (pt) 1993-11-09 2004-07-30 Targeted Genetics Corp Criacao de elevados titulos de vectores de aav recombinantes
FR2716682B1 (fr) 1994-01-28 1996-04-26 Centre Nat Rech Scient Procédé de préparation de virus adéno-associés (AAV) recombinants et utilisations.
US6608182B1 (en) 1994-03-08 2003-08-19 Human Genome Sciences, Inc. Human vascular endothelial growth factor 2
US6734285B2 (en) 1994-03-08 2004-05-11 Human Genome Sciences, Inc. Vascular endothelial growth factor 2 proteins and compositions
US5932540A (en) 1994-03-08 1999-08-03 Human Genome Sciences, Inc. Vascular endothelial growth factor 2
ES2249762T3 (es) 1994-03-08 2006-04-01 Human Genome Sciences, Inc. Factor de crecimiento del endotelio vascular 2.
US6040157A (en) 1994-03-08 2000-03-21 Human Genome Sciences, Inc. Vascular endothelial growth factor 2
US6204059B1 (en) 1994-06-30 2001-03-20 University Of Pittsburgh AAV capsid vehicles for molecular transfer
US5856152A (en) 1994-10-28 1999-01-05 The Trustees Of The University Of Pennsylvania Hybrid adenovirus-AAV vector and methods of use therefor
WO1998033917A1 (en) 1994-11-14 1998-08-06 The Ludwig Institute For Cancer Research Vascular endothelial growth factor c (vegf-c) protein and gene, mutants thereof, and uses thereof
US6130071A (en) 1997-02-05 2000-10-10 Helsinki University Licensing, Ltd. Vascular endothelial growth factor C (VEGF-C) ΔCys156 protein and gene, and uses thereof
US6221839B1 (en) 1994-11-14 2001-04-24 Helsinki University Licensing Ltd. Oy FIt4 ligand and methods of use
US6403088B1 (en) 1995-08-01 2002-06-11 Helsinki University Licensing, Ltd. Antibodies reactive with VEGF-C, a ligand for the Flt4 receptor tyrosine kinase (VEGFR-3)
US6245530B1 (en) 1995-08-01 2001-06-12 Ludwig Institute For Cancer Research Receptor ligand
US6645933B1 (en) 1995-08-01 2003-11-11 Helsinki University Licensing Ltd. Oy Receptor ligand VEGF-C
US5707385A (en) 1994-11-16 1998-01-13 Advanced Cardiovascular Systems, Inc. Drug loaded elastic membrane and method for delivery
US5637113A (en) 1994-12-13 1997-06-10 Advanced Cardiovascular Systems, Inc. Polymer film for wrapping a stent structure
US5792453A (en) 1995-02-28 1998-08-11 The Regents Of The University Of California Gene transfer-mediated angiogenesis therapy
US5928939A (en) 1995-03-01 1999-07-27 Ludwig Institute For Cancer Research Vascular endothelial growth factor-b and dna coding therefor
US5607918A (en) 1995-03-01 1997-03-04 Ludwig Institute For Cancer Research Vascular endothelial growth factor-B and DNA coding therefor
US5707618A (en) 1995-03-24 1998-01-13 Genzyme Corporation Adenovirus vectors for gene therapy
FR2732357B1 (fr) 1995-03-31 1997-04-30 Rhone Poulenc Rorer Sa Vecteurs viraux et utilisation pour le traitement des desordres hyperproliferatifs, notamment de la restenose
US5773289A (en) 1995-06-06 1998-06-30 University Of Pittsburgh AAV directed targeted integration
US6361946B1 (en) 1997-02-05 2002-03-26 Licentia Ltd Vascular endothelial growth factor C (VEGF-C) protein and gene, mutants thereof, and uses thereof
US5622856A (en) 1995-08-03 1997-04-22 Avigen High efficiency helper system for AAV vector production
DE69628652T3 (de) 1995-09-08 2012-05-03 Genentech, Inc. Vegf-verwandtes protein
DE69634412T3 (de) 1995-09-29 2013-07-04 Vegenics Pty Ltd Regulierte gene und ihre verwendungen
US5653689A (en) 1995-09-30 1997-08-05 Abacus Design & Development, Inc. Infusion catheter
US5830727A (en) 1995-11-18 1998-11-03 Human Gene Therapy Research Institute Herpes simplex virus amplicon mini-vector gene transfer system
US6100071A (en) * 1996-05-07 2000-08-08 Genentech, Inc. Receptors as novel inhibitors of vascular endothelial growth factor activity and processes for their production
US5785965A (en) 1996-05-15 1998-07-28 The Board Of Trustees Of The Leland Stanford Junior Univ. VEGF gene transfer into endothelial cells for vascular prosthesis
WO1998002543A1 (fr) 1996-07-15 1998-01-22 Chugai Research Institute For Molecular Medicine, Inc. Nouveaux facteurs analogues au vegf
WO1998007832A1 (en) 1996-08-23 1998-02-26 Ludwig Institute For Cancer Research Recombinant vascular endothelial cell growth factor d (vegf-d)
EP0941116B1 (en) 1996-11-01 2005-01-19 Ark Therapeutics Limited Use of vegf for the manufacture of a medicament for the treatment or prevention of intimal hyperplasia and delivery device
EP1015013A4 (en) 1997-01-10 2002-07-24 Massachusetts Inst Technology TREATMENTS RELATING TO NEUROTOXICITY IN ALZHEIMER'S DISEASE CAUSED BY beta-AMYLOID PEPTIDES
AU1810899A (en) 1997-12-09 1999-06-28 Children's Medical Center Corporation Neuropilins and use thereof in methods for diagnosis and prognosis of cancer
CN1345247A (zh) 1997-12-24 2002-04-17 路德维格癌症研究所 表达血管内皮生长因子d的表达载体和细胞系以及治疗黑素瘤的方法
AU774266B2 (en) 1998-10-09 2004-06-24 Vegenics Limited Flt4 (VEGFR-3) as a target for tumor imaging and anti-tumor therapy
EP1126870B1 (en) 1998-10-26 2004-09-08 Ludwig Institute For Cancer Research Use of vegf-c or vegf-d gene or protein to prevent restenosis
AU775956B2 (en) 1998-11-02 2004-08-19 Otago Innovation Limited Vascular endothelial growth factor-like protein from ORF virus NZ2 binds and activates mammalian VEGF receptor-2
DE69930872T8 (de) 1998-12-21 2007-05-03 Ludwig Institute For Cancer Research Antikörper gegen verkürzten vegf-d und deren verwendungen
EP1156820B1 (en) 1999-02-08 2008-07-09 Human Genome Sciences, Inc. Use of vascular endothelial growth factor-2 (vegf-2)
WO2001012669A1 (en) 1999-08-16 2001-02-22 Universita' Degli Studi Di Siena Vegf-d and angiogenic use thereof
AU3988401A (en) 2000-02-25 2001-09-03 Ludwig Inst Cancer Res Materials and methods involving hybrid vascular endothelial growth factor dnas and proteins
AU2001264565B2 (en) 2000-05-03 2006-12-07 Vegenics Limited A method for activating only the vascular endothelial growth factor receptor-3 and uses thereof
US20030211988A1 (en) 2001-01-09 2003-11-13 Epstein Stephen E Enhancing lymph channel development and treatment of lymphatic obstructive disease
WO2005016963A2 (en) * 2003-06-12 2005-02-24 Ludwig Institute For Cancer Research Heparin binding veger-3 ligands
EP1919944B1 (en) * 2005-08-15 2011-03-23 Vegenics Pty Ltd Modified vegf and pdgf with improved angiogenic properties

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8263739B2 (en) 2000-06-02 2012-09-11 Bracco Suisse Sa Compounds for targeting endothelial cells, compositions containing the same and methods for their use
US7109167B2 (en) 2000-06-02 2006-09-19 Bracco International B.V. Compounds for targeting endothelial cells, compositions containing the same and methods for their use
US7884183B2 (en) 2000-06-02 2011-02-08 Bracco Suisse Sa Compounds for targeting endothelial cells, compositions containing the same and methods for their use
US7820621B2 (en) 2000-06-02 2010-10-26 Bracco International B.V. Compounds for targeting endothelial cells, compositions containing the same and methods for their use
US8642010B2 (en) 2002-03-01 2014-02-04 Dyax Corp. KDR and VEGF/KDR binding peptides and their use in diagnosis and therapy
US9629934B2 (en) 2002-03-01 2017-04-25 Dyax Corp. KDR and VEGF/KDR binding peptides and their use in diagnosis and therapy
US9000124B2 (en) 2003-03-03 2015-04-07 Dyax Corp. Peptides that specifically bind HGF receptor (cMet) and uses thereof
US8044175B2 (en) 2003-03-03 2011-10-25 Dyax Corp. Peptides that specifically bind HGF receptor (CMET) and uses thereof
US9845340B2 (en) 2003-03-03 2017-12-19 Dyax Corp. Peptides that specifically bind HGF receptor (cMet) and uses thereof
US7855178B2 (en) 2004-03-05 2010-12-21 Vegenics Limited Growth factor binding constructs materials and methods
US7422741B2 (en) 2004-03-05 2008-09-09 Vegenics Limited VEGFR-3 fusion proteins
WO2005086684A3 (en) * 2004-03-08 2009-03-19 Ludwig Inst Cancer Res Method for modulating, regulating and/or stabilizing angiogenesis
US7476654B2 (en) * 2004-03-08 2009-01-13 Ludwig Institute For Cancer Research Method for modulating, regulating and/or stabilizing angiogenesis
US8025886B2 (en) 2005-08-15 2011-09-27 Vegenics Pty Ltd Modified VEGF-A with improved angiogenic properties
WO2007022287A2 (en) 2005-08-15 2007-02-22 Vegenics Limited Modified vegf and pdgf with improved angiogenic properties
CN1903880B (zh) * 2006-08-02 2010-05-12 中国人民解放军军事医学科学院基础医学研究所 抗肿瘤血管内皮生长因子vegf-e抗原及其编码基因与应用
WO2010065995A1 (en) * 2008-12-08 2010-06-17 Vegenics Limited Isolated vegf-c and vegf-d peptides and uses thereof
WO2011154308A1 (en) 2010-06-08 2011-12-15 Proyecto De Biomedicina Cima, S.L. New compositions and cell therapy methods for the treatment of cirrhosis
WO2012088563A1 (en) * 2010-11-24 2012-07-05 Vegenics Pty Limited Vegfr-2-specific forms of vegf-d and vegf-c and uses thereof
WO2014124487A1 (en) 2013-02-18 2014-08-21 Vegenics Pty Limited Ligand binding molecules and uses thereof
EP3693381A1 (en) 2013-02-18 2020-08-12 Vegenics Pty Limited Ligand binding molecules and uses thereof
US20160193298A1 (en) * 2013-08-14 2016-07-07 Laurantis Pharma Oy Therapeutic use of vegf-c and ccbe1

Also Published As

Publication number Publication date
AU2001239884C1 (en) 2001-09-03
WO2001062942A3 (en) 2002-03-21
US20090318352A1 (en) 2009-12-24
ATE377081T1 (de) 2007-11-15
JP4981229B2 (ja) 2012-07-18
US7566566B2 (en) 2009-07-28
US20080058263A1 (en) 2008-03-06
DE60131146D1 (de) 2007-12-13
AU2006235995A1 (en) 2006-12-07
US20110207664A1 (en) 2011-08-25
DE60131146T2 (de) 2008-03-06
JP2004507208A (ja) 2004-03-11
US6965010B2 (en) 2005-11-15
US20050267024A1 (en) 2005-12-01
US7902149B2 (en) 2011-03-08
EP1259626A2 (en) 2002-11-27
AU3988401A (en) 2001-09-03
US20020151680A1 (en) 2002-10-17
EP1259626B1 (en) 2007-10-31
CA2400948A1 (en) 2001-08-30
US8278098B2 (en) 2012-10-02
AU2001239884B2 (en) 2006-08-10
US7309604B2 (en) 2007-12-18

Similar Documents

Publication Publication Date Title
US8278098B2 (en) Materials and methods involving hybrid vascular endothelial growth factor DNAs and proteins
AU2001239884A1 (en) Materials and methods involving hybrid vascular endothelial growth factor DNAs and proteins and screening methods for modulators
US7611711B2 (en) VEGFR-3 inhibitor materials and methods
JP4524340B2 (ja) 血管内皮増殖因子c(vegf−c)タンパク質およびその遺伝子、変異体、ならびにその使用
US6689580B1 (en) Growth factor
ES2336731T3 (es) Factor de crecimiento d derivado de plaquetas, adn codificante del mismo y sus usos.
US20040214766A1 (en) VEGF-C or VEGF-D materials and methods for treatment of neuropathologies
AU2002225265A1 (en) VEGFR-3 Binding peptides and their use for inhibiting angiogenesis
JP2004507208A5 (https=)
WO2003004529A2 (en) Ephrin-tie receptor materials and methods
US20080057028A1 (en) Vegf-C or Vegf-D Materials and Methods for Stimulation of Neural Stem cells
JP2003517275A (ja) 哺乳動物vegfレセプター−2に結合し、これを活性化するオルフウイルスnz2由来の血管内皮細胞増殖因子様タンパク質
US20030113324A1 (en) Neuropilin/VEGF-C/VEGFR-3 materials and methods
JP2006517586A (ja) 幹細胞のvegf−b及びpdgf調節
JP2002535006A (ja) 血小板由来増殖因子/血管内皮増殖因子様増殖因子hとその利用法
AU2008200559A1 (en) VEGFR-3 Binding peptides and their use for inhibiting angiogenesis

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
AK Designated states

Kind code of ref document: A3

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A3

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

WWE Wipo information: entry into national phase

Ref document number: 2400948

Country of ref document: CA

ENP Entry into the national phase

Ref country code: JP

Ref document number: 2001 561752

Kind code of ref document: A

Format of ref document f/p: F

WWE Wipo information: entry into national phase

Ref document number: 2001239884

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2001914501

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 2001914501

Country of ref document: EP

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWG Wipo information: grant in national office

Ref document number: 2001914501

Country of ref document: EP