WO2001009189A2 - Compositions and methods for the treatment of tumors - Google Patents

Compositions and methods for the treatment of tumors Download PDF

Info

Publication number
WO2001009189A2
WO2001009189A2 PCT/US2000/020731 US0020731W WO0109189A2 WO 2001009189 A2 WO2001009189 A2 WO 2001009189A2 US 0020731 W US0020731 W US 0020731W WO 0109189 A2 WO0109189 A2 WO 0109189A2
Authority
WO
WIPO (PCT)
Prior art keywords
adam8
antibody
expression
polypeptide
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2000/020731
Other languages
English (en)
French (fr)
Other versions
WO2001009189A3 (en
Inventor
Sarah C. Bodary
Karen L. Fisher
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genentech Inc
Original Assignee
Genentech Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Genentech Inc filed Critical Genentech Inc
Priority to JP2001513995A priority Critical patent/JP2003508028A/ja
Priority to AU63913/00A priority patent/AU776600B2/en
Priority to DE60045247T priority patent/DE60045247D1/de
Priority to EP00950879A priority patent/EP1204682B1/en
Priority to AT00950879T priority patent/ATE488529T1/de
Priority to CA2378182A priority patent/CA2378182C/en
Publication of WO2001009189A2 publication Critical patent/WO2001009189A2/en
Publication of WO2001009189A3 publication Critical patent/WO2001009189A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2799/00Uses of viruses
    • C12N2799/02Uses of viruses as vector
    • C12N2799/021Uses of viruses as vector for the expression of a heterologous nucleic acid
    • C12N2799/026Uses of viruses as vector for the expression of a heterologous nucleic acid where the vector is derived from a baculovirus

Definitions

  • the present invention relates to compositions and methods for the diagnosis and treatment of tumors
  • cancers Malignant tumors (cancers) are the second leading cause of death in the United States, after heart disease (Boring et al , CA Cancel J Clin 43 7 [ 1993])
  • Cancer is characterized by an increase in the number of abnormal, or neoplastic, cells derived from a normal tissue which proliferate to form a tumor mass, the invasion of adjacent tissues by these neoplastic tumor cells, and the generation of malignant cells which eventually spread via the blood or lymphatic system to regional lymph nodes and to distant sites (metastasis)
  • a cell proliferates under conditions in which normal cells would not grow Cancer manifests itself in a wide variety of forms, characterized by different degrees of invasiveness and aggressiveness
  • a well known mechanism of gene (e g oncogene) overexpression in cancer cells is gene amplification This is a process where in the chromosome of the ancestral cell multiple copies of a particular gene are produced The process involves unscheduled replication of the region of chromosome comprising the gene, followed by recombination of the replicated segments back into the chromosome (Ahtalo et al , Adv Cancer Res 47 235-281 [1986]) It is believed that the overexpression of the gene parallels gene amplification, i e is proportionate to the number of copies made Proto-oncogenes that encode growth factors and growth factor receptors have been identified to play important roles in the pathogenesis of various human malignancies, including breast cancer For example, it has been found that the human ErbB2 gene (erbB2, also known as her2, or c-erbB-2), which encodes a 185-
  • HER2-positive patients responding clinically to treatment with taxanes were greater than three times those of HER2-negative patients (Ibid).
  • a recombinant humanized anti-ErbB2 (anti-HER2) monoclonal antibody (a humanized version of the murine anti-ErbB2 antibody 4D5, referred to as rhuMAb HER2 or HerceptinTM) has been clinically active in patients with ErbB2-overexpressing metastatic breast cancers that had received extensive prior anticancer therapy. (Baselga et al., J. Clin. Oncol. 14:737-744 [1996]).
  • Murine ADAM8 (also known as MS2 and mCD156) was initially cloned from macrophages and macrophage cell lines and described as a cell surface antigen. (Yoshida, S., et al (1990) Intl Immunology 2:585-591). Although not initially recognized, mADAM8 has a structure resembling the metalloproteinase domain of hemorahagic snake venom proteins on the amino-terminal side of a cysteine-rich region and may play a role in tissue infiltration of myelomonocytic cells. (Higuchi, Y. et al (1996) Tissue Antigens 48:423; Kataoka, M. et al (1997) J.
  • ADAM8 Human ADAM8 (hADAM8, also known as hCD156) has been cloned and the corresponding gene mapped to chromosome 10q26.3. hADAM8 exhibits 61.7% homology with mADAM8 and displays disintegrin and metalloproteinase domains. (Yoshiyama, K. et al (1997) Genomics 41 :56-62). It has also been reported that an ADAM8 peptide enhanced tolerance induction in a rat model of generalized autoimmunity of the nervous system. (Schluesener, H. (1998) J Neuroimmunologv 87: 197-202). WO 9740072 describes ADAM 12 proteins and uses thereof.
  • the present invention concerns compositions and methods for the diagnosis and treatment of neoplastic cell growth and proliferation in mammals, including humans.
  • the present invention is based on the identification of a gene that is amplified in the genome of tumor cells. Such gene amplification is associated with the overexpression of the gene product and contributes to tumorigenesis. Accordingly, the proteins encoded by the amplified genes are useful targets for the diagnosis and/or treatment (including prevention) of certain cancers, and act as predictors of the prognosis of tumor treatment.
  • ADAM8 contains a metalloprotease and a disintegrin domain. It was also isolated as an antigen present on monocytes.
  • ADAM8 is believed to play a role in the migration of monocytes through the extracellular matrix or perhaps in the processing of cytokines or other chemotactic molecules.
  • Increased ADAM8 expression in or near tumor cells therefore, provides a means by which tumor cells invade tissue or form metastases. Targeting such a molecule with an antibody or another molecule that blocks, inactivates or otherwise incapacitates the ability of tumor cells to move into or out of tissue results in a clinically relevant anti-tumor therapeutic.
  • the present invention concerns an isolated antibody that binds to a polypeptide designated herein as ADAM8.
  • the isolated antibody specifically binds to an ADAM8 polypeptide
  • the antibody induces the death of a cell that expresses an ADAM8 polypeptide
  • the cell that expresses the ADAM8 polypeptide is a tumor cell that overexpresses the polypeptide as compared to a normal cell of the same type
  • the antibody is a monoclonal antibody, which preferably has non-human complementarity determining region (CDR) residues and human framework region (FR) residues
  • CDR complementarity determining region
  • FR human framework region
  • the antibody may be labeled and may be immobilized on a solid support
  • the antibody is an antibody fragment, a single-chain antibody, or an anti- ldiotypic antibody that binds, preferably specifically, to an ADAM8 polypeptide
  • the invention concerns a composition of matter that comprises an antibody that binds, preferably specifically, to an ADAM8 polypeptide in admixture with a pharmaceutically acceptable carrier
  • the composition of matter comprises a therapeutically effective amount of the antibody
  • the composition comprises a further active ingredient, which may, for example, be a further antibody or a cytotoxic or chemotherapeutic agent
  • the composition is sterile
  • the invention concerns an isolated nucleic acid molecule that encodes an ant ⁇ -ADAM8 antibody, and vectors and recombinant host cells comprising such nucleic acid molecules
  • the invention concerns a method for producing an ant ⁇ -ADAM8 antibody, wherein the method comprises cultu ⁇ ng a host cell transformed with a nucleic acid molecule which encodes the antibody under conditions sufficient to allow expression of the antibody, and recovering the antibody from the cell culture
  • the invention further concerns antagonists of an ADAM8 polypeptide that inhibit one or more of the functions or activities of an ADAM8 polypeptide Agonists of an ADAM8 polypeptide are also contemplated herein
  • the invention concerns an isolated nucleic acid molecule that hybridizes to the complement of a nucleic acid molecule encoding an ADAM8 polypeptide
  • the isolated nucleic acid molecule is preferably DNA, and hybridization preferably occurs under stringent hybridization and wash conditions
  • Such nucleic acid molecules can act as antisense molecules of the amplified genes identified herein, which, in turn, can find use in the modulation of the respective amplified genes, or as antisense primers in amplification reactions
  • sequences can be used as part of a ribozyme and/or a triple helix sequence which, in turn, may be used in regulation of the amplified genes
  • the invention provides a method for determining the presence of an amplified genes identified herein, which, in turn, can find use in the modulation of the respective amplified genes, or as antisense primers in amplification reactions
  • sequences can be used as part of a ribozyme and/or a triple helix sequence which, in turn, may
  • ADAM8 polypeptide in a sample suspected of containing an ADAM8 polypeptide wherein the method comprises exposing the sample to an ant ⁇ -ADAM8 antibody and determining binding of the antibody to an
  • the invention provides a method for determining the presence of an ADAM8 polypeptide in a cell, wherein the method comprises exposing the cell to an ant ⁇ -ADAM8 antibody and determining binding of the antibody to the cell
  • the present invention concerns a method of diagnosing tumor in a mammal, comprising detecting the level of expression of a gene encoding an ADAM8 polypeptide (a) in a test sample of tissue cells obtained from the mammal, and (b) in a control sample of known normal tissue cells of the same cell type, wherein a higher expression level in the test sample is indicative of the presence of tumor in the mammal from which the test tissue cells were obtained.
  • the present invention concerns a method of diagnosing tumor in a mammal, comprising (a) contacting an anti ADAM8 antibody with a test sample of tissue cells obtained from the mammal, and (b) detecting the formation of a complex between the ant ⁇ -ADAM8 antibody and an ADAM8 polypeptide in the test sample, wherein the formation of a complex is indicative of the presence of a tumor in said mammal
  • the detection may be qualitative or quantitative, and may be performed in comparison with monitoring the complex formation in a control sample of known normal tissue cells of the same cell type
  • test sample is usually obtained from an individual suspected to have neoplastic cell growth or proliferation (e g cancerous cells)
  • the present invention concerns a cancer diagnostic kit comprising an anti- ADAM8 antibody and a carrier (e g a buffer) in suitable packaging
  • a carrier e g a buffer
  • the kit preferably contains instructions for using the antibody to detect the presence of an ADAM8 polypeptide in a sample suspected of containing the same
  • the invention concerns a method for inhibiting the growth of tumor cells comprising exposing tumor cells which express an ADAM8 polypeptide to an effective amount of an agent which inhibits an activity and/or the expression of an ADAM8 polypeptide, wherein growth of the tumor cells is thereby inhibited
  • the agent preferably is an ant ⁇ -ADAM8 antibody, a small organic and inorganic molecule, peptide, phosphopeptide, antisense or ribozyme molecule, or a triple helix molecule
  • the agent e g the ant ⁇ -ADAM8 antibody, induces cell death
  • the tumor cells are further exposed to radiation treatment and/or a cytotoxic or chemotherapeutic agent
  • the invention concerns an article of manufacture, comprising a container, a label on the container, and a composition comprising an active agent contained within the container, wherein the composition is effective for inhibiting the growth of tumor cells and the label on the container indicates that the composition can be used for treating conditions characterized by overexpression of an ADAM8 polypeptide as compared to a normal cell of the same tissue type
  • the active agent in the composition is an agent which inhibits an activity and/or the expression of an ADAM8 polypeptide
  • the active agent is an ant ⁇ -ADAM8 antibody or an antisense oligonucleotide
  • the invention also provides a method for identifying a compound that inhibits an activity of an ADAM8 polypeptide, comprising contacting a candidate compound with an ADAM8 polypeptide under conditions and for a time sufficient to allow these two components to interact and determining whether an activity of the ADAM8 polypeptide is inhibited
  • either the candidate compound or the ADAM8 polypeptide is immobilized on a solid support
  • the non-immobilized component carries a detectable label
  • this method comprises the steps of (a) contacting cells and a candidate compound to be screened in the presence of ADAM8 polypeptide under conditions suitable for the induction of a cellular response normally induced by an ADAM8 polypeptide and (b) determining the induction of said cellular response to determine if the test compound is an effective antagonist
  • the invention provides a method for identifying a compound that inhibits the expression of an ADAMS polypeptide in cells that express the polypeptide, wherein the method comprises contacting the cells with
  • ADAM8 Sequences An amino acid sequence of native ADAM8 protein is shown below: MRGLGLWLLGAMMLPAIAPSRPWALMEQYEVVLPRRLPGPRVRRALPSHLGLHPERVSYVLGATG HNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCLYQGHVEGYPDSAASLSTCAGLRGFF QVGSDLHLIEPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRE TRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSP DPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVG VACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQS VCLANAPDLS
  • a DNA sequence encoding the ADAM8 amino acid polypeptide shown above is shown below: ATGCGCGGCCTCGGGCTCTGGCTGCTGGGCGCGATGATGCTGCCTGCGATTGCCCCCAGCCGGC CCTGGGCCCTCATGGAGCAGTATGAGGTCGTGTTGCCGCGGCGTCTGCCAGGCCCCCGAGTCCG CCGAGCTCTGCCCTCCCACTTGGGCCTGCACCCAGAGAGGGTGAGCTACGTCCTTGGGGCCACA GGGCACAACTTCACCCTCCACCTGCGGAAGAACAGGGACCTGCTGGGTTCCGGCTACACAGAG ACCTATACGGCTGCCAATGGCTCCGAGGTGACGGAGCAGCCTCGCGGGCAGGACCACTGCTTAT ACCAGGGCCACGTAGAGGGGTACCCGGACTCAGCCGCCAGCCTCAGCACCTGTGCCGGCCTCA GGGGTTTCTTCCAGGTGGGGTCAGACCTGCACCTGATCGAGCCCCTGGATGAAGGTGGCGAGGG CGGACGGCACGCCGTGG
  • Tables 1 A-D show hypothetical exemplifications for using the below desc ⁇ bed method to determine % amino acid sequence identity (Tables 1A-B) and % nucleic acid sequence identity (Tables 1C-D) using the ALIGN-2 sequence comparison computer program, wherein "PRO” represents the amino acid sequence of a hypothetical ADAM8 polypeptide of interest, “Comparison Protein” represents the amino acid sequence of a polypeptide against which the "PRO” polypeptide of interest is being compared, “PRO-DNA” represents a hypothetical ADAM8-encod ⁇ ng nucleic acid sequence of interest, “Comparison DNA ' represents the nucleotide sequence of a nucleic acid molecule against which the "PRO-DNA ' nucleic acid molecule of interest is being compared, “X, "Y' and “Z” each represent different hypothetical amino acid residues and "N", “L” and “V” each represent different hypothetical nucleotides Tables 2A-Q provide the complete source code for the ALIGN-2 sequence comparison computer program
  • cancer and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth
  • cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia More particular examples of such cancers include breast cancer, prostate cancer, colon cancer, squamous cell cancer, small-cell lung cancer, non-small cell lung cancer, gastrointestinal cancer, pancreatic cancer, ghoblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, colorectal cancer, endometrial carcinoma, salivary gland carcinoma, kidney cancer, liver cancer, vulval cancer, thyroid cancer, hepatic carcinoma and various types of head and neck cancer
  • Treatment refers to both therapeutic treatment and prophylactic or preventative measures Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented
  • the "pathology" of cancer includes all phenomena that compromise the well-being of the patient This includes, without limitation, abnormal or uncontrollable cell growth, metastasis, interference with the normal functioning of neighboring cells, release of cytokines or other secretory products at abnormal levels, suppression or aggravation of inflammatory or immunological response, etc
  • “Mammal” for purposes of treatment refers to any animal classified as a mammal, including humans, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, horses cats, cattle, pigs, sheep, etc Preferably the mammal is human
  • Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers which are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed Often the physiologically acceptable carrier is an aqueous pH buffered solution
  • physiologically acceptable carriers include buffers such as phosphate, citrate, and other organic acids, antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM, poly
  • Administration "in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
  • cytotoxic agent refers to a substance that inhibits or prevents the function
  • radioactive isotopes e.g., I ,
  • chemotherapeutic agents such as enzymatically active toxins of bacterial, fungal, plant or animal origin, or fragments thereof.
  • chemotherapeutic agent is a chemical compound useful in the treatment of cancer.
  • chemotherapeutic agents include adriamycin, doxorubicin, epirubicin, 5-fluorouracil, cytosine arabinoside ("Ara-C”), cyclophosphamide, thiotepa, busulfan, cytoxin, taxoids, e.g.
  • paclitaxel Texol, Bristol-Myers Squibb Oncology, Princeton, NJ
  • doxetaxel Tetraxotere, Rh ⁇ ne-Poulenc Rorer, Antony, Rnace
  • toxotere methotrexate
  • cisplatin melphalan
  • vinblastine bleomycin
  • etoposide ifosfamide
  • mitomycin C mitoxantrone
  • vincristine vinorelbine
  • carboplatin teniposide, daunomycin, carminomycin, aminopterin, dactinomycin, mitomycins, esperamicins (see U.S. Pat. No.
  • a “growth inhibitory agent” when used herein refers to a compound or composition which inhibits growth of a cell, especially cancer cell overexpressing any of the genes identified herein, either in vitro or in vivo.
  • the growth inhibitory agent is one which significantly reduces the percentage of cells overexpressing such genes in S phase.
  • growth inhibitory agents include agents that block cell cycle progression (at a place other than S phase), such as agents that induce Gl arrest and M-phase arrest.
  • Classical M-phase blockers include the vincas (vincristine and vinblastine), taxol, and topo II inhibitors such as doxorubicin, epirubicin, daunorubicin, etoposide, and bleomycin.
  • DNA alkylating agents such as tamoxifen, prednisone, dacarbazine, mechlorethamine, cisplatin, methotrexate, 5-fluorouracil, and ara-C. Further information can be found in The Molecular Basis of Cancer, Mendelsohn and Israel, eds., Chapter 1 , entitled “Cell cycle regulation, oncogens, and antineoplastic drugs” by Murakami et al. (WB Saunders: Philadelphia, 1995), especially p. 13.
  • Doxorubicin is an athracycline antibiotic.
  • the full chemical name of doxorubicin is (8S-cis)-10- [(3-amino-2,3,6-trideoxy-alpha-L-lyxo-hexapyranosyl)oxy]-7,8,9,10-tetrahydro-6,8,l l-trihydroxy-8- (hydroxyacetyl)- 1 -methoxy-5, 12-naphthacenedione.
  • cytokine is a generic term for proteins released by one cell population which act on another cell as intercellular mediators.
  • cytokines are lymphokines, monokines, and traditional polypeptide hormones. Included among the cytokines are growth hormone such as human growth hormone, N-methionyl human growth hormone, and bovine growth hormone; parathyroid hormone; thyroxine, insulin, proinsuhn, relaxin, prorelaxin, glycoprotein hormones such as follicle stimulating hormone (FSH), thyroid stimulating hormone (TSH), and luteinizing hormone (LH), hepatic growth factor, fibroblast growth factor, prolactin, placental lactogen, tumor necrosis factor-alpha and -beta , mulle ⁇ an- mhibiting substance, mouse gonadotropin-associated peptide, inhibin, activin, vascular endothehal growth factor, lnteg ⁇ n, thrombopoietin (TPO), nerve growth factors
  • prodrug refers to a precursor or derivative form of a pharmaceutically active substance that is less cytotoxic to tumor cells compared to the parent drug and is capable of being enzymatically activated or converted into the more active parent form See, e g Wilman, "Prodrugs in Cancer Chemotherapy", Biochemical Society Transactions.
  • the prodrugs of this invention include, but are not limited to, phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate-containing prodrugs, peptide-containing prodrugs, D-amino acid-modified prodrugs, glysocylated prodrugs, beta-lactam- containing prodrugs, optionally substituted phenoxyacetamide-containing prodrugs or optionally substituted phenylacetamide-containing prodrugs, 5-fluorocytos ⁇ ne and other 5-fluorou ⁇ d ⁇ ne prodrugs which can be converted into the more active cytotoxic free drug Examples of cytotoxic drugs that can be de ⁇ vatized into a prodrugs form for
  • ADAM8 or "ADAM8 polypeptide” when used herein encompass native sequence ADAM8 polypeptides and ADAM8 polypeptide variants (which are further defined herein) and are preferably human polypeptides
  • the ADAM8 polypeptide may be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant and/or synthetic methods
  • a "native sequence” ADAM8 polypeptide comprises a polypeptide having the same amino acid sequence as an ADAM8 polypeptide derived from nature
  • native sequence ADAM8 polypeptide can be isolated from nature or can be produced by recombinant and/or synthetic means
  • the term "native sequence” ADAM8 polypeptide specifically encompasses naturally-occurring truncated or secreted forms (e g , an extracellular domain sequence), naturally-occurring variant forms (e g , alternatively spliced forms) and naturally-occurring allelic variants of the ADAM8 polypeptide
  • ADAM8 variant polypeptide means an active ADAM8 polypeptide as defined below having at least about 80% amino acid sequence identity with the amino acid sequence shown above (SEQ ID NO 1), or a specifically derived fragment thereof
  • ADAM8 variant polypeptides include, for instance, ADAM8 polypeptides wherein one or more amino acid residues are added, or deleted, at the N- and/or C-terminus, as well as within one or more internal domains, of the sequence of SEQ ID NO 1, respectively
  • an ADAM8 variant polypeptide will have at least about 80% amino acid sequence identity, more preferably at least about 81 % amino acid sequence identity, more preferably at least about 82% amino acid sequence identity, more preferably at least about 83% amino acid sequence identity, more preferably at least about 84% amino acid sequence identity, more preferably at least about 85% amino acid sequence identity, more preferably at least about 86% amino acid sequence identity, more preferably at least about 87% amino acid sequence identity, more preferably at least about 88% amino acid sequence identity, more
  • Percent (%) amino acid sequence identity with respect to the ADAM8 polypeptide sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the ADAM8 sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megahgn (DNASTAR) software Those skilled in the art can determine approp ⁇ ate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared The % amino acid sequence identity values used herein are generated using the WU-BLAST-2 computer program [Altschul et al , Methods in Enzymology, 266 460-480 (1996)] WU-BLAST-2 uses several search
  • ADAM8 variant polynucleotide or "ADAM8 variant nucleic acid sequence * ' means an active ADAM8 polypeptide-encoding nucleic acid molecule as defined below having at least about 80% nucleic acid sequence identity with the nucleotide acid sequence shown above (SEQ ID NO 2) or a specifically derived fragment thereof
  • an ADAM8 variant polynucleotide will have at least about 80% nucleic acid sequence identity, more preferably at least about 81 % nucleic acid sequence identity, more preferably at least about 82% nucleic acid sequence identity, more preferably at least about 83% nucleic acid sequence identity, more preferably at least about 84% nucleic acid sequence identity, more preferably at least about 85% nucleic acid sequence identity, more preferably at least about 86% nucleic acid sequence identity, more preferably at least about 87% nucleic acid sequence identity, more preferably at least about 88% nucleic acid sequence identity, more preferably at least about 89% nucleic acid sequence identity, more preferably
  • Percent (%) nucleic acid sequence identity with respect to the ADAM8 polypeptide-encoding nucleic acid sequences identified herein is defined as the percentage of nucleotides m a candidate sequence that are identical with the nucleotides in the ADAM8 polypeptide-encoding sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity Alignment for purposes of determining percent nucleic acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST- 2, ALIGN, ALIGN-2 or Mega gn (DNASTAR) software Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared The % identity values used herein are generated using the WU-BLAST-2 computer program [Altschul et al , supra] WU-BLAST-2 uses several search parameters, most of which are set to the default values Those that are not
  • % nucleic acid sequence identity values may also be determined using the computer program ALIGN-2 which was authored by Genentech, Inc and which has been filed with user documentation in the U S Copyright Office, Washington D C , 20559 and which is registered under U S Copyright Registration No TXU510087 All search parameters are set by the ALIGN-2 program and do not vary See Tables 2A-Q
  • ADAM8 variant polynucleotides are nucleic acid molecules that encode an active ADAM8 polypeptide and which are capable of hybridizing, preferably under stringent hybridization and wash conditions, to nucleotide sequences encoding the full-length ADAM8 polypeptide (SEQ ID NO 1)
  • ADAM8 variant polypeptides may be those that are encoded by an ADAM8 variant polynucleotide
  • the % value of positives is determined by dividing (a) the number of amino acid residues scoring a positive value in the BLOSUM62 matrix between the ADAM8 polypeptide amino acid sequence and the comparison amino acid sequence of interest (l e , the amino acid sequence against which the ADAM8 polypeptide sequence is being compared) as determined by WU-BLAST-2 by (b) the total number of amino acid residues of the ADAM8 polypeptide of interest See Tables 1A-D
  • isolated when used to describe the various polypeptides disclosed herein, means polypeptide that has been identified and separated and/or recovered from a component of its natural environment Preferably, the isolated polypeptide is free of association with all components with which it is naturally associated Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes
  • the polypeptide will be purified (1) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (2) to homogeneity by SDS-PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver stain Isolated polypeptide includes polypeptide in situ within recombinant cells, since at least one component of the ADAM8 natural environment will not be present Ordinarily, however, isolated polypeptide will be prepared by at least one purification step
  • An ' isolated nucleic acid molecule encoding a ADAM8 polypeptide is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the natural source of ADAM8-encod ⁇ ng nucleic acid
  • An isolated ADAM8-encod ⁇ ng nucleic acid molecule is other than in the form or setting in which it is found in nature Isolated nucleic acid molecules therefore are distinguished from the ADAM8-encod ⁇ ng nucleic acid molecule as it exists in natural cells
  • an isolated nucleic acid molecule encoding an ADAM8 polypeptide includes nucleic acid molecules contained in cells that ordinarily express ADAM8 where, for example, the nucleic acid molecule is in a chromosomal location different from that of natural cells
  • control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism The control sequences that are suitable for prokaryotes, for example, include
  • Nucleic acid is operably linked" when it is placed into a functional relationship with another nucleic acid sequence
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence
  • a ⁇ bosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation
  • "operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase
  • enhancers do not have to be contiguous Linking is accomplished by hgation at convenient restriction sites If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice
  • “Stringency” of hybridization reactions is readily determinable by one of ordinary skill in the art, and generally is an empirical calculation dependent upon probe length, washing temperature, and salt concentration In general, longer probes require higher temperatures for proper annealing, while shorter probes need lower temperatures Hybridization generally depends on the ability of denatured DNA to reanneal when complementary strands are present in an environment below their melting temperature The higher the degree of desired homology between the probe and hyb ⁇ dizable sequence, the higher the relative temperature which can be used As a result, it follows that higher relative temperatures would tend to make the reaction conditions more stringent, while lower temperatures less so For additional details and explanation of stringency of hybridization reactions, see Ausubel et al , Current Protocols in Molecular Biology, Wiley Interscience Publishers, (1995)
  • “Stringent conditions” or “high stringency conditions”, as defined herein, may be identified by those that (1 ) employ low ionic strength and high temperature for washing, for example 0 015 M sodium chloride/00015 M sodium c ⁇ trate/0 1% sodium dodecyl sulfate at 50°C, (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0 1% bovine serum album ⁇ n/0 1 % F ⁇ coll/0 1 % poly v ⁇ nylpyrrol ⁇ done/50mM sodium phosphate buffer at pH 6 5 with 750 mM sodium chloride, 75 mM sodium citrate at 42°C, or (3) employ 50% formamide, 5 x SSC (0 75 M NaCl, 0 075 M sodium citrate), 50 mM sodium phosphate (pH 6 8), 0 1 % sodium pyrophosphate, 5 x Denhardt's solution, sonicated salmon sperm DNA (50
  • Modely stringent conditions may be identified as desc ⁇ bed by Sambrook et al , Molecular Cloning A Laboratory Manual. New York Cold Spring Harbor Press, 1989, and include the use of washing solution and hybridization conditions (e g , temperature, ionic strength and % SDS) less stringent than those described above
  • An example of moderately stringent conditions is overnight incubation at 37°C in a solution comprising 20% formamide, 5 x SSC (150 mM NaCl, 15 mM t ⁇ sodium citrate), 50 mM sodium phosphate (pH 7 6), 5 x Denhardt's solution, 10% dextran sulfate, and 20 mg/mL denatured sheared salmon sperm DNA, followed by washing the filters in 1 x SSC at about 35-50°C
  • the skilled artisan will recognize how to adjust the temperature, ionic strength, etc as necessary to accommodate factors such as probe length and the
  • epipe tagged when used herein refers to a chimeric poly
  • ADAM8 polypeptides or “activity” in the context of molecules identified based upon the ADAM8 polypeptides (or their coding sequences) refers to polypeptides (e g antibodies) or organic or inorganic small molecules, peptides, etc which retain a biological and/or an immunological activity/property of a native or naturally- occurring ADAM8 polypeptide
  • Bioactivity in the context of an antibody or another molecule that can be identified by the screening assays disclosed herein (e g an organic or inorganic small molecule, peptide, etc ) is used to refer to the ability of such molecules to bind or complex with the polypeptides encoded by the amplified genes identified herein, or otherwise interfere with the interaction of the encoded polypeptides with other cellular proteins
  • a preferred biological activity is growth inhibition of a target tumor cell
  • Another preferred biological activity is cytotoxic activity resulting in the death of the target tumor cell
  • immunological cross-reactivity means immunological cross-reactivity with at least one epitope of an ADAM8 polypeptide
  • immunological cross-reactivity means that the candidate polypeptide is capable of competitively inhibiting the qualitative biological activity of an ADAM8 polypeptide having this activity with polyclonal antisera raised against the known active ADAM8 polypeptide
  • Such antisera are prepared in conventional fashion by injecting goats or rabbits, for example, subcutaneously with the known active analogue in complete Freund's adjuvant, followed by booster lntrape ⁇ toneal or subcutaneous injection in incomplete Freunds
  • the immunological cross-reactivity preferably is "specific", which means that the binding affinity of the immunologically cross-reactive molecule (e g antibody) identified, to the corresponding ADAM8 polypeptide is significantly higher (preferably at least about 2-t ⁇ mes, more preferably at least about 4-t ⁇ mes, even more preferably at least about 8-t ⁇ mes, most preferably at least about 8-t ⁇ mes higher) than the binding affinity of
  • a "small molecule” is defined herein to have a molecular weight below about 500 Daltons
  • Antibodies (Abs) and “immunoglobulins” (Igs) are glycoproteins having the same structural characteristics While antibodies exhibit binding specificity to a specific antigen, immunoglobulins include both antibodies and other antibody-like molecules that lack antigen specificity Polypeptides of the latter kind are, for example, produced at low levels by the lymph system and at increased levels by myelomas
  • antibody is used in the broadest sense and specifically covers, without limitation, intact monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e g , bispecific antibodies) formed from at least two intact antibodies, and antibody fragments so long as they exhibit the desired biological activity
  • “Native antibodies' and “native immunoglobulins' are usually heterotetrame ⁇ c glycoproteins of about 150,000 Dalton, composed of two identical light (L) chains and two identical heavy (H) chains Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes Each heavy and light chain also has regularly spaced intrachain disulfide bridges Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains Each light chain has a variable domain at one end (V L ) and a constant domain at its other end, the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light-chain variable domain is aligned with the variable domain of the heavy chain Particular amino acid residues are believed to form an interface between the light- and heavy- chain variable domains
  • variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen
  • CDRs complementarity-determining regions
  • hyperva ⁇ able regions both in the light-chain and the heavy-chain variable domains
  • the more highly conserved portions of variable domains are called the framework (FR)
  • the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta -sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the -sheet structure
  • the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al , NIH Publ No 91- 3242, Vol I, pages 647-669 (1991))
  • the constant domains are not involved directly
  • hyperva ⁇ able region when i' ed herein refers to the amino acid residues of an antibody which are responsible for antigen-binding
  • the hyperva ⁇ able region comprises amino acid residues from a "complementarity determining region" to "CDR" (I e residues 24-34 (LI), 50-56 (L2) and 89-97 (L3) in the light chain variable domain and 31-35 (HI), 50-65 (H2) and 95-102 (H3) in the heavy chain variable domain, Kabat et al , Sequences of Proteins of Immunological Interest, 5th Ed Public Health Service, National Institute of Health, Bethesda, MD [1991]) and/or those residues from a "hyperva ⁇ able loop” (I e residues 26-32 (LI), 50-52 (L2) and 91-96 (L3) in the light chain variable domain and 26-32 (HI), 53-55 (H2) and 96- 101 (H3) m the heavy chain variable domain , Clothia and Lesk, J
  • Antibody fragments comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody
  • antibody fragments include Fab, Fab', F(ab ) 2 , and Fv fragments, diabodies, linear antibodies (Zapata et al , Protein Eng 8(10) 1057-1062 [1995]), single-chain antibody molecules, and multispecific antibodies formed from antibody fragments
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment, whose name reflects its ability to crystallize readily Pepsin treatment yields an F(ab') fragment that has two antigen-combining sites and is still capable of cross-linking antigen
  • Fv is the minimum antibody fragment which contains a complete antigen-recognition and -binding site This region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-V dimer Collectively, the six CDRs confer antigen-binding specificity to the antibody However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site
  • the Fab fragment also contains the constant domain of the light chain and the first constant domain
  • CHI heavy chain Fab fragments differ from Fab' fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHI domain including one or more cysteines from the antibody hinge region Fab'-SH is the designation herein for Fab' in which the cysteine res ⁇ due(s) of the constant domains bear a free thiol group F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them Other chemical couplings of antibody fragments are also known
  • the "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains
  • immunoglobulins can be assigned to different classes There are five major classes of immunoglobulins IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e g , IgGl, IgG2, IgG3, IgG4, IgA, and IgA2
  • the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and ⁇ , respectively
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known
  • the term "monoclonal ant ⁇ ⁇ ⁇ dy" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, l e , the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts Monoclonal antibodies are highly specific, being directed
  • the monoclonal antibodies herein specifically include ' chimeric antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the cha ⁇ n(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U S Patent No 4,816,567, Morrison et al , Proc Natl Acad Sci USA, 81 6851-6855 [1984])
  • humanized forms of non-human (e g , murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab') or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a CDR of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity, and capacity
  • donor antibody such as mouse, rat or rabbit having the desired specificity, affinity, and capacity
  • corresponding non-human residues replace Fv FR residues of the human immunoglobulin
  • humanized antibodies may comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences
  • Single-chain r v or “sFv' antibody fragments comprise the V H and V L domains of antibody, wherein these domains are present in a single polypeptide chain
  • the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains, which enables the sFv to form the desired structure for antigen binding
  • diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH - VL)
  • VH heavy-chain variable domain
  • VL light-chain variable domain
  • VH - VL polypeptide chain
  • an “isolated” antibody is one which has been identified and separated and/or recovered from a component of its natural environment Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes
  • the antibody will be purified (1 ) to greater than 95% by weight of antibody as determined by the Lowry method and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present Ordinarily, however, isolated antibody will be prepared by at least one purification step
  • label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to the antibody so as to generate a "labeled” antibody
  • the label may be detectable by itself (e g , radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable
  • Radionuchdes that can serve as detectable labels include, for example, 1-131, 1-123, 1-125, Y-90, Re- 188, Re- 186, At-211, Cu- 67, B ⁇ -212, and Pd-109
  • solid phase is meant a non-aqueous matrix to which the antibody of the present invention can adhere
  • solid phases encompassed herein include those formed partially or entirely of glass (e g , controlled pore glass), polysaccharides (e g , agarose), polyacrylamides, polystyrene, polyvinyl alcohol and sihcones
  • the solid phase can comprise the well of an assay plate, in others it is a purification column (e g , an affinity chromatography column) This term also includes a discontinuous solid phase of discrete particles, such as those desc ⁇ bed in U S Patent No 4,275,149
  • a “liposome” is a small vesicle composed of various types of lipids, phosphohpids and/or surfactant which is useful for delivery of a drug (such as an ADAM8 polypeptide or antibody thereto and, optionally, a chemotherapeutic agent) to a mammal
  • a drug such as an ADAM8 polypeptide or antibody thereto and, optionally, a chemotherapeutic agent
  • the components of the liposome are commonly arranged in a bilayer formation, similar to the lipid arrangement of biological membranes
  • the term “lmmunoadhesin” designates antibody-like molecules that combine the binding sf ficity of a heterologous protein (an “adhesin”) with the effector functions of immu ⁇ ilobuhn constant domains Structurally, the immunoadhesins comprise a fusion of an amino acid sequence with the desired binding specificity which is other than the antigen recognition and binding site of an antibody (l e ,
  • ADAM8 nucleotide sequences encoding polypeptides referred to in the present application as ADAM8
  • cDNA encoding ADAM8 polypeptides has been identified and isolated, as disclosed in further detail in the Examples below
  • the proteins encoded by the herein disclosed nucleic acid sequences as well as all further native homologues and variants included in the foregoing definition of ADAM8, will be referred to as "ADAM8", regardless of their origin or mode of preparation B ADAM8 Variants
  • ADAM8 variants can be prepared ADAM8 variants can be prepared by introducing appropriate nucleotide changes into the ADAM8 DNA, and/or by synthesis of the desired ADAM8 polypeptide Those skilled in the art will appreciate that amino acid changes may alter post-translational processes of the ADAM8, such as changing the number or position of glycosylation sites or altering the membrane anchoring characteristics
  • Variations in the native full-length sequence ADAM8 or in various domains of the ADAM8 described herein can be made, for example, using any of the techniques and guidelines for conservative and non-conservative mutations set forth, for instance, in U S Patent No 5,364,934
  • Variations may be a substitution, deletion or insertion of one or more codons encoding the ADAM8 that results in a change in the amino acid sequence of the ADAM8 as compared with the native sequence ADAM8
  • the variation is by substitution of at least one amino acid with any other amino acid in one or more of the domains of the ADAM8
  • Guidance in determining which amino acid residue may be inserted, substituted or deleted without adversely affecting the desired activity may be found by comparing the sequence of the ADAM8 with that of homologous known protein molecules and minimizing the number of amino acid sequence changes made in regions of high homology
  • Amino acid substitutions can be the result of replacing one amino acid with another amino acid having similar structural and/or chemical properties, such as the replacement of
  • ADAM8 polypeptide fragments are provided herein Such fragments may be truncated at the N- terminus or C-terminus, or may lack internal residues, for example, when compared with a full-length native protein Certain fragments lack amino acid residues that are not essential for a desired biological activity of he ADAM8 polypeptide
  • ADAM8 fragments may be prepared by any of a number of conventional techniques Desired peptide fragments may be chemically synthesized
  • An alternative approach involves generating ADAM8 fragments by enzymatic digestion, e g , by treating the protein with an enzyme known to cleave proteins at sites defined by particular amino acid residues, or by digesting the DNA with suitable restriction enzymes and isolating the desired fragment
  • Yet another suitable technique involves isolating and amplifying a DNA fragment encoding a desired polypeptide fragment, by polymerase chain reaction (PCR) Oligonucleotides that define the desired termini of the DNA fragment are employed at the 5' and 3' primers in the PCR
  • ADAM8 polypeptide fragments share at least one biological and/or immunological activity with the native ADAM8 polypeptide
  • Leu (L) norleucine lie, val, met, ala, phe lie
  • Val (V) lie, leu, met, phe, ,ala, norleucine leu
  • Substantial modifications in function or immunological identity of the polypeptide are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain Naturally occurring residues are divided into groups based on common side-chain properties (1) hydrophobic norleucine, met, ala, val, leu, lie, (2) neutral hydrophilic cys, ser, thr,
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class Such substituted residues also may be introduced into the conservative substitution sites or, more preferably, into the remaining (non-conserved) sites
  • the variations can be made using methods known in the art such as o gonucleotide-mediated (site- directed) mutagenesis, alanine scanning, and PCR mutagenesis Site-directed mutagenesis [Carter et al , Nucl Acids Res . 13 4331 (1986), Zoller et al , Nucl Acids Res . 10 6487 (1987)], cassette mutagenesis [Wells et al , Gene, 34 315 ( 1985)], restriction selection mutagenesis [Wells et al , Philos Trans R Soc London SerA, 317 415 ( 1986)] or other known techniques can be performed on the cloned DNA to produce the PEACH variant DNA
  • Scanning amino acid analysis can also be employed to identify one or more amino acids along a contiguous sequence
  • preferred scanning amino acids are relatively small, neutral amino acids
  • amino acids include alanine, glycine, serine, and cysteine
  • Alanine is typically a preferred scanning amino acid among this group because it eliminates the side-chain beyond the beta-carbon and is less likely to alter the main-chain conformation of the variant [Cunningham and Wells, Science, 244 1081-1085 (1989)]
  • Alanine is also typically preferred because it is the most common amino acid Further, it is frequently found in both buried and exposed positions [Creighton, The Proteins, (W H Freeman & Co , N Y ), Chothia, J_ Mol Biol , 150 1 (1976)] If alanine substitution does not yield adequate amounts of variant, an isoteric amino acid can be used
  • Covalent modifications of ADAM8 are included within the scope of this invention
  • One type of covalent modification includes reacting targeted amino acid residues of an ADAM8 polypeptide with an organic de ⁇ atizing agent that is capable of reacting with selected side chains or the N- or C- terminal residues of the ADAM8
  • De ⁇ vatization with bifunctional agents is useful, for instance, for crosslinking ADAM8 to a water-insoluble support matrix or surface for use in the method for purifying ant ⁇ -ADAM8 antibodies, and vice- versa
  • Commonly used crosslinking agents include, e g , l,l-b ⁇ s(d ⁇ azoacetyl)-2- phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-az ⁇ dosal ⁇ cyl ⁇ c acid, homobifunctional lmidoesters, including disuccinimidyl esters such as 3,3 - d ⁇ th ⁇ ob ⁇ s(succ ⁇ n
  • Another type of covalent modification of the ADAM8 polypeptide included within the scope of this invention comprises altering the native glycosylation pattern of the polypeptide "Altering the native glycosylation pattern" is intended for purposes herein to mean deleting one or more carbohydrate moieties found in native sequence ADAM8 (either by removing the underlying glycosylation site or by deleting the glycosylation by chemical and/or enzymatic means), and/or adding one or more glycosylation sites that are not present in the native sequence ADAM8
  • the phrase includes qualitative changes in the glycosylation of the native proteins, involving a change in the nature and proportions of the various carbohydrate moieties present
  • ADAM8 polypeptide may be accomplished by altering the amino acid sequence The alteration may be made, for example, by the addition of, or substitution by, one or more serine or threonine residues to the native sequence ADAM8 (for O-hnked glycosylation sites)
  • the ADAM8 amino acid sequence may optionally be altered through changes at the DNA level, particularly by mutating the DNA encoding the ADAM8 polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids
  • ADAM8 polypeptide Another means of increasing the number of carbohydrate moieties on the ADAM8 polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide Such methods are described in the art, e g , in WO 87/05330 published 11 September 1987, and in Ap n and W ⁇ ston, CRC C ⁇ t Rev Biochem , pp 259-306 (1981 )
  • Removal of carbohydrate moieties present on the ADAM8 polypeptide may be accomplished chemically or enzymatically or by mutational substitution of codons encoding for amino acid residues that serve as targets for glycosylation
  • Chemical deglycosylation techniques are known in the art and described, for instance, by Hakimuddin, et al , Arch Biochem Biophys . 259 52 (1987) and by Edge et al , Anal Biochem , 1 18 131 (1981 )
  • Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as desc ⁇ bed by Thotakura et al Meth Enzymol . 138 350 (1987)
  • ADAM8 comprises linking the ADAM8 polypeptide to one of a variety of nonproteinaceous polymers, e g , polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U S Patent Nos 4,640,835, 4,496,689, 4,301,144, 4,670,417, 4,791,192 or 4,179,337
  • nonproteinaceous polymers e g , polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylenes
  • the ADAM8 of the present invention may also be modified in a way to form a chimeric molecule comprising ADAM8 fused to another, heterologous polypeptide or amino acid sequence
  • a chimeric molecule comprises a fusion of the ADAM8 with a tag polypeptide that provides an epitope to which an anti-tag antibody can selectively bind
  • the epitope tag is generally placed at the amino- or carboxyl-termmus of the ADAM8
  • the presence of such epitope-tagged forms of the ADAM8 can be detected using an antibody against the tag polypeptide
  • provision of the epitope tag enables the ADAM8 to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag
  • Various tag polypeptides and their respective antibodies are well known in the art Exampl include poly-histidine (poly-his) or poly-histidine-glycine (poly-his-gly) tags, the flu HA tag polypeptide and
  • Tag polypeptides include the Flag-peptide [Hopp et al , BioTechnology, 6 1204-1210 (1988)], the KT3 epitope peptide [Martin et al , Science.
  • the chimeric molecule may comprise a fusion of the ADAM8 with an immunoglobulin or a particular region of an immunoglobulin
  • an immunoglobulin or a particular region of an immunoglobulin
  • a bivalent form of the chimeric molecule also referred to as an "lmmunoadhesin”
  • such a fusion could be to the Fc region of an IgG molecule
  • the Ig fusions preferably include the substitution of a soluble (transmembrane domain deleted or inactivated) form of an ADAM8 polypeptide in place of at least one variable region within an Ig molecule
  • the immunoglobulin fusion includes
  • ADAM8 by cultu ⁇ ng cells transformed or transfected with a vector containing ADAM8 nucleic acid
  • ADAM8 sequence, or portions thereof may be produced by direct peptide synthesis using solid-phase techniques [see, e g , Stewart et al , Solid Phase Peptide Synthesis, W H Freeman Co , San Francisco, CA (1969), Mer ⁇ field, J Am Chem Soc , 85 2149-2154 (1963)]
  • In vitro protein synthesis may be performed using manual techniques or by automation Automated synthesis may be accomplished, for instance, using an Applied Biosystems Peptide Synthesizer (Foster City, CA) using manufacturer's instructions
  • Various portions of the ADAM8 may be chemically synthesized separately and combined using chemical or enzymatic methods to produce the full-length ADAM8 a Isolation of DNA Encoding an ADAM8 a Isolation of DNA Encoding an AD
  • the oligonucleotide sequences selected as probes should be of sufficient length and sufficiently unambiguous that false positives are minimized
  • the oligonucleotide is preferably labeled such that it can be detected upon hybridization to DNA in the library being screened
  • Methods of labeling are well known in the art, and include the use of radiolabels like 32 P-labeled ATP, biotinylation or enzyme labeling Hybridization conditions, including moderate stringency and high stringency, are provided in Sambrook et al , supra
  • Sequences identified in such library screening methods can be compared and aligned to other known sequences deposited and available in public databases such as GenBank or other private sequence databases
  • Sequence identity at either the amino acid or nucleotide level within defined regions of the molecule or across the full-length sequence can be determined using methods known in the art and as described herein
  • Nucleic acid having protein coding sequence may be obtained by screening selected cDNA or genomic libraries using the deduced amino acid sequence disclosed herein for the first time, and, if necessary, using conventional primer extension procedures as desc ⁇ bed in Sambrook et al , supra to detect precursors and processing intermediates of mRNA that may not have been reverse-transcribed into cDNA b Selection and Transformation of Host Cells
  • Host cells are transfected or transformed with expression or cloning vectors described herein for ADAM8 production and cultured in conventional nutrient media modified as appropriate lor inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences
  • the skilled artisan without undue experimentation can select the culture conditions, such as media, temperature, pH and the like
  • principles, protocols, and practical techniques for maximizing the productivity of cell cultures can be found in Mammalian Cell Biotechnology a Practical Approach, M Butler, ed (IRL Press, 1991) and Sambrook et al , supra
  • Suitable host cells for cloning or expressing the DNA in the vectors herein include prokaryote, yeast, or higher eukaryote cells
  • Suitable prokaryotes include but are not limited to eubacte ⁇ a, such as Gram- negative or Gram-positive organisms, for example, Enterobacte ⁇ aceae such as E coli
  • E coli strains are publicly available, such as E coli K12 strain MM294 (ATCC 31 ,446), E colt X1776 (ATCC 31,537), E coh strain W31 10 (A1C C 27,325) and K5 772 (ATCC 53,635)
  • Other suitable prokaryotic host cells include Enterobacte ⁇ aceae such as Escherichia, e g , £ coh, Enterobacter, Erwtnia, Klebsiella, Proteus, Salmonella, e g , Salmonella typhimunum, Serratia, e g , Ser
  • the nucleic acid (e g , cDNA or genomic DNA) encoding ADAM8 may be inserted into a rephcable vector for cloning (amplification of the DNA) or for expression
  • a rephcable vector for cloning (amplification of the DNA) or for expression
  • the vector may, for example, be in the form of a plasmid, cosmid, viral particle, or phage
  • the appropriate nucleic acid sequence may be inserted into the vector by a variety of procedures
  • DNA is inserted into an approp ⁇ ate restriction endonuclease s ⁇ te(s) using techniques known in the art
  • Vector components generally include, but are not limited to, one or more of a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence Construction of suitable vectors containing one or more of these components employs standard hgation techniques that are known to the skilled artisan
  • the ADAM8 may be produced recomb
  • Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells Such sequences are well known for a variety of bacteria, yeast, and viruses
  • the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2 ⁇ plasmid origin is suitable for yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells
  • Selection genes will typically contain a selection gene, also termed a selectable marker
  • Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e g , ampicilhn, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e g , the gene encoding D-alanine racemase for Bacilli
  • suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up the ADAM8-encod ⁇ ng nucleic acid, such as DHFR or thymidine kinase
  • An appropriate host cell when wild-type DHFR is employed is the CHO cell line deficient in DHFR activity, prepared and propagated as described by Urlaub et al , Proc Natl Acad Sci USA, 77 4216 (1980)
  • a suitable selection gene for use in yeast is the trp ⁇ gene present in the
  • Expression and cloning vectors usually contain a promoter operably linked to the ADAM8-encod ⁇ ng nucleic acid sequence to direct mRNA synthesis
  • Promoters recognized by a variety of potential host cells are well known Promoters suitable for use with prokaryotic hosts include the beta-lactamase and lactose promoter systems [Chang et al , Nature, 275 615 (1978), Goeddel et al , Nature, 281 544 (1979)], alkaline phosphatase, a tryptophan (trp) promoter system [Goeddel, Nucleic Acids Res , 8 4057 (1980), EP 36,776], and hybrid promoters such as the tac promoter [deBoer et al , Proc Natl Acad Sci USA, 80 21-25 (1983)] Promoters for use in bacterial systems also will contain a Shine-Dalgarno (S D ) sequence operably linked to the DNA encoding ADAM8
  • suitable promoting sequences for use with yeast hosts include the promoters for 3- phosphoglycerate kinase [Hitzeman et al , J Biol Chem , 255 2073 (1980)] or other glycolytic enzymes [Hess et al , J Adv Enzyme Reg , 7 149 (1968), Holland, Biochemistry, 17 4900 (1978)], such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, t ⁇ osephosphate isomerase, phosphoglucose isomerase, and glucokinase
  • yeast promoters which are inducible promoters having the additional advantage of transcription controlled by growth conditions, are the promoter regions for alcohol dehydrogenas
  • ADAM8 transcription from vectors in mammalian host cells is controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus (UK 2,21 1 ,504 published 5 July 1989), adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), from heterologous mammalian promoters, e g , the actin promoter or an immunoglobulin promoter, and from heat-shock promoters, provided such promoters are compatible with the host cell systems
  • viruses such as polyoma virus, fowlpox virus (UK 2,21 1 ,504 published 5 July 1989), adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a
  • Enhancers are cis-acting elements of DNA, usually about from 10 to 300 bp, that act on a promoter to increase its transcription
  • Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, -fetoprotein, and insulin)
  • an enhancer from a eukaryotic cell virus examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers
  • the enhancer may be spliced into the vector at a position 5' or 3' to the ADAM8 coding sequence, but is preferably located at a site 5' from the promoter
  • Expression vectors used in eukaryotic host cells will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding ADAM8
  • Gene amplification and/or expression may be measured in a sample directly, for example, by conventional Southern blotting, Northern blotting to quantitate the transcription of mRNA [Thomas, Proc Natl Acad Sci USA, 77 5201-5205 (1980)], dot blotting (DNA analysis), or in situ hybridization, using an appropriately labeled probe, based on the sequences provided herein
  • antibodies may be employed that can recognize specific duplexes, including DNA duplexes, RNA duplexes, and DNA-RNA hybrid duplexes or DNA-protein duplexes
  • the antibodies in turn may be labeled and the assay may be carried out where the duplex is bound to a surface, so that upon the formation of duplex on the surface, the presence of antibody bound to the duplex can be detected
  • Gene expression may be measured by immunological methods, such as immunohistochemical staining of cells or tissue sections and assay of cell culture or body fluids, to quantitate directly the expression of gene product
  • Antibodies useful for immunohistochemical staining and/or assay of sample fluids may be either monoclonal or polyclonal, and may be prepared in any mammal Conveniently, the antibodies may be prepared against a native sequence ADAM8 polypeptide or against a synthetic peptide based on the DNA sequences provided herein or against exogenous sequence fused to ADAM8 DNA and encoding a specific antibody epitope e Purification of Polypeptide
  • ADAM8 may be recovered from culture medium or from host cell lysates If membrane- bound, it can be released from the membrane using a suitable detergent solution (e g , T ⁇ ton-X 100) or by enzymatic cleavage Cells employed in expression of ADAM8 can be disrupted by various physical or chemical means, such as freeze-thaw cycling, sonication, mechanical disruption, or cell lysing agents It may be desired to purify ADAM8 from recombinant cell proteins or polypeptides The following procedures are exemplary of suitable purification procedures by fractionation on an ion-exchange column, ethanol precipitation, reverse phase HPLC, chromatography on silica or on a cation-exchange resin such as DEAE, chromatofocusing, SDS-PAGE, ammonium sulfate precipitation, gel filtration using, for example, Sephadex G-75, protein A Sepharose columns to remove contaminants such as IgG, and metal chelating columns to bind epitope-tagged forms of
  • the purification step(s) selected will depend, for example, on the nature of the production process used and the particular ADAM8 produced E Amplification of Genes Encoding the ADAM8 Polypeptides in Tumor Tissues and Cell Lines
  • MTX cytotoxic drug methotrexate
  • DHFR dihydrofolate reductase
  • the amplification of DNA sequences may indicate specific functional requirement as illustrated in the DHFR experimental system Therefore, the amplification of certain oncogenes in malignancies points toward a causative role of these genes in the process of malignant transformation and maintenance of the transformed phenotype
  • the bcl-2 protein was found to be amplified in certain types of non-Hodgkin's lymphoma This protein inhibits apoptosis and leads to the progressive accumulation of neoplastic cells
  • Members of the gene family of growth factor receptors have been found to be amplified in various types of cancers suggesting that overexpression of these receptors may make neoplastic cells less susceptible to limiting amounts of available growth factor Examples include the amplification of the androgen receptor in recurrent prostate cancer during androgen deprivation therapy and the amplification of the growth factor receptor homologue ERB2 in breast cancer
  • genes involved in intracellular signaling and control of cell cycle progression can undergo amplification during malignant transformation This is illustrated by the
  • PCR polymerase chain reaction
  • such genes have been identified by quantitative PCR (S Gelmini et al , Clin Chem 43 752 [1997]), by comparing DNA from a variety of primary tumors, including breast, lung, colon, prostate, brain, liver, kidney, pancreas, spleen, thymus, testis, ovary, uterus, etc tumor, or tumor cell lines, with pooled DNA from healthy donors Quantitative PCR was performed using a TaqMan instrument (ABI) Gene-specific primers and fluorogenic probes were designed based upon the coding sequences of the DNAs
  • Human lung carcinoma cell lines include A549 (SRC768), Calu-1 (SRC769), Calu-6 (SRC770),
  • H157 (SRC771), H441 (SRC772), H460 (SRC773), H522 (SRC832), H810 (SRC833), SKMES-1 (SRC774) and SW900 (SRC775) all available from ATCC
  • Primary human lung tumor cells usually derive from adenocarcinomas, squamous cell carcinomas, large cell carcinomas, non-small cell carcinomas, small cell carcinomas, and broncho alveolar carcinomas, and include, for example, SRC724 (squamous cell carcinoma abbreviated as "SqCCa”)(LTl), SRC725 (non-small cell carcinoma, abbreviated as "NSCCa”)(LTla),
  • SRC726 (adenocarcinoma, abbreviated as "AdenoCa")(LT2), SRC727 (adenocarc ⁇ noma)(LT3), SRC728 (squamous cell carc ⁇ noma)(LT4), SRC729 (adenocarc ⁇ noma)(LT6), SRC730 (adeno/squamous cell carc ⁇ noma)(LT7), SRCC731 (adenocarr- 10 ma)(LT9), SRC732 (squamous cell carc ⁇ noma)(LT10), SRC733
  • Colon cancer cell lines include, for example, ATCC cell lines SW480 (adenocarcinoma, SRCC776), SW620 (lymph node metastasis of colon adenocarcinoma, SRC777), Colo320 (carcinoma, SRCC778), Colo205 (carcinoma, SRC828), HCC2998 (carcinoma, SRC830), HT29 (adenocarcinoma, SRC779), HM7 (carcinoma, SRC780), KM12 (carcinoma, SRC831), CaWiDr (adenocarcinoma, SRC781), HCT15 (carcinoma, SRC829), HCT1 16 (carcinoma, SRC782), SKCOl (adenocarcinoma, SRC783), SW403 (adenocarcinoma, SRC784), LS174T (carcinoma, SRC785), and HM7 (a high mucin producing
  • Human breast carcinoma cell lines include, for example, HBL100 (SRCC759), MB435s (SRCC760) T47D (SRCC761 ), MB468 (SRCC762), MB 175 (SRCC763), MB361 (SRCC764), BT20 (SRCC765), MCF7 (SRCC766), SKBR3 (SRCC767)
  • gene amplification and/or gene expression in various tissues may be measured by conventional Southern blotting, Northern blotting to quantitate the transcription of mRNA (Thomas, Proc
  • antibodies may be employed that can recognize specific duplexes, including DNA duplexes, RNA duplexes, and DNA-RNA hybrid duplexes or DNA-protein duplexes Gene expression in various tissues, alternatively, may be measured by immunological methods, such as immunohistochemical staining of tissue sections and assay of cell culture or body fluids, to quantitate directly the expression of gene product
  • Antibodies useful for immunohistochemical staining and/or assay of sample fluids may be either monoclonal or polyclonal, and may be prepared in any mammal Conveniently, the antibodies may be prepared against a native sequence ADAM8 polypeptide or against a synthetic peptide based on the DNA sequences provided herein or against exogenous sequence fused to sequence ADAM8
  • the gene can be mapped to a particular ct r ⁇ mosome, e g by radiation-hybrid anal is The amplification level is then determined at the location identified, and at neighboring genomic region Selective or preferential amplification at the genomic region to which to gene has been mapped is consistent with the possibility that the gene amplification observed promotes tumor growth or survival
  • Chromosome mapping includes both framework and epicenter mapping For further details see e g , Stewart et al , Genome Research 7 422-433 (1997)
  • Antibody binding studies may be carried out in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays Zola, Monoclonal
  • the tumor sample mav be fresh or frozen or may be embedded in paraffin and fixed with a preservative such as formalin, for example
  • a preservative such as formalin
  • Cell-based assays and animal models for tumors e g , cancers
  • the role of gene products identified herein in the development and pathology of tumor or cancer can be tested by using primary tumor cells or cells lines that have been identified to amplify the genes herein Such cells include, for example, the breast, colon and lung cancer cells and cell lines listed above
  • Suitable cells include, for example, stable tumor cells lines such as, the B 104-1-1 cell line (stable NIH-3T3 cell line transfected with the neu protooncogene) and ras-transfected NIH-3T3 cells, which can be transfected with the desired gene, and monitored for tumorogenic growth
  • stable tumor cells lines such as, the B 104-1-1 cell line (stable NIH-3T3 cell line transfected with the neu protooncogene) and ras-transfected NIH-3T3 cells, which can be transfected with the desired gene, and monitored for tumorogenic growth
  • Such transfected cell lines can then be used to test the ability > p poly- or monoclonal antibodies or antibody compositions to inhibit tumorogenic cell t ' wth by exerting cytostatic or cytotoxic activity on the growth of the transformed cells, or by mediating antibody- dependent cellular cytotoxicity (ADCC)
  • ADCC antibody- dependent cellular cytotoxicity
  • mice Animal models of tumors and cancers (e g breast cancer, colon cancer, prostate cancer, lung cancer, etc ) include both non-recombinant and recombinant (transgenic) animals
  • Non-recombinant animal models include, for example, rodent, e g , murine models
  • Such models can be generated by introducing tumor cells into syngeneic mice using standard techniques, e g subcutaneous injection, tail vein injection, spleen implantation, lntrape ⁇ toneal implantation, implantation under the renal capsule, or orthopin implantation, e g colon cancer cells implanted in colonic tissue (See, e g PCT publication No WO 97/33551 , published
  • the cells introduced into such animals can be derived from known tumor/cancer cell lines, such as, any of the above-listed tumor cell lines, and, for example, the B 104-1-1 cell line (stable NIH-3T3 cell line transfected with the neu protooncogene), ras-transfected NIH-3T3 cells, Caco-2 (ATCC HTB-37), a moderately well-differentiated grade II human colon adenocarcinoma cell line, HT-29 (ATCC HTB-38), or from tumors and cancers Samples of tumor or cancer cells can be obtained from patients undergoing surgery, using standard conditions, involving freezing and storing in liquid nitrogen (Karmah et al , Br J Cancer 48 689-696 [ 1983])
  • Tumor cells can be introduced into animals, such as nude mice, by a variety of procedures
  • the subcutaneous (s c ) space in mice is very suitable for tumor implantation
  • Tumors can be transplanted s c as solid blocks, as needle biopsies by use of a trochar, or as cell suspensions
  • tumor tissue fragments of suitable size are introduced into the s c space
  • Cell suspensions are freshly prepared from primary tumors or stable tumor cell lines, and injected subcutaneously Tumor cells ca lso be injected as subdermal implants In this location, the inoculum is deposited bet ⁇ - ;n the lower part of the dermal connective tissue and the s c tissue Boven and Winograd (1991), supra
  • Animal models of breast cancer can be generated, for example, by implanting rat neuroblastoma cells (from which the neu oncogen was initially isolated), or new-transformed NIH-3T3 cells into nude mice, essentially as described by Drebin et al PNAS USA 83 9129-9133 (1986)
  • animal models of colon cancer can be generated by passaging colon cancer cells in animals, e g nude mice, leading to the appearance of tumors in these animals
  • An orthotopic transplant model of human colon cancer in nude mice has been described, for example, by Wang et al , Cancer Research 54 4726-4728 (1994) and Too et al , Cancer Research 55 681-684 (1995) This model is based on the so- called “METAMOUSE” sold by AntiCancer, Inc (San Diego, California)
  • Tumors that arise in animals can be removed and cultured in vitro Cells from the in vitro cultures can then be passaged to animals Such tumors can serve as targets for further testing or drug screening Alternatively, the tumors resulting from the passage can be isolated and RNA from pre-passage cells and cells isolated after one or more rounds of passage analyzed for differential expression of genes of interest
  • Such passaging techniques can be performed with any known tumor or cancer cell lines
  • Meth A CMS4, CMS5, CMS21 , and WEHI 164 are chemically induced fibrosarcomas of BALB/c female mice (DeLeo et al , J Exp Med 146 720 [ 1977]), which provide a highly controllable model system for studying the anti-tumor activities of various agents (Palladino et al , J_ Immunol 138 4023-4032 [1987])
  • tumor cells are propagated in vitro in cell culture Prior to injection into the animals, the cell lines are washed and suspended in buffer, at a cell density of about 10x10
  • the Lewis lung (3LL) carcinoma of mice which is one of the most thoroughly studied experimental tumors, can be used as an investigational tumor model Efficacy in this tumor model has been correlated with beneficial effects in the treatment of human patients diagnosed with small cell carcinoma of the lung (SCCL)
  • SCCL small cell carcinoma of the lung
  • This tumor can be introduced in normal mice upon injection of tumor fragments from an affected mouse or of cells maintained in culture (Zupi et al , Br J Cancer 41 suppl 4 309 [1980]), and evidence indicates that tumors can be started from injection of even a single cell and that a very high proportion of infected tumor cells survive For further information about this tumor model see Zacharski, Hae ostasis 16 300-320 [1986])
  • One way of evaluating the efficacy of a test compound in an animal model is implanted tumor is to measure the size of the tumor before and after treatment Traditionally, the size of implanted tumors has been measured with a slide calmer in two or three dimensions The measure limited to two dimensions does not accurately reflect the size of the tumor, therefore, it is usually converted into the corresponding volume by using a mathematical formula However, the measurement of tumor size is very inaccurate The therapeutic effects of a drug candidate can be better described as treatment-induced growth delay and specific growth delay Another important variable in the description of tumor growth is the tumor volume doubling time Computer programs for the calculation and description of tumor growth are also available, such as the program reported by Rygaard and Spang-Thomsen, Proc 6th Int Workshop on Immune-Deficient Animals.
  • Recombinant (transgenic) animal models can be engineered by introducing the coding portion of the genes identified herein into the genome of animals of interest, using standard techniques for producing transgenic animals
  • Animals that can serve as a target for transgenic manipulation include, without limitation, mice, rats, rabbits, guinea pigs, sheep, goats, pigs, and non-human primates, e g baboons, chimpanzees and monkeys
  • Techniques known in the art to introduce a transgene into such animals include pronucleic micromjection (Hoppe and Wanger, U S Patent No 4,873,191), retrovirus-mediated gene transfer into germ lines (e g , Van der Putten et al , Proc Natl Acad Sci USA 82 6148-615 [1985]), gene targeting in embryonic stem cells (Thompson et al , Cell 56 313-321 [1989]), electroporation of embryos (Lo, Mol Cell Biol 3 1803-1814 [1983
  • transgenic animals include those that carry the transgene only in part of their cells ("mosaic animals”).
  • the transgene can be integrated either as a single transgene, or in concatamers, e g , head-to-head or head-to-tail tandems
  • Selective introduction of a transgene into a particular cell type is also possible by following, for example, the technique of Lasko et al Proc Natl Acad Sci USA 89 6232-636 ( 1992)
  • transgenic animals can be monitored by standard techniques For example, Southern blot analysis or PCR amplification can be used to verify the integration of the transgene The level of mRNA expression can then be analyzed using techniques such as in situ hybridization, Northern blot analysis, PCR, or lmmunocytochemistry The animals are further examined for signs of tumor or cancer development
  • "knock out" animals can be constructed which have a defectne or altered gene encoding an ADAM8 polypeptide identified herein, as a result of homologous recombination between the endogenous gene encoding the polypeptide and altered genomic DNA encoding the same polypeptide introduced into an embryonic cell of the animal
  • cDNA encoding an ADAM8 polypeptide can be used to clone genomic DNA encoding that polypeptide in accordance with established techniques
  • a portion of the genomic DNA encoding a particular ADAM8 polypeptide can be deleted or replaced with another gene, such as a gene encoding a selectable marker that can be used to monitor integration
  • several kilobases of unaltered flanking DNA are included in the vector [see e g , Thomas and Capecchi, Cell, 51 503 (1987) for a description of homologous recombination vectors]
  • the vector is introduced into an embryonic stem cell line (e g , Thomas and Capecchi, Cell, 51 50
  • Screening assays for drug candidates are designed to identify compounds that bind or complex with the polypeptides encoded by the genes identified herein, or otherwise interfere with the interaction of the encoded polypeptides with other cellular proteins
  • Such screening assays will include assays amenable to high-throughput screening of chemical libraries, making them particularly suitable for identifying small molecule drug candidates
  • Small molecules contemplated include synthetic organic or inorganic compounds, including peptides, preferably soluble peptides, (poly)pept ⁇ de- ⁇ mmunoglobuhn fusions, and, in particular, antibodies including, without limitation, poly- and monoclonal antibodies and antibody fragments, single- chain antibodies, anti-idiotypic antibodies, and chimeric or humanized versions of such antibodies or fragments, as well as human antibodies and antibody fragments
  • the assays can be performed in a variety of formats, including protein-protein-binding assays, biochemical-screening assays, immunoassays and cell based assays, which are well
  • the interaction is binding and the complex formed can be isolated or detected in the reaction mixture
  • the polypeptide encoded by the gene identified herein or the drug candidate is immobilized on a solid phase, e g , on a microtiter plate, by covalent or non-covalent attachments
  • Non-covalent attachment generally is accomplished by coating the solid surface with a solution of the polypeptide and drying Altern " vely, an immobilized antibody, e g a monoclonal antibody, specific for the polypeptide to be immobilized can be used to anchor it to a solid surface
  • the assay is performed by adding the non-immobilized component, which may be labeled by a detectable label, to the immobilized component, e g the coated surface containing the anchored component
  • the non-reacted components are removed, e g by washing, and complexes anchored on the solid surface are detected
  • a reaction mixture is prepared containing the product of the amplified gene and the intra- or extracellular component under conditions and for a time allowing for the interaction and binding of the two products
  • a placebo may be added to a third reaction mixture, to serve as positive control
  • the binding (complex formation) between the test compound and the intra- or extracellular component present in the mixture is monitored as described hereinabove
  • the formation of a complex in the control react ⁇ on(s) but not in the reaction mixture containing the test compound indicates that the test compound interferes with the interaction of the test compound and its reaction partner
  • compositions useful in the treatment of tumors associated with the amplification of the genes identified herein include, without limitation, antibodies, small organic and inorganic molecules, peptides, phosphopept > s, antisense and ribozyme molecules, triple helix molecules, etc that inhibit the ex » ss ⁇ on and/or activity of the target gene product
  • antisense RNA and RNA molecule act to directly block the translation of mRNA by hybridizing to targeted mRNA and preventing protein translation
  • oligodeoxyribonucleotides derived from the translation initiation site, e g between about -10 and +10 positions of the target gene nucleotide sequence, are preferred
  • Ribozymes are enzymatic RNA molecules capable of catalyzing the specific cleavage of RNA
  • Ribozymes act by sequence-specific hybridization to the complementary target RNA, followed by endonucleolytic cleavage Specific ribozyme cleavage sites within a potential RNA target can be identified by known techniques For further details see, e g , Rossi, Current Biology 4 469-471 (1994), and PCT publication No WO 97/33551 (published September 18, 1997)
  • Nucleic acid molecules in triple helix formation used to inhibit transcription should be single- stranded and composed of deoxynucleotides
  • the base composition of these oligonucleotides is designed such that it promotes triple helix formation via Hoogsteen base pairing rules, which generally require sizeable stretches of purines or pyrimidines on one strand of a duplex
  • Hoogsteen base pairing rules which generally require sizeable stretches of purines or pyrimidines on one strand of a duplex
  • Some of the most promising drug candidates according to the present invention are antibodies and antibody fragments that inhibit the production or the gene product of the amplified genes identified herein and/or reduce the activity of the gene products
  • the immunizing agent may include the ADAM8 polypeptide or a fusion protein thereof It may be useful to conjugate the immunizing agent to a protein known to be immunogenic in the mammal being immunized
  • immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor
  • adjuvants include Freund's complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate)
  • the ant ⁇ -ADAM8 antibodies may, alternatively, be monoclonal antibodies
  • Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256 495 (1975)
  • a hybridoma method a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent
  • the lymphocytes may be immunized in vitro
  • the immunizing agent will typically include the ADAM8 polypeptide, including fragments, or a fusion protein of such protein or a fragment thereof Generally, either peripheral blood lymphocytes ("PBLs") are used if cells of human origin are desired, or spleen cells or lymph noi' * cells are used if non- human mammalian sources are desired
  • PBLs peripheral blood lymphocytes
  • spleen cells or lymph noi' * cells are used if non- human mammalian sources are desired
  • the lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell [Goding, Monoclonal Antibodies Principles and Practice, Academic Press, (1986) pp 59-103]
  • Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin Usually, rat or mouse myeloma cell lines are employed
  • the hybridoma cells may be
  • Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium
  • More preferred immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, California and the American Type Culture Collection (ATCC), Manassas, Virginia Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies [Kozbor J Immunol . 133 3001 (1984), Brodeur et al , Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc , New York, (1987) pp 51-63]
  • the culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against ADAM8
  • the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitio binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA)
  • RIA radioimmunoassay
  • ELISA enzyme-linked immunoabsorbent assay
  • the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal Biochem .
  • the clones may be subcloned by limiting dilution procedures and grown by standard methods [Goding, supra] Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium Alternatively, the hybridoma cells may be grown in vivo as ascites in a mammal
  • the monoclonal antibodies secreted by the subclones may be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography
  • the monoclonal antibodies may also be made by recombinant DNA methods, such as those described in U S Patent No 4,816,567
  • DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e g , by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and hght chains of murine antibodies)
  • the hybridoma cells of the invention serve as a preferred source of such DNA
  • the DNA may be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells
  • the DNA also may be modified, for example, by substituting the coding sequence for human heavy ai.
  • non-immunoglobuhn polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody
  • the antibodies may be monovalent antibodies
  • Methods for preparing monovalent antibodies are well known in the art For example, one method involves recombinant expression of immunoglobulin light chain and modified heavy chain
  • the heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain crosslinking
  • the relevant cysteine residues are substituted with another amino acid residue or are deleted so as to prevent crosslinking
  • the ant ⁇ -ADAM8 antibodies may further comprise humanized antibodies or human antibodies
  • Humanized forms of non-human (e g murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab") or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non human immunoglobulin
  • Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity
  • CDR complementary determining region
  • donor antibody such as mouse, rat or rabbit having the desired specificity, affinity and capacity
  • corresponding non-human residues replace Fv framework residues of the human immunoglobulin Humanized antibodies may also comprise residues that are found neither
  • a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human
  • These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import" variable domain Humanization can be essentially performed following the method of Winter and co-workers [Jones et al , Nature 321 522-525 (1986), Riechmann et al , Nature 332 323-327 (1988), Verhoeyen et al , Science 239 1534-1536 (1988)]], by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody Accordingly, such "humanized” antibodies are chimeric antibodies (U S Patent No 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species
  • humanized antibodies are typically humai antibodies in which some CDR residues and possibly some FR
  • Human antibodies can also be produced using various techniques known in the art, including phage display libraries [Hoogenboom and Winter, J Mol Biol . 227 381 (1991), Marks et al , J Mol Biol 222 581 (1991)] The techniques of Cole et al and Boerner et al are also available for the preparation of human monoclonal antibodies (Cole et al , Monoclonal Antibodies and Cancer Therapy, Alan R Liss, p 77 (1985) and Boerner et al , J Immunol 147(1) 86-95 (1991)] Similarly, human antibodies can be made by introducing of human immunoglobulin loci into transgenic animals, e g , mice in which the endogenous immunoglobulin genes have been partially or completely inactivated Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire This approach is described, for example, in U S Patent Nos 5,545,807, 5,
  • the enzyme component of the immunoconjugate useful for ADEPT includes any enzyme capable of acting on a prodrug in such as way so as to convert it into its more active, cytotoxic form
  • Enzymes that are useful in the method of this invention include, but are not limited to, glycosidase, glucose oxidase, human lysosyme, human glucuronidase, alkaline phosphatase useful for converting phosphate-containing prodrugs into free drugs, arylsulfatase useful for converting sulfate-containing prodrugs into free drugs, cytosine deaminase useful for converting non-toxic 5-fluorocytos ⁇ ne into the anti-cancer drug 5-fluorouracil, proteases, such as serratia protease, thermolysin, subtilisin, carboxypeptidases (e g , carboxypeptidase G2 and carboxypeptidase A) and cathepsins (such as cathepsins B and L), that are useful for converting peptide-containing prodrugs into free drugs, D-alanylcarboxypeptidases, useful for converting prodrugs that contain D-a
  • Vamidase or penicillin G amidase useful for converting drugs de ⁇ vatized at their amine nitrogens with phenoxyacetyl or phenylacetyl groups, respectively, into free drugs
  • antibodies with enzymatic activity also known in the art as "abzymes” can be used to convert the prodrugs of the invention into free active drugs (see, e g , Massey, Nature 328 457-458 (1987))
  • Antibody-abzyme conjugates can be prepared as described herein for delivery of the abzyme to a tumor cell population
  • the enzymes of this invention can be covalently bound to the ant ⁇ -ADAM8 antibodies by techniques well known in the art such as the use of the heterobifunctional cross-linking agents discussed above Alternatively, fusion proteins comprising at least the antigen binding region of the antibody of the invention linked to at least a functionally active portion of an enzyme of the invention can be constructed using recombinant DNA techniques well known in the art (see, e g Neuberger et al , Nature 312 604-608 (1984)) 5 Bispecific Antibodies
  • Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens
  • one of the binding specificities is for the ADAM8
  • the other one is for any other antigen, and preferably for a cell-surface protein or receptor or receptor subunit
  • bispecific antibodies are known in the art Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/hght- chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature 305 537-539 [1983]) Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of ten different antibody molecules, of which only one has the correct bispecific structure The purification of the correct molecule is usually accomplished by affinity chromatography steps Similar procedures are disclosed in WO 93/08829, published 13 May 1993, and in Traunecker et al , EMBO J 10 3655-3659 (1991)
  • Antibody variable domains with the desired binding specificities can be fused to immunoglobulin constant domain sequences
  • the fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions It is preferred to have the first heavy-chain constant region (CHI ) containing the site necessary for light-chain binding present in at least one of the fusions DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin hght chain, are inserted into separate expression vectors, and are co- transfected into a suitable host organism
  • CHI first heavy-chain constant region
  • the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers that are recovered from recombinant cell culture
  • the preferred interface comprises at least a part of the CH3 region of an antibody constant domain
  • one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e g tyrosine or tryptophan)
  • Compensatory "cavities" of identical or similar size to the large side cha ⁇ n(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e g alanine or threonine)
  • This provides a mechanism for increasing the yield of the heterodimer over other unwanted end products such as homodimers
  • Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e g F(ab') bispecific antibodies) Techniques for generating bispecific antibodies from antibody fragments have been described in the literature For example, bispecific antibodies can be prepared can be
  • bispecific antibodies have been produced using leucine zippers Kostelny et al , J Immunol 148(5) 1547-1553 (1992)
  • the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion
  • the antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers
  • This method can also be utilized for the production of antibody homodimers
  • the "diabody” technology described by Holl ger et al , Proc Natl Acad Sci USA 90 6444-6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments
  • the fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker that is too short to allow pairing between the two domains on the same chain Accordingly, the VH and VL domain
  • Antibodies with more than two valencies are contemplated
  • trispecific antibodies can be prepared Tutt et al , J Immunol 147 60 ( 1991 )
  • bispecific antibodies may bind to two different epitopes on a given polypeptide herein Alternatively, an anti-polypeptide arm may be combined with an arm which binds to a triggering molecule on a leukocyte such as a T cell receptor molecule (e g , CD2, CD3, CD28, or B7), or Fc receptors for IgG (Fc R), such as Fc Rl (CD64), Fc RII (CD32) and Fc RIII (CD16) so as to focus cellular defense mechanisms to the cell expressing the particular polypeptide
  • Bispecific antibodies may also be used to localize cytotoxic agents to cells that express a particular polypeptide
  • These antibodies possess a polypeptide-binding arm and an arm that binds a cytotoxic agent or a radionuc de chelator, such as EOTUBE, DPTA, DOTA, or TETA
  • TF tissue factor
  • Heteroconiugate antibodies are composed of two covalently joined antibodies Such antibodies have, for example, been proposed to target immune system cells to unwanted cells [U S Patent No 4,676,980], and for treatment of HIV infection [WO 91/00360, WO 92/200373, EP 03089] It is contemplated that the antibodies may be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents For example, immunotoxins may be constructed using a disulfide exchange reaction or by forming a thioether bond Examples of suitable reagents for this pu ⁇ ose include lmmothiolate and methyl-4-mercaptobuty ⁇ m ⁇ date and those disclosed, for example, in U S Patent No 4,676,980
  • the homodime ⁇ c antibody thus generated may have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC) See Caron et al , J_ Exp Med 176 1191-1 195 (1992) and Shopes, J Immunol 148 2918-2922 (1992) Homodime ⁇ c antibodies with enhanced anti-tumor activity may also be prepared using heterobifunctional cross-linkers as described in Wolff et al Cancer Research 53 2560-2565 (1993) Alternatively, an antibody can be engineered which has dual Fc regions and may thereby have enhanced complement lysis and ADCC capabilities See Stevenson et al , Anti-Cancer Drug Design 3 219-230 (1989)
  • the invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e g , an enzymatically active toxin of bacterial, fungal, plant or animal origin, or fragments thereof, or a small molecule toxin), or a radioactive isotope (l e , a radioconjugate)
  • a cytotoxic agent such as a chemotherapeutic agent, toxin (e g , an enzymatically active toxin of bacterial, fungal, plant or animal origin, or fragments thereof, or a small molecule toxin)
  • toxin e g , an enzymatically active toxin of bacterial, fungal, plant or animal origin, or fragments thereof, or a small molecule toxin
  • l e a radioactive isotope
  • Enzymatically active protein toxins and fragments thereof which can be used include diphtheria A chain, nonbindmg active fragments of diphtheria toxin, cholera toxin, botuhnus toxin, exotoxin A chain (from Pseudomonas aeruginosa), ⁇ cin A chain, ab ⁇ n A chain, modeccin A chain, alpha-sarcin, Aleurites fordu proteins, dianthin proteins, Ph ⁇ tolaca amencana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaona ⁇ a officinahs inhibitor, gelomn, sapo ⁇ n, mitogel n, rest ⁇ ctocin, phenomycin, enomycin and the t ⁇ cothecenes
  • Small molecule toxins include, for example, ca cheamicins (US
  • Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein coupling agents such as N-succ ⁇ n ⁇ m ⁇ dyl-3-(2-py ⁇ dyld ⁇ th ⁇ ol) propionate (SPDP), lminothiolane (IT), bifunctional derivatives of lmidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis (p- azidobenzoyl) hexanediamine), bis diazonium derivatives (such as b ⁇ s-(p-d ⁇ azon ⁇ umbenzoyl)- ethylenediamine), dnsocyanates (such as tolyene 2,6-dnsocyanate), and bis-active fluorine compounds (such as l,5-d ⁇ fluoro-2,4-d ⁇ n ⁇ trobenzene)
  • the antibody may be conjugated to a "receptor” (such streptavidin) for utilization in tumor pretargeting wherein the antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a "ligand” (e g , avidin) which is conjugated to a cytotoxic agent (e g , a radionucleotide) 9 Immunohposomes
  • the antibodies disclosed herein may also be formulated as immunohposomes
  • Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al , Proc Natl Acad Sci USA 82 3688 (1985), Hwang et al , Proc Natl Acad Sci USA 77 4030 (1980), and U S latent Nos 4,485,045 and 4,544,545 Liposomes with enhanced circulation time are disclosed in U S Patent No 5,013,556
  • Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcho ne, cholesterol and PEG-de ⁇ vatized phosphatidylethanolamine (PEG-PE) Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter Fab' fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al , J Biol Chem 257 286-288 (1982) via a disulfide interchange reaction A chemotherapeutic agent (such as Doxorubicin) is optionally contained within the liposome See Gabizon et al , J National Cancer Inst 81(19) 1484 (1989) 10 Pharmaceutical Compositions
  • Antibodies specifically binding the product of an amplified gene identified herein, as well as other molecules identified by the screening assays disclosed hereinbefore, can be administered for the treatment of tumors, including cancers, in the form of pharmaceutical compositions
  • peptide molecules can be designed which retain the ability to bind the target protein sequence
  • Such peptides can be synthesized chemically and/or produced by recombinant DNA technology (see, e g Marasco et al , Proc Natl Acad Sci USA 90 7889- 7893 [ 1993])
  • Therapeutic formulations of the antibody are prepared for storage by mixing the antibody having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences, 16th edition, Osol, A Ed [1980]), in the form of lyophi zed formulations or aqueous solutions
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids, antioxidants including ascorbic acid and methionine, preservatives (such as octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethomum chloride, phenol, butyl or benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3- pentanol, and m
  • Non-antibody compounds identified by the screening assays of the present invention can be formulated in an analogous manner, using standard techniques well known in the art
  • composition herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other
  • composition m y comprise a cytotoxic agent, cytokine or growth inhibitory agent
  • Such molecules are suitably present in combination in amounts that are effective for the pu ⁇ ose intended
  • the active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin- microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions Such techniques are disclosed in Remington's Pharmaceutical Sciences, 16th edition, Osol, A Ed (1980)
  • the formulations to be used for in vivo administration must be sterile This is readily accomplished by filtration through sterile filtration membranes
  • sustained-release preparations may be prepared Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e g , films or microcapsules
  • sustained-release matrices include polyesters, hydrogels (for example, poly (2-hydroxyethyl-methacrylate), or poly(vmylalcohol)), polylactides (U S Pat No 3,773,919), copolymers of L-glutamic acid and ethyl L glutamate, non-degradable ethylene vinyl acetate, degradable lactic acid glycohc acid copolymers such as the
  • LUPRON DEPOT TM injectable microspheres composed of lactic acid-glycohc acid copolymer and leuprolide acetate
  • poly-D poly-D (-)-3-hydroxybuty ⁇ c acid
  • polymers such as ethylene-vinyl acetate and lactic acid-glycohc acid enable release of molecules for over 100 days
  • certain hydrogels release proteins for shorter time periods
  • encapsulated antibodies remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37°C, resulting in a loss of biological activity and possible changes in immunogenicity Rational strategies can be devised for stabilization depending on the mechanism involved For example, if the aggregation mechanism is discovered to be intermolecular S-S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophi zing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions
  • the antibodies and other anti-tumor compounds of the present invention may be used to treat various conditions, including those characterized by overexpression and/or activation of the amplified genes identified herein
  • Exemplary conditions or disorders to be treated with such antibodies and other compounds include benign or malignant tumors (e g , renal, liver, kidney, bladder, breast, gastric, ovarian, colorectal, prostate, pancreatic, ling, vulval, thyroid, hepatic carcinomas, sarcomas, ghoblastomas, and various head and neck tumors), leukemias and lymphoid malignancies, other disorders such as neuronal, g al, astrocytal, hypothalamic and other glandular, macrophagal, epithelial, stromal and blastocoehc disorders, and inflammatory, angiogemc and lmmunologic disorders
  • the anti-tumor agents of the present invention are administered to a mammal, preferably a human, in accord with known methods, such as intravenous administration as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, mtrathecal, oral, topical, or inhalation routes
  • Intravenous administration of the antibody is , r ⁇ ferred
  • chemotherapeutic agents may be administered to the patient Preparation and dosing schedules for such chemotherapeutic agents may be used according to manufacturers' instructions or as determined empirically by the skilled practitioner Preparation and dosing schedules for such chemotherapy are also described in Chemotherapy Service Ed , M C Perry, Williams & Wilkins, Baltimore, MD (1992)
  • the chemotherapeutic agent may precede, or follow administration of the anti-tumor agent, e g , antibody, or may be given simultaneously therewith
  • the antibody may be combined with an anti-oestrogen compound such as tamoxifen or an anti-progesterone such as onapristone (see, EP 616812) in dosages known for such molecules
  • VEGF vascular endothe al factor
  • two or more antibodies binding the same or two or more different antigens disclosed herein may be co-administered to the patient
  • the antibodies herein are co-administered with a growth inhibitory agent
  • the growth inhibitory agent may be administered first, followed by an antibody of the present invention
  • simultaneous administration or administration of the antibody of the present invention first is also contemplated Suitable dosages for the growth inhibitory agent are those presently used and may be lowered due to the combined action (synergy) of the growth inhibitory agent and the antibody herein
  • an anti-tumor agent e g , an antibody herein will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the agent is administered for preventive or therapeutic pu ⁇ oses, previous therapy, the patient's clinical history and response to the agent, and the discretion of the attending physician
  • the agent is suitably administered to the patient at one time or over a series of treatments
  • ⁇ g/kg to 15 mg/kg (e g , 0 l-20mg/kg) of antibody is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion
  • a typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above
  • the treatment is sustained until a desired suppression of disease symptoms occurs
  • other dosage regimens may be useful The progress of this therapy is easily monitored by conventional techniques and assays
  • an agent that inhibits the activity of ADAM8 can be used to diagnose or treat various diseases of inflammation Initiating, exacerbating, or ongoing events in diseases of both acute and chronic inflammation involve the trafficking and migration of various populations of leukocytes, for example monocytes, into and out of tissue resulting in tissue damage Inhibiting the migration, trafficking, and tissue destruction by leukocytes by inhibiting ADAM8 mitigates the inflammatory process Diseases such as psoriasis, dermatitis, inflammatory bowel disease, arthritis, multiple sclerosis and chronic obstructive pulmonary diseases are examples of diseases, which can be treated, with an inhibitor of ADAM8 Additional examples of such diseases include T cell inflammatory responses such as inflammatory skin diseases including responses associated with inflammatory bowel disease (such as Crohn's disease and ulcerative colitis), adult respiratory distress syndrome, meningitis, encephalitis, uveitis, allergic conditions such as eczema and asthma, conditions involving infiltration of T cells and chronic inflammatory responses, skin hypersensitivity reactions
  • an article of manufacture containing materials useful for the diagnosis or treatment of the disorders described above comprises a container and a label Suitable containers include, for example, bottles, vials, syringes, and test tubes
  • the containers may be formed from a variety of materials such as glass or plastic
  • the container holds a composition which is effective for diagnosing or treating the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle)
  • the active agent in the composition is usually an anti-tumor agent that is capable of interfering with the activity of a gene product identified herein, e g , an antibody
  • the label on, or associated with, the container indicates that the composition is used for diagnosing or treating the condition of choice
  • the article of manufacture may further comprise a second container comprising a pharmaceutically-acceptable buffer, such as phosphate-buffered saline, Ringer's solution and dextrose solution
  • tumor diagnostics or prognostics While cell surface proteins, such as growth receptors overexpressed in certain tumors are excellent targets for drug candidates or tumor (e g , cancer) treatment, the same proteins along with secreted proteins encoded by the genes amplified in tumor cells find additional use in the diagnosis and prognosis of tumors.
  • antibodies directed against the proteins products of genes amplified in tumor cells can be used as tumor diagnostics or prognostics
  • antibodies can be used to qualitatively or quantitatively detect the expression of proteins encoded by the amplified genes ("marker gene products")
  • the antibody preferably is equipped with a detectable, e g , fluorescent label, and binding can be monitored by light microscopy, flow cytometry, fluo ⁇ metry, or other techniques known in the art These techniques are particularly suitable, if the amplified gene encodes a cell surface protein, e g , a growth factor Such binding assays are performed essentially as described in section 5 above
  • In situ detection of antibody binding to the marker gene products can be performed, for example, by immunofluorescence or immunoelectron microscopy
  • a histological specimen is removed from the patient, and a labeled antibody is applied to it, preferably by overlaying the antibody on a biological sample
  • This procedure also allows for determining the distribution of the marker gene product in the tissue examined
  • ADAM8 mRNA is present at higher levels in cells of certain breast, lung, and colon cancers
  • An increase in the level of mRNA is indicative of an increase in the amount of the ADAM8 protein expressed on the surface of cells
  • a protein that is overexpressed in certain cancers such as colon, breast, lung and other cancers is a useful target for therapeutic intervention
  • Therapeutic agents may take the form of antagonists of ADAM8 polypeptide, for example, mu ⁇ ne-human chimeric, humanized or human antibodies against an ADAM8-polypept ⁇ de
  • RNA was also isolated from normal healthy tissue removed from nearby each of the tumors
  • Real-time quantitative PCR (ABI P ⁇ zm 7700 Sequence Detection System TM, Perkin Elmer, Applied Biosystems Division, Foster City, CA) was used to find differences in the mRNA levels in the tumor tissue versus the normal tissue
  • the results were used to determine whether the DNA encoding ADAM8 is over-represented in any of the primary lung, colon or breast cancers that were screened
  • the results of the Taqman analysis are reported in delta ( ⁇ ) Ct units One unit corresponds to 1 PCR cycle of approximately a 2-fold increase relative to the normal tissue, 2 units corresponds to a 4-fold, 3 units to an 8-fold increase and so on Quantitation was obtained using primers and a Taqman TM fluorescent probe derived from the ADAM8-encod ⁇ ng
  • ADAM8 3-1817T (32mer) AGGACTTACACGTTTACAGATCCAGCAACTGC (SEQ ID NO 7) reverse primer ADAM8 3- 1881 R ( 19mer) GTTGCACACCCCATGGTTG (SEQ ID NO 8)
  • the 5' nuclease assay reaction is a fluorescent PCR-based technique that makes use of the 5' exonuclease activity of Taq DNA polymerase enzyme to monitor amplification in real time
  • Two oligonucleotide primers are used to generate an amphcon typical of a PCR reaction
  • a third oligonucleotide, or probe is designed to detect nucleotide sequence located between the two PCR primers
  • the probe is non-extendible by Taq DNA polymerase enzyme, and is labeled with a reporter fluorescent dye and a quencher fluorescent dye Any laser-induced emission from the reporter dye is quenched by the quenching dye when the two dyes are located close together as they are on the probe
  • the Taq DNA polymerase enzyme cleaves the probe in a template-dependent manner
  • the resultant probe fragments disassociate in solution, and signal from the released reporter dye is free from the quenching effect of the second fluorophore
  • One molecule of reporter dye
  • the 5' nuclease procedure is run on a real-time quantitative PCR device such as the ABI Prism 7700TM Sequence Detection
  • a real-time quantitative PCR device such as the ABI Prism 7700TM Sequence Detection
  • the system consists of a thermocycler, laser, charge-coupled device (CCD) camera and computer
  • the system amplifies samples in a 96-well format on a thermocycler During amplification, laser-induced fluorescent signal is collected in real-time through fiber optics cables for all 96 wells, and detected at the CCD
  • the system includes software for running the instrument and for analyzing the data
  • Ct 5' Nuclease assay data are initially expressed as Ct, or the threshold cycle This is defined as the cycle at which the reporter signal accumulates above the background level of fluorescence
  • the Ct values are used as quantitative measurement of the relative number of starting comes of a particular target sequence in a nucleic acid sample when comparing cancer DNA results to normal human DNA results RNA Preparation and Quantitation
  • RNA was prepared from thinly sliced section of frozen matched human tumor and normal tissue The isolation was preformed using purification kit, including buffers, columns, and other reagents from Qiagen RNeasy mini kits according to the manufacturer's instructions and the description below
  • RNeasy mini spin column sitting in a 2 ml collection tube was loaded with 700 ⁇ l of sample The column was centrifuged for 15 seconds at least 8000 x g If the volume of the sample exceeded 700 ⁇ l , then successive aliquots were loaded onto the RNeasy mini column and it was centrifuged again as above After each centrifuge spin the flow-through was discarded This same column was loaded with 700 ⁇ l of buffer
  • the ADAM8 primer/probe sets were used in Taqman analysis to amplify the ADAM8 mRNA in the total RNA samples prepared from human breast, lung and colon tumors and compared with normal tissue sections taken from nearby the tumors The total RNA was diluted to 2.5ng/ ⁇ l in H20 The samples were tested in duplicate or triplicate and included on the plate were reactions with GAPDH and/or b-actin Taqman
  • TM primers and probe no template controls, and no reverse transcriptase controls
  • the reactions were prepared as follows. lO ⁇ l 25mM MgC12 (Perkin Elmer reagent)
  • RNA samples were run in TaqmanTM experiments, and then the diluted RNA samples were again quantitated using the RiboGreen RNA Quantitation Kit (Molecular Probes R-l 1490) following manufacturer's directions. Plates were read on a fluorescent plate reader (SepctroMax Gemini, Molecular Devices). Samples were diluted using the spectrophotometric readings to 2.5ng/ul. After TaqmanTM experiments were run, Ct values were adjusted for any differences in RNA concentration as determined by the fluorescent quantitation method.
  • Colon tumor margin 6.8X (rerun) Colon tumor: 7.4X Colon tumor: 3.5X Breast tumor: 4.8X
  • EXAMPLE 2 Gene Amplification This example shows that the ADAM8-encoding genes are amplified in the genome of certain human lung, colon and/or breast cancers and/or cell lines. Amplification is associated with overexpression of the gene product, indicating that the polypeptides are useful targets for therapeutic intervention in certain cancers such as colon, lung, breast and other cancers.
  • Therapeutic agents may take the form of antagonists of ADAM8 polypeptide, for example, murine-human chimeric, humanized or human antibodies against an ADAM8 polypeptide.
  • the starting material for the screen was genomic DNA isolated from a variety of cancers.
  • the DNA is quantitated precisely, e.g., fluorometrically.
  • DNA was isolated from the cells of ten normal healthy individuals, which was pooled and used as assay controls for the gene copy in healthy individuals (not shown)
  • the 5 nuclease assay for example, TaqManTM
  • real-time quantitative PCR for example, ABI P ⁇ zm 7700 Sequence Detection SystemTM (Perkin Elmer, Applied Biosystems Division, Foster City, CA)
  • the results were used to determine whether the DNA encoding ADAM8 is over-represented in any of the primary lung or colon cancers or cancer cell lines or breast cancer cell lines that were screened
  • the primary lung cancers were obtained from individuals with tumors of the type and stage as indicated in Table 2 An explanation of the abbreviations used for the designation of the primary tumors listed in Table 2 and the primary tumors and cell lines referred to throughout this example
  • the 5' nuclease assay reaction is a fluorescent PCR-based technique that makes use of the 5' exonuclease activity of Taq DNA polymerase enzyme to monitor amplification in real time
  • Two oligonucleotide primers are used to generate an amplicon typical of a PCR reaction
  • a third oligonucleotide, or probe is designed to detec f nucleotide sequence located between the two FCR primers
  • the probe is non-extendible by Taq DNA polymerase enzyme, and is labeled with a reporter fluorescent dye and a quencher fluorescent dye Any laser-induced emission from the reporter dye is quenched by the quenching dye when the two dyes are located close together as they are on the probe Du ⁇ ng the amplification reaction, the Taq DNA polymerase enzyme cleaves the probe in a template-dependent manner The resultant probe fragments disassociate in solution, and signal from the released reporter dye is free from the quenching effect of the second fluorophore
  • the 5' nuclease procedure is run on a real-time quantitative PCR device such as the ABI Prism 7700TM Sequence Detection
  • the system consists of a thermocycler, laser, charge-coupled device (CCD) camera and computer
  • the system amplifies samples in a 96-well format on a thermocycler During amplification, laser-induced fluorescent signal is collected in real-time through fiber optics cables for all 96 wells, and detected at the CCD
  • the system includes software for running the instrument and for analyzing the data 5' Nuclease assay data are initially expressed as Ct, or the threshold cycle This is defined as the cycle at which the reporter signal accumulates above the background level of fluorescence
  • the Ct values are used as quantitative measurement of the relative number of starting copies of a particular target sequence in a nucleic acid sample when comparing cancer DNA results to normal human DNA results
  • Table 4 describes the stage, T stage and N stage of various primary tumors that were used to screen the ADAM8 compounds of the invention.
  • the primary lung cancers were obtained from individuals with tumors of the type and stage as indicated in Table 4. An explanation of the abbreviations used for the designation of the primary tumors listed in Table 4 and the primary tumors and cell lines referred to throughout this example has been given hereinbefore.
  • DNA was prepared from cultured cell lines, primary tumors, normal human blood The isolation was performed using purification kit, buffer set and protease and all from Quiagen, according to the manufacturer's instructions and the description below Cell culture lysis
  • #19155 was diluted into 6 25 ml cold ddH 0 to a final concentration of 20 mg/ml and equilibrated at 4°C 10 mL of G2 Buffer was prepared by diluting Qiagen RNAse A stock (100 mg/ml) to a final concentration of 200 ⁇ g/ml
  • Buffer Cl (10 mL, 4°C) and ddH20 (40 mL, 4°C) were then added to the 10 mL of cell suspension, mixed by inverting and incubated on ice for 10 minutes
  • the cell nuclei were pelleted by cent ⁇ fuging in a Beckman swinging bucket rotor at 2500 ⁇ m at 4°C for 15 minutes The supernatant was discarded and the nuclei were suspended with a vortex into 2 mL Buffer Cl (at 4°C) and 6 mL ddH 0, followed by a second 4°C centrifugation at 2500 ⁇ m for 15 minutes
  • the nuclei were then resuspended into the residual buffer using 200 ⁇ l per tip G2 buffer (10 ml) was added to the suspended nuclei while gentle vortexing was applied Upon completion of buffer addition, vigorous vortexing was applied for 30 seconds Quiagen protease (200 ⁇ l, prepared as indicated above) was added and incubated at 50°C for
  • Tumor samples were weighed and placed into 50 ml conical tubes and held on ice Processing was limited to no more than 250 mg tissue per preparation (1 tip/preparation)
  • the protease solution was freshly prepared by diluting into 6 25 ml cold ddH 2 0 to a final concentration of 20 mg/ml and stored at 4°C G2 buffer (20 ml) was prepared by diluting DNAse A to a final concentration of 200 mg/ml (from 100 mg/ml stock)
  • the tumor tissue was homogenated in 19 ml G2 buffer for 60 seconds using the large tip of the polytron in a laminar-flow TC hood to order to avoid inhalation of aerosols, and held at room temperature Between samples, the polytron was cleaned by spinning at 2 x 30 seconds each in 2L ddH 0, followed by G2 buffer (50 ml) If tissue was still present on the generator tip, the apparatus was disassembled and cleaned
  • DNA levels in each tube were quantified by standard A260, A280 spectrophotometry on a 1 20 dilution (5 ⁇ l DNA + 95 ⁇ l ddH 2 0) using the 0 1 ml quartz cuvettes in the Beckman DU640 spectrophotometer A260/A280 ratios were in the range of 1 8-1 9
  • Each DNA samples was then diluted further to approximately 200 ng/ml in TE (pH 8 5) If the original material was highly concentrated (about 700 ng/ ⁇ l), the mate ⁇ al was placed at 50°C for several hours until resuspended
  • Fluoromet ⁇ c DNA quantitation was then performed on the diluted material (20-600 ng/ml) using the manufacturer's guidelines as modified below This was accomplished by allowing a Hoeffer DyNA Quant 200 fluorometer to warm-up for about 15 minutes
  • the Hoechst dye working solution (#H33258, 10 ⁇ l, prepared within 12 hours of use) was diluted into 100 ml 1 x TNE buffer A 2 ml cuvette was filled with the fluorometer solution, placed into the machine, and the machine was zeroed pGEM 3Zf(+) (2 ⁇ l, lot #360851026) was added to 2 ml of fluorometer solution and calibrated at 200 units An additional 2 ⁇ l of pGEM 3Zf(+) DNA was then tested and the reading confirmed at 400 +/- 10 units Each sample was then read at least in triplicate When 3 samples were found to be within 10% of each other, their average was taken and this value was used as the quantification value The fluorometrically determined concentration was then used to dilute
  • the ADAM8 gene was screened in the following primary tumors and the resulting Ct values are reported in Table 5 Table 5
  • ADAM8 The Ct values for a variety of human tumors are reported in Table 5 A Ct of >1 was typically used as the threshold value for amplification scoring, as this represents a doubling of gene copy Table 5 indicates that significant amplification of ADAM8 occurred in primary lung tumors LT1 1 , LT13, LT15, LT17, and LT18 The average Ct values for these primary lung tumor hits are 1 12, 1 43, 1 68, 1 59, and
  • Table 5 also indicates that significant amplification of ADAM8 occurred in primary colon tumors CTl , CT2, CT4, CT5, CT6, CT10, CTl 1 , and CT12
  • the average Ct values for these primary colon tumor hits are 1 5, 1 38, 1 75, 2 32, 1 14, 1 32, 2 76, and 1 2, which represents approximately a 2 83,
  • ADAM8 amplification of ADAM8 occurs in various tumors, it is likely associated with tumor formation and /or growth As a result, antagonists (eg antibodies) directed against ADAM8 are useful in cancer therapy
  • Example 3 Isolation of cDNA Clones Encoding ADAM8 Total spleen RNA was purchased from Clonetech (#64034-1) Reagents for synthesizing cDNA were purchased from GibcoBRL (Superscript TM Preamplification System #18089-011) The RNA was used to synthesize oligo dT primed cDNA according to the manufacturer's directions This cDNA (5 ⁇ g) was used in a PCR reaction with ADAM8 specific primers to generate an approximately 880bp DNA fragment from the 5' end of the ADAM8 mRNA. The specific primers used are as follows: h8-9FBAM forward primer (29 mer)
  • This PCR amplified fragment was cleaned with the Concert TM PCR purification kit (Gibco BRL), digested with restriction enzymes BamHI and Sail (New England Biolabs) according to the manufacturer's instructions and the 880bp fragment isolated on a 1 % Agarose gel (FMC Corporation) A BamHI site was created in the forward PCR primer while a Sail site occurs in the ADAM8 cDNA sequence The resulting fragment was cleaned using the Concert TM Gel Purification Kit (GibcoBRL Corporation) This fragment was ligated (New England Biolabs ligase) into an expression vector called pRK5tkneo, also digested at BamHI and Sail sites in the multiple cloning site and purified in similar fashion as described above Transformation was done with Stratagene Supercompetent XL1 Blue according to manufacturer's directions The resulting colonies were grown in 5 ml cultures overnight and small preparations of DNA were made with a Qiagen miniprep kit A variety of restriction digests,
  • the primer used referred to as h8-3109R, has the sequence 5' AGCTGACTCTCCCACATAGCCC 3' (SEQ ID NO 1 1)
  • the cDNA was made according to manufacturer's directions using approximately 5ug of total RNA and an incuabation temperature for the reverse transcriptase of 60 degrees C PCR reactions were performed with Platinum Taq DNA Polymerase High Fidelity enzyme (GibcoBRL) using a final concentration of 2mM MgS04
  • the reverse primer was the same as that listed above for the cDNA reaction and the forward primer, referred to as h8-9Fbam, has the sequence
  • PCR amplification cycling paramers were as follows 95 degrees C for 2 minutes as an initial denaturation step, 95 degrees C for 30 seconds, 55 degrees C for 30 seconds, 68 degrees C for 3 minutes for 40 cycles, 4 degrees C soak to hold reactions until retreived
  • the expected size of the PCR band was approximately 3100bp and this was confirmed by gel electrophoresis
  • the PCR reaction was digested with BamHI and Hindlll restriction enzymes and the resulting mixture separated by agarose gel electrophoresis A band of approximately 3100bp was extracted from the gel and ligated into a plasmid vector similarly digested with BamHI and Hindlll
  • the resulting clones were sequenced and found to contain several sequence differences relative to the published sequence for ADAM8 These clones may represent ADAM8 variants Two of these resulted in amino acid changes, Arg to Gly at amino acid number 171 and Lys to Arg at amino acid number 223 They were restored to the pubhsed sequence by digesting out a 346bp SanDI/Sall fragment and replacing it with a similar fragment from the 880bp 5' end ADAM8 clone, which contained the published sequence at these loci, using standard molecular biology methods Two other differences were found in both the full-length clone and the 880bp 5' end clone 1) nucleotide number 249 (as
  • In situ hybridization is a powerful and versatile technique for the detection and localization of nucleic acid sequences within cell or tissue preparations It may be useful, for example, to identify sites of gene expression, analyze the tissue distribution of transcription, identify and localize viral infection, follow changes in specific mRNA synthesis and aid in chromosome mapping
  • In situ hybridization was performed following an optimized version of the protocol by Lu and
  • NTP mix (2 5 mM 10 ⁇ l, each of 10 mM GTP, CTP & ATP + 10 ⁇ l H 2 0)
  • the probe was run on a TBE/urea gel 1-3 ⁇ l of the probe or 5 ⁇ 1 of RNA Mrk III were added to 3 ⁇ l of loading buffer After heating on a 37°C heat block for three minutes, the probes were immediately placed on ice The wells of gel were flushed, the samples loaded, and run at 180 250 volts for 45 minutes
  • the gel was wrapped in saran wrap and exposed to XAR film with an intensifying screen in -70°C freezer one hour to overnight
  • Hybridization 1 0 x 10 cpm probe and 1 0 ⁇ l tRNA (50 mg/ml stock) per slide were heated at
  • the probe was amplified using the Advantage cDNA polymerase mix from Clonetech (8417-1) according to the manufacturer's directions Cycle conditions were as follows 10 cycles of 94° C 30 seconds 68° C 30 seconds 72° C 1 minutes
  • ADAM 8 was found in the malignant epithelium of lung squamous cell carcinomas, in lung adenocarcinomas, in colon carcinomas, in prostate carcinomas, in breast carcinomas and in inflammatory tissues, etc Expression was present in malignant cells and in some tumors was present in the stroma immediately adjacent to the tumor There was some weak patchy expression in various normal tissues Normal tissues
  • Fetal human skin, epidermis weak positive expression Fetal human thymus low level diffuse expression in thymic medulla
  • Adrenal cortex (H97-621 and H99-346) Positive expression in adrenal epithelial cortical epithelial cells (On a C nomic array normal adrenal cortex was negative to weak positive)
  • Tissues that were negative include prostate, liver, pancreas, normal lung (2 sections), placenta, bile duct, and kidney Neoplasms
  • This squamous cell carcinoma has areas of necrosis and fibroplasia and adjacent non-neoplastic lung, there is no significant expression (98/14964)
  • HP001261 carcinoma moderate positive expression in neoplastic cells, low level expression in some fibrous stroma tissue
  • + 1 expression diffusely in mononuclear cells (monocytes) in mantle zone and paracortex areas of tonsil There is low level (+1) expression in the overlying oral mucosa epithelium
  • tonsil crypt epithelium cells epithelium cells (epithelial cells and some infiltrating mononuclear cells), +1 expression cells in germinal centers and in discrete cells which are most likely dendritic cells, +1 expression diffusely in mononuclear cells (monocytes) in mantle zone and paracortex areas of tonsil There is low level (+1) expression in the overlying oral mucosa epithelium
  • tonsil crypt epithelium cells epithelium cells (epithelial cells and some infiltrating mononuclear cells), +1 expression cells in germinal centers and in discrete cells which are most likely dendritic cells, +1 expression diffusely in mononuclear cells (monocytes) in marginal zone and paracortex areas of tonsil Spleen
  • ADAM8 as a hybridization probe
  • the following method describes use of a nucleotide sequence encoding an ADAM8 polypeptide as a hybridization probe
  • DNA comprising the coding sequence of a full-length or mature ADAM8 polypeptide as disclosed herein and/or fragments thereof may be employed as a probe to screen for homologous DNAs (such as those encoding naturally-occumng variants of ADAM8) in human tissue cDNA libraries or human tissue genomic libraries
  • Hybridization and washing of filters containing either library DNAs is performed under the following high stringency conditions
  • Hybridization of radiolabeled ADAM8-de ⁇ ved probe to the filters is performed in a solution of 50% formamide, 5x SSC, 0 1 % SDS, 0 1 % sodium pyrophosphate, 50 mM sodium phosphate pH 6 8 2x Denhardt solution, and 10% dextran sulfate at 42°C for 20 hours Washing of the filters is performed in an aqueous solution of 0 lx SSC and 0 1 % SDS at 42°C
  • DNAs having a desired sequence identity with the DNA encoding full-length native sequence ADAM8 can then be identified using standard techniques known in the art
  • EXAMPLE 6 Expression of "ADAM8" Polypeptides in E coh
  • This example illustrates preparation of an unglycosylated form of ADAM8 by recombinant expression in E coh
  • the DNA sequence encoding the ADAM8 polypeptide of interest is initially amplified using selected PCR primers
  • the primers should contain restriction enzyme sites which correspond to the restriction enzyme sites on the selected expression vector
  • a variety of expression vectors may be employed
  • An example of a suitable vector is pBR322 (derived from E coh, see Bolivar et al , Gene.
  • the vector is digested with restriction enzyme and dephosphorylated
  • the PCR amplified sequences are then ligated into the vector
  • the vector will preferably include sequences which encode for an antibiotic resistance gene, a trp promoter, a polyhis leader (including the first six STII codons, polyhis sequence, and enterokinase cleavage site), the ADAM8 coding region, lambda transcriptional terminator, and an argU gene
  • the ligation mixture is then used to transform a selected E coli strain using the methods described in Sambrook et al , supra Transformants are identified by their ability to grow on LB plates and antibiotic resistant colonies are then selected Plasmid DNA can be isolated and confirmed by restriction analysis and DNA sequencing
  • Selected clones can be grown overnight in liquid culture medium such as LB broth supplemented with antibiotics
  • the overnight culture may subsequently be used to inoculate a larger scale culture
  • the cells are then grown to a desired optical density, during which the expression promoter is turned on
  • the cells can be harvested by centrifugation
  • the cell pellet obtained by the centrifugation can be solubi zed using various agents known in the art, and the solubihzed ADAM8 protein can then be purified using a metal chelating column under conditions that allow tight binding of the protein ADAM8 can be expressed in E coh in a poly-His tagged form, using the following procedure.
  • DNA encoding ADAM8 is initially amplified using selected PCR primers
  • the primers contain restriction enzyme sites which conespond to the restriction enzyme sites on the selected expression vector, and other useful sequences providing for efficient and reliable translation initiation, rapid purification on a metal chelation column, and proteolytic removal with enterokinase
  • the PCR-amplified, poly-His tagged sequences are then ligated into an expression vector, which is used to transform an E coh host based on strain 52 (W31 10 fuhA(tonA) Ion galE rpoHts(htpRts) clpP(lacIq)
  • Transformants are first grown in LB containing 50 mg/ml carbenicilhn at 30 C with shaking until an O D 600 of 3-5 is reached Cultures are then diluted 50-100 fold into CRAP media (prepared by mixing 3 57 g (NH 4 ) 2 S0 4 , 071 g sodium c ⁇ trate»2H20,
  • E coh paste from 0 5 to 1 L fermentations (6-10 g pellets) is resuspended in 10 volumes (w/v) in 7 M guanidine, 20 mM Tris, pH 8 buffer
  • Solid sodium sulfite and sodium tetrathionate is added to make final concentrations of 0 IM and 0 02 M, respectively, and the solution is stined overnight at 4 C
  • This step results in a denatured protein with all cysteine residues blocked by sulfitolization
  • the solution is centrifuged at 40,000 ⁇ m in a Beckman Ultracentifuge for 30 min
  • the supernatant is diluted with 3-5 volumes of metal chelate column buffer (6 M guanidine, 20 mM Tris, pH 7 4) and filtered through 0 22 micron filters to clarify
  • the clarified extract is loaded onto a 5 ml Qiagen Ni-NTA metal chelate column equilibrated in the metal chelate column buffer The column is was
  • the proteins are refolded by diluting sample slowly into freshly prepared refolding buffer consisting of 20 mM Tris, pH 8 6, 0 3 M NaCl, 2 5 M urea, 5 mM cysteine, 20 mM glycine and 1 mM EDTA Refolding volumes are chosen so that the final protein concentration is between 50 to 100 micrograms/ml
  • the refolding solution is stmed gently at 4C for 12-36 hours
  • the refolding reaction is quenched by the addition of TFA to a final concentration of 04% (pH of approximately 3)
  • the solution is filtered through a 0 22 micron filter and acetonitrile is added to 2-10% final concentration
  • the refolded protein is chromatographed on a Poros Rl/H reversed phase column using a mobile buffer of 0 1% TFA with elution with a gradient of acetonitrile from 10 to 80% Aliquots of fractions with A280 absorbance
  • Proteins are formulated into 20 mM Hepes, pH 6 8 with 0 14 M sodium chloride and 4% manmtol by dialysis or by gel filtration using G25 Superfine (Pharmacia) resins equilibrated in the formulation buffer and sterile filtered
  • PCR reactions were set up using a full-length ADAM8 clone, which contained 346bp SanDI to Sail fragment from the 5' end clone of ADAM8, as a template
  • This construct is described in Example 3
  • the forward primer, ST239A8MF (42mer), for this reaction is as follows 5' CATCAAATGCATCAAGACTCTCTGCCATCCCGAGAGACCCGC 3' (SEQ ID NO 14)
  • the sequence for the reverse primer, ST239A8TCR (54 mer) is as follows
  • the forward sequence was designed with an Nsil restriction site toward the 5' end followed by the sequence of the beginning of the mature sequence of ADAM8, consisting of the amino acid sequence DSLPSRETR (SEQ ID NO 21 )
  • the reverse primer sequence was designed with an Sstl restriction site near the 5' end followed by a Notl restriction site, a stop codon and the sequence of ADAM8 ending at the beginning of the transmembrane domain TEVHAASGS (SEQ ID NO 22)
  • the ADAM8 sequence inserted into the expression vector constitutes the mature extracellular domain PCR reactions were set up using Platinum Taq, HF PCR buffer, and 2mM MgS04 final (GibcoBRL) Reactions were incubated as follows 95 degrees C for 2 minutes, then 40 cycles of 95 degrees C for 30 seconds, 55 degrees C for 30 seconds, and 68 degrees C for 3 minutes, followed by a soak at 4 degrees C until the reactions were retrieved
  • the reaction was purified using Concert rapid PCR pu ⁇ fiction columns (GibcoBRL)
  • the plasmid pST239 ADAM ⁇ mat was transformed into the E coh strain 58F3 (fhuA ⁇ (tonA ⁇ ) lon ⁇ galE rpoHts(htpRts) ⁇ clpP laclq ⁇ ompT ⁇ (nmpc-fepE) ⁇ slyD)
  • a Luna Broth culture of one of the transformants was first grown overnight at 30 degrees C, and then diluted 100- fold into a phosphate limiting media to induce the alkaline phosphatase promoter After 24 hours at 10 degrees C with shaking, the cultures were centrufuged, and the cell pastes frozen until the start of purification
  • E coh pastes ( 6-10 gm pellets) were resuspended in 10 volumes (w/v) of 7 M guanidine HCI, 20 mM T ⁇ s, pH 8, buffer Solid sodium sulfite and sodium tetrathionate were added to make final concentrations of 0 IM and 0 02 M, respectively, and the solution was stmed overnight at 4°C
  • the solution was clarified by centrifugation and loaded onto a Qiagen Ni-NTA metal chelate column equilibrated in 6 M guanidine, HCI, 20 mM Tris, pH 7 4
  • the column was washed with additional buffer containing 50 mM imidazole (Calbiochem, Utrol grade)
  • the protein was eluted with buffer containing 250 mM imidazole
  • the eluate was further purified on a Pharmacia S-200 gel filtration column in buffer containing 6 M guanidine, 20 mM MES, pH 6 0 Fractions
  • This example illustrates preparation of a potentially glycosylated form of ADAM8 by recombinant expression in mammalian cells
  • the vector, pRK5 (see EP 307,247, published March 15, 1989), is employed as the expression vector
  • the ADAM8 DNA is ligated into pRK5 with selected restriction enzymes to allow insertion of the ADAM8 DNA using hgation methods such as described in Sambrook et al , supra
  • the resulting vector is called pRK5-ADAM8
  • the selected host cells may be 293 cells Human 293 cells (ATCC CCL 1573) are grown to confluence in tissue culture plates in medium such as DMEM supplemented with fetal calf serum and optionally, nutrient components and/or antibiotics
  • About 10 ⁇ g pRK5-ADAM8 DNA is mixed with about l ⁇ g DNA encoding the VA RNA gene [Thimmappaya et al , Cell 31 543 (1982)] and dissolved in 500 ⁇ l of 1 mM Tris-HCl, 0 1 mM EDTA, 0 227 M CaCl 2 To this
  • the culture medium is removed and replaced with
  • ADAM8 DNA may be introduced into 293 cells transiently using the dextran sulfate method described by Somparyrac et al , Proc Natl Acad Sci 12 7575 (1981) 293 cells are grown to maximal density in a spinner flask and 700 ⁇ g pRK5-ADAM8 DNA is added The cells are first concentrated from the spinner flask by centrifugation and washed with PBS The DNA-dextran precipitate is incubated on the cell pellet for four hours The cells are treated with 20% glycerol for 90 seconds, washed with tissue culture medium, and re-introduced into the spinner flask containing tissue culture medium, 5 ⁇ g/ml bovine insulin and 0 1 ⁇ g/ml bovine transfemn After about four days, the conditioned media is centrifuged and filtered to remove cells and debris The sample containing expressed ADAM8 can then be concentrated and purified by any selected method, such as dialysis and/or column
  • ADAM8 can be expressed in CHO cells
  • the pRK5-ADAM8 vector can be transfected into CHO cells using known reagents such as CaP0 4 or DEAE-dextran As described above, the cell cultures can be incubated, and the medium replaced with culture medium (alone) or medium containing a
  • the culture medium may be replaced with serum free medium
  • the cultures are incubated for about 6 days, and then the conditioned medium is harvested
  • the medium containing the expressed ADAM8 can then be concentrated and purified by any selected method
  • Epitope-tagged ADAM8 may also be expressed in host CHO cells
  • the ADAM8 may be subcloned out of the pRK5 vector
  • the subclone insert can undergo PCR to fuse in frame with a selected epitope tag such as a poly-His tag into a Baculovirus expression vector
  • the poly-His tagged ADAM8 insert can then be subcloned into a SV40 driven vector containing a selection marker such as DHFR for selection of stable clones
  • the CHO cells can be transfected (as described above) with the SV40 driven vector Labeling may be performed, as described above, to verify expression
  • the culture medium containing the expressed poly-His tagged ADAM8 can then be concentrated and purified by any selected method such as by Ni chelate affinity chromatography Stable expression in CHO cells is performed using the following procedure
  • the proteins are expressed as an IgG construct (lmmunoadhesin), in which the coding sequences for the soluble forms (
  • the ampules containing the plasmid DNA are thawed by placement into water bath and mixed by vortexing
  • the contents are pipetted into a centrifuge tube containing 10 mLs of media and centrifuged at 1000 ⁇ m for 5 minutes
  • the supernatant is aspirated and the cells are resuspended in 10 mL of selective media (0 2 ⁇ m filtered PS20 with 5% 0 2 ⁇ m diafiltered fetal bovine serum)
  • the cells are then aliquoted into a 100 mL spinner containing 90 mL of selective media
  • the cells are transfened into a 250 mL spinner filled with 150 mL selective growth medium and incubated at 37°C After another 2-3 days, 250 mL, 500 mL and 2000 mL spinners are seeded with 3 x 10 cells/mL
  • the cell media is exchanged with fresh media by centrifugation and resuspension in production medium
  • any suitable CHO media
  • the proteins are purified using a Ni-NTA column (Qiagen) Before purification, imidazole is added to the conditioned media to a concentration of 5 mM The conditioned media is pumped onto a 6 ml Ni-NTA column equilibrated in 20 mM Hepes, pH 7 4, buffer containing 0 3 M NaCl and 5 mM imidazole at a flow rate of 4-5 ml/min at 4°C After loading, the column is washed with additional equilibration buffer and the protein eluted with equilibration buffer containing 0 25 ⁇ M imidazole The highly purified protein is subsequently desalted into a storage buffer containing 10 mM Hepes, 0 14 M NaCl and 4% manmtol, pH 6 8, with a 25 ml G25 Superfine (Pharmacia) column and stored at -80°C lmmunoadhesin (Fc containing)
  • PCR reactions were set up using a full-length ADAM8 clone, which contained 346bp SanDI to Sail fragment from the 5' end clone of ADAM8, as a template This construct is described in Example 3
  • the forward primer, PRKA8F, for this reaction is as follows
  • the forward sequence was designed with an EcoRI restriction site toward the 5 ' end followed by the sequence of the beginning of the signal sequence of ADAM8, consisting of the amino acid sequence
  • ADAM8 sequence inserted into the expression vector constitutes the extracellular domain, including the signal sequence, pro domain, metalloproteinase domain, disintegrin domain, cystme rich domain, and the EGF domain PCR reactions were set up using Platinum
  • reaction was pu ⁇ fed using Concert rapid PCR pu ⁇ fiction columns (GibcoBRL) and digested with EcoRI and BstEII
  • the two fragments were gel pu ⁇ fed and ligated together to form the final construct, pRK ADAM ⁇ lg, the sequence of which was verified
  • This plasmid containing the extracellular domain of human ADAM8 fused to a human IgGlFc, was transfected into 293 cells (Graham, F L et al , J Gen Virol 36, 59-74, 1977) using a calcium phosphate method (Gorman, C et al , Science 221, 551-553, 1983) and lOug of plasmid along with lug of a plasmid containing a gene that confers Neomycin resistence These cells were selected with 800ug/ml of Geneticin (GibcoBRL) and grown in 50 50 FI 12 DMEM media supplemented with IX L-Glutamine (GibcoBRL) and 10% FBS These cells were used in assays described in Example 10
  • DP12-DHFR+ Chinese hamster ovary (CHO) cell line designated DP12-DHFR+ (EP 307,247 published 15 March 1989) These cells were derived from a dihydrofolate minus (dhfr-) DUKX CHO host (Urlaub and Chasm, Proc Natl Acad Sci USA, 77 4216 [1980]) which were stably transfected with a DHFR+ plasmid to allow for rapid growth in suspension cultures
  • the plasmid pADAM8 IgG was introduced into this cell line using the large scale transient transfection method as follows 1 95 liters of DP 12 DHFR+ cells at a density of 1 5 x 106 cells/ml were seeded in selective growth medium (modified HAM F12/DMEM with trace elements as described in U S patent 5, 122,469 )
  • selective growth medium modified HAM F12/DMEM with trace elements as described in U S patent 5, 122,469
  • the transfection complex was generated by mixing 6 mg of plasmid DNA (purified by Qiagen Gigaprep procedure) with 12 ml of cationic lipid reagent (equivalent to DMRIE-C, Life Technologies, Inc ) in 1 05 liters of complexing media (modified HAMS F12/DMEM, same as above) without additions
  • the transfection complex was incubated for 30-60 minutes and was then mixed with the cells
  • the transfected cell culture was divided into three IL cultures and incubated in 3L spinner vessels at 37°C
  • the transfected cell culture was medium exchanged to remove serum and transfection reagents by cent ⁇ fuging at 1000 rpm for 8 minutes
  • Transfected cells were resuspended in production media (modified HAM F12/DMEM with trace elements and 'Super' amino acids as described in U S patent 5,122,469) supplemented with 2mg/L insulin, 0 15 g/L gentamycin sulfate, 30 g/L glucose and 125 ml/L 20% p ⁇ matone P3 (Quest)
  • the cell culture was placed at 33°C for the remainder of the production period pH was controlled through additions of Na 2 C0 3
  • the culture was harvested on day 7 and the recombinant protein product was purified by Protein A (ProSep) chromatography To 3 5 liters of conditioned media was added ImM sodium azide and lmM PMSF which was then loaded over a 6 ml Prosep A (protein A) column overnight at 4C The column was washed with P
  • EXAMPLE 8 Expression of ADAM8 in Yeast The following method describes recombinant expression of ADAM8 in yeast
  • yeast expression vectors are constructed for intracellular production or secretion of ADAM8 from the ADH2/GAPDH promoter DNA encoding ADAM8 and the promoter is inserted into suitable restriction enzyme sites in the selected plasmid to direct intracellular expression of ADAM8
  • DNA encoding ADAM8 can be cloned into the selected plasmid, together with DNA encoding the ADH2/GAPDH promoter, a native ADAM8 signal peptide or other mammalian signal peptide, or, for example, a yeast alpha-factor or invertase secretory signal/leader sequence, and linker sequences (if needed) for expression of ADAM8
  • Yeast cells such as yeast strain AB I 10
  • yeast cells can then be transformed with the expression plasmids described above and cultured in selected fermentation media
  • the transformed yeast supernatants can be analyzed by precipitation with 10% t ⁇ chloroacetic acid and separation by SDS-PAGE, followed by staining of the gels with Coomassie Blue stain
  • ADAM8 can subsequently be isolated and purified by removing the yeast cells from the fermentation medium by centrifugation and then concentrating the medium using selected cartridge filters
  • the concentrate containing ADAM8 may further be purified using selected column chromatography resins EXAMPLE 9
  • ADAM8 in Baculovirus-infected Insect Cells
  • the sequence coding for ADAM8 is fused upstream of an epitope tag contained within a baculovirus expression vector
  • epitope tags include poly-His tags and immunoglobulin tags (like Fc regions of IgG)
  • a variety of plasmids may be employed, including plasmids derived from commercially available plasmids such as pVL1393 (Novagen) Briefly, the sequence encoding ADAM8 or the desired portion of the coding sequence of ADAM8 such as the sequence encoding the extracellular domain of a transmembrane protein or the sequence encoding the mature protein if the protein is extracellular is amplified by PCR with primers complementary to the 5' and 3' regions The 5' primer may incorporate flanking (selected) restriction enzyme sites The product is then digested with those selected restriction enzymes and subcloned into the expression
  • Recombinant baculovirus is generated by co-transfecting the above plasmid and BaculoGoldTM virus DNA (Pharmingen) into Spodoptera frug ⁇ erda (“Sf9") cells (ATCC CRL 171 1) using hpofectin (commercially available from GIBCO-BRL) After 4 - 5 days of incubation at 28°C, the released viruses are harvested and used for further amplifications Viral infection and protein expression are performed as described by OReilley et al , Baculovirus expression vectors A Laboratory Manual, Oxford Oxford University Press (1994)
  • Expressed poly-His tagged ADAM8 can then be purified, for example, by N ⁇ -chelate affinity chromatography as follows Extracts are prepared from recombinant virus-infected Sf9 cells as described by Rupert et al , Nature 362 175-179 (1 93) Briefly, Sf9 cells are washed, resuspended in sonication buffer (25 mL Hepes, pH 7 9, 12 5 mM MgCl 2 , 0 1 mM EDTA, 10% glycerol, 0 1% NP-40, 04 M KC1), and sonicated twice for 20 seconds on ice The sonicates are cleared by centrifugation, and the supernatant is diluted 50- fold in loading buffer (50 mM phosphate, 300 mM NaCl, 10% glycerol, pH 7 8) and filtered through a 045 mm filter A Ni -NTA agarose column (commercially available from Qiagen) is
  • purification of the IgG tagged (or Fc tagged) ADAM8 can be performed using known chromatography techniques, including for instance, Protein A or protein G column chromatography
  • the respective coding sequences are subcloned into a baculovirus expression vector (pb PH IgG for IgG fusions and pb PH His c for poly-His tagged proteins), and the vector and Baculogold® baculovirus DNA (Pharmingen) are co-transfected into 105 Spodoptera frug ⁇ erda ("Sf9") cells (ATCC CRL 171 1 ), using Lipofectin (Gibco BRL)
  • pb PH IgG and pb PH His are modifications of the commercially available baculovirus expression vector pVL1393 (Pharmingen), with modified poly nker regions to include the His or Fc tag sequences
  • the cells are grown in Hink's TNM-FH medium supplemented with 10%
  • the conditioned medium from the transfected cells (0 5 to 3 L) is harvested by centrifugation to remove the cells and filtered through 0 22 micron filters
  • the protein construct is purified using a Ni-NTA column (Qiagen) Before purification, imidazole is added to the conditioned media to a concentration of 5 mM
  • the conditioned media are pumped onto a 6 ml Ni-NTA column equilibrated in 20 mM Hepes, pH 7 4, buffer containing 0 3 M NaCl and 5 mM imidazole at a flow rate of 4-5 ml/min at 4 C
  • the column is washed with additional equilibration buffer and the protein eluted with equilibration buffer containing 0 25 M imidazole
  • the highly purified protein is subsequently desalted into a storage buffer containing 10 mM Hepes, 0 14 M NaCl and 4% manmtol, pH 6 8, with a 25 ml G
  • a modified baculovirus procedure may be used inco ⁇ orating high 5 cells
  • the DNA encoding the desired sequence is amplified with suitable systems, such as Pfu (Stratagene), or fused upstream (5'-of) of an epitope tag contained with a baculovirus expression vector
  • epitope tags include poly-his tags and immunoglobulin tags (like Fc regions of IgG)
  • plasmids may be employed, including plasmids derived from commercially available plasmids such as pIEl- 1 (Novagen)
  • the pIEl-1 and pIEl-2 vectors are designed for constitutive expression of recombinant proteins from the baculovirus lei promoter in stably-transformed insect cells
  • the plasmids differ only in the orientation of the multiple cloning sites and contain all promoter sequences known to be important for lel- mediated gene expression in uninfected insect cells as well as the hr5 enhancer element pIEl
  • H ⁇ 5 cells are grown to a confluency of 50% under the conditions of, 27 C, no C0 , NO pen/strep
  • 30 ug of pIE based vector containing the sequence is mixed with 1 ml Ex-Cell medium (Media Ex-Cell 401 + 1/100 L-Glu JRH Biosciences #14401-78P (note this media is light sensitive)), and in a separate tube, 100 ul of CellFectin (CellFECTIN (GibcoBRL #10362-010) (vortexed to mix)) is mixed with 1 ml of Ex-Cell medium
  • CellFECTIN GibcoBRL #10362-010
  • the two solutions are combined and allowed to incubate at room temperature for 15 minutes 8 ml of Ex-Cell media is added to the 2ml of DNA/CellFECTIN mix and this is layered on H ⁇ 5 cells that has been washed once with Ex-Cell media
  • the plate is then incubated in darkness for 1 hour at
  • the animals "positive" for antibodies can be injected with a final intravenous injection of ADAM8
  • the mice are sacrificed and the spleen cells are harvested
  • the spleen cells are then fused (using 35% polyethylene glycol) to a selected murine myeloma cell line such as P3X63AgU 1 , available from ATCC, No CRL 1597
  • the fusions generate hybridoma cells which can then be plated in 96 well tissue culture plates containing HAT (hypoxanthine, aminopte ⁇ n, and thymidine) medium to inhibit proliferation of non-fused cells, myeloma hybrids, and spleen cell hybrids
  • HAT hyperxanthine, aminopte ⁇ n, and thymidine
  • the positive hybridoma cells can be injected intraperitoneally into syngeneic Balb/c mice to produce ascites containing the ant ⁇ -ADAM8 monoclonal antibodies
  • the hybridoma cells can be grown in tissue culture flasks or roller bottles Purification of the monoclonal antibodies produced in the ascites can be accomplished using ammonium sulfate precipitation, followed by gel exclusion chromatography Alternatively, affinity chromatography based upon binding of antibody to protein A or protein G can be employed Development of ant ⁇ -ADAM8 monoclonal antibodies
  • mice were hype ⁇ mmunized with purified human ADAM8 in Ribi adjuvant (Ribi Immunochem Research, Inc , Hamilton, MT)
  • Ribi adjuvant Ribi Immunochem Research, Inc , Hamilton, MT
  • B- lymphocytes from five of the mice demonstrating the highest ant ⁇ -ADAM8 antibody titers were harvested from the popliteal and inguinal lymph nodes and fused with mouse myeloma cells (X63 Ag8 653, American Type Culture Collection, Rockville, MD) as previously described (Kohler et al , 1975) After 8-14 days, the supernatants were harvested and screened for antibody production by direct enzyme-linked immunosorbent assay (ELISA) Sixty-seven positive clones, showing the highest ADAM8-spec ⁇ fic immunobinding were expanded for immunocytochemical analysis Twenty-three of the positive clones were subcloned by limiting dilution After a second round of subcloning, selected lineages are injected into P ⁇ stane-p ⁇
  • Microtiter plates were coated with 100 ⁇ l/well of either human ADAM8 or an inelevant polyHQ tagged protein (1 ⁇ g/ml) in 0 05 M carbonate buffer, pH 9 6, overnight at 4 C C The remainder of the assay was performed as previously described (Hongo et al 1995) Isotyping
  • the isotypes of the antibodies were determined using a commercially available isotyping kit (Mouse Antibody Isotyping Kit, dipstick format, GibcoBRL Life Technologies, Gaithersburg, MD) Screening an ⁇ t-ADAM8 secreting hybridomas for binding to fixed cells
  • an assay was developed to screen the hybridomas against fixed cells transfected with an expression vector encoding an ADAM8Ig fusion Human kidney eel's (293 cells) were transfected with an ADAM8Ig expression vector and pRSVneo, a plasmid expressing a gene encoding a protein that confers neomycin resistence
  • the transfected cells were selected with Geneticin (GibcoBRL) at 800 ug/ml to specifically select those cells expressing ADAM8
  • the cells were grown in a 50 50 mix of DMEM F12 supplemented with 10% FBS and IX L-Glutamine (GiboBRL) These cells were plated in 6
  • Antibodies that bind to cells fixed with methanol or formalin are particularly useful in standard lmmunohistochemistry experiments to analyze the expression and degree of expression of ADAM8 in sample tissues
  • Antibodies which recognise and bind to ADAM8 on the surface of living cells and to ADAMS on fixed cells are particularly interesting since fixing of cells in formalin, for example, is known to alter antigen structures
  • These antibodies may recognize an epitope on ADAM8 that is retained when the cells/tissue are fixed
  • Such antibodies may be used clinically as diagnostic reagentts and as therapeutic antibodies
  • Max file length is 65535 (limited by unsigned short x in the jmp struct)
  • the program may create a tmp file in /tmp to hold info about traceback
  • dumpblockO dump a block of lines with numbers, stars: pr_al ⁇ gn() * numsO - put out a number line: dumpblockO
  • static nm, /* matches in core — for checking */ static lmax, /* lengths of st ⁇ pped file names */ static ⁇ j[2], /* jmp index for a path */ static nc[2], /* number at start of current line */ static n ⁇ [2], /* current elem number — for gapping */ static s ⁇ z[2], static char *ps[2], /* ptr to current element */ static char *po[2], /* ptr to next output char slot */ static char oouutt[[22]][[lP_LINE] , /* output line */ static char star[PJ i], /* set by stars() *//
  • *ps[ ⁇ ] toupper(*ps[ ⁇ ]), po[ ⁇ ]++, ps[ ⁇ ]++,
  • *py++ *p ⁇ , else if ( ⁇ slower(*px))
  • *py++ toupper(*px), if ( ⁇ ndex("ATGCU",*(py-l))) natgc++, ⁇ ⁇

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Veterinary Medicine (AREA)
  • Cell Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2000/020731 1999-07-28 2000-07-27 Compositions and methods for the treatment of tumors Ceased WO2001009189A2 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
JP2001513995A JP2003508028A (ja) 1999-07-28 2000-07-27 腫瘍治療のための組成物と方法
AU63913/00A AU776600B2 (en) 1999-07-28 2000-07-27 Compositions and methods for the treatment of tumors
DE60045247T DE60045247D1 (de) 1999-07-28 2000-07-27 Zusammensetzungen und verfahren zur behandlung von tumoren
EP00950879A EP1204682B1 (en) 1999-07-28 2000-07-27 Compositions and methods for the treatment of tumors
AT00950879T ATE488529T1 (de) 1999-07-28 2000-07-27 Zusammensetzungen und verfahren zur behandlung von tumoren
CA2378182A CA2378182C (en) 1999-07-28 2000-07-27 Compositions and methods for the treatment of tumors

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US14621799P 1999-07-28 1999-07-28
US60/146,217 1999-07-28

Publications (2)

Publication Number Publication Date
WO2001009189A2 true WO2001009189A2 (en) 2001-02-08
WO2001009189A3 WO2001009189A3 (en) 2001-06-14

Family

ID=22516336

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2000/020731 Ceased WO2001009189A2 (en) 1999-07-28 2000-07-27 Compositions and methods for the treatment of tumors

Country Status (9)

Country Link
US (2) US7226596B2 (https=)
EP (1) EP1204682B1 (https=)
JP (3) JP2003508028A (https=)
AT (1) ATE488529T1 (https=)
AU (1) AU776600B2 (https=)
CA (1) CA2378182C (https=)
DE (1) DE60045247D1 (https=)
ES (1) ES2355055T3 (https=)
WO (1) WO2001009189A2 (https=)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003070936A1 (fr) * 2002-02-20 2003-08-28 Yamanouchi Pharmaceutical Co., Ltd. Nouveau polypeptide
WO2005090991A1 (en) * 2004-03-24 2005-09-29 Oncotherapy Science, Inc. Adam8 as tumor marker and therapeutic target for non-small cell lung cancer
WO2006069403A3 (en) * 2004-12-22 2006-09-28 Genentech Inc Methods for producing soluble multi-membrane-spanning proteins
US7226596B2 (en) * 1999-07-28 2007-06-05 Genentech, Inc. Compositions and methods for the treatment of tumors
EP1596813A4 (en) * 2003-01-31 2008-02-20 Five Prime Therapeutics Inc POLYPEPTIDES EXPRESSED IN THE LUNG
WO2008074840A3 (en) * 2006-12-19 2008-10-30 Ablynx Nv Amino acid sequences directed against a metalloproteinase from the adam family and polypeptides comprising the same for the treatment of adam-related diseases and disorders
CN1854313B (zh) * 2002-09-30 2010-10-20 肿瘤疗法科学股份有限公司 非小细胞肺癌的诊断方法
US9546198B2 (en) 2007-10-12 2017-01-17 Cancer Research Technology Limited Cyclic peptides as ADAM protease inhibitors
EP2996721A4 (en) * 2013-05-13 2017-06-21 Tufts University Methods and compositions for prognosis, diagnosis and treatment of adam8-expressing cancer
US12540193B2 (en) 2019-05-31 2026-02-03 Trustees Of Tufts College Anti-ADAM8 antibodies and uses of the same

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2318575T3 (es) * 2004-11-10 2009-05-01 Novartis Vaccines And Diagnostics, Inc. Interferon beta desamidado.
FR2879462B1 (fr) * 2004-12-21 2008-12-26 Sod Conseils Rech Applic Utilisation de toxine botulique pour une insensibilisation locale prolongee
US20060242012A1 (en) * 2005-04-22 2006-10-26 Sumit Agarwal Determining or scoring properties to solicit to join ad network using advertiser or aggregated advertiser interest
US20090304719A1 (en) 2007-08-22 2009-12-10 Patrick Daugherty Activatable binding polypeptides and methods of identification and use thereof
EP2225563B1 (en) * 2007-11-27 2015-01-21 Janssen Diagnostics, LLC Automated enumeration and characterization of circulating melanoma cells in blood
RU2636046C2 (ru) 2009-01-12 2017-11-17 Сайтомкс Терапьютикс, Инк Композиции модифицированных антител, способы их получения и применения
AU2010215761B2 (en) 2009-02-23 2017-04-06 Cytomx Therapeutics, Inc Proproteins and methods of use thereof
TW201613621A (en) * 2014-10-14 2016-04-16 Bionet Corp Composition for promoting growth of dermal papilla cells, pharmaceutical composition, and preparation method thereof
TW201613622A (en) * 2014-10-14 2016-04-16 Bionet Corp Composition for skincare and pharmaceutical composition and preparation method thereof
JP2018130113A (ja) * 2017-02-15 2018-08-23 国立大学法人 東京大学 慢性骨髄性白血病(cml)の検査方法及び検査用キット、チロシンキナーゼ阻害剤(tki)耐性cmlの単離方法、並びにcmlにおけるtki耐性の低減剤及びそのスクリーニング方法

Family Cites Families (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH04187084A (ja) * 1990-11-22 1992-07-03 Otsuka Pharmaceut Co Ltd 単球表面に発現する抗原及び該抗原に対するモノクローナル抗体
PT822186E (pt) * 1994-01-20 2000-08-31 British Biotech Pharm L-tert-leucina-2-piridilamida
GB9608130D0 (en) 1996-04-19 1996-06-26 Univ Sheffield Adam proteins and uses thereof
WO1998031394A2 (en) 1997-01-22 1998-07-23 Board Of Regents, The University Of Texas System Tissue factor methods and compositions for coagulation and tumor treatment
GB9705521D0 (en) * 1997-03-18 1997-05-07 Univ Sheffield The use of mononuclear phagocytes in the vivo imaging of hypoxic/ischaemic tissue
US5922566A (en) * 1997-05-13 1999-07-13 Incyte Pharmaceuticals, Inc. Tumor-associated antigen
WO1999064626A2 (en) * 1998-06-06 1999-12-16 Genostic Pharma Limited Probes used for genetic profiling
CA2702148C (en) * 1999-01-06 2014-03-04 Genenews Inc. Method of profiling gene expression in a human subject having an infectious disease
US20010034023A1 (en) * 1999-04-26 2001-10-25 Stanton Vincent P. Gene sequence variations with utility in determining the treatment of disease, in genes relating to drug processing
ATE488529T1 (de) * 1999-07-28 2010-12-15 Genentech Inc Zusammensetzungen und verfahren zur behandlung von tumoren
NZ521437A (en) * 2000-02-25 2004-04-30 Immunex Corp Integrin antagonists suitable as inhibitors of angiogenesis
IL151872A0 (en) * 2000-03-24 2003-04-10 Micromet Ag mRNA AMPLIFICATION
US6458552B1 (en) * 2000-06-06 2002-10-01 Ortho-Mcneil Pharmaceutical, Inc. Metalloprotease peptide substrates and methods
US6818401B2 (en) * 2000-10-02 2004-11-16 Board Of Regents University Of Texas System Method of detection and interpretation of mutations through expression or function tests of haploid genes
US20030154032A1 (en) * 2000-12-15 2003-08-14 Pittman Debra D. Methods and compositions for diagnosing and treating rheumatoid arthritis
WO2002085285A2 (en) * 2001-04-18 2002-10-31 Wyeth Methods and reagents for regulating bone and cartilage formation
US20030138792A1 (en) * 2001-05-31 2003-07-24 Millennium Pharmaceuticals, Inc. Compositions, kits, and methods for identification, assessment, prevention and therapy of cervical cancer
US20030148316A1 (en) * 2001-08-01 2003-08-07 Lipford Grayson B. Methods and compositions relating to plasmacytoid dendritic cells
US20030148334A1 (en) * 2001-10-12 2003-08-07 Zairen Sun Differentially-expressed genes and polypeptides in angiogenesis
CA2477400A1 (en) * 2002-03-01 2003-09-12 Marc Rothenberg Treatment for asthma or allergies
US20040018522A1 (en) * 2002-05-09 2004-01-29 Brigham And Women's Hospital, Inc. Identification of dysregulated genes in patients with multiple sclerosis
US20050003390A1 (en) * 2002-05-17 2005-01-06 Axenovich Sergey A. Targets for controlling cellular growth and for diagnostic methods
JP2004041121A (ja) * 2002-07-12 2004-02-12 Hitachi Ltd アレルギー解析方法及びシステム
WO2004058052A2 (en) * 2002-12-20 2004-07-15 Applera Corporation Genetic polymorphisms associated with myocardial infarction, methods of detection and uses thereof
US8088737B2 (en) * 2003-04-04 2012-01-03 Incyte Corporation Compositions, methods and kits relating to Her-2 cleavage
US20050009067A1 (en) * 2003-05-19 2005-01-13 Craig Logsdon Expression profile of pancreatic cancer
WO2005026325A2 (en) * 2003-09-10 2005-03-24 Surromed, Inc, Bivalent targeting of cell surfaces

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
" Leucocyte Typing V White Cell Differentiation Antigens" 1995 , YAMAMOTO, S., YOSHIYAMA, K., KATAOKA, M., SETOGUCHI, M., HIGUCHI, Y. AND AKIZUKI, S. (ED. BY SCHLOSSMAN, S. F. ET AL.), OXFORD UNIV. PRESS; PP. 1091-1093 , OXFORD, GB XP002156065 page 1091, column 2, line 3-8 page 1093, column 1, paragraph 3 -column 2, paragraph 1 *
HIGUCHI YASUNORI ET AL: "MS2 (ADAM 8) a myelomonocytic cell surface antigen: Expression, chromosomal localization and production of truncated ADAM 8 transgenic mice." TISSUE ANTIGENS, vol. 48, no. 4-2, 1996, page 423 XP000945109 6th International Workshop and Conference on Human Leukocyte Differentiation Antigens;Kobe, Japan; November 10-14, 1996 ISSN: 0001-2815 *
KATAOKA M ET AL: "Structure of the murine CD156 gene, characterization of its promoter, and chromosomal location." JOURNAL OF BIOLOGICAL CHEMISTRY, (1997 JUL 18) 272 (29) 18209-15. , XP000941768 *
YAMAMOTO SHUNSUKE ET AL: "ADAM family proteins in the immune system." IMMUNOLOGY TODAY, vol. 20, no. 6, June 1999 (1999-06), pages 278-284, XP004169720 ISSN: 0167-5699 *
YOSHIDA S ET AL: "MOLECULAR CLONING OF COMPLEMENTARY DNA ENCODING MS2 ANTIGEN A NOVEL CELL SURFACE ANTIGEN STRONGLY EXPRESSED IN MURINE MONOCYTIC LINEAGE" INTERNATIONAL IMMUNOLOGY, vol. 2, no. 6, 1990, pages 585-592, XP000196854 ISSN: 0953-8178 *
YOSHIYAMA K ET AL: "CD156 (human ADAM8 ): expression, primary amino acid sequence, and gene location." GENOMICS, (1997 APR 1) 41 (1) 56-62. , XP000945107 *

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7226596B2 (en) * 1999-07-28 2007-06-05 Genentech, Inc. Compositions and methods for the treatment of tumors
WO2003070936A1 (fr) * 2002-02-20 2003-08-28 Yamanouchi Pharmaceutical Co., Ltd. Nouveau polypeptide
EP1477559A4 (en) * 2002-02-20 2005-12-07 Astellas Pharma Inc NEW POLYPEPTIDE
US7374923B2 (en) 2002-02-20 2008-05-20 Astellas Pharma Inc. Polypeptide
US7157567B2 (en) 2002-02-20 2007-01-02 Astellas Pharma, Inc. Polypeptide
CN1854313B (zh) * 2002-09-30 2010-10-20 肿瘤疗法科学股份有限公司 非小细胞肺癌的诊断方法
EP1596813A4 (en) * 2003-01-31 2008-02-20 Five Prime Therapeutics Inc POLYPEPTIDES EXPRESSED IN THE LUNG
WO2005090991A1 (en) * 2004-03-24 2005-09-29 Oncotherapy Science, Inc. Adam8 as tumor marker and therapeutic target for non-small cell lung cancer
EP2290087A3 (en) * 2004-12-22 2011-06-15 Genentech, Inc. Methods for producing soluble multi-membrane-spanning proteins
EP2290086A3 (en) * 2004-12-22 2011-10-19 Genentech, Inc. Methods for producing soluble multi-membrane-spanning proteins
US8323902B2 (en) 2004-12-22 2012-12-04 Genentech, Inc. Methods for producing soluble membrane-spanning proteins
US7820806B2 (en) 2004-12-22 2010-10-26 Genentech, Inc. Methods for producing soluble membrane spanning proteins
US7829684B2 (en) 2004-12-22 2010-11-09 Genentech, Inc. Methods for producing soluble membrane-spanning proteins
EP2290088A1 (en) * 2004-12-22 2011-03-02 Genentech, Inc. Methods for producing soluble multi-menbrane-spanning proteins
WO2006069403A3 (en) * 2004-12-22 2006-09-28 Genentech Inc Methods for producing soluble multi-membrane-spanning proteins
US7691989B2 (en) 2004-12-22 2010-04-06 Genentech, Inc. Methods for producing soluble membrane-spanning proteins
WO2008074840A3 (en) * 2006-12-19 2008-10-30 Ablynx Nv Amino acid sequences directed against a metalloproteinase from the adam family and polypeptides comprising the same for the treatment of adam-related diseases and disorders
US9156914B2 (en) 2006-12-19 2015-10-13 Ablynx N.V. Amino acid sequences directed against a metalloproteinase from the ADAM family and polypeptides comprising the same for the treatment of ADAM-related diseases and disorders
US9546198B2 (en) 2007-10-12 2017-01-17 Cancer Research Technology Limited Cyclic peptides as ADAM protease inhibitors
US10472393B2 (en) 2007-10-12 2019-11-12 Cancer Research Technology Limited Method for inhibiting ADAM proteases with cyclic peptides
EP2996721A4 (en) * 2013-05-13 2017-06-21 Tufts University Methods and compositions for prognosis, diagnosis and treatment of adam8-expressing cancer
US12540193B2 (en) 2019-05-31 2026-02-03 Trustees Of Tufts College Anti-ADAM8 antibodies and uses of the same

Also Published As

Publication number Publication date
JP5897300B2 (ja) 2016-03-30
EP1204682B1 (en) 2010-11-17
AU776600B2 (en) 2004-09-16
JP2003508028A (ja) 2003-03-04
US7226596B2 (en) 2007-06-05
CA2378182A1 (en) 2001-02-08
WO2001009189A3 (en) 2001-06-14
ATE488529T1 (de) 2010-12-15
AU6391300A (en) 2001-02-19
EP1204682A2 (en) 2002-05-15
JP2014144959A (ja) 2014-08-14
US20030113764A1 (en) 2003-06-19
US20080175842A1 (en) 2008-07-24
DE60045247D1 (de) 2010-12-30
ES2355055T3 (es) 2011-03-22
CA2378182C (en) 2014-09-23
JP2012068254A (ja) 2012-04-05

Similar Documents

Publication Publication Date Title
AU2003200740B2 (en) Compositions and methods for the treatment of tumor
US20080175842A1 (en) Compositions and methods for treatment
WO2000053755A2 (en) Compositions and methods for the treatment of tumor
EP1185642A2 (en) Compositions and methods for the treatment of tumor
AU773055C (en) Compositions and methods for the treatment of tumors
WO2000037640A9 (en) Compositions and methods for the treatment of tumor
EP1109833A2 (en) Compositions and methods for the treatment of tumors
WO2001005836A1 (en) Polypeptidic compositions and methods for the treatment of tumors
AU776063B2 (en) Compositions and methods for the treatment of tumor
AU756400B2 (en) Compositions and methods for the treatment of tumor
AU2003200721C1 (en) Compositions and methods for the treatment of tumor
WO2000053754A1 (en) Compositions and methods for the treatment of tumor
CA2478728A1 (en) Compositions and methods for the treatment of tumors
NZ513423A (en) Compositions and methods for the treatment of tumors

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
AK Designated states

Kind code of ref document: A3

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW

AL Designated countries for regional patents

Kind code of ref document: A3

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG

WWE Wipo information: entry into national phase

Ref document number: 63913/00

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2378182

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2000950879

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 2000950879

Country of ref document: EP

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWG Wipo information: grant in national office

Ref document number: 63913/00

Country of ref document: AU