WO1998008375A1 - Polypeptides fused with alfalfa mosaic virus or ilarvirus capsid - Google Patents
Polypeptides fused with alfalfa mosaic virus or ilarvirus capsid Download PDFInfo
- Publication number
- WO1998008375A1 WO1998008375A1 PCT/US1997/015200 US9715200W WO9808375A1 WO 1998008375 A1 WO1998008375 A1 WO 1998008375A1 US 9715200 W US9715200 W US 9715200W WO 9808375 A1 WO9808375 A1 WO 9808375A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- virus
- plant
- capsid protein
- protein
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
- C12N15/8257—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits for the production of primary gene products, e.g. pharmaceutical products, interferon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20111—Lyssavirus, e.g. rabies virus
- C12N2760/20122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/14011—Bromoviridae
- C12N2770/14022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- the field of the invention is recombinant plant viruses, especially their use as immunizing agents which carry antigenic sequences from mammalian (e.g., human) or other animal pathogens and their use as a system for increased production of polypeptides of interest.
- the current invention is a process of delivering a fusion capsid protein (a plant virus capsid protein fused to a foreign polypeptide) to a mammal (such as a human) or other animal using recombinant tobacco mosaic virus (TMV) genetic material (TMV genetic material combined with genetic material that codes for a chimeric capsid protein, the chimeric capsid protein being capsid protein of either an alfalfa mosaic virus (AlMV) capsid protein (CP) or ilarvirus CP, fused to the foreign polypeptide) as a delivery vehicle to that mammal or other animal.
- TMV tobacco mosaic virus
- a foreign polypeptide is one that does not naturally occur in either TMV, an AlMV or an ilarvirus.
- the fusion protein is administered to the mammal or other animal for purposes of inducing an immune response against the foreign polypeptide.
- the invention is a production process: the use of such a chimeric virus to express the fused coat protein (comprising either an antigenic or nonantigenic foreign protein) in a plant.
- FIG. IA Schematic representation of the genome of TMV.
- the regions of the genome coding for the 126 kDa and 183 kDa proteins required for virus replication, the 30 kDa viral movement protein, and the CP (viral coat protein) are shown schematically.
- the arrow under "TMV CP SP" indicates the subgenomic promoter of TMV.
- the three connected ellipsoids under "pep” represent the polypeptide fused to the AlMV CP .
- Rz- indicates ribozyme.
- B30Rz- is a derivative of TMV.
- AvB30Rz- is a derivative of B30Rz and is defective as to translation of coat protein.
- Figure IB A schematic representation of cloning strategy: the cloning of chimeric AlMV CP into a TMV based vector.
- the sequences of polypeptides from HIV-l and rabies virus are used as the "pep" to create recombinant viruses.
- the "pep” polypeptide has the following amino sequence:
- BRzCPDnvlOc MSAVYTRIMMNGGRLKRYEAAELTLTDVALADDS (SEQ ID NO: 3)
- BRzCPDrg24 MSAVYTRIMMNGGRLKRPPDQLVALHDGIEKLWEEDS (SEQ ID NO: 4)
- FIG. 1 Accumulation of chimeric AlMV CP, fused with different peptides, in tobacco protoplasts infected with transcripts of recombinant virus. Proteins were separated by electrophoresis in a 13% SDS-polyacrylamide gel and electroblotted on nylon membrane. The proteins were reacted with monoclonal antibodies to AlMV CP followed by detection with estatin im unostain kit (Sigma) . Lane 1 represents wt AlMV CP . Lane 2 and 3 are in vi tro translation products of pSPCPDIOc and pSPCPDrg24 , respectively.
- FIG. 3 Electron micrographs of recombinant AlMV particles from tobacco plants, infected with recombinant transcripts of TMV presenting different constructs. The particles were negatively stained with 2% of uranyl acetate. The bars indicate 100 nm. A-B30Rz. B- pBRzCPNLV3. The single arrow indicates a TMV particle. The double arrow indicates indicates recombinant A1LMV particles.
- Figure 4. Accumulation of chimeric AlMV CP in systemically infected tobaccco leaves. The tobacco leaves were inoculated with transcripts of recombinant virus. Proteins were separated by electrophoresis in a 13% SDS- polyacrilamide gel.
- Lane 1 represents wt AlMV CP.
- FIG. 5 Immunoprecipitation of chimeric particles containing rabies and HIV-1 epitodes.
- the particles purified from plant tissue which were coinfected with transcripts of recombinant virus and immunoprecipitated using monoclonal antibodies to the linear epitope of rabies G protein (rg24) .
- Immunoprecipitated proteins were separated by electrophoresis in a 13% SDS-polyacrilamide gel. The proteins were reacted with antibodies to HIV-1 V3 loop or with monoclonal antibodies to N protein of rabies followed by detection with Westatin immunostain kit.
- Lane 1 represents immunoprecipitated proteins reacting with antibodies to N protein. Two- wild type rabies.
- FIG. 7 The precentage of mice producing specific rabies virus antibodies after I. p. immunization with pBRzCPDrg24 (Rg24-A/TMV) or mix of AlMV plus TMV (Control) . The results were obtained in ELISA. Experiment is described in the legend to Figure 6.
- FIG. 8 Serum antibody response of mice immunized with CPMNV3 and neutralizing activity of those antibodies. Serum antibody response was measured by ELISA on plates coated with synthetic peptide resembling the V3 loop of HIV-1.
- Fig. 8A indicates the serum antibody response when the immunogen was administered without CFA whereas in Fig. 8B CFA was added. Also shown are the ELISA data for preimmune and mice immunized with control virus.
- Fig. 8C represents neutralization of HIV- l/MN isolate by sera from mice immunized with CPMNV3. Data points in Fig. 7C are averages obtained using preimmune and sera after the last (seventh) inoculation of antigen.
- FIG. 9 Serum antibody response of mice immunized with CPDrg24. Serum antibody response was measured by ELISA using a 1:40 dilution of serum and plates coated with AlMV (vector plates) or inactivated ERA strain rabies virus (ERA plates) .
- Fig. 9A shows the serum IgA response specific for vector and Drg24 whereas in Fig. 9B shows the serum IgG response specific for vector and Drg24. Also shown are the ELISA data for preimmune and mice immunized with control virus.
- a "plant” for purposes of this patent application includes liverworts (Hepaticae) , mosses (Musci) , psilopsids (Psilopsida) , club mosses (Lycopsida) , horsetails (Sphenopsida) , ferns and seed plants, and certain fungi specified below, and algae including blue-green algae. Ferns and seed plants together make up the Pteropsida. Seed plants include gymnosperms (Gymnospermae) and angiosperm ⁇ (.Angiospermae) . The great majority of plants used for food are angiosperm ⁇ .
- Basidiomycetes which include mushrooms.
- bacteria single-celled eukaryotes
- fungi Phycomycetes, Ascomycetes (yeasts), and Deuteromycetes .
- plant tissue includes any tissue of a plant.
- animal refers to humans as well as other animals .
- a "bird” is a warm-blooded vertebrate of the class Aves .
- a "fish” is a cold-blooded aquatic vertebrate, having gills and fins.
- a "chimeric protein” is created when two or more genes that normally code for two separate proteins recombine, either naturally or as the result of human intervention, to code for a protein that is a combination of all or part of each of those two proteins .
- code for is used in this application to refer to both the nucleic acid sequence that codes for a polypeptide sequence and a base sequence complementary to such a nucleic acid sequence.
- fusion capsid protein is a chimeric protein m which one of the genes in the chimera codes for a plant virus capsid protein .
- a "bipartite fusion capsid protein” is a fusion wherein genes for two proteins recombine.
- a "tripartite fusion capsid protein” is a fusion wherein genes for three proteins recombine .
- a "pathogen protein” is a protein that is coded for by the genetic material of a pathogen.
- a "naturally occurring plant protein” is one that is normally found in a plant, at least one stage in its life cycle, in its natural habitat.
- “Infecting a plant cell” means infecting a plant cell with one or more genes that it does not naturally have, the infection being by a nucleic acid molecule that may or may not be encapsidated within a virus .
- Protective immunity is the ability of an animal, such as a mammal, bird, or fish, to resist (delayed onset of symptoms or reduced severity of symptoms) , as the result of its exposure to the antigen of a pathogen, disease or death that otherwise follows contact with the pathogen.
- Protective immunity is achieved by one or more of the following mechanisms: mucosal, humoral, or cellular immunity.
- Mucosal immunity is primarily the result of secretory IgA (sIGA) antibodies on mucosal surfaces of the respiratory, gastrointestinal, and genitourinary tracts.
- the sIGA antibodies are generated after a series of events mediated by antigen-processing cells, B and T lymphocytes, that result in sIGA production by B lymphocytes on mucosa-lined tissues of the body.
- Mucosal immunity can be stimulated by an oral vaccine.
- the primary result of protective immunity is the destruction of the pathogen or inhibition of its ability to replicate itself.
- Human immunity is the result of IgG antibodies and IgM antibodies in serum.
- Cellular immunity can be achieved through cytotoxic T lymphocytes or through delayed-type hypersensitivity that involves macrophages and T lymphocytes, as well as other mechanisms involving T cells without a requirement for antibodies.
- a "derivative cell” derived from an infected plant cell is one created as a result of the infected plant cell undergoing cell division or a series of cell divisions such that one or more copies of the foreign gene introduced into the plant cell by infection is in the derivative cell.
- Ilarviruses includes the following subgroups: tobacco streak virus, prune dwarf virus, lilac ring mottle virus, citrus leaf rugose virus, citrus variegation virus, elm mottle virus, spinach latent virus, asparagus virus 2, Parietaria mottle virus, hydrangea mosaic virus, apple mosaic virus, Prunus necrotic ringspot virus, tulare apple mosaic virus, blueberry scorch virus, cherry rugose virus, danish plum line pattern virus, Hop A virus, Hop C virus, American plum line pattern virus, and Humulus japonicus virus.
- a “recombinant virus” is one in which the genetic material of a virus has combined with other genetic material.
- a “polypeptide” is a molecule in which there is at least four amino acids linked by peptide bonds.
- “Viral nucleic acid” may be the genome (or the majority thereof) of a virus, or a nucleic acid molecule complementary in base sequence to that genome.
- a DNA molecule that is complementary to viral RNA is also considered viral nucleic acid.
- An RNA molecule that is complementary in base sequence to viral DNA is also considered to be viral nucleic acid.
- A1MV is alfalfa mosaic virus.
- TMV tobacco mosaic virus.
- a "vaccine” in the present invention is the fusion capsid protein, any particle of which that protein is part, or any preparation such as plant material of which that protein is part .
- the invention is a process of administering a polypeptide to an animal (especially a mammal, bird, or fish), the process comprising the steps of:
- the viral nucleic acid may either be in a virus or not in a virus. If it is not in a virus, it may either be pure nucleic acid or nucleic acid associated with other molecules or molecular structures .
- the recombinant plant virus nucleic acid comprises TMV nucleic acid
- the TMV nucleic acid will preferably comprise nucleic acid coding for the TMV 123 kDA 183 kDa, and 30 kDa proteins.
- the infected cell or derivative cell may either be part of a plant or plant tissue or may be free of other plant cells.
- step (1) it is preferable that the viral nucleic acid have sufficient genetic information to produce viral particles during step (2) .
- the route of administration m step (3) can be parenteral or nonparenteral. If administered parenterally, the protein to be administered to the animal will preferably be substantially pure of other material found m the plant cells that produced it .
- the protein or portion thereof may be in or part of the infected or derivative cell, part of an extract of such a infected or derivative cell or, as a result of protein purification, free of other material normally present in the infected or derivative cell.
- step (3) is, in a particular embodiment of the invention, an immune response against the part of the fusion capsid protein that is not plant viral protein. That immune response preferably results in either protective immunity or systemic tolerance.
- the steps for purifying a fusion capsid protein are ones commonly used for the fractionation of plants into their protein components and the separation of individual proteins from other components of the infected or derivative cell. Such steps include protection of the native conformation of the pathogen protein by steps such as flash freezing the plant material with dry ice or liquid nitrogen.
- An extract would be created by a process comprising mechanical or chemical disruption of a cell. In some cases, additional protein purification steps would be used to make the extract .
- step (3) the fusion capsid protein is in part of a plant or plant product and is fed to the mammal (i.e. oral route of administration) .
- the plant is raw; i.e., has not been cooked (heated above the temperatures associated with growth, storage, and transport) .
- the plant is not cooked.
- Animals typically may eat the plant, pieces of the plant, a puree from the plant, or plant juice.
- step (2) takes place in an edible plant or part of an edible plant . Animals vary as regards which food is edible.
- Plants of greatest interest include potatoes, tomatoes, peas, beans, alfalfa, citrus fruits (e.g., oranges, lemons, grapefruit), grapes, carrots, strawberries, blueberries and other berries, bananas, rice, wheat, corn, barley, oats, rye, dates, cabbage, Brussel sprouts, cauliflower, turnips, cucurbits, papaya, guava, apples, cherries, apricots, pears, and grapes.
- citrus fruits e.g., oranges, lemons, grapefruit
- grapes carrots
- strawberries blueberries and other berries
- bananas rice, wheat, corn, barley, oats, rye
- dates cabbage
- Brussel sprouts cauliflower, turnips, cucurbits
- papaya guava
- apples cherries
- apricots pears, and grapes.
- the fusion capsid protein of interest is extracted in purified form from the plant and administered as a substantially pure protein, possibly with an adjuvant or other compounds needed to facilitate or improve vaccine administration.
- the polypeptide referred to in step (1) may be one that is a glycoprotein in the pathogen.
- a pathogen is any organism such as a virus, bacterium, fungus, or parasite, as well as a protein which is capable of self -replication such as a prion and capable of inducing disease in an animal.
- Pathogens against which vaccines created by the present invention are effective are those including but not limited to bacteria of the genera streptococci and staphylococci , as well as the mycoplasma, rickettsia and spirochetes.
- Pathogens against which vaccines of the present invention are expected to be particularly useful are rabies, respiratory syncytial virus, cholera, typhoid fever, herpes simplex types I and II, tuberculosis, pathogenic pneumococci, human immunodeficiency virus-1 (HIV-l) and human immunodeficiency virus-2 (HIV-2) .
- pathogens includes those of veterinary significance and includes parvoviridae, papovaviridae, adenoviridae, herpesviridae, poxviridae, iridoviridae, picornaviridae , caliciviridae , togaviridae, flaviviridae, coronaviridae, ortho- and paramyxoviridae, rhabdoviridae, bunyaviridae , reoviridae, birnaviridae, and the retroviruses . Both gram negative and gram positive bacteria and spirochetes are also expected to be pathogens which may be clinically affected by the plant vaccines of the present invention.
- Genes may be transferred by any of a variety of infection means, which means include but are not limited to:
- modified plants can be crossed genetically, plants expressing an adjuvant protein and a primary antigen can be produced separately and combined to deliver antigen and adjuvant in one plant.
- the quasi-isometric/bacilliforra viruses can, according to J. A. Levy et al . (Virology, 3rd edition, Prentice Hall, Englewood Cliffs, New Jersey (1994)), be divided into two subgroups: AlMV and the ilarviruses.
- the antigen-presenting capsid protein in the present invention is that of a quasi/bacilliform virus: its synthesis is driven by a genome constructed to produce a chimeric capsid protein whose components include the quasi/bacilliform capsid protein and the antigenic protein or polypeptide of interest.
- the virus that delivers the chimeric capsid protein to a plant for production of the antigenic protein may itself be a quasi- isometric/bacilliform virus, or alternatively, may be a nonenveloped virus with a positive-sense RNA genome that is not a quasi-isometric/bacilliform virus.
- examples are given of how AlMV or TMV can form the major part of the delivery vehicle.
- TMV tobacco mosaic virus
- AlMV alfalfa mosaic virus
- TMV is the type member of the tobamovirus group.
- TMV consists of a single plus-sense genomic RNA (6.5 kb) encapsidated with a unique coat protein (17.5 kDa) which results in rod- shaped particles (300 nm) .
- a wide host range of tobacco mosaic virus allows one to use a variety of plant species as production and delivery systems. The expression of protein depends only upon virus replication and does not interfere with plant nuclear transcription machinery thus providing high levels of protein accumulation in infected cells.
- AlMV CP The second component of a recombinant expression vector exemplified herein is AlMV CP .
- AlMV is a type member of Bromoviridae family.
- the genome of this virus consists of ' three positive-sense RNAs (RNAs 1-3) which are encapsidated by CP (24 kDa) resulting in a 30-60 nm bacillifor particle.
- RNA4 The fourth RNA (subgenomic RNA4) of AlMV is the messenger for CP and is synthesized from genomic RNA3. RNA4 is separately encapsidated into spherical particles of 20, 30 n .
- the functions of CP thought to be important for the virus include: initiation of infection, stability of viral RNA, switching from minus to plus RNA, movement of the infectious material throughout the host, and encapsulation.
- the N-terminus of the AlMV CP specifically binds to the 3' noncoding region of all AlMV RNAs, requiring the AUGC repeats at the 3' end of viral RNAs and initiates the infection.
- the carboxyterminus of CP is required for the encapsidation of viral RNA.
- AlMV CP carrying 37 amino acids at its N- terminus will preserve the biological activity and form the particles in vi tro (Yusibov e t al . , J. Gen. Virol 77, 567
- the AlMV CP is used as an additional component to complement TMV expression system.
- vi tro transcripts of TMV carrying inserted sequences are used for the mechanical inoculation of tobacco plants.
- infected plant tissue can be used to determine the amount of protein in tissue, for purification of virus particles, and for the feeding experiments to test mucosal immunogenicity .
- low alkaloid tobacco plants that can be fed to the animals are used to grow the recombinant viruses.
- the infecting RNA After infection with recombinant viral RNA coding for a fusion protein (AlMV capsid protein fused to an antigenic polypeptide) , the infecting RNA is processed and the infection results in two types of viral particles:
- AlMV-non infectious AlMV particles consisting of subgenomic RNA coding for fusion protein (AlMV capsid protein fused to an antigenic polypeptide) and fusion protein.
- AlMV capsid protein fused to an antigenic polypeptide fused to an antigenic polypeptide
- the particles consisting of recombinant AlMV CP serve as antigen delivery and presentation systems. These particles have advantages over recombinant TMV particles that do not have AlMV or ilarvirus fusion capsid proteins.
- the use of AlMV or ilarvirus capsid protein allows the assembly of up to 100 amino acids presenting foreign antigenic or nonantigenic sequences into particles for effective antigen presentation .
- the TMV CP is capable presenting up to 25 amino acids.
- the larger peptides interferes with TMV assembly.
- AlMV CP molecules each of which is fused to different antigenic polypeptides will assemble into multivalent particles carrying multiple antigens, which allows simultaneous immunization against multiple pathogens.
- Plasmids containing recombinant TMV carrying chimeric AlMV CP Tobacco mosaic virus was used as a vector for the expression of chimeric genes.
- the plasmids B30Rz and AvB30Rz (Proc. Natl. Acad. Sci. U.S. 88, 7204 (1991)) containing the TMV genome and multiple cloning sites were a gift from Dr. William Dawson of Florida University.
- fusion capsid proteins were made using AlMV CP where the first AUG codon (start codon for in vivo translation of AlMV CP) was exchanged for TCG to create an Xhol (CTCGAG) site for cloning and an RNA molecule defective in translation (an RNA molecule which does not have a continuous open reading frame that will support the synthesis of stable and detectible polypeptide in vivo or in vi tro, pSP ⁇ AUG, (Yusibov and Loesch-fries, Virology 208, 405 (1994)) .
- Peptides or proteins from human immunodeficiency virus (HIV) and from rabies virus were engineered as fusion with capsid protein of AlMV and cloned into B30Rz.
- a plasmid DNA containing sequences for HIV-1 envelope protein (env ,160) was used as a template for the polymerase chain reaction (PCR) .
- PCR polymerase chain reaction
- a plasmid can be made by cloning the cDNA of the HIV-1 MN strain containing gpl20 sequences including the V3 loop by using PCR cloning into the PCRII vector (Invitrogen, Inc.) or other appropriate vector.
- the plasmid used here was supplied by David Weiner of U. Pennsylvania) .
- PCR on the plasmid DNA containing sequences for HIV-1 envelope protein was performed using 5' -AGATCTCGAGATGAGTTCATCTGTAGAAATTAATTGTACA-3' as the first strand- and 5 ' -CGGCTCGAGCTACTAATGTTACAATG-3 ' as the second strand primers.
- the PCR products were digested by Xhol and ligated into pSPCP ⁇ AUG linearized by Xhol .
- the ligation product, pSPCPMNV3 contained the DNA coding for the HIV V3 loop and full length AlMV CP.
- the translation initiation codon (AUG) was created upstream of the first codon (UGC, which codes for Cys) of the V3 loop so that the full length fusion protein will be read only from this codon.
- the clone also contained 5'- (37 nucleotides upstream of wild type AlMV CP translation start codon) and 3' -(192 nucleotides following AlMV CP stop codon containing AlMV origin of assembly) noncoding regions of AlMV CP .
- the segment of pSPCPMNV3 containing the DNA for HIV-1 V3 loop, the AlMV CP, and the 5'- and 3 ' -noncoding regions of AlMV CP, were excised by EcoRl and
- the full length fusion protein carrying V3 loop, vpr, or vpu was introduced into B30Rz to generate plasmids, pBRzCPNLV3, pBRzCPNLVpr, and pBRzCPNLVpu .
- These plasmids contain full length TMV molecule and engineered fusion proteins subcloned under the subgenomic promoter of TMV CP .
- HIV-1 NL 4.3 V3 loop 3' primer
- DNVlOc is a chimera of the linear epitope (NVlOc) of rabies nucleocapsid protein and the synthetic peptide 31D.
- Drg24 is a chimera of the linear epitope (rg24) of rabies glycoprotein and the synthetic peptide 3 ID.
- NVlOc and rg24 are the B cell determinants.
- Synthetic peptide 31D is the T cell determinant .
- the linear epitopes of the N (NV10C) and G (g24) proteins of rabies virus were engineered as a chimeras with the synthetic peptide 31D and the chimeras fused with AlMV CP .
- Each chimera (DNVlOc and Drg24) was synthesized by PCR using overlapping primers (Table 1) which serve as a template for each other.
- the primers are made in a way that the first strand and second strand primers has 18 homologous nucleotides that will anneal during PCR reaction. Thus each primer will serve as a template for other one and support the synthesis of new chain.
- the primers were created to synthesize known amino acid sequence.
- PCR products resulting from these reactions were digested by Xhol and cloned into pSPCP ⁇ AUG to fuse with AlMV CP .
- the resulting plasmids were named as pSPCPDNVlOc and pSPCPDrg24.
- the sequences for full length fusion capsid proteins and for 5'- 3' noncoding regions were cut by EcoRI plus Smal and cloned into B30Rz linearized by Xhol and subsequent blunt end ligation to create pBRzCPDNVlOc, pBRzCPDrg24.
- TMV vector (Av/TMV) that had a nontranslatable coat protein.
- the Av/TMV was created in the laboratory of William Dawson of Florida University.
- the plasmid was derived from B30Rz used for the cloning described above. The schematic representation of the plasmid is given on Fig. IA.
- To engineer the chimeric virus the wild type or recombinant AlMV CP (CP carrying Drg24) was cloned so as to be under the control of TMV CP subgenomic promoter.
- the AlMV CP was excised from pSP65A4 (Yusibov and Loesch-Fries , Proc .
- Protoplasts were isolated from axenic tobacco plants
- TMV transcripts per lxlO 1* protoplasts using a polyethylene glycol procedure (Yusibov and Loesch-Fries, Proc . Natl. Acad. Sci. U.S. 1995). After inoculation the protoplasts were incubated on ice (15 minute) pelleted and washed twice with 10% mannitol.
- the protoplasts were resuspended in lxAIOK medium (0.2 mM KH 7 P0 4 , 1 mM KNQ , ImM MgS0 4 , 1 ⁇ M KI, 0.1 ⁇ M CuSQ , 10 mM CaCJ .2 ⁇ 0, pH 6.5) and incubated at low light conditions at 25-27° C.
- the protoplasts were collected 24 hr after inoculation and assayed by immunofluorescence using monoclonal antibodies to AlMV CP
- the particles extracted from plant tissue which were coinfected with transcripts of recombinant virus were immunoprecipitated using monoclonal antibodies to the linear epitope of rabies G protein (rg24) .
- Antibodies Dietzschold et al . , Virology 6_4, 3804 (1990)
- the suspension of (50 ⁇ l) formalin-fixed staph A cells were add to the incubation mix and continued incubate at the same conditions for one more hour.
- virus particles carrying recombinant protein were harvested 12 days post -inoculation.
- the leave tissue was frozen in liquid nitrogen and ground in prechilled mortar.
- Ground tissue was transferred into sterile tubes containing buffer (I ml/1 g of tissue; 0.25 M sodium phosphate, pH 7.2) and resuspended by vortexing followed by centrifugation at 10,000 rpm for 15 minutes. All manipulations with samples were performed at 0 to 4° C. Upon centrifugation the supernatant was transferred into new tubes and virus particles were selectively precipitated in a buffer containing 4% polyethylene glycol (MW 15,000 - 20,000) and 50 mM ⁇ aCl for 2 hours.
- buffer I ml/1 g of tissue; 0.25 M sodium phosphate, pH 7.2
- Polyethylene glycol is a component that precipitates virus particles. Then virus particles were pelleted at 10,000 rpm for 20 minutes. The pellet was resuspended in a 25 mM sodium phosphate buffer pH 7.2 and centrifuged once again under a similar conditions to separate possible plant debris and insoluble plant components. The supernatant (which contains virus) from this step was used for future experiments .
- CsCI purified recombinant plasmid (pSPCPMNV3, pSPCPNLV3 , pSPCPNLVpr, pSPCPNLVpu, pSPCPDlOc, and pSPCPDrg24 ) .
- DNA containing engineered genes was digested by Smal and used for the in vi tro transcription.
- the capped transcripts of recombinant genes were synthesized using SP6 polymerase and translated in a wheat germ cell free translation system as described above. All tested transcripts had a messenger activity and directed the incorporation of 1b SMet into polypeptides of expected size . Translation of fusion capsid proteins in infected tobacco protoplasts
- the expending leaves of tobacco were inoculated with transcripts of recombinant TMV. Twelve days after inoculation, the virus was purified from locally and systemically infected leaves separately. In local infections, infection occurred in originally inoculated leaves. In systemic infection, the spread of virus was throughout the plant into new growing noninoculated leaves. Prior to purification 30-50 mg of infected tissue was used to determine if, together with TMV particles, the recombinant AlMV particles were assembled. The tissue was homogenized and the sap from it was applied on a carbon coated grid.
- spherical particles presenting recombinant AlMV
- transcripts from all constructs (pBRzCPMNV3, pBRzCPNLV3 , pBRzCPNLVpr, pBRzCPNLVpu, pBRzCPDNVlOc, and pBRzCPDrg24)
- Fig.3 presents the results of negative staining of particles (wild type B30Rz and recombinant BRzCPDrg24) using 2% urea acetate.
- Western blot analysis of purified virus samples demonstrated the presence of fusion capsid proteins in samples from both locally and systemically infected leaves (Fig. 4) . This indicated that the recombinant virus was viable and it retained the fusion capsid protein during systemic movement through the plant.
- the in vi tro transcripts of pAv/ACP or pAv/ACPDrg24 were used for inoculation of tobacco plants. Within eight days the tissue samples were collected to assess the systemic spread of virus in noninoculated leaves. Western analysis (data not shown) detected the wt (ACP) or recombinant (ACPDrg24) protein in a systemic noninoculated leaves of tobacco indicating that AIMV CP supported the systemic spread of CP defective TMV.
- the plants inoculated with transcripts of the vector itself (pAv/TMV) did not show any systemic symptoms on tobacco plants even 20 days after inoculation. Assembly of recombinant AlMV particles presenting epitopes from different pathogens
- Samples of infected leaf tissues from pBRzCPMNV3 , pBRzCPNLV3, pBRzCPDNVlOc, and pBRzCPDrg24-infected plants were taken, combined and used for the infection of tobacco plants.
- the virus particles were purified 12 days after inoculation and assessed for co-assembly of recombinant AlMV CPs from different constructs.
- the virus particles were immunoprecipitated using monoclonal antibodies to the linear epitope of rabies G protein (rg24) and formalin fixed Staph A cells. Immunoprecipitation products were separated by SDS polyacrylamide gel electrophoresis (above) and used for the Western blot analysis.
- the separated proteins were reacted to the monoclonal antibodies for the AlMV CP, antibodies against the linear epitopes of rabies N and G proteins, and antibodies against V3 loop of HIV1 MN strain (National Institute of Allergy and Infectious Diseases. AIDS Research and Reference Reagent Program. #1728 Antibody to HIV-1 V3 ) . All antibodies reacted with the immunoprecipitation product after gel separation (Fig. 5) indicating that upon co- infection AlMV CP molecules will assemble into multivalent particles presenting antigenic epitopes from different pathogens. The larger molecular weight bands seen in Fig. 5 represent protein dimers similar to those of control virus (AlMV CP) .
- mice Eight-week old female Swiss-Webster, outbred mice were immunized with 10 ⁇ g per dose of recombinant TMV virus engineered to express the rg24 epitope of rabies glycoprotein (Drg24-A/TMV) .
- Three immunizations of 0.1 ml were administered intra-peritoneally at intervals of 2 weeks each with and without complete Freund's adjuvant (CFA) at a 1:1, vol:vol ratio.
- CFA complete Freund's adjuvant
- An equal quantity of a mixture of wild type AlMV plus TMV was used with and without CFA as controls.
- serum samples were obtained from individual mice and rabies virus-specific antibody titers assessed.
- Antigen-specif ic antibody analysis of serum was performed using a solid phase enzyme- linked immunoabsorbant assay (ELISA) .
- ELISA plates (Nunc Polysorp, Denmark) were coated with 100 ⁇ l per well of inactivated ERA- strain rabies virus (5 ⁇ g/ml in Phosphate-buffered saline) overnight at room temperature (RT; about 25 °C) .
- Coated plates were washed 3x with PBS-Tween (0.05%) and then blocked with 5% dried milk in PBS at RT for at least 1 hour. A series of dilutions of sera were added to the plates (30 ⁇ l/well) for 2 to 4 hours at RT .
- Fig. 6A Eighty percent of mice immunized with particles carrying Drg24 had rabies-specific antibodies (Fig. 7) . Specific neutralization of rabies virus was assessed using a modified rapid fluorescent focus forming assay (Fig. 6B) . Serum was inactivated by treatment for 30 minutes at 56°C and diluted in MEM medium supplemented with 10% fetal bovine serum (FBS) to a starting dilution of 1/5.
- FBS fetal bovine serum
- the 1/5 serum dilution was further diluted serially 1/2 (1 volume plus 1 volume diluent) in 96 well plates (Nunc) such that each well contained 50 ⁇ l of the titrated serum. Thirty ⁇ l of a preparation of rabies CVS-11 virus was added to each well.
- the rabies virus solution was prepared such that 30 ⁇ l diluted with 50 ⁇ l of medium and 30 ⁇ l of BHK indicator cells (1.5 x 10 fi /ml) contained sufficient virus to cause infection of 80 to 90% of the cells in monolayer cultures after 20 hours.
- the 96 -well plates containing the serum dilutions and rabies virus were incubated for 1 hour at 37°C prior to being carefully mixed with 30 ⁇ l of BHK indicator cells (1.5 x 106/ml) . Ten ⁇ l of each of these mixtures was transferred to the wells of Terasaki plates (Nunc) .
- the Terasaki plates were incubated for 20 hours at 37°C in a humidified atmosphere of 95% air and 5% C0 2 . The plates were then washed 3x with PBS and the cells fixed by the addition of ice-cold acetone (90%) for 20 minutes.
- Fig. 6B shows the presence of neutralizing antibodies in sera.
- Example 4 AlMV constructs not involving TMV nucleic acid
- AlMV constructs free of TMV RNA analogous to those described above are constructed in a matter analogous to the TMV recombinant constructs.
- AlMV nucleic acid is substituted for the TMV RNA.
- the structure of the AlMV genome is published and the required functions coded for by the AlMV genome have been mapped. (Bol et al . , Virology 4_6, 73 (1971) ; Bol et al., Virology 58 . , 101 (1974)).
- mice with AIMV/TMV construct containing recombinant AlMV CP carrying chimeric rabies peptide Drg24 and challenge of immunized mice with CVS-24 strain rabies virus Eight week old female Swiss -Webster , outbred mice were immunized with 50 mg per dose of recombinant TMV virus engineered to express the recombinant AlMV CP (CPDrg24) carrying chimeric epitome (DRg24) of rabies virus. Three immunizations of 0.1 ml were administered intra-peritoneally at intervals of 2 weeks. No adjuvant was used in this experiment . An equal quantity of a mixture of wild type AMV plus TMV was used as a control.
- mice 24 strain rabies virus. All control mice (nonim unized and mice immunized with vector only) died by day 6 to 7 while 40% of CPDrg24 immunized mice were protected. 60% of CPDrg24 immunized mice died by day 15-16. However, all immunized mice survived longer than either the control or nonimmunized mice, indicating some level of protective immunity for all immunized mice .
- the results of the challenge experiment are presented m Table 2.
- Example 6 Immunization of mice with an A1MV/TMV construct containing recombinant AlMV CP carrying the V3 loop of HIV-1 MN strain.
- mice Eight week old female Swiss-Webster, outbred mice were immunized with 10 mg per dose of recombinant TMV virus engineered to express the recombinant AlMV CP (CPMNV3) carrying V3 loop of HIV-1 MN strain Seven immunizations of 0.1 ml were administered mtra-peritoneally at intervals of 2 weeks Three immunizations of 0 1 ml were administered mtra-peritoneally at intervals of 2 weeks each with and without complete Freund's adjuvant (CFA) at 1:3, vol:vol ratio .An equal quantity of a mixture of wild type AMV plus TMV (30B/A1MV in Fig 8) was used with and without CFA as a control.
- CFA complete Freund's adjuvant
- the HTLV-I/MT2 cell lines (obtained from the NIH AIDS Research and References Reagent Program) were used as target cells in the HIV-1 neutralization assay. These cells were maintained in RPMI 1640 medium supplemented with 10% FBS, penicillin- streptomycin and pyruvate. The cell-free HIV-l/MN isolate was propagated in HTLV-1/MT2 cells as described. Cell-free virus (100 TCID50) was preincubated with different dilutions of heat -inactivated preimmune or immune sera for 1 hr at 37o c. Following incubation, the serum-treated virus was used to infect HTLV-I/MT2 cells. Syncytia formation was evaluated 5 days after inoculation of HTLV-I/MT2 cells by phase contrast microscopy.
- mice with AMV/TMV construct containing recombinant AIMVCP carrying chimeric rabies peptide Drg2 Eight week old female Swiss-Webster, outbred mice were immunized via gastric intubation with 250 mg per dose of recombinant TMV virus engineered to express the AlMV CP
- CPDrg24 carrying chimeric epitope (Drg24) of rabies virus.
- Five immunizations of 0.1 ml were administered orally at intervals of 2 weeks. No adjuvant was used in this experiment.
- An equal quantity of a mixture of wild type AMV plus TMV (A/TMV in Fig. 9A and 9B) was used as a control.
Landscapes
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- General Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gastroenterology & Hepatology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Virology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP10511934A JP2001500487A (ja) | 1996-08-28 | 1997-08-28 | 植物ウイルスコートタンパク質と融合したポリペプチド |
| CA002264571A CA2264571A1 (en) | 1996-08-28 | 1997-08-28 | Polypeptides fused with alfalfa mosaic virus or ilarvirus capsid |
| EP97941378A EP1006782B1 (en) | 1996-08-28 | 1997-08-28 | Polypeptides fused with alfalfa mosaic virus or ilarvirus capsid |
| DE69735854T DE69735854D1 (de) | 1996-08-28 | 1997-08-28 | Polypeptide, die mit alfalfamosaikviralen oder ilarviralen kapsiden fusioniert sind |
| US09/242,881 US6448070B1 (en) | 1996-08-28 | 1997-08-28 | Polypeptides fused with alfalfa mosaic virus or ilarvirus capsid |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US08/704,856 US6042832A (en) | 1996-08-28 | 1996-08-28 | Polypeptides fused with alfalfa mosaic virus or ilarvirus capsid proteins |
| US08/704,856 | 1996-08-28 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO1998008375A1 true WO1998008375A1 (en) | 1998-03-05 |
Family
ID=24831131
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US1997/015200 Ceased WO1998008375A1 (en) | 1996-08-28 | 1997-08-28 | Polypeptides fused with alfalfa mosaic virus or ilarvirus capsid |
Country Status (7)
| Country | Link |
|---|---|
| US (2) | US6042832A (https=) |
| EP (1) | EP1006782B1 (https=) |
| JP (1) | JP2001500487A (https=) |
| AT (1) | ATE325882T1 (https=) |
| CA (1) | CA2264571A1 (https=) |
| DE (1) | DE69735854D1 (https=) |
| WO (1) | WO1998008375A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000046350A1 (en) * | 1999-02-05 | 2000-08-10 | Thomas Jefferson University | Production of biomedical peptides and proteins in plants using transcomplementation systems |
| EP1077600A4 (en) * | 1998-10-30 | 2003-04-09 | Univ Jefferson | PRODUCTION OF BIOMEDICAL PEPTIDES AND PROTEINS IN PLANTS USING VEGETABLE VECTORS |
| US6984486B1 (en) * | 1999-02-19 | 2006-01-10 | J. David Gladstone Institutes | Synthetic peptide of regulatory virus protein R (VPR) of human immunodeficiency virus type 1 (HIV-1) and the utilization thereof |
| US7641896B2 (en) | 2002-07-05 | 2010-01-05 | Folia Biotech Inc. | Adjuvant viral particle |
| US8101189B2 (en) | 2002-07-05 | 2012-01-24 | Folia Biotech Inc. | Vaccines and immunopotentiating compositions and methods for making and using them |
| US8951791B2 (en) | 2003-02-03 | 2015-02-10 | Ibio, Inc. | System for expression of genes in plants |
Families Citing this family (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6660500B2 (en) * | 1988-02-26 | 2003-12-09 | Large Scale Biology Corporation | Production of peptides in plants as viral coat protein fusions |
| US6846968B1 (en) * | 1988-02-26 | 2005-01-25 | Large Scale Biology Corporation | Production of lysosomal enzymes in plants by transient expression |
| US6544769B1 (en) * | 1996-12-13 | 2003-04-08 | Schering Corporation | Compostions comprising viruses and methods for concentrating virus preparations |
| US6730306B1 (en) * | 2000-03-08 | 2004-05-04 | Large Scale Biology Corporation | Parvovirus vaccine as viral coat protein fusions |
| US20020061309A1 (en) * | 2000-03-08 | 2002-05-23 | Garger Stephen J. | Production of peptides in plants as N-terminal viral coat protein fusions |
| WO2004044161A2 (en) | 2002-11-06 | 2004-05-27 | Fraunhofer Usa | Expression of foreign sequences in plants using trans-activation system |
| US7692063B2 (en) * | 2002-11-12 | 2010-04-06 | Ibio, Inc. | Production of foreign nucleic acids and polypeptides in sprout systems |
| US7683238B2 (en) * | 2002-11-12 | 2010-03-23 | iBio, Inc. and Fraunhofer USA, Inc. | Production of pharmaceutically active proteins in sprouted seedlings |
| WO2005026375A2 (en) | 2003-05-22 | 2005-03-24 | Fraunhofer Usa, Inc. | Recombinant carrier molecule for expression, delivery and purification of target polypeptides |
| US20070150976A1 (en) * | 2003-12-09 | 2007-06-28 | Ventria Bioscience | High-level expression of fusion polypeptides in plant seeds utilizing seed-storage proteins as fusion carriers |
| EP1699820A2 (en) * | 2003-12-31 | 2006-09-13 | Schering-Plough Ltd. | Neutralizing epitope-based growth enhancing vaccine |
| EP1769068B1 (en) | 2004-02-20 | 2014-12-31 | iBio, Inc. | Systems and methods for clonal expression in plants |
| US7928290B2 (en) * | 2004-02-27 | 2011-04-19 | Dow Agrosciences Llc | Viral capsid fusion peptide expressing plant cells |
| BRPI0515777A (pt) * | 2004-12-11 | 2008-08-05 | Cytogenix Inc | biossìntese isenta de células de ácido nucléico de alta qualidade e usos dos mesmos |
| CA2594276A1 (en) * | 2004-12-30 | 2006-07-13 | Schering-Plough Ltd. | Neutralizing epitope-based growth enhancing vaccine |
| BRPI0611336A2 (pt) | 2005-06-01 | 2010-08-31 | Dow Global Technologies Inc | método para produzir uma partìcula multivalente semelhante a vìrus, partìcula multivalente semelhante a vìrus, método de aumentar a solubilidade de uma partìcula multivalente semelhante a vìrus e vacina |
| JP2009502207A (ja) * | 2005-08-03 | 2009-01-29 | フラウンホーファー ユーエスエー, インコーポレイテッド | イムノグロブリンの産生のための組成物および方法 |
| CA2637600A1 (en) | 2006-01-17 | 2007-07-26 | Health Research, Inc. | Heteroduplex tracking assay |
| US8277816B2 (en) * | 2006-02-13 | 2012-10-02 | Fraunhofer Usa, Inc. | Bacillus anthracis antigens, vaccine compositions, and related methods |
| BRPI0707733B1 (pt) * | 2006-02-13 | 2019-12-31 | Ibio, Inc. | antígeno isolado, composição de vacina, uso da referida composição e método para produção de uma proteína de antígeno |
| KR20080106434A (ko) * | 2006-02-13 | 2008-12-05 | 프라운호퍼 유에스에이, 인코포레이티드 | Hpv 항원, 백신 조성물 및 관련된 방법 |
| WO2009016433A2 (en) * | 2006-09-15 | 2009-02-05 | Ottawa Health Research Institute | Oncolytic rhabdovirus |
| JP2010508857A (ja) | 2006-11-15 | 2010-03-25 | フォリア バイオテック インコーポレイテッド | パパイヤモザイクウイルスに基づく免疫原性の親和性で複合体化された抗原系及びその使用 |
| CA2669485C (en) * | 2006-11-15 | 2017-01-03 | Folia Biotech Inc. | Papaya mosaic virus-based vaccines for influenza |
| EP2152301A4 (en) * | 2007-04-28 | 2010-07-28 | Fraunhofer Usa Inc | TRYPANOSOMAANTIGEN, VACCINE COMPOSITIONS AND RELATED METHODS |
| WO2009009759A2 (en) | 2007-07-11 | 2009-01-15 | Fraunhofer Usa, Inc. | Yersinia pestis antigens, vaccine compositions, and related methods |
| WO2009076778A1 (en) | 2007-11-27 | 2009-06-25 | Medicago Inc. | Recombinant influenza virus-like particles (vlps) produced in transgenic plants expressing hemagglutinin |
| CA2615372A1 (en) | 2007-07-13 | 2009-01-13 | Marc-Andre D'aoust | Influenza virus-like particles (vlps) comprising hemagglutinin |
| JP2010538619A (ja) * | 2007-09-11 | 2010-12-16 | ユニベルシテ ラヴァル | Malvaモザイクウイルスおよびウイルス様粒子およびこれらの使用 |
| NZ590351A (en) * | 2008-07-18 | 2012-11-30 | Medicago Inc | HA1 domain totally or partially free of N-linked glycosylation operatively linked to a regulatory region |
| US8734803B2 (en) | 2008-09-28 | 2014-05-27 | Ibio Inc. | Humanized neuraminidase antibody and methods of use thereof |
| HUE039100T2 (hu) | 2009-06-24 | 2018-12-28 | Medicago Inc | Hemagglutinint tartalmazó kimer influenzavírus-jellegû részecskék |
| KR101773431B1 (ko) | 2009-09-22 | 2017-09-12 | 메디카고 인코포레이티드 | 식물-유래 vlp의 제조방법 |
| US8784819B2 (en) | 2009-09-29 | 2014-07-22 | Ibio Inc. | Influenza hemagglutinin antibodies, compositions and related methods |
| RU2699982C2 (ru) | 2014-01-10 | 2019-09-11 | Медикаго Инк. | Энхансерные элементы cpmv |
| KR102696265B1 (ko) * | 2021-02-25 | 2024-08-21 | 주식회사 바이오앱 | 식물 발현 시스템을 이용한 알팔파 모자이크 바이러스 유사 입자 제조 방법 및 이의 활용 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1992018618A1 (en) * | 1991-04-19 | 1992-10-29 | Agricultural Genetics Company Limited | Modified plant viruses as vectors |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB8421282D0 (en) * | 1984-08-22 | 1984-09-26 | Connaught Lab | Multispecific antigenic proteins |
| CA1288073C (en) | 1985-03-07 | 1991-08-27 | Paul G. Ahlquist | Rna transformation vector |
| US5466788A (en) | 1985-03-07 | 1995-11-14 | Mycogen Plant Science, Inc. | Subgenomic promoter |
| US4956282A (en) * | 1985-07-29 | 1990-09-11 | Calgene, Inc. | Mammalian peptide expression in plant cells |
| US5041385A (en) * | 1986-11-01 | 1991-08-20 | Oxford Gene Systems Limited | Vector expressing fusion proteins and particles |
| US5316931A (en) * | 1988-02-26 | 1994-05-31 | Biosource Genetics Corp. | Plant viral vectors having heterologous subgenomic promoters for systemic expression of foreign genes |
| US5977438A (en) * | 1988-02-26 | 1999-11-02 | Biosource Technologies, Inc. | Production of peptides in plants as viral coat protein fusions |
| US5612487A (en) * | 1991-08-26 | 1997-03-18 | Edible Vaccines, Inc. | Anti-viral vaccines expressed in plants |
| WO1995021248A1 (en) * | 1994-02-03 | 1995-08-10 | The Scripps Research Institute | Method for using tobacco mosaic virus to overproduce peptides and proteins |
| US5862541A (en) * | 1997-10-06 | 1999-01-26 | Mailhot; Louis | Swimming pool skimmer well frog rescue device |
-
1996
- 1996-08-28 US US08/704,856 patent/US6042832A/en not_active Expired - Lifetime
-
1997
- 1997-08-28 CA CA002264571A patent/CA2264571A1/en not_active Abandoned
- 1997-08-28 DE DE69735854T patent/DE69735854D1/de not_active Expired - Lifetime
- 1997-08-28 US US09/242,881 patent/US6448070B1/en not_active Expired - Lifetime
- 1997-08-28 WO PCT/US1997/015200 patent/WO1998008375A1/en not_active Ceased
- 1997-08-28 EP EP97941378A patent/EP1006782B1/en not_active Expired - Lifetime
- 1997-08-28 AT AT97941378T patent/ATE325882T1/de not_active IP Right Cessation
- 1997-08-28 JP JP10511934A patent/JP2001500487A/ja not_active Ceased
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1992018618A1 (en) * | 1991-04-19 | 1992-10-29 | Agricultural Genetics Company Limited | Modified plant viruses as vectors |
Non-Patent Citations (1)
| Title |
|---|
| THE EMBO JOURNAL, 1994, Vol. 13, No. 3, BAER et al., "Specific RNA Binding by Amino-Terminal Peptides of Alfalfa Mosaic Virus Coat Protein", pages 727-735. * |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1077600A4 (en) * | 1998-10-30 | 2003-04-09 | Univ Jefferson | PRODUCTION OF BIOMEDICAL PEPTIDES AND PROTEINS IN PLANTS USING VEGETABLE VECTORS |
| WO2000046350A1 (en) * | 1999-02-05 | 2000-08-10 | Thomas Jefferson University | Production of biomedical peptides and proteins in plants using transcomplementation systems |
| US6984486B1 (en) * | 1999-02-19 | 2006-01-10 | J. David Gladstone Institutes | Synthetic peptide of regulatory virus protein R (VPR) of human immunodeficiency virus type 1 (HIV-1) and the utilization thereof |
| US7641896B2 (en) | 2002-07-05 | 2010-01-05 | Folia Biotech Inc. | Adjuvant viral particle |
| US8101189B2 (en) | 2002-07-05 | 2012-01-24 | Folia Biotech Inc. | Vaccines and immunopotentiating compositions and methods for making and using them |
| US8282940B2 (en) | 2002-07-05 | 2012-10-09 | Folia Biotech Inc. | Adjuvant viral particle |
| US9339535B2 (en) | 2002-07-05 | 2016-05-17 | Folia Biotech, Inc. | Vaccines and immunopotentiating compositions and methods for making and using them |
| US8951791B2 (en) | 2003-02-03 | 2015-02-10 | Ibio, Inc. | System for expression of genes in plants |
| US9551001B2 (en) | 2003-02-03 | 2017-01-24 | Ibio, Inc. | System for expression of genes in plants |
| US9765349B2 (en) | 2003-02-03 | 2017-09-19 | Ibio, Inc. | System for expression of genes in plants |
Also Published As
| Publication number | Publication date |
|---|---|
| EP1006782A1 (en) | 2000-06-14 |
| DE69735854D1 (de) | 2006-06-14 |
| US6448070B1 (en) | 2002-09-10 |
| US6042832A (en) | 2000-03-28 |
| ATE325882T1 (de) | 2006-06-15 |
| CA2264571A1 (en) | 1998-03-05 |
| JP2001500487A (ja) | 2001-01-16 |
| EP1006782A4 (en) | 2004-03-03 |
| EP1006782B1 (en) | 2006-05-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US6448070B1 (en) | Polypeptides fused with alfalfa mosaic virus or ilarvirus capsid | |
| CA2170412C (en) | Modified plant viruses as vectors of heterologous peptides | |
| Marquet-Blouin et al. | Neutralizing immunogenicity of transgenic carrot (Daucus carota L.)-derived measles virus hemagglutinin | |
| Yusibov et al. | Expression in plants and immunogenicity of plant virus-based experimental rabies vaccine | |
| Huang et al. | Plant-derived measles virus hemagglutinin protein induces neutralizing antibodies in mice | |
| Yusibov et al. | Plant viral vectors based on tobamoviruses | |
| EP0793717B1 (en) | Oral immunization with transgenic plants | |
| US6884623B1 (en) | Modified plant viruses as vectors of heterologous peptides | |
| Molina et al. | Induction of neutralizing antibodies by a tobacco chloroplast-derived vaccine based on a B cell epitope from canine parvovirus | |
| JP7145083B2 (ja) | 高等植物の葉緑体におけるトランス遺伝子発現を増加させるためのコドン最適化及びリボソームプロファイリング | |
| Ma et al. | Plant expression systems for the production of vaccines | |
| CN112135630A (zh) | 猪瘟疫苗组合物及其制备方法 | |
| CN113490508B (zh) | 猪流行性腹泻(ped)病毒疫苗组合物及其制备方法 | |
| CA2414396A1 (en) | Production of vaccines using transgenic plants | |
| US20040057969A1 (en) | Compositions containing stabilized hepatitis antigen and methods of their use | |
| CN111565747B (zh) | 与猪fc片段融合的抗原,以及包含该抗原的疫苗组合物 | |
| US20120121635A1 (en) | Expression in plants of HIV-related proteins | |
| WO1996040229A1 (en) | Vaccines synthesized by transgenic plants | |
| JP4769977B2 (ja) | ワクチン遺伝子導入イネ | |
| EP1167530A9 (en) | PVX capsid-antigen fusion protein, chimaeric viral particles displaying it on the capsid, plants infected with said particles, their uses and compositions comprising them | |
| WO1998056933A1 (en) | Polypeptide presentation system | |
| Alli et al. | Pharming vaccines for hepatitis and cytomegalovirus: towards the development of multivalent and subunit vaccines for oral delivery of antigens | |
| Yusibov et al. | Plant viral expression vectors: history and new developments | |
| Lomonossoff | Antigen Delivery Systems III: Use of Recombinant Plant Viruses | |
| CA2510482A1 (en) | Recombinant hepatitis a virus antigens obtained in plant cells |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): CA JP US |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): AT BE CH DE DK ES FI FR GB GR IE IT LU MC NL PT SE |
|
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| ENP | Entry into the national phase |
Ref document number: 2264571 Country of ref document: CA Ref country code: JP Ref document number: 1998 511934 Kind code of ref document: A Format of ref document f/p: F Ref country code: CA Ref document number: 2264571 Kind code of ref document: A Format of ref document f/p: F |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1997941378 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 1997941378 Country of ref document: EP |
|
| WWG | Wipo information: grant in national office |
Ref document number: 1997941378 Country of ref document: EP |