WO1991006637A1 - Subtilisin mutants - Google Patents

Subtilisin mutants Download PDF

Info

Publication number
WO1991006637A1
WO1991006637A1 PCT/US1990/006084 US9006084W WO9106637A1 WO 1991006637 A1 WO1991006637 A1 WO 1991006637A1 US 9006084 W US9006084 W US 9006084W WO 9106637 A1 WO9106637 A1 WO 9106637A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
carbonyl
mutant
bacillus
εubtiliεin
Prior art date
Application number
PCT/US1990/006084
Other languages
French (fr)
Inventor
Robert Mark Caldwell
David Aaron Estell
Thomas Paul Graycar
Original Assignee
Genencor International, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=27028376&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO1991006637(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to DK90915958T priority Critical patent/DK0451244T3/en
Priority to KR1019910700677A priority patent/KR970004938B1/en
Priority to DK96120247T priority patent/DK0775749T4/en
Priority to BR909006993A priority patent/BR9006993A/en
Priority to EP90915958A priority patent/EP0451244B9/en
Application filed by Genencor International, Inc. filed Critical Genencor International, Inc.
Priority to CA002044630A priority patent/CA2044630C/en
Priority to DE69032852T priority patent/DE69032852T2/en
Priority to TR90/1065A priority patent/TR25991A/en
Publication of WO1991006637A1 publication Critical patent/WO1991006637A1/en
Priority to FI913166A priority patent/FI103052B1/en
Priority to NO912567A priority patent/NO301081B1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • C11D3/38609Protease or amylase in solid compositions only
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/38Products with no well-defined composition, e.g. natural products
    • C11D3/386Preparations containing enzymes, e.g. protease or amylase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N1/00Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
    • C12N1/20Bacteria; Culture media therefor
    • C12N1/205Bacterial isolates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102Mutagenizing nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/74Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
    • C12N15/75Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for Bacillus
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/18Carboxylic ester hydrolases (3.1.1)
    • C12N9/20Triglyceride splitting, e.g. by means of lipase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/52Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
    • C12N9/54Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea bacteria being Bacillus
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P7/00Preparation of oxygen-containing organic compounds
    • C12P7/64Fats; Fatty oils; Ester-type waxes; Higher fatty acids, i.e. having at least seven carbon atoms in an unbroken chain bound to a carboxyl group; Oxidised oils or fats
    • C12P7/6409Fatty acids
    • C12P7/6418Fatty acids by hydrolysis of fatty acid esters
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12RINDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
    • C12R2001/00Microorganisms ; Processes using microorganisms
    • C12R2001/01Bacteria or Actinomycetales ; using bacteria or Actinomycetales
    • C12R2001/07Bacillus

Definitions

  • the present invention relates to novel carbonyl hydrolase mutants having an amino acid sequence wherein one or more amino acid residues of- a precursor carbonyl hydrolase, specifically those at positions corresponding to residues +123 and/or +274 in Bacillus amyloliquefaciens subtilisin, have been substituted with a different amino acid.
  • Such mutant carbonyl hydrolases in general, are obtained by in vitro modification of a precursor DNA sequence encoding a naturally-occurring or recombinant carbonyl hydrolase to encode the substitution of one or both of these amino acid residues in a precursor amino acid sequence alone or in combination with other substitution, insertion or deletion in the precursor amino acid sequence.
  • Serine proteases are a subgroup of carbonyl hydrolase.
  • Subtilisin is a serine endoprotease (MW 27,500) which is secreted in large amounts from a wide variety of Bacillus species and other microorganisms.
  • the protein sequence of subtilisin has been determined from at least four different species of Bacillus. Markland, F.S., et al. (1983), Honne-Seyler's Z. Phvsiol. Chem..364.1537- 1540.
  • the three-dimensional crystallographic structure of Bacillus amyloliquefaciens subtilisin to 2.5A resolution has also been reported. Wright, C.S. , et al. (1969), Nature. 221.235-242; Drenth, J., et al. (1972), Eur. J.
  • subtilisin is genetically unrelated to the mammalian serine proteases, it has a similar active site structure.
  • the x-ray crystal structures of subtilisin containing covalently bound peptide inhibitors Robottus, J.D., et al. (1972), Biochemistry. 11. 2439- 2449), or product complexes (Robertus, J.D., et al. (1976), J. Biol. Chem.. 251. 1097-1103
  • subtilisin Philipp, M., et al.
  • subtilisin enzymes made by mutating a nucleotide sequence coding for a subtilisin. Numerous amino acid residues are identified in each of these publications which may be so modified. However, as with the previously identified references, neither identifies the residues of the present invention.
  • Another object of the invention is to provide host cells transformed with such vectors a ⁇ well as host cells which are capable of expressing such DNA to produce carbonyl hydrolase mutants either intracellularly or extracellularly.
  • the invention includes non-naturally occurring carbonyl hydrolase mutants having a different proteolytic activity, stability, and/or performance characteristic as " compared to the precursor carbonyl hydrolase from which the amino acid sequence of the mutant is derived.
  • the precur ⁇ or carbonyl hydrolase may be a naturally- occurring carbonyl hydrolase or recombinant hydrolase.
  • such carbonyl hydrolase mutants have an amino acid sequence, not found in nature, which is derived by replacement of one or more amino acid residues of a precursor carbonyl hydrolase with one or more different amino acids.
  • the one or more amino acid residue ⁇ of the precur ⁇ or enzyme correspond to position ⁇ A ⁇ n +123 and/or Ala +274 of Bacillus a yloli ⁇ uefaciens subtilisin or equivalent amino acid residue ⁇ in other carbonyl hydrola ⁇ es or ⁇ ubtilisins.
  • the invention also includes mutant DNA sequences encoding such carbonyl hydrolase or subtilisin mutants.
  • mutant DNA sequence ⁇ are derived from a precur ⁇ or DNA sequence which encodes a naturally-occurring or recombinant precursor enzyme.
  • the mutant DNA sequence ⁇ are derived by modifying the precursor DNA sequence to encode the substitution of one or more ⁇ pecific amino acid residues encoded by the precur ⁇ or DNA ⁇ equence corre ⁇ ponding to position +123 and/or +274 in Bacillus amyloliquefaciens.
  • These recombinant DNA sequences encode carbonyl hydrolase mutants having a novel amino acid sequence and, in general, at least one property which is ⁇ ubstantially different from the same property of the enzyme encoded by the precursor carbonyl hydrola ⁇ e DNA ⁇ equence.
  • Such propertie ⁇ include proteolytic activity, stability and/or enhanced performance characteristics.
  • the invention also includes procaryotic and eucaryotic subtili ⁇ ins with a different amino acid re ⁇ idue such as serine, at positions equivalent to Asn +123 in Bacillus amyloliquefaciens subtilisin and to subtilisin with different amino acid re ⁇ idues at positions equivalent to position +274 in Bacillus amyloliquefaciens subtilisin.
  • a different amino acid re ⁇ idue such as serine
  • the invention includes expression vectors containing such mutant carbonyl hydrolase DNA sequences as well as host cells transformed with ⁇ uch vectors which are capable of producing such mutants.
  • the invention also relates to detergent composition ⁇ compri ⁇ ing the carbonyl hydrola ⁇ e mutant ⁇ of the invention.
  • Fig. 1 depicts the DNA and amino acid sequence for Bacillus a yloliquefaciens subtili ⁇ in and a partial restriction map of this gene.
  • Fig. 2 depict ⁇ the conserved amino acid residue ⁇ among subtilisin ⁇ from Bacillus amyloliquefaciens. Bacillus subtilis varI168 and Bacillus licheniformis (carlsbergensis) .
  • Fig ⁇ . 3A and 3B depict the amino acid ⁇ equence of ⁇ ubtili ⁇ in from Bacillus amyloli uefacien ⁇ . Bacillu ⁇ ⁇ ubtili ⁇ varI168 and Bacillus licheniformis.
  • Fig. 4 depicts the amino acid sequence of three subtili ⁇ ins.
  • the top line represent ⁇ the amino acid ⁇ equence of subtilisin from Bacillus amyloliquefaciens subtilisin (also sometimes referred to as ⁇ ubtili ⁇ in BPN 1 ).
  • the ⁇ econd line depicts the amino acid ⁇ equence of ⁇ ubtili ⁇ in from Bacillus lentus (subtilisin 309 in PCT Publication No. WO 89/06276) .
  • the bottom line represents the amino acid sequence of a preferred embodiment of the invention designated GG-RYSA.
  • the symbol * denotes the absence of specific amino acid residues as compared to subtili ⁇ in BPN 1 .
  • Fig. 5 depict ⁇ the construction of pla ⁇ mid pGG A274.
  • Fig. 6 depicts the construction of pGG-KVNA which i ⁇ an intermediate to pla ⁇ mid pGG-RYSA.
  • Fig. 7 depict ⁇ the oligonucleotide-duplex method u ⁇ ed to con ⁇ truct a ⁇ ynthetic Bacillu ⁇ lentu ⁇ subtili ⁇ in gene.
  • Fig.8 depicts the strategy for con ⁇ tructing a ⁇ ynthetic gene encoding Bacillus lentus subtili ⁇ in.
  • Fig. 9 depicts the cassette used to make ⁇ ubstitutions in the DNA at codon po ⁇ ition +123 by ca ⁇ ette mutagene ⁇ i ⁇ .
  • XXX repre ⁇ ent ⁇ the codon modified to encode the amino acid ⁇ ub ⁇ titution ⁇ at po ⁇ ition +123.
  • Fig. 10 depict ⁇ the DNA and amino acid sequence of a preferred embodiment of the invention wherein the DNA ⁇ equence is a ⁇ ynthetic DNA.
  • the DNA in thi ⁇ Figure ha ⁇ been modified to encode arginine at po ⁇ ition 27, ⁇ erine at po ⁇ ition 78, tyro ⁇ ine at po ⁇ ition 104, ⁇ erine at po ⁇ ition 123 and alanine at po ⁇ ition 274.
  • subtilisinmutants exhibiting altered stability, e.g. modified autoproteolytic stability.
  • the ⁇ e latter mutants also exhibit enhanced performance when used in detergent compositions.
  • Carbonyl hydrolases are enzymes which hydrolyze compounds containing
  • Naturally-occurring carbonyl hydrolase ⁇ principally include hydrola ⁇ e ⁇ , e.g. peptide hydrolases, such as ⁇ ubtilisins or metalloproteases.
  • Peptide hydrola ⁇ es include ⁇ -aminoacylpeptide hydrolase, peptidylamino acid hydrolase, acylamino hydrolase, ⁇ erinecarboxypeptidase, metallocarboxypeptida ⁇ e, thiol proteina ⁇ e, carboxylproteinase and metalloproteinase. Serine, metallo, thiol and acid proteases are included, as well as endo and exo-proteases.
  • Recombinant carbonyl hydrolase refers to a carbonyl hydrolase in which the DNA sequence encoding the naturally-occurring carbonyl hydrola ⁇ e i ⁇ modified to produce a mutant DNA ⁇ equence which encode ⁇ the ⁇ ub ⁇ titution, in ⁇ ertion or deletion of one or more amino acid ⁇ in the carbonyl hydrola ⁇ e amino acid ⁇ equence.
  • Subtili ⁇ in ⁇ are bacterial or fungal carbonyl hydrola ⁇ es which generally act to cleave peptide bond ⁇ of proteins or peptides.
  • subtili ⁇ in means a naturally-occurring subtili ⁇ in or a recombinant ⁇ ubtilisin.
  • a memori ⁇ of naturally-occurring ⁇ ubtili ⁇ ins is known to be produced and often ⁇ ecreted by various microbial specie ⁇ .
  • Amino acid ⁇ equence ⁇ of the members of this ⁇ erie ⁇ are not entirely homologous. However, the subtili ⁇ ins in this series exhibit the same or similar type of proteolytic activity.
  • This clas ⁇ of serine protea ⁇ e ⁇ shares a common amino acid sequence defining a catalytic triadwhich distingui ⁇ he ⁇ themfrom the chymotryp ⁇ in related cla ⁇ s of ⁇ erine protea ⁇ e ⁇ .
  • the subtili ⁇ in ⁇ and chymotryp ⁇ in related serine protea ⁇ e ⁇ both have a catalytic triad compri ⁇ ing aspartate, hi ⁇ tidine and serine.
  • the ⁇ ubtilisin related protease ⁇ the relative order of the ⁇ e amino acid ⁇ , reading from the amino to carboxy terminu ⁇ i ⁇ aspartate- histidine-serine.
  • subtili ⁇ in herein refer ⁇ to a ⁇ erine protea ⁇ e having the catalytic triad of subtili ⁇ in related protea ⁇ e ⁇ . Examples include the subtilisin ⁇ identified in Fig. 3 herein and as described in PCT Publication WO 89/06276 and EPO Publication No. 0 283 075.
  • Recombinant subtilisin refers to a subtili ⁇ in inwhich the DNA ⁇ equence encoding the ⁇ ubtili ⁇ in i ⁇ modified to produce a mutant DNA ⁇ equence which encodes the sub ⁇ titution, deletion or insertion of one or more amino acids in the naturally-occurring subtilisin amino acid sequence.
  • Suitable methods to produce suchmodification and which may be combined with those disclosed herein include those disclosed in EPO Publication Nos. 0 130 756 and 0 251 446 and PCT Publication Nos. W0 89/06279, W0 89/09830 and W0 89/09819.
  • Non-human carbonyl hydrolases and the DNA encoding them may be obtained from many procaryotic and eucaryotic organi ⁇ ms.
  • Suitable example ⁇ of procaryotic organism ⁇ include gram negative organisms such as £. coli or Pseudomonas and gram positive bacteria such a ⁇ Micrococcus or Bacillus.
  • Examples of eucaryotic organism ⁇ from which carbonyl hydrola ⁇ e and their gene ⁇ may be obtained include yeast such as Saccaromycees cerevisiae. fungi such as Asper illus sp. , and non-human mammalian ⁇ ource ⁇ ⁇ uch a ⁇ , for example, bovine ⁇ p.
  • non-human carbonyl hydrolase a ⁇ u ⁇ ed herein has a functional definition which refer ⁇ to carbonyl hydrolases which are as ⁇ ociated, directlyor indirectly, withprocaryoticand eucaryotic ⁇ ource ⁇ .
  • a “carbonyl hydrolase mutant” has an amino acid sequence which is derived from the amino acid sequence of a "precursor carbonyl hydrolase".
  • the precursor carbonyl hydrolases include naturally-occurring carbonyl hydrola ⁇ e ⁇ and recombinant carbonyl hydrola ⁇ e ⁇ .
  • Such modification i ⁇ - of the "precur ⁇ or DNA sequence" which encodes the amino acid sequence of the precursor carbonyl hydrolase rather than manipulation of the precur ⁇ or carbonyl hydrola ⁇ e enzyme per ⁇ e.
  • Suitable methods for such manipulation of the precursor DNA sequence include methods disclosed herein and in EPO Publication Nos. 0 130 756 and 0 251 446.
  • a residue (amino acid) of a precur ⁇ or carbonyl hydrola ⁇ e is equivalent to a re ⁇ idue of Bacillu ⁇ amyloliquefaciens subtilisin if it is either homologous (i.e., corresponding in position in either primary or tertiary structure) or analogous to a specific residue or portion of that residue in Bacillu ⁇ amyloliquefacien ⁇ ⁇ ubtilisin (i.e., having the same or similar functional capacity to combine, react, or interact chemically) .
  • the amino acid sequence of a precursor carbonyl hydrolase is directly compared to the Bacillus amyloliquefaciens ⁇ ubtili ⁇ in primary sequence and particularly to a ⁇ et of re ⁇ idues known to be invariant in all subtili ⁇ in ⁇ for which ⁇ equence i ⁇ known (Fig. 2).
  • the re ⁇ idue ⁇ equivalent to particular amino acids in the primary ⁇ equence of Bacillus amyloliquefaciens ⁇ ubtili ⁇ in are defined. Alignment of conserved residues preferably should conserve 100% of such residues. However, alignment of greater than 75% or a ⁇ little as 50% of conserved residues is also adequate to define equivalent residue ⁇ . Con ⁇ ervation of the catalytic triad, Asp32/Hi ⁇ 64/Ser221 ⁇ hould be maintained.
  • Fig. 3 the amino acid ⁇ equence of ⁇ ubtilisin from Bacillus amyloliquefaciens. Bacillus subtilis var. 1168 and Bacillus lichenformis (carlsbergensis) are aligned to provide the maximum amount of homology between amino acid sequences. A comparison of these sequences shows that there are a number of conserved residues contained in each sequence. These are the residues identified in Fig. 2.
  • conserved residues thus may be u ⁇ ed to define the corre ⁇ pondingequivalent amino acid re ⁇ idue ⁇ ofBacillu ⁇ amyloliquefaciens ⁇ ubtilisin in other carbonyl hydrola ⁇ e ⁇ such as subtilisin from Bacillus lentus (PCT Publication No. W089/06279 published July 13, 1989) and the preferred ⁇ ubtilisin mutant herein.
  • subtilisin from Bacillus lentus
  • ⁇ ubtilisin mutant herein.
  • These particular amino acid sequence ⁇ are aligned in Fig. 4 with the sequence of Bacillus amyloliquefaciens subtilisin to produce the maximum homology of conserved residues.
  • the amino acid at po ⁇ ition 123 i ⁇ a ⁇ paragine in Bacillus amyloliquefaciens subtili ⁇ in In Bacillus lentus subtili ⁇ in the equivalent re ⁇ idue i ⁇ the particular a ⁇ paragine shown. In the preferred subtili ⁇ in mutant of the invention, however, the amino acid equivalent to +123 in Bacillus amyloliquefaciens subtilisin is an amino acid other than asparagine and is preferably the serine ⁇ hown in Fig. 4. Similarly, in Fig. 4, the amino acid at po ⁇ ition +274 Bacillus amyloliquefaciens subtili ⁇ in i ⁇ alanine.
  • a ⁇ can be ⁇ een, the equivalent amino acid in Bacillus lentus subtili ⁇ in is the particular threonine shown in Fig. 4.
  • the po ⁇ ition ⁇ +123 and +274 are identified by primary amino acid sequences in Fig. 4 for the subtilisin from Bacillus lentus and the preferred embodiment of the invention.
  • various other amino acid re ⁇ idue ⁇ may be modified which are equivalent to specific amino acids in Bacillus amyloliquefaciens subtilisin.
  • the amino acid lysine at po ⁇ ition 27 in Bacillu ⁇ amyloliquefacien ⁇ subtili ⁇ i ⁇ has an equivalent lysine at position 27 in Bacillus lentus ⁇ ubtili ⁇ in.
  • modifications to the DNA included the modification of codons equivalent to positions 123 and 274 of Bacillus amyloliquefaciens subtili ⁇ in.
  • two other modifications were made to the Bacillus lentus amino acid sequence at po ⁇ itions equivalent to residue ⁇ 27 and 104 in Bacillus amyloliquefaciens subtilisin.
  • the lysine at equivalent residue 27 in Bacillus lentus subtilisin was modified to encode arginine in the preferred embodiment.
  • the valine residue at position 104 of Bacillus lentus. which is equivalent to tyrosine 104 in Bacillus amyloliquefaciens subtilisin was also modified to encode tyrosine.
  • the preferred embodiment shown in Fig. 4 contains an amino acid sequence derived from Bacillus lentus subtili ⁇ in by modifying residues of that subtili ⁇ in equivalent to positions 27, 104, 123 and 274 of Bacillus amyloliquefaciens subtilisin.
  • Equivalent residues may also be defined by determining homology at the level of tertiary structure for a precur ⁇ or carbonyl hydrolase whose tertiary structure has been determined by x-ray crystallography.
  • Equivalent re ⁇ idues are defined as those for which the atomic coordinates of two or more of the main chain atoms of a particular amino acid residue of the precur ⁇ or carbonyl hydrola ⁇ e and Bacillus amyloliquefaciens ⁇ ubtilisin (N on N, CA on CA, C on C, and 0 on O) are within 0.13nm and preferably O.ln after alignment.
  • Alignment is achieved after the best model has been oriented and positioned to give the maximum overlap of atomic coordinate ⁇ of non-hydrogen protein atom ⁇ of the carbonyl hydrola ⁇ e in que ⁇ tion to the Bacillus amyloliquefaciens ⁇ ubtili ⁇ in.
  • Equivalent residues which are functionally analogous to a specific residue of Bacillus amyloliquefaciens subtili ⁇ in are defined as those amino acids of the precursor carbonyl hydrolases which may adopt a conformation such that they either alter, modify or contribute to protein structure, substrate binding or catalysi ⁇ in a manner defined and attributed to a ⁇ pecific re ⁇ idue of the Bacillus amyloliquefaciens subtilisin.
  • residue ⁇ of the precur ⁇ or carbonyl hydrola ⁇ e (for which a tertiary ⁇ tructure ha ⁇ been obtained by x-ray cry ⁇ tallography) , which occupy an analogous position to the extent that although the main chain atoms of the given residue may not sati ⁇ fy the criteria of equivalence on the ba ⁇ i ⁇ of occupying a homologous position, the atomic coordinates of at least two of the ⁇ ide chain atoms of the residue lie with 0.13nm of the corre ⁇ ponding ⁇ ide chain atoms of Bacillus amyloliquefaciens subtili ⁇ in.
  • the coordinate ⁇ of the three dimen ⁇ ional ⁇ tructure of Bacillus amyloliquefaciens subtili ⁇ in are ⁇ et forth in EPO Publication No. 0 251 446 and can be u ⁇ ed a ⁇ outlined above to determine equivalent re ⁇ idues on the level of tertiary ⁇ tructure.
  • re ⁇ idues identified for substitution, insertion or deletion are con ⁇ erved re ⁇ idue ⁇ wherea ⁇ other ⁇ are not.
  • the replacement of one or more amino acids is limited to substitutions which produce a mutant which has an amino acid ⁇ equence that doe ⁇ not correspond to one found in nature.
  • such replacements should not result in a naturally- occurring sequence.
  • the carbonyl hydrolase mutants of the present invention include the mature forms of carbonyl hydrolase mutants as well as the pro- and prepro-forms of such hydrolase mutants.
  • the prepro- forms are the preferred construction since this facilitate ⁇ the expre ⁇ sion, secretion and maturation of the carbonyl hydrola ⁇ e utant ⁇ .
  • Protein refer ⁇ to a ⁇ equence of amino acid ⁇ bound to the N-terminal portion of the mature form of a carbonyl hydrolase which when removed results in the appearance of the "mature" form of the carbonyl hydrolase.
  • Many proteolytic enzymes are found in nature as translational proenzyme products and, in the absence of po ⁇ t-tran ⁇ lational proce ⁇ ing, are expre ⁇ ed in thi ⁇ fa ⁇ hion.
  • the putative pro ⁇ equence from the ⁇ ubtili ⁇ in from Bacillus lentus was used.
  • a " ⁇ ignal ⁇ equence” or “presequence” refers to any ⁇ equence of amino acids bound to the N-terminal portion of a carbonyl hydrolase or to the N-terminal portion of a prohydrolase which may participate in the secretion of the mature or pro form ⁇ of the hydrola ⁇ e.
  • the pre ⁇ ent invention utilize ⁇ ⁇ uch ⁇ equences to effect the secretion of the carbonyl hydrolase mutants as defined herein.
  • a preferred signal sequence used in the Examples comprises the first seven amino acid residue ⁇ of the ⁇ ignal ⁇ equence from Bacillus subtilis subtili ⁇ in fu ⁇ ed to the remainder of the ⁇ ignal ⁇ equence of the ⁇ ubtili ⁇ in from Bacillus lentus (ATCC 21536) .
  • “Expre ⁇ ionvector” refers to a DNA construct containing a DNA sequence which is operably linked to a suitable control sequence capable of effecting the expres ⁇ ion of ⁇ aid DNA in a ⁇ uitable ho ⁇ t.
  • control ⁇ equence ⁇ include a promoter to effect tran ⁇ cription, an optional operator ⁇ equence to control ⁇ uch tran ⁇ cription, a ⁇ equence encoding ⁇ uitable mRNA ribo ⁇ ome binding ⁇ ite ⁇ , and ⁇ equence ⁇ which control termination oftran ⁇ cription and tran ⁇ lation.
  • the vector may be a pla ⁇ mid, a phage particle, or ⁇ imply a potential genomic in ⁇ ert.
  • the vector may replicate and function independently of the ho ⁇ t genome, or may, in ⁇ ome in ⁇ tance ⁇ , integrate into the genome it ⁇ elf.
  • plaque and “vector” are ⁇ o etimes used interchangeably a ⁇ the pla ⁇ mid i ⁇ the mo ⁇ t commonly u ⁇ ed form of vector at present.
  • the invention is intended to include such other forms of expres ⁇ ion vector ⁇ which serve equivalent function ⁇ and which are, or become, known in the art.
  • the "host cells” used in the present invention generally are procaryotic or eucaryotic host ⁇ which preferably have been manipulated by the method ⁇ di ⁇ clo ⁇ ed in EPO Publication No. 0 130 756 to render them incapable of ⁇ ecreting enzy atically active end ⁇ protea ⁇ e.
  • a preferred host cell for expressing subtilisin is the Bacillus strain BG2036 which is deficient in enzymatically active neutral protease and alkaline protea ⁇ e ( ⁇ ubtilisin) .
  • the construction of strain BG2036 is described in detail in EPO Publication No. 0 130 756 and further described by Yang, M.Y., et al. (1984). J. Bacteriol..160. 15-21.
  • Other host cell ⁇ for expre ⁇ ing ⁇ ubtili ⁇ in include Bacillus ⁇ ubtili ⁇ 1168 (EPO Publication No. 0 130 756) .
  • Host cells are transformed or transfected with vectors constructed using recombinant DNA techniques. Such transformed host cells are capable of either replicating vectors encoding the carbonyl hydrolase mutants or expres ⁇ ing the de ⁇ ired carbonyl hydrola ⁇ e mutant. In the ca ⁇ e of vectors which encode the pre or prepro form of the carbonyl hydrolase mutant, such mutant ⁇ , when expre ⁇ ed, are typically ⁇ ecreted from the ho ⁇ t cell into the host cell medium.
  • a presequence when describing the relationship between two DNA regions simply means that they are functionally related to each other.
  • a presequence is operably linked to a peptide if it functions as a ⁇ ignal sequence, participating in the secretion of the mature form of the protein most probably involving cleavage of the ⁇ ignal ⁇ equence.
  • a promoter i ⁇ operably linked to a coding ⁇ equence if it control ⁇ the tran ⁇ cription of the ⁇ equence; a ribo ⁇ ome binding site i ⁇ operably linked to a coding sequence if it is positioned ⁇ o a ⁇ to permit tran ⁇ lation.
  • the gene ⁇ encoding the naturally-occurring precur ⁇ or carbonyl hydrola ⁇ e may be obtained in accord with the general method ⁇ de ⁇ cribed in EPO Publication No ⁇ . 0 130 756 and 0 251 446.
  • the methods generally comprise synthesizing labelled probes having putative sequence ⁇ encoding regions of the hydrola ⁇ e of interest, preparing genomic libraries from organism ⁇ expre ⁇ ing the hydrola ⁇ e, and ⁇ creening the librarie ⁇ for the gene of intere ⁇ t by hybridization to the probe ⁇ . Po ⁇ itively hybridizing clone ⁇ are then mapped and ⁇ equenced.
  • the cloned carbonyl hydrola ⁇ e i ⁇ then u ⁇ ed to tran ⁇ form a ho ⁇ t cell in order to express the hydrolase.
  • the hydrolase gene i ⁇ then ligated into a high copy number plasmid.
  • High copynumber plasmids also contain an origin of replication for the host, thereby enabling large number ⁇ of pla ⁇ mid ⁇ to be generated in the c topla ⁇ m without chromosomal limitations.
  • it i ⁇ within the ⁇ cope herein to integrate multiple copie ⁇ of the hydrola ⁇ e gene into ho ⁇ t genome. Thi ⁇ i ⁇ facilitated by procaryotic and eucaryotic organi ⁇ m ⁇ which are particularly susceptible to homologous recombination.
  • a ⁇ ynthetic gene encoding a naturally- occurring or mutant precur ⁇ or carbonyl hydrola ⁇ e may be produced.
  • the DNA and/or amino acid sequence of the precursor hydrolase is determined.
  • Multiple, overlapping synthetic single-stranded DNA fragments are thereafter synthesized which upon hybridization and ligation produce a synthetic DNA encoding the precursor hydrolase.
  • Thi ⁇ approach provide ⁇ ⁇ everal advantages over cloning the natural gene in that restriction sites may be interposed throughout the DNA without change in the amino acid sequence encoded ⁇ o a ⁇ to facilitate subsequent modification to form mutant carbonyl hydrolase ⁇ .
  • the synthetic approach allows for adjustingthe codon usage in the synthetic gene to conform with the codon bias for the particular expres ⁇ ion ho ⁇ t ⁇ to be u ⁇ ed.
  • An example of ⁇ ynthetic gene construction is set forth in the Examples.
  • cassette mutagenesis method may be used to facilitate the construction and identification of the carbonyl hydrolase mutants of the pre ⁇ ent invention although other method ⁇ including ⁇ ite-directed mutagene ⁇ i ⁇ may be u ⁇ ed.
  • Fir ⁇ t the naturally-occurring gene encoding the hydrola ⁇ e i ⁇ obtained and ⁇ equenced in whole or in part. Then the ⁇ equence i ⁇ scanned for a point at which it is desired to make a mutation (deletion, in ⁇ ertion or ⁇ ubstitution) of one or more amino acids in the encoded enzyme.
  • the ⁇ equence ⁇ flanking thi ⁇ point are evaluated for the pre ⁇ ence of restriction sites for replacing a short segment of the gene with an oligonucleotide pool which when expre ⁇ ed will encode various mutant ⁇ .
  • Such re ⁇ triction site ⁇ are preferably unique sites within the hydrolase gene so a ⁇ to facilitate the replacement of the gene ⁇ egment.
  • any convenient re ⁇ triction ⁇ ite which i ⁇ not overly redundant in the hydrola ⁇ e gene may be u ⁇ ed, provided the gene fragment ⁇ generated by re ⁇ triction dige ⁇ tion can be rea ⁇ embled in proper ⁇ equence.
  • ⁇ uch sites are generated by sub ⁇ tituting nucleotides in the gene in such a fa ⁇ hion that neither the reading frame nor the amino acid ⁇ encoded are changed in the final con ⁇ truction. Mutation of the gene in order to change it ⁇ ⁇ equence to conform to the de ⁇ ired ⁇ equence is accomplished by M13 primer exten ⁇ ion in accord with generally known method ⁇ .
  • the ta ⁇ k of locating ⁇ uitable flanking region ⁇ and evaluating the needed change ⁇ to arrive at two convenient re ⁇ triction ⁇ ite sequences is made routine by the redundancy of the genetic code, a restriction enzyme map of the gene and the large number of different re ⁇ triction enzymes. Note that if a convenient flanking restriction ⁇ ite i ⁇ available, the above method need be u ⁇ ed only in connection with the flanking region which doe ⁇ not contain a ⁇ ite.
  • the re ⁇ triction ⁇ ite ⁇ flanking the po ⁇ ition ⁇ to be mutated are digested with the cognate restriction enzymes and a plurality of end termini-complementary oligonucleotide ca ⁇ ette ⁇ are ligated into the gene.
  • the mutagene ⁇ i ⁇ i ⁇ concentratedou ⁇ ly ⁇ implified by thi ⁇ method becau ⁇ e all of the oligonucleotide ⁇ can be synthe ⁇ ized ⁇ o a ⁇ to have the ⁇ ame re ⁇ triction ⁇ ite ⁇ , and no synthetic linkers are necessary to create the restriction sites.
  • proteolytic activity i ⁇ defined a ⁇ the rate of hydroly ⁇ i ⁇ of peptide bond ⁇ per milligram of active enzyme.
  • Many well known procedure ⁇ exi ⁇ t for mea ⁇ uringproteolytic activity K. M. Kali ⁇ z, "Microbial Proteinases", Advances in Biochemical Engineering/ Biotechnology. A. Fiechter ed. , 1988).
  • the objective is to ⁇ ecure a mutant carbonyl hydrola ⁇ e having a greater (numerically large) proteolytic activity a ⁇ compared to the precur ⁇ or carbonyl hydrolase, thereby enabling the use of the enzyme to more efficiently act on a target sub ⁇ trate.
  • Specific amino acid ⁇ u ⁇ eful to obtain such results in subtili ⁇ in-type carbonyl hydrola ⁇ e ⁇ at re ⁇ idues equivalent to +123 in Bacillus amyloliquefaciens subtili ⁇ in are pre ⁇ ented in the Examples. In some in ⁇ tance ⁇ , lower proteolytic activity may be desirable.
  • a decrea ⁇ e in proteolytic activity can be produced by ⁇ ub ⁇ tituting the amino acid ⁇ identified in the example ⁇ at re ⁇ idue ⁇ equivalent to +123 in Bacillus amyloliquefaciens subtili ⁇ in.
  • the ⁇ ub ⁇ titution can be one that decrea ⁇ e ⁇ proteolytic activity.
  • Thi ⁇ would be u ⁇ eful, for example, where the synthetic activity of the carbonyl hydrolases is desired (a ⁇ for ⁇ ynthe ⁇ izing peptide ⁇ ) .
  • re ⁇ idue ⁇ equivalent to +274 in Bacillu ⁇ amyloliquefaciens ⁇ ubtilisin are important in modulating the overall performance characteri ⁇ tics of the enzyme in detergent compositions.
  • the threonine in Bacillus lentus subtili ⁇ in at equivalent po ⁇ ition +274 can be mutated to alanine in the preferred embodiment to produce enhanced performance of the mutant enzyme.
  • leucine, ⁇ erine, valine and alanine re ⁇ ult ⁇ in a decrea ⁇ e in the ⁇ tability of the mutant Such decrea ⁇ e in ⁇ tability i ⁇ believed to be the re ⁇ ult of autocatalytic degradation of the mutant. Thu ⁇ , modification ⁇ of re ⁇ idue ⁇ equivalent to +274 in Bacillu ⁇ subtili ⁇ in are capable of enhancing the overall performance of the enzyme in a detergent compo ⁇ ition and modulating the overall ⁇ tability of the enzyme.
  • the objective is to secure a mutant carbonyl hydrola ⁇ e having enhanced performance when u ⁇ ed in a detergent compo ⁇ ition a ⁇ compared to the precur ⁇ or carbonyl hydrola ⁇ e.
  • a preferred embodiment of the invention is set forth in the Example ⁇ wherein the lysine at position 27 is ⁇ ub ⁇ tituted with arginine, the valine at po ⁇ ition 104 i ⁇ ⁇ ub ⁇ tituted with tyro ⁇ ine, the a ⁇ paragine at po ⁇ ition 123 ⁇ ub ⁇ tituted with ⁇ erine and the threonine at re ⁇ idue 274 i ⁇ ⁇ ub ⁇ tituted with alanine in Bacillus lentus subtili ⁇ in.
  • this enzyme Although the stability of this enzyme is ⁇ omewhat reduced as compared to the precursor Bacillus lentus subtili ⁇ in, the performance level of this enzyme in a detergent composition is sub ⁇ tantially enhanced ⁇ uch that the same performance of this Bacillus lentus subtili ⁇ in mutant is obtained a ⁇ compared to the unmodified Bacillus lentus subtili ⁇ in when using approximately one-half the amount of enzyme.
  • carbonyl hydrola ⁇ e mutant ⁇ of the invention e ⁇ pecially ⁇ ubtili ⁇ in, are u ⁇ eful in formulatingvariou ⁇ detergent compo ⁇ ition ⁇ .
  • a number of known compound ⁇ are ⁇ uitable ⁇ urfactant ⁇ u ⁇ eful in compo ⁇ ition ⁇ compri ⁇ ing the carbonyl hydrola ⁇ e mutant ⁇ of the invention.
  • the ⁇ e include nonionic, anionic, cationic, anionic, or zwitterionic detergents, a ⁇ di ⁇ clo ⁇ ed in U.S.4,404,128 to Barry J. Ander ⁇ on and U.S. 4,261,868 to Jiri Flora, et al.
  • Subtilisins of the invention can be formulated into known powdered and liquid detergents having pH between 6.5 and 12.0 at levels of about .01 to about 5% preferably .1% to .05%) by weight.
  • These detergent cleaning compo ⁇ itions can al ⁇ o include other enzyme ⁇ ⁇ uch a ⁇ known protea ⁇ e ⁇ and amyla ⁇ e ⁇ , a ⁇ well a ⁇ builders and ⁇ tabilizer ⁇ .
  • ⁇ ubtili ⁇ in ⁇ of the invention to conventional cleaning compo ⁇ ition ⁇ doe ⁇ not create any ⁇ pecial u ⁇ e limitation.
  • any temperature and pH suitable for the detergent is also ⁇ uitable for the pre ⁇ ent compo ⁇ ition ⁇ as long as the pH is within the above range, and the temperature is below the subtili ⁇ in ⁇ of the invention denaturing temperature.
  • ⁇ ubtilisins of the invention can be used in a cleaning composition without detergents, again either alone or in combination with builders and stabilizer ⁇ .
  • Plasmid pSAR, Fig.5, carries a translational fusion via a common Sau3A restriction site at the ⁇ eventh/eighth ⁇ ignal sequence codon of the ⁇ ubtilisin genes of B. subtilis and £_ t _ amyloliquefaciens.
  • thi ⁇ gene on an EcoRI-BamHI 2.0 Kb fragment, wa ⁇ subcloned into M13mpl9 in order to i ⁇ olate single- stranded template DNA to be u ⁇ ed for ⁇ ite-directed mutagene ⁇ i ⁇ to form pSAR-Q275R.
  • the mutagene ⁇ i ⁇ protocol wa ⁇ e ⁇ entially that of Zoller, M. , et al. (1983), Methods Enzvmol.. 100. 468-500, (1) and used a ⁇ ynthetic oligonucleotide of the ⁇ equence:
  • a ⁇ teri ⁇ ks denote changes from the wild-type gene sequences and the underline represent ⁇ an introduced P ⁇ tl restriction endonuclease ⁇ ite u ⁇ ed in ⁇ creening for the particular mutant gene encoding the Q275R change.
  • These changes were made to (1) convert the amino acid at this position to that found in Bacillus lentus subtilisin and (2) to allow hookup of the terminator in pSAR to the mature coding region of Bacillus lentus via a Pst ⁇ ite ⁇ imilarly introduced into pGG36 from Bacillus lentus (ATCC 21536) .
  • Pla ⁇ mid pGG36 contains a 2.1 kb geno ic DNA fragment from Bacillus lentus (ATCC 21536) encoding the complete ⁇ ubtili ⁇ in gene which was cloned by standard methods in the shuttle vector pBS42. Band, L. , et al. (1984), £NA, 1, 17-21.
  • T274A in order to 1) introduce a PstI site at the same location in this gene corresponding to the ⁇ ite introduced into pSAR above and 2) to ⁇ ub ⁇ titute the threonine at position 274 with alanine to form pGG36- T274A.
  • the mutant pSAR-Q275R and pGG36-T274A genes were individually subcloned back into pBS42 prior to P ⁇ tl/BamHI dige ⁇ tions, fragment isolation and ligation to produce plasmid GG-A274B.amy.term. as shown in Fig. 5, all by standard methods.
  • GG-KVNA indicates that this ⁇ ubtili ⁇ in contain ⁇ the ⁇ ubtili ⁇ in encoded by pGG-36 which includes lysine (K) at po ⁇ ition 27, valine (V) at po ⁇ ition 104, a ⁇ paragine (N) at po ⁇ ition 123 and the ⁇ ub ⁇ titution of threonine at po ⁇ ition 274 with alanine (A) .
  • the GG-KVNA gene (2.1 kb EcoRI- BamHI fragment) was subcloned into M13 for three successive rounds of site-directed mutagenesis using oligonucleotides having the sequence:
  • the asteri ⁇ k ⁇ denote changes from the wild-type gene sequence.
  • the underlines represent, in (a) an introduced Xbal site and in (b) and (c) introduced Nhel sites used to screen for the presence of the linked R27, Y104 and S123 mutations, respectively.
  • the overlined denote ⁇ a de ⁇ troyed Sphl site.
  • the 2.1 kb GG-RYSA gene wa ⁇ ⁇ ubcloned back into pBS42 for expression in J . subtili ⁇ ho ⁇ ts.
  • the resultant plasmid was designated pGG-RYSA.
  • Thi ⁇ designation indicates that four residues were modified in the pGG-KVNA plasmid.
  • the alanine previou ⁇ ly substituted at residue 274 was not modified in this procedure.
  • the lysine at po ⁇ ition 27 wa ⁇ substituted with arginine based upon the amino acid sequencing of ⁇ ubtili ⁇ in 309. A ⁇ indicated in PCT Publication No. WO89/06279, lysine is located at po ⁇ ition 27.
  • DNA encoding the amino acid sequence of Bacillu ⁇ lentu ⁇ ⁇ ubtili ⁇ in wa ⁇ al ⁇ o prepared by con ⁇ tructing a gene encoding a ⁇ ynthetic DNA ⁇ equence.
  • rl51-rl97 were utilized except in the case ⁇ where alternate codon ⁇ re ⁇ ulted in conveniently located restriction enzyme recognition sites within the gene; (2) Approximately every 40-60 b.p. of the -0.8 mature coding region, combinations of 2 or 3 specifically chosen codons were utilized which resulted in the introduction of fairly evenly spaced, unique restriction ⁇ ite ⁇ .
  • the ⁇ e ⁇ ite ⁇ were cho ⁇ en to facilitate (a) later cassette mutagenesis and screening studie ⁇ and (b) con ⁇ tructions involving more than one mutation; (3) A unique Pst I recognition site was de ⁇ igned to cover codons 272-274 allowing hook up to the terminator sequences of a Bacillus amyloliquefaciens gene similarly modified over the same three codon ⁇ and ⁇ ub ⁇ tituting threonine at po ⁇ ition 274 with alanine; and (4) A unique Nrul ⁇ ite was introduced to cover mature codon ⁇ re ⁇ idue ⁇ 9-10 allowing hookup to GG36' ⁇ pre-pro coding ⁇ equence via a ⁇ hort ⁇ ynthetic duplex DNA linker.
  • oligo ⁇ oligonucleotides
  • one additional pair or synthetic oligo' ⁇ wa ⁇ ⁇ ynthesized which upon annealing (to give fragment 2 in Fig. 8) has an Ncol -site at it' ⁇ 5* end (complimentary to GG36' ⁇ Ncol site at mature codons 5-6) and an Nrul site at it ⁇ 3' end (complimentary to the 3's 5 ⁇ end of fragment 3) .
  • An Xho I site was introduced over codons 111/112 in the ⁇ ynthetic gene from Example 3 by making three phenotypically ⁇ ilent mutation ⁇ via ⁇ ite directed mutagene ⁇ i ⁇ (primer exten ⁇ ion mutagene ⁇ i ⁇ in M13) .
  • the re ⁇ ulting pla ⁇ mid, pX123 (Fig.9) wa ⁇ dige ⁇ ted with Xho I and Ava I and the large vector-containing fragment i ⁇ olated by electroelution from agaro ⁇ e gel.
  • Complimentarysynthetic oligonucleotide ⁇ were annealed, ligated with the pX123 large fragment and tran ⁇ formed into E. coli ⁇ train MM294.
  • Po ⁇ itives by restriction analysi ⁇ i.e., Sph I negative ⁇
  • Proteolytic activity of each of the subtilisin mutants encoded by the above modified position +123 mutants was as ⁇ ayed by mixing 0.04 ml of ⁇ upernatant from centrifuged culture broths with 0.56 ml of 1% w/v casein in 0.1M Tris pH8.60. After a 20 minute incubation at 37'C, reactions were quenched by precipitation with 10% trichloroacetic acid (TCA) . Activity was determined from the absorbance at a wavelength of 280nm for the supernatant after precipitation with 10% TCA.
  • TCA trichloroacetic acid
  • proline wa ⁇ found to be at po ⁇ ition 78 in ⁇ tead of ⁇ erine (the amino acid at thi ⁇ position in Bacillus lentus subtili ⁇ in) .
  • the initial propertie ⁇ of the po ⁇ ition 123 mutation ⁇ were te ⁇ ted in thi ⁇ enzyme, BC3-RPYA (proline at po ⁇ ition 78) .
  • the ⁇ e re ⁇ ult ⁇ are ⁇ hown in Table I.
  • the amino acid at po ⁇ ition 78 wa ⁇ thereafter changed back to serine to form the DNA and amino acid sequence shown in Fig.
  • alanine mutation wa ⁇ not a ⁇ ⁇ table a ⁇ ⁇ erine or threonine at thi ⁇ po ⁇ ition
  • thi ⁇ enzyme provided ⁇ uperior performance relative to Bacillus lentus subtili ⁇ in under the conditions of use described.
  • other amino acids at position 274 may be used.
  • a spray-dried phosphate detergent granule of the following composition was prepared:
  • a 0.1 weight percent ⁇ olution of thi ⁇ compo ⁇ ition in water had a pH of 10.0.
  • the composition with subtili ⁇ in mutant of the invention (Fig. 7) provided ⁇ uperior cleaning of enzyme- ⁇ ensitive stains, when compared to Bacillus lentus at 0.068 mg active enzyme/g product, in a 95"F (35'C) wash at 6 grains per gallon (gpg) hardnes ⁇ (3:1 Ca/Mg) .

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Virology (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Detergent Compositions (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Novel carbonyl hydrolase mutants derived from the DNA sequences of naturally-occurring or recombinant non-human carbonyl hydrolases are disclosed. The mutant carbonyl hydrolases, in general, are obtained by in vitro modification of a precursor DNA sequence encoding the naturally-occurring or recombinant carbonyl hydrolase to generate the substitution of one or more amino acid residues in the amino acid sequence of a precursor carbonyl hydrolase. Such mutant carbonyl hydrolases have porperties which are different from those of the precursor hydrolase and are especially useful in detergent formulations. The substituted amino acid residues correspond to position +123 and/or +274 in Bacillus amyloliquefaciens subtilisin.

Description

SUBTILISIN MUTANTS
Field of the Invention
The present invention relates to novel carbonyl hydrolase mutants having an amino acid sequence wherein one or more amino acid residues of- a precursor carbonyl hydrolase, specifically those at positions corresponding to residues +123 and/or +274 in Bacillus amyloliquefaciens subtilisin, have been substituted with a different amino acid. Such mutant carbonyl hydrolases, in general, are obtained by in vitro modification of a precursor DNA sequence encoding a naturally-occurring or recombinant carbonyl hydrolase to encode the substitution of one or both of these amino acid residues in a precursor amino acid sequence alone or in combination with other substitution, insertion or deletion in the precursor amino acid sequence.
Background of the Invention
Serine proteases are a subgroup of carbonyl hydrolase.
They comprise a diverse class of enzymes having a wide range of specificities and biological functions. Stroud, R. M. (1974), Sci. Amer.. 131. 74-88. Despite their functional diversity, the catalytic machinery of serine proteases has been approached by at least two genetically distinct families of enzymes: the subtilisins and the mammalian chymotrypsin related and homologous bacterial serine proteases (e.g. , trypsin and S. qresius trypsin) . These two families of serine proteaseε show remarkably similar mechanisms of catalysis. Kraut, J. (1977) , Ann. Rev. Biochem.. 46. 331-358. Furthermore, although the primary structure is unrelated, the tertiary structure of these two enzyme families bring together a conserved catalytic triad of amino acids consisting of serine, histidine and aspartate.
Subtilisin is a serine endoprotease (MW 27,500) which is secreted in large amounts from a wide variety of Bacillus species and other microorganisms. The protein sequence of subtilisin has been determined from at least four different species of Bacillus. Markland, F.S., et al. (1983), Honne-Seyler's Z. Phvsiol. Chem..364.1537- 1540. The three-dimensional crystallographic structure of Bacillus amyloliquefaciens subtilisin to 2.5A resolution has also been reported. Wright, C.S. , et al. (1969), Nature. 221.235-242; Drenth, J., et al. (1972), Eur. J. Biochem.. 26. 177-181. These studies indicate that although subtilisin is genetically unrelated to the mammalian serine proteases, it has a similar active site structure. The x-ray crystal structures of subtilisin containing covalently bound peptide inhibitors (Robertus, J.D., et al. (1972), Biochemistry. 11. 2439- 2449), or product complexes (Robertus, J.D., et al. (1976), J. Biol. Chem.. 251. 1097-1103), have also provided information regarding the active site and putative substrate binding cleft of subtilisin. In addition, a large number of kinetic and chemical modification studies have been reported for subtilisin (Philipp, M., et al. (1983), Mol. Cell. Biochem.. £1, 5-32; Svendsen, B. (1976), Carlsbera Res. Coπtm. f 41. 237-291; Markland, F.S. Id.) as well as at least one report wherein the side chain of methione at residue 222 of subtilisin was converted by hydrogen peroxide to methionine-εulfoxide (Stauffer, D.C, et al. (1965), J. Biol. Chem.. 244. 5333-5338) and the side chain of serine at residue 221 converted to cysteine by chemical modification (Polgar, et al. (1981), Biochi ica et Biophvsica Acta. 667. 351-354.)
U.S. Patent No. 4,760,025 and EPO Publication No. 0 130 756 published January 9, 1985 each disclose the modification of subtilisin amino acid residues corresponding to positions in Bacillus amyloliquefacien subtilisin tyrosine -l, aspartate +32, asparagine +155, tyrosine +104, methionine +222, glycine +166, histidine +64, glycine +169, phenylalanine +189, serine +33, serine +221, tyrosine +217, glutamate +156 and alanine +152. EPO Publication No. 0 251 446 published January 7, 1988 discloses other amino acid residues in Bacillus amyloliquefaciens subtilisin and their equivalents which may be modified by way of substitution, insertion or deletion and which may be combined with modifications to the residues identified in U.S. Patent No. 4,760,025 to form useful subtilisin mutants. The particular residues identified herein, however, are not identified in these references.
Similarly, PCT Publication No. W0 89/09819 and W0 89/09830 each published October 19, 1989, disclose subtilisin enzymes made by mutating a nucleotide sequence coding for a subtilisin. Numerous amino acid residues are identified in each of these publications which may be so modified. However, as with the previously identified references, neither identifies the residues of the present invention.
Accordingly, it is an object herein to provide carbonyl hydrolase mutants containing the substitution of amino acid residues in a precursor carbonyl hydrolase corresponding to positions +123 and/or +274 in Bacillus amyloliquefaciens subtilisin. Such mutants generally have at least one property which is different from the same property of the carbonyl hydrolase precursor from which the amino acid of said mutant is derived.
It is further object to provide DNA sequences encoding εuch carbonyl hydrolase mutants aε well as expression vectors containing such mutant DNA sequences.
Still further, another object of the invention is to provide host cells transformed with such vectors aε well as host cells which are capable of expressing such DNA to produce carbonyl hydrolase mutants either intracellularly or extracellularly.
Summary of the Invention
The invention includes non-naturally occurring carbonyl hydrolase mutants having a different proteolytic activity, stability, and/or performance characteristic as"compared to the precursor carbonyl hydrolase from which the amino acid sequence of the mutant is derived. The precurεor carbonyl hydrolase may be a naturally- occurring carbonyl hydrolase or recombinant hydrolase. Specifically, such carbonyl hydrolase mutants have an amino acid sequence, not found in nature, which is derived by replacement of one or more amino acid residues of a precursor carbonyl hydrolase with one or more different amino acids. The one or more amino acid residueε of the precurεor enzyme correspond to positionε Aεn +123 and/or Ala +274 of Bacillus a yloliσuefaciens subtilisin or equivalent amino acid residueε in other carbonyl hydrolaεes or εubtilisins.
The invention also includes mutant DNA sequences encoding such carbonyl hydrolase or subtilisin mutants.
These mutant DNA sequenceε are derived from a precurεor DNA sequence which encodes a naturally-occurring or recombinant precursor enzyme. The mutant DNA sequenceε are derived by modifying the precursor DNA sequence to encode the substitution of one or more εpecific amino acid residues encoded by the precurεor DNA εequence correεponding to position +123 and/or +274 in Bacillus amyloliquefaciens. These recombinant DNA sequences encode carbonyl hydrolase mutants having a novel amino acid sequence and, in general, at least one property which is εubstantially different from the same property of the enzyme encoded by the precursor carbonyl hydrolaεe DNA εequence. Such propertieε include proteolytic activity, stability and/or enhanced performance characteristics.
The invention also includes procaryotic and eucaryotic subtiliεins with a different amino acid reεidue such as serine, at positions equivalent to Asn +123 in Bacillus amyloliquefaciens subtilisin and to subtilisin with different amino acid reεidues at positions equivalent to position +274 in Bacillus amyloliquefaciens subtilisin.
Further, the invention includes expression vectors containing such mutant carbonyl hydrolase DNA sequences as well as host cells transformed with εuch vectors which are capable of producing such mutants. The invention also relates to detergent compositionε compriεing the carbonyl hydrolaεe mutantε of the invention.
Brief Deεcription of the Drawings
Fig. 1 depicts the DNA and amino acid sequence for Bacillus a yloliquefaciens subtiliεin and a partial restriction map of this gene. Fig. 2 depictε the conserved amino acid residueε among subtilisinε from Bacillus amyloliquefaciens. Bacillus subtilis varI168 and Bacillus licheniformis (carlsbergensis) .
Figε. 3A and 3B depict the amino acid εequence of εubtiliεin from Bacillus amyloli uefacienε. Bacilluε εubtiliε varI168 and Bacillus licheniformis.
Fig. 4 depicts the amino acid sequence of three subtiliεins. The top line representε the amino acid εequence of subtilisin from Bacillus amyloliquefaciens subtilisin (also sometimes referred to as εubtiliεin BPN1). The εecond line depicts the amino acid εequence of εubtiliεin from Bacillus lentus (subtilisin 309 in PCT Publication No. WO 89/06276) . The bottom line represents the amino acid sequence of a preferred embodiment of the invention designated GG-RYSA. The symbol * denotes the absence of specific amino acid residues as compared to subtiliεin BPN1.
Fig. 5 depictε the construction of plaεmid pGG A274.
Fig. 6 depicts the construction of pGG-KVNA which iε an intermediate to plaεmid pGG-RYSA.
Fig. 7 depictε the oligonucleotide-duplex method uεed to conεtruct a εynthetic Bacilluε lentuε subtiliεin gene.
Fig.8 depicts the strategy for conεtructing a εynthetic gene encoding Bacillus lentus subtiliεin.
Fig. 9 depicts the cassette used to make εubstitutions in the DNA at codon poεition +123 by caεεette mutageneεiε. XXX repreεentε the codon modified to encode the amino acid εubεtitutionε at poεition +123. Fig. 10 depictε the DNA and amino acid sequence of a preferred embodiment of the invention wherein the DNA εequence is a εynthetic DNA. The DNA in thiε Figure haε been modified to encode arginine at poεition 27, εerine at poεition 78, tyroεine at poεition 104, εerine at poεition 123 and alanine at poεition 274.
Detailed Description of the Invention It has been discovered that in vitro mutations in the carbonyl hydrolase εubtiliεin at an amino acid reεidue equivalent to +123 in Bacillus amylolicruefaciens εubtiliεin produces εubtiliεin utantε exhibiting altered proteolytic activity over precurεor εubtilisins.
It has also been discovered that in vitro mutation at residues equivalent to +274 in Bacillus amyloliquefaciens subtiliεin produce subtilisinmutants exhibiting altered stability, e.g. modified autoproteolytic stability. In εome inεtanceε, theεe latter mutants also exhibit enhanced performance when used in detergent compositions.
Carbonyl hydrolases are enzymes which hydrolyze compounds containing
Figure imgf000009_0001
bonds in which X is oxygen or nitrogen. They include naturally-occurring carbonyl hydrolaεes and recombinant carbonyl hydrolases. Naturally-occurring carbonyl hydrolaseε principally include hydrolaεeε, e.g. peptide hydrolases, such as εubtilisins or metalloproteases. Peptide hydrolaεes include α-aminoacylpeptide hydrolase, peptidylamino acid hydrolase, acylamino hydrolase, εerinecarboxypeptidase, metallocarboxypeptidaεe, thiol proteinaεe, carboxylproteinase and metalloproteinase. Serine, metallo, thiol and acid proteases are included, as well as endo and exo-proteases.
"Recombinant carbonyl hydrolase" refers to a carbonyl hydrolase in which the DNA sequence encoding the naturally-occurring carbonyl hydrolaεe iε modified to produce a mutant DNA εequence which encodeε the εubεtitution, inεertion or deletion of one or more amino acidε in the carbonyl hydrolaεe amino acid εequence. Suitable modification methodε are diεcloεed herein, in EPO Publication No. 0130756 publiεhed January 9, 1985 and EPO Publication No. 0 251446 publiεhed January 7, 1988.
Subtiliεinε are bacterial or fungal carbonyl hydrolaεes which generally act to cleave peptide bondε of proteins or peptides. As used herein, "subtiliεin" means a naturally-occurring subtiliεin or a recombinant εubtilisin. A serieε of naturally-occurring εubtiliεins is known to be produced and often εecreted by various microbial specieε. Amino acid εequenceε of the members of this εerieε are not entirely homologous. However, the subtiliεins in this series exhibit the same or similar type of proteolytic activity. This clasε of serine proteaεeε shares a common amino acid sequence defining a catalytic triadwhich distinguiεheε themfrom the chymotrypεin related claεs of εerine proteaεeε. The subtiliεinε and chymotrypεin related serine proteaεeε both have a catalytic triad compriεing aspartate, hiεtidine and serine. In the εubtilisin related proteaseε the relative order of theεe amino acidε, reading from the amino to carboxy terminuε iε aspartate- histidine-serine. Inthe chymotrypsin relatedproteases the relative order, however iε hiεtidine-aεpartate- εerine. Thuε, subtiliεin herein referε to a εerine proteaεe having the catalytic triad of subtiliεin related proteaεeε. Examples include the subtilisinε identified in Fig. 3 herein and as described in PCT Publication WO 89/06276 and EPO Publication No. 0 283 075.
"Recombinant subtilisin" refers to a subtiliεin inwhich the DNA εequence encoding the εubtiliεin iε modified to produce a mutant DNA εequence which encodes the subεtitution, deletion or insertion of one or more amino acids in the naturally-occurring subtilisin amino acid sequence. Suitable methods to produce suchmodification and which may be combined with those disclosed herein include those disclosed in EPO Publication Nos. 0 130 756 and 0 251 446 and PCT Publication Nos. W0 89/06279, W0 89/09830 and W0 89/09819.
"Non-human carbonyl hydrolases" and the DNA encoding them may be obtained from many procaryotic and eucaryotic organiεms. Suitable exampleε of procaryotic organismε include gram negative organisms such as £. coli or Pseudomonas and gram positive bacteria such aε Micrococcus or Bacillus. Examples of eucaryotic organismε from which carbonyl hydrolaεe and their geneε may be obtained include yeast such as Saccaromycees cerevisiae. fungi such as Asper illus sp. , and non-human mammalian εourceε εuch aε, for example, bovine εp. from which the gene encoding the carbonyl hydrolase chymosin can be obtained. Aε with εubtilisins, a εerieε of carbonyl hydrolaεeε can be obtained fromvariouε related εpecies which have amino acid sequences which are not entirely homologous between the members of that series but which nevertheless exhibit the same or similar type of biological activity. Thus, non-human carbonyl hydrolase aε uεed herein has a functional definition which referε to carbonyl hydrolases which are asεociated, directlyor indirectly, withprocaryoticand eucaryotic εourceε. A "carbonyl hydrolase mutant" has an amino acid sequence which is derived from the amino acid sequence of a "precursor carbonyl hydrolase". The precursor carbonyl hydrolases include naturally-occurring carbonyl hydrolaεeε and recombinant carbonyl hydrolaεeε. The amino acid εequence of the carbonyl hydrolaεe mutant iε "derived" from the precurεor hydrolaεe amino acid εequence by the εubεtitution, deletion or inεertion of one or more amino acids of the precursor amino acid sequence. Such modification iε- of the "precurεor DNA sequence" which encodes the amino acid sequence of the precursor carbonyl hydrolase rather than manipulation of the precurεor carbonyl hydrolaεe enzyme per εe. Suitable methods for such manipulation of the precursor DNA sequence include methods disclosed herein and in EPO Publication Nos. 0 130 756 and 0 251 446.
Specific residues corresponding to positions +123 and +274 of Bacillus amyloliquefaciens subtiliεin are identified herein for εubεtitution. Theεe amino acid position numbers refer to those assigned to the mature Bacillus amyloliquefaciens subtilisin sequence presented in Fig. 1. The invention, however, is not limited to the mutation of this particular subtiliεin but extendε to precurεor carbonyl hydrolaεeε containing amino acid reεidueε at poεitionε which are "equivalent" to the particular identified reεidues in Bacillus amyloliquefaciens εubtilisin.
A residue (amino acid) of a precurεor carbonyl hydrolaεe is equivalent to a reεidue of Bacilluε amyloliquefaciens subtilisin if it is either homologous (i.e., corresponding in position in either primary or tertiary structure) or analogous to a specific residue or portion of that residue in Bacilluε amyloliquefacienε εubtilisin (i.e., having the same or similar functional capacity to combine, react, or interact chemically) . In order to establish homology to primarystructure, the amino acid sequence of a precursor carbonyl hydrolase is directly compared to the Bacillus amyloliquefaciens εubtiliεin primary sequence and particularly to a εet of reεidues known to be invariant in all subtiliεinε for which εequence iε known (Fig. 2). After aligning the conεerved reεidues, allowing for neceεεary inεertionε and deletionε in order to maintain alignment (i.e., avoiding the elimination of conεerved reεidueε through arbitrary deletion and inεertion) , the reεidueε equivalent to particular amino acids in the primary εequence of Bacillus amyloliquefaciens εubtiliεin are defined. Alignment of conserved residues preferably should conserve 100% of such residues. However, alignment of greater than 75% or aε little as 50% of conserved residues is also adequate to define equivalent residueε. Conεervation of the catalytic triad, Asp32/Hiε64/Ser221 εhould be maintained.
For example, in Fig. 3 the amino acid εequence of εubtilisin from Bacillus amyloliquefaciens. Bacillus subtilis var. 1168 and Bacillus lichenformis (carlsbergensis) are aligned to provide the maximum amount of homology between amino acid sequences. A comparison of these sequences shows that there are a number of conserved residues contained in each sequence. These are the residues identified in Fig. 2.
These conserved residues thus may be uεed to define the correεpondingequivalent amino acid reεidueε ofBacilluε amyloliquefaciens εubtilisin in other carbonyl hydrolaεeε such as subtilisin from Bacillus lentus (PCT Publication No. W089/06279 published July 13, 1989) and the preferred εubtilisin mutant herein. These particular amino acid sequenceε are aligned in Fig. 4 with the sequence of Bacillus amyloliquefaciens subtilisin to produce the maximum homology of conserved residues. As can be seen there are a number of deletions in the sequence of Bacillus lentus and in the preferred subtiliεin mutant of the invention aε compared to Bacillus amyloliquefaciens subtilisin. Thus, the equivalent amino acid for Val-165 in Bacillus amyloliquefaciens εubtiliεin in the other εubtiliεinε iε the particular iεoleucine εhown beneath Val-165.
In Fig. 4, the amino acid at poεition 123 iε aεparagine in Bacillus amyloliquefaciens subtiliεin. In Bacillus lentus subtiliεin the equivalent reεidue iε the particular aεparagine shown. In the preferred subtiliεin mutant of the invention, however, the amino acid equivalent to +123 in Bacillus amyloliquefaciens subtilisin is an amino acid other than asparagine and is preferably the serine εhown in Fig. 4. Similarly, in Fig. 4, the amino acid at poεition +274 Bacillus amyloliquefaciens subtiliεin iε alanine. Aε can be εeen, the equivalent amino acid in Bacillus lentus subtiliεin is the particular threonine shown in Fig. 4. In a particular preferred subtiliεin mutant of the invention, the equivalent amino acid poεition 274 iε occupied by the alanine εhown in Fig. 4.
Thuε, the poεitionε +123 and +274 are identified by primary amino acid sequences in Fig. 4 for the subtilisin from Bacillus lentus and the preferred embodiment of the invention. However, various other amino acid reεidueε may be modified which are equivalent to specific amino acids in Bacillus amyloliquefaciens subtilisin. Thus, in the preferred embodiment, the amino acid lysine at poεition 27 in Bacilluε amyloliquefacienε subtiliεiή has an equivalent lysine at position 27 in Bacillus lentus εubtiliεin. As indicated in the Examples, the εubtiliεin compriεing one of the preferred embodimentε of the invention waε derived by modifying a DNA εequence encoding Bacilluε lentus εubtilisin. Such modifications to the DNA included the modification of codons equivalent to positions 123 and 274 of Bacillus amyloliquefaciens subtiliεin. However, two other modifications were made to the Bacillus lentus amino acid sequence at poεitions equivalent to residueε 27 and 104 in Bacillus amyloliquefaciens subtilisin. Thus, as can be seen in Fig. 4, the lysine at equivalent residue 27 in Bacillus lentus subtilisin was modified to encode arginine in the preferred embodiment. Similarly, the valine residue at position 104 of Bacillus lentus. which is equivalent to tyrosine 104 in Bacillus amyloliquefaciens subtilisin, was also modified to encode tyrosine. Thus, the preferred embodiment shown in Fig. 4 contains an amino acid sequence derived from Bacillus lentus subtiliεin by modifying residues of that subtiliεin equivalent to positions 27, 104, 123 and 274 of Bacillus amyloliquefaciens subtilisin.
Equivalent residues may also be defined by determining homology at the level of tertiary structure for a precurεor carbonyl hydrolase whose tertiary structure has been determined by x-ray crystallography. Equivalent reεidues are defined as those for which the atomic coordinates of two or more of the main chain atoms of a particular amino acid residue of the precurεor carbonyl hydrolaεe and Bacillus amyloliquefaciens εubtilisin (N on N, CA on CA, C on C, and 0 on O) are within 0.13nm and preferably O.ln after alignment. Alignment is achieved after the best model has been oriented and positioned to give the maximum overlap of atomic coordinateε of non-hydrogen protein atomε of the carbonyl hydrolaεe in queεtion to the Bacillus amyloliquefaciens εubtiliεin. The beεt model iε the cryεtallographic model giving the lowest R factor for experimental diffraction data at the highest resolution available. R factoI .
Figure imgf000016_0001
Equivalent residues which are functionally analogous to a specific residue of Bacillus amyloliquefaciens subtiliεin are defined as those amino acids of the precursor carbonyl hydrolases which may adopt a conformation such that they either alter, modify or contribute to protein structure, substrate binding or catalysiε in a manner defined and attributed to a εpecific reεidue of the Bacillus amyloliquefaciens subtilisin. Further, they are those residueε of the precurεor carbonyl hydrolaεe (for which a tertiary εtructure haε been obtained by x-ray cryεtallography) , which occupy an analogous position to the extent that although the main chain atoms of the given residue may not satiεfy the criteria of equivalence on the baεiε of occupying a homologous position, the atomic coordinates of at least two of the εide chain atoms of the residue lie with 0.13nm of the correεponding εide chain atoms of Bacillus amyloliquefaciens subtiliεin. The coordinateε of the three dimenεional εtructure of Bacillus amyloliquefaciens subtiliεin are εet forth in EPO Publication No. 0 251 446 and can be uεed aε outlined above to determine equivalent reεidues on the level of tertiary εtructure.
Some of the reεidues identified for substitution, insertion or deletion are conεerved reεidueε whereaε otherε are not. In the caεe of reεidueε which are not conεerved, the replacement of one or more amino acids is limited to substitutions which produce a mutant which has an amino acid εequence that doeε not correspond to one found in nature. In the case of conserved reεidueε. such replacements should not result in a naturally- occurring sequence. The carbonyl hydrolase mutants of the present invention include the mature forms of carbonyl hydrolase mutants as well as the pro- and prepro-forms of such hydrolase mutants. The prepro- forms are the preferred construction since this facilitateε the expreεsion, secretion and maturation of the carbonyl hydrolaεe utantε.
"Proεequence" referε to a εequence of amino acidε bound to the N-terminal portion of the mature form of a carbonyl hydrolase which when removed results in the appearance of the "mature" form of the carbonyl hydrolase. Many proteolytic enzymes are found in nature as translational proenzyme products and, in the absence of poεt-tranεlational proceεεing, are expreεεed in thiε faεhion. Apreferred proεequence for producing carbonyl hydrolaεe mutantε, εpecifically εubtiliεin mutantε, iε the putative proεequence of Bacillus amyloliquefaciens subtiliεin although other εubtiliεin proεequences may be used. In the Examples, the putative pro εequence from the εubtiliεin from Bacillus lentus (ATCC 21536) was used.
A "εignal εequence" or "presequence" refers to any εequence of amino acids bound to the N-terminal portion of a carbonyl hydrolase or to the N-terminal portion of a prohydrolase which may participate in the secretion of the mature or pro formε of the hydrolaεe. Thiε definition of εignal εequence iε a functional one, meant to include all thoεe amino acid sequenceε, encoded by the N-terminal portion of the εubtiliεin gene or other secretable carbonyl hydrolaεeε, whichparticipate inthe effectuation of the secretion of εubtiliεin or other carbonyl hydrolaεeε under native conditionε. The preεent invention utilizeε εuch εequences to effect the secretion of the carbonyl hydrolase mutants as defined herein. A preferred signal sequence used in the Examples comprises the first seven amino acid residueε of the εignal εequence from Bacillus subtilis subtiliεin fuεed to the remainder of the εignal εequence of the εubtiliεin from Bacillus lentus (ATCC 21536) .
A "prepro" form of a carbonyl hydrolase mutant conεiεtε of the mature form of the hydrolase having a proεequence operably linked to the amino-terminuε of the hydrolaεe and a "pre" or "εignal" εequence.operably linked to the amino terminuε of the proεequence.
"Expreεεionvector" refers to a DNA construct containing a DNA sequence which is operably linked to a suitable control sequence capable of effecting the expresεion of εaid DNA in a εuitable hoεt. Such control εequenceε include a promoter to effect tranεcription, an optional operator εequence to control εuch tranεcription, a εequence encoding εuitable mRNA riboεome binding εiteε, and εequenceεwhich control termination oftranεcription and tranεlation. The vector may be a plaεmid, a phage particle, or εimply a potential genomic inεert. Once tranεformed into a εuitable hoεt, the vector may replicate and function independently of the hoεt genome, or may, in εome inεtanceε, integrate into the genome itεelf. In the preεent εpecification, "plaεmid" and "vector" are εo etimes used interchangeably aε the plaεmid iε the moεt commonly uεed form of vector at present. However, the invention is intended to include such other forms of expresεion vectorε which serve equivalent functionε and which are, or become, known in the art.
The "host cells" used in the present invention generally are procaryotic or eucaryotic hostε which preferably have been manipulated by the methodε diεcloεed in EPO Publication No. 0 130 756 to render them incapable of εecreting enzy atically active endόproteaεe. A preferred host cell for expressing subtilisin is the Bacillus strain BG2036 which is deficient in enzymatically active neutral protease and alkaline proteaεe (εubtilisin) . The construction of strain BG2036 is described in detail in EPO Publication No. 0 130 756 and further described by Yang, M.Y., et al. (1984). J. Bacteriol..160. 15-21. Other host cellε for expreεεing εubtiliεin include Bacillus εubtiliε 1168 (EPO Publication No. 0 130 756) .
Host cells are transformed or transfected with vectors constructed using recombinant DNA techniques. Such transformed host cells are capable of either replicating vectors encoding the carbonyl hydrolase mutants or expresεing the deεired carbonyl hydrolaεe mutant. In the caεe of vectors which encode the pre or prepro form of the carbonyl hydrolase mutant, such mutantε, when expreεεed, are typically εecreted from the hoεt cell into the host cell medium.
"Operably linked" when describing the relationship between two DNA regions simply means that they are functionally related to each other. For example, a presequence is operably linked to a peptide if it functions as a εignal sequence, participating in the secretion of the mature form of the protein most probably involving cleavage of the εignal εequence. A promoter iε operably linked to a coding εequence if it controlε the tranεcription of the εequence; a riboεome binding site iε operably linked to a coding sequence if it is positioned εo aε to permit tranεlation.
The geneε encoding the naturally-occurring precurεor carbonyl hydrolaεe may be obtained in accord with the general methodε deεcribed in EPO Publication Noε. 0 130 756 and 0 251 446. As can be seen from the examples diεcloεed therein, the methods generally comprise synthesizing labelled probes having putative sequenceε encoding regions of the hydrolaεe of interest, preparing genomic libraries from organismε expreεεing the hydrolaεe, and εcreening the librarieε for the gene of intereεt by hybridization to the probeε. Poεitively hybridizing cloneε are then mapped and εequenced.
The cloned carbonyl hydrolaεe iε then uεed to tranεform a hoεt cell in order to express the hydrolase. The hydrolase gene iε then ligated into a high copy number plasmid. This plaεmid replicateε in hosts in the εense that it contains the well-known elements neceεεary for plasmid replication: a promoter operably linked to the gene in question (which may be supplied as the gene's own homologous promotor if it is recognized, i.e., transcribed, by the host) , a transcription termination and polyadenylation region (necessary for stability of the mRNA tranεcribed by the hoεt from the hydrolaεe gene in certain eucaryotic hoεt cellε) which iε exogenous or is supplied by the endogenous terminator region of the hydrolase gene and, desirably, a selection gene such as an antibiotic reεiεtance gene that enableε continuouε cultural maintenance of plaεmid-infected hoεt cellε by growth in antibiotic-containing media. High copynumber plasmids also contain an origin of replication for the host, thereby enabling large numberε of plaεmidε to be generated in the c toplaεm without chromosomal limitations. However, it iε within the εcope herein to integrate multiple copieε of the hydrolaεe gene into hoεt genome. Thiε iε facilitated by procaryotic and eucaryotic organiεmε which are particularly susceptible to homologous recombination.
Alternatively, a εynthetic gene encoding a naturally- occurring or mutant precurεor carbonyl hydrolaεe may be produced. In εuch an approach, the DNA and/or amino acid sequence of the precursor hydrolase is determined. Multiple, overlapping synthetic single-stranded DNA fragments are thereafter synthesized which upon hybridization and ligation produce a synthetic DNA encoding the precursor hydrolase. Thiε approach provideε εeveral advantages over cloning the natural gene in that restriction sites may be interposed throughout the DNA without change in the amino acid sequence encoded εo aε to facilitate subsequent modification to form mutant carbonyl hydrolaseε. Further, the synthetic approach allows for adjustingthe codon usage in the synthetic gene to conform with the codon bias for the particular expresεion hoεtε to be uεed. An example of εynthetic gene construction is set forth in the Examples.
Once the naturally-occurring or synthetic precursor carbonyl hydrolase gene has been cloned, a number of modifications are undertaken to enhance the use of the gene beyond synthesis of the naturally-occurring precursor carbonyl hydrolase. Such modifications include the production of recombinant carbonyl hydrolaseε as disclosed in EPO Publication Nos. 0 130 756 and 0 251446 and the production of carbonyl hydrolase mutants deεcribed herein.
The following cassette mutagenesis method may be used to facilitate the construction and identification of the carbonyl hydrolase mutants of the preεent invention although other methodε including εite-directed mutageneεiε may be uεed. Firεt, the naturally-occurring gene encoding the hydrolaεe iε obtained and εequenced in whole or in part. Then the εequence iε scanned for a point at which it is desired to make a mutation (deletion, inεertion or εubstitution) of one or more amino acids in the encoded enzyme. The εequenceε flanking thiε point are evaluated for the preεence of restriction sites for replacing a short segment of the gene with an oligonucleotide pool which when expreεεed will encode various mutantε. Such reεtriction siteε are preferably unique sites within the hydrolase gene so aε to facilitate the replacement of the gene εegment. However, any convenient reεtriction εite which iε not overly redundant in the hydrolaεe gene may be uεed, provided the gene fragmentε generated by reεtriction digeεtion can be reaεεembled in proper εequence. If reεtriction εiteε are not preεent at locationε within a convenient diεtance from the εelected point (from 10 to 15 nucleotideε) , εuch sites are generated by subεtituting nucleotides in the gene in such a faεhion that neither the reading frame nor the amino acidε encoded are changed in the final conεtruction. Mutation of the gene in order to change itε εequence to conform to the deεired εequence is accomplished by M13 primer extenεion in accord with generally known methodε. The taεk of locating εuitable flanking regionε and evaluating the needed changeε to arrive at two convenient reεtriction εite sequences is made routine by the redundancy of the genetic code, a restriction enzyme map of the gene and the large number of different reεtriction enzymes. Note that if a convenient flanking restriction εite iε available, the above method need be uεed only in connection with the flanking region which doeε not contain a εite.
Once the naturally-occurring DNA or εynthetic DNA is cloned, the reεtriction εiteε flanking the poεitionε to be mutated are digested with the cognate restriction enzymes and a plurality of end termini-complementary oligonucleotide caεεetteε are ligated into the gene. The mutageneεiε iε enormouεly εimplified by thiε method becauεe all of the oligonucleotideε can be syntheεized εo aε to have the εame reεtriction εiteε, and no synthetic linkers are necessary to create the restriction sites.
Aε uεed herein, proteolytic activity iε defined aε the rate of hydrolyεiε of peptide bondε per milligram of active enzyme. Many well known procedureε exiεt for meaεuringproteolytic activity (K. M. Kaliεz, "Microbial Proteinases", Advances in Biochemical Engineering/ Biotechnology. A. Fiechter ed. , 1988).
In one aspect of the invention, the objective is to εecure a mutant carbonyl hydrolaεe having a greater (numerically large) proteolytic activity aε compared to the precurεor carbonyl hydrolase, thereby enabling the use of the enzyme to more efficiently act on a target subεtrate. Specific amino acidε uεeful to obtain such results in subtiliεin-type carbonyl hydrolaεeε at reεidues equivalent to +123 in Bacillus amyloliquefaciens subtiliεin are preεented in the Examples. In some inεtanceε, lower proteolytic activity may be desirable. In εuch cases a decreaεe in proteolytic activity can be produced by εubεtituting the amino acidε identified in the exampleε at reεidueε equivalent to +123 in Bacillus amyloliquefaciens subtiliεin.
For precurεor εubtiliεins wherein serine is not the residue at the position equivalent to +123 in Bacilluε amyloliquefacienε the greateεt proteolytic activity iε obtained when εerine iε εubεtituted in the precurεor at poεition+123. Further, no naturally-occurring Bacilluε εubtiliεin iε known to exiεt which contains εerine at a position equivalent to +123 in Bacillus amyloliquefaciens subtilisin. Based on the discovery that εerine at thiε poεition enhanceε proteolytic activity, one skilled in the art can εcreen naturally- occurring Bacilluε subtiliεin to identify and clone a natural mutant containing serine at this position. Such natural Bacillus subtilisin mutants are within the scope of the invention.
Where the carbonyl hydrolaεe iε from other than Bacillus and a serine is present at +123 in the precursor enzyme the εubεtitution can be one that decreaεeε proteolytic activity. Thiε would be uεeful, for example, where the synthetic activity of the carbonyl hydrolases is desired (aε for εyntheεizing peptideε) . One may wiεh to decreaεe thiε proteolytic activity which iε capable of deεtroying the product of εuch εyntheεiε.
In another aεpect of the invention, it haε been determined that reεidueε equivalent to +274 in Bacilluε amyloliquefaciens εubtilisin are important in modulating the overall performance characteriεtics of the enzyme in detergent compositions. Thus, as set forth in the Examples, the threonine in Bacillus lentus subtiliεin at equivalent poεition +274 can be mutated to alanine in the preferred embodiment to produce enhanced performance of the mutant enzyme. Aε alεo diεcloεed in the Examples, subεtitution of thiε reεidue with an amino acid other than threonine, e.g. leucine, εerine, valine and alanine reεultε in a decreaεe in the εtability of the mutant. Such decreaεe in εtability iε believed to be the reεult of autocatalytic degradation of the mutant. Thuε, modificationε of reεidueε equivalent to +274 in Bacilluε subtiliεin are capable of enhancing the overall performance of the enzyme in a detergent compoεition and modulating the overall εtability of the enzyme. In thiε aεpect of the invention, the objective is to secure a mutant carbonyl hydrolaεe having enhanced performance when uεed in a detergent compoεition aε compared to the precurεor carbonyl hydrolaεe. Aε uεed herein, enhanced performance in a detergent iε defined as increaεed cleaning of certain enzyme sensitive stains εuch as grass or blood. This cleaning is determined by visual evaluation after a standard wash cycle.
A preferred embodiment of the invention is set forth in the Exampleε wherein the lysine at position 27 is εubεtituted with arginine, the valine at poεition 104 iε εubεtituted with tyroεine, the aεparagine at poεition 123 εubεtituted with εerine and the threonine at reεidue 274 iε εubεtituted with alanine in Bacillus lentus subtiliεin. Although the stability of this enzyme is εomewhat reduced as compared to the precursor Bacillus lentus subtiliεin, the performance level of this enzyme in a detergent composition is subεtantially enhanced εuch that the same performance of this Bacillus lentus subtiliεin mutant is obtained aε compared to the unmodified Bacillus lentus subtiliεin when using approximately one-half the amount of enzyme.
Based on the reεults obtained with this and other mutant εubtiliεinε, it is apparent that residues in carbonyl hydrolaseε equivalent to positions +123 and +274 in Bacillus amyloliquefaciens are important to the proteolytic activity, performance and/or stability of theεe enzymeε.
Many of the carbonyl hydrolaεe mutantε of the invention, eεpecially εubtiliεin, are uεeful in formulatingvariouε detergent compoεitionε. A number of known compoundε are εuitable εurfactantε uεeful in compoεitionε compriεing the carbonyl hydrolaεe mutantε of the invention. Theεe include nonionic, anionic, cationic, anionic, or zwitterionic detergents, aε diεcloεed in U.S.4,404,128 to Barry J. Anderεon and U.S. 4,261,868 to Jiri Flora, et al. The art is familiar with the different formulations which can be uεed aε cleaning compoεitionε. Subtilisins of the invention can be formulated into known powdered and liquid detergents having pH between 6.5 and 12.0 at levels of about .01 to about 5% preferably .1% to .05%) by weight. These detergent cleaning compoεitions can alεo include other enzymeε εuch aε known proteaεeε and amylaεeε, aε well aε builders and εtabilizerε.
The addition of εubtiliεinε of the invention to conventional cleaning compoεitionε doeε not create any εpecial uεe limitation. In other words, any temperature and pH suitable for the detergent is also εuitable for the preεent compoεitionε as long as the pH is within the above range, and the temperature is below the subtiliεinε of the invention denaturing temperature. In addition, εubtilisins of the invention can be used in a cleaning composition without detergents, again either alone or in combination with builders and stabilizerε.
The following iε preεented by way of example and iε not to be conεtrued aε a limitation to the εcope of the claims.
EXAMPLE 1
Conεtructionε for Expression of Bacillus lentus Subtilisin Gene in Bacillus subtiliε
Plasmid pSAR, Fig.5, carries a translational fusion via a common Sau3A restriction site at the εeventh/eighth εignal sequence codon of the εubtilisin genes of B. subtilis and £_t_ amyloliquefaciens. Aε εhown in Fig. 5, thiε gene, on an EcoRI-BamHI 2.0 Kb fragment, waε subcloned into M13mpl9 in order to iεolate single- stranded template DNA to be uεed for εite-directed mutageneεiε to form pSAR-Q275R. The mutageneεiε protocol waε eεεentially that of Zoller, M. , et al. (1983), Methods Enzvmol.. 100. 468-500, (1) and used a εynthetic oligonucleotide of the εequence:
* **
5'-C-AAC-GTA-CAG-GCT-GCA-GCT-CGC-TAA-AAC-ATA-A-3' Q275R
where the aεteriεks denote changes from the wild-type gene sequences and the underline representε an introduced Pεtl restriction endonuclease εite uεed in εcreening for the particular mutant gene encoding the Q275R change. These changes were made to (1) convert the amino acid at this position to that found in Bacillus lentus subtilisin and (2) to allow hookup of the terminator in pSAR to the mature coding region of Bacillus lentus via a Pst εite εimilarly introduced into pGG36 from Bacillus lentus (ATCC 21536) .
Plaεmid pGG36, Fig. 5, contains a 2.1 kb geno ic DNA fragment from Bacillus lentus (ATCC 21536) encoding the complete εubtiliεin gene which was cloned by standard methods in the shuttle vector pBS42. Band, L. , et al. (1984), £NA, 1, 17-21.
The amino acid sequence for this subtilisin iε the εame aε that diεcloεed for εubtiliεin 309 in PCT Publication
No. 89/06279. This gene was subcloned into M13 aε above for site-directed mutagenesiε using an oligonucleotide of the sequence:
* * * 5'-C-AAT-GCA-GAA-GCT-GCA-GCT-CGC-TAA-TCA-A-3'
T274A in order to 1) introduce a PstI site at the same location in this gene corresponding to the εite introduced into pSAR above and 2) to εubεtitute the threonine at position 274 with alanine to form pGG36- T274A. The mutant pSAR-Q275R and pGG36-T274A genes were individually subcloned back into pBS42 prior to Pεtl/BamHI digeεtions, fragment isolation and ligation to produce plasmid GG-A274B.amy.term. as shown in Fig. 5, all by standard methods.
A εynthetic DNA linker waε made by annealing complimentary εingle-εtranded oligonucleotideε of the εequenceε:
5'-G-ATC-GTC-GCG-TCG-ACC-GCA-CTA-CTC-ATT-TCT-GTT- GCT-TTT-AGT-TCA-T-3' and
5'-CGA-TGA-ACT-AAA-AGC-AAC-AGA-AAT-GAG-TAG-TGC- GGT-CGA-CGC-GAC-3'
to give the double-εtranded DNA fragment #2 εhown in Fig. 6. The recessed left- and right-hand ends of this duplex linker are complimentary to the Sau3A end of fragment #1 (from pSAR) and the Clal end of fragment #3
(from pGG-A274 B.amy.term) , reεpectively. Theεe 3 fragmentε were combined with fragment 4 from pSAR-Q275R after reεtriction endonucleaεe digeεtions of plasmids, fragment isolation and ligation by εtandard methodε to produce plaεmid pGG-KVNA. The designation GG-KVNA indicates that this εubtiliεin containε the εubtiliεin encoded by pGG-36 which includes lysine (K) at poεition 27, valine (V) at poεition 104, aεparagine (N) at poεition 123 and the εubεtitution of threonine at poεition 274 with alanine (A) . EXAMPLE 2
Modification of PGG-KVNA
As indicated in Fig. 6, the GG-KVNA gene (2.1 kb EcoRI- BamHI fragment) was subcloned into M13 for three successive rounds of site-directed mutagenesis using oligonucleotides having the sequence:
* * *
(a) 5'-GT-TCT-GGT-GTA-AGA-GTT-GCT-GTT-CTA-GAT-ACA-GGT-3' ,
K27R
* **
(b) 5'-A-GTA-TTA-GGG-GCT-AGC-GGT-TCA-GGT-TCG-TAC-AGC-TCG-ATT-3'
V104y and
* ** (c) 5'-GGG-AAC-AAT-GGA-ATG-CAC-GTT-GCT-AGC-TTG-AGT-TTA-3'
N123S
The asteriεkε denote changes from the wild-type gene sequence. The underlines represent, in (a) an introduced Xbal site and in (b) and (c) introduced Nhel sites used to screen for the presence of the linked R27, Y104 and S123 mutations, respectively. In addition, in (c) , the overlined denoteε a deεtroyed Sphl site. Finally, the 2.1 kb GG-RYSA gene waε εubcloned back into pBS42 for expression in J . subtiliε hoεts.
The resultant plasmid was designated pGG-RYSA. Thiε designation indicates that four residues were modified in the pGG-KVNA plasmid. Lysine (K) at position 27 to arginine (R) , valine (V) to tyrosine (Y) at position 104 and asparagine (N) at position 123 to εerine (S) . The alanine previouεly substituted at residue 274 was not modified in this procedure. The lysine at poεition 27 waε substituted with arginine based upon the amino acid sequencing of εubtiliεin 309. Aε indicated in PCT Publication No. WO89/06279, lysine is located at poεition 27. However, after independently εequencing thiε εubtiliεin protein, the initial data indicated that arginine waε the reεidue at poεition 27. In the caεe of the εubεtitution of tyroεine for valine at reεidue 104, the εubstitution was made to lower the pH activity profile and to increaεe the performance of the enzyme baεed on reεultε previouεly obtained for Bacillus amyloliquefaciens subtiliεin (εo etimeε referred to aε BPN') . The εubεtitution of aεparagine at poεition 123 with εerine iε baεed on the reεultε obtained hereinafter wherein it waε determined that the εubεtitution of εerine at poεition 123 maximized the proteolytic activity of the enzyme in a closely related mutant.
EXAMPLE 3
Construction of Synthetic Bacillus lentus Subtilisin Gene
DNA encoding the amino acid sequence of Bacilluε lentuε εubtiliεin waε alεo prepared by conεtructing a gene encoding a εynthetic DNA εequence.
The 2.1 kb Hindlll genomic fragment from plaεmid pGG36 waε sequenced. The deduced amino acid sequence of the mature gene product (GG36 subtilisin) was uεed to design a synthetic mature coding εequence with the following propertieε: (1) In general, the codons most frequently found for each amino acid in seven different &____ subtiliε genes (from a tabulation of codon usages, Table 2 from Maruyama, T. , et al., (1986), Nucl. Acids Reε.. Supplement I£ pp. rl51-rl97) were utilized except in the caseε where alternate codonε reεulted in conveniently located restriction enzyme recognition sites within the gene; (2) Approximately every 40-60 b.p. of the -0.8 mature coding region, combinations of 2 or 3 specifically chosen codons were utilized which resulted in the introduction of fairly evenly spaced, unique restriction εiteε. Theεe εiteε were choεen to facilitate (a) later cassette mutagenesis and screening studieε and (b) conεtructions involving more than one mutation; (3) A unique Pst I recognition site was deεigned to cover codons 272-274 allowing hook up to the terminator sequences of a Bacillus amyloliquefaciens gene similarly modified over the same three codonε and εubεtituting threonine at poεition 274 with alanine; and (4) A unique Nrul εite was introduced to cover mature codonε reεidueε 9-10 allowing hookup to GG36'ε pre-pro coding εequence via a εhort εynthetic duplex DNA linker. Based on this design, oligonucleotides ("oligoε") were εyntheεized εuch that upon annealing the coding and non- coding oligos for a given -60 b.p. coding region, the resultant duplex DNA fragment would have at it's endε εingle εtranded regions complimentary to the end of the next duplex fragment of the gene (see, Fig. 7) .
A total of 36 separate oligoε (compriεing 18 individual duplexeε) were used in the scheme, as outlined above, resulting in an -O.δkb duplex synthetic mature coding region (Fragment 3 in Fig. 8) .
Finally, one additional pair or synthetic oligo'ε waε εynthesized, which upon annealing (to give fragment 2 in Fig. 8) has an Ncol -site at it'ε 5* end (complimentary to GG36'ε Ncol site at mature codons 5-6) and an Nrul site at itε 3' end (complimentary to the 3's 5 end of fragment 3) .
The final conεtruction to give a complete expreεεion unit conεisting of __. εubtiliε promoter and the firεt εeven amino acids of the signal sequence hooked up to GG36'ε εequenceε encoding the remainder of the εignal sequence, the complete pro sequence and the first six mature amino acids (Fragment 1 from GG-KVNA) , the εynthetic gene encodingmature reεidueε 7-274 (Fragmentε 2+3) and the terminator region (including the final mature gene codon 279) of Bacillus amyloliquefaciens (fragment 4) was done as a four-way ligation as εet forth in Fig. 6.
Finally, three additional εeparate mutationε were introduced into the mature coding region of thiε full length hybrid gene. The first substituted the lysine at position 27 with arginine. The second εubεtituted the valine at position 104 with tyrosine. The third subεtituted the asparagine at position 123 with serine The reεultant plasmid is designated pBC3-RYSA. The following example describes the method used to modify position 123 in the synthetic gene. Similar methodε were uεed to modify positions 27 and 104 in this εynthetic gene.
EXAMPLE 4
Construction of Position 123 Mutants
An Xho I site was introduced over codons 111/112 in the εynthetic gene from Example 3 by making three phenotypically εilent mutationε via εite directed mutageneεiε (primer extenεion mutageneεiε in M13) . The reεulting plaεmid, pX123 (Fig.9) , waε digeεted with Xho I and Ava I and the large vector-containing fragment iεolated by electroelution from agaroεe gel. Complimentarysynthetic oligonucleotideεwere annealed, ligated with the pX123 large fragment and tranεformed into E. coli εtrain MM294. Theεe caεεetteε encoded, individually, all 20 naturally-occurring amino acidε at position 123, and in addition contained a silent mutation which destroyed a unique Sph I site lying between the Xho I and Ava I sites in pX123. Resulting plasmidε from E. coli transformantε were εcreened for the loεε of the unique Sph I εite. Poεitives by restriction analysiε (i.e., Sph I negativeε) were εequenced to confirm the presence of the desired position 123 mutations subcloned into the εhuttle vector pBS42 and tranεformed into Bacillus subtilis BG2036 for expresεion.
EXAMPLE 5
Activity of Various +123 Mutants
Proteolytic activity of each of the subtilisin mutants encoded by the above modified position +123 mutants was asεayed by mixing 0.04 ml of εupernatant from centrifuged culture broths with 0.56 ml of 1% w/v casein in 0.1M Tris pH8.60. After a 20 minute incubation at 37'C, reactions were quenched by precipitation with 10% trichloroacetic acid (TCA) . Activity was determined from the absorbance at a wavelength of 280nm for the supernatant after precipitation with 10% TCA.
-
TABLE I
Relative proteolytic activity of codon 123 variants normalized to Asn-123 mutant
% Proteolytic Codon 123 Activity
Ser 116
Aεn 100
Cyε 22
Gly 12 Ala 9
Thr 7
Gin 7
Val 6
Glu <5 lie <5
Trp <5
Phe <5
Aεp <5
Hiε <5 Leu <5
Met <5
Pro <5
Tyr <5
In the proceεε of final confirmation of the DNA εequence of the εynthetic gene coding for the enzyme BC3-RYSA, proline waε found to be at poεition 78 inεtead of εerine (the amino acid at thiε position in Bacillus lentus subtiliεin) . The initial propertieε of the poεition 123 mutationε were teεted in thiε enzyme, BC3-RPYA (proline at poεition 78) . Theεe reεultε are εhown in Table I. The amino acid at poεition 78 waε thereafter changed back to serine to form the DNA and amino acid sequence shown in Fig. 10 by replacing the εynthetic DNA duplex correεponding to that portion of the gene. Aε can be εeen the substitution of Asn with Ser at position +123 results in a substantial increase in proteolytic activity. The relationship between the various subtiliεins discussed herein are summarized for positions 27, 78, 104, 123 and 274 in Table II.
TABLE II position
Figure imgf000035_0001
EXAMPLE 6
Stability of Position 274 Mutants
Stability of position 274 mutants in BC3-RPY (arginine at position 27, proline at poεition 78, and tyroεine at poεition 104 in Bacillus lentus subtilisin) are εhown in Table III. Data are percent activity remaining following incubation at 37*C in 50mM EDTA for 60 minutes.
Figure imgf000036_0001
Mutations at this position clearly effect stability of the enzyme. Although the alanine mutation waε not aε εtable aε εerine or threonine at thiε poεition, thiε enzyme provided εuperior performance relative to Bacillus lentus subtiliεin under the conditions of use described. For different applications, other amino acids at position 274 may be used.
EXAMPLE 7
Detergent Composition
A spray-dried phosphate detergent granule of the following composition was prepared:
Component
Sodium C12 linear alkylbenzene εulfonate
Sodium Tallow Alcohol sulfate Sodium C14"15 linear alkyl sulfate
Sodium Toluene Sulfonate
Sodium Tripolyphoεphate
Sodium pyrophoεphate
Silicate (1.6 r) Sodium Sulfate
Sodium polyacrylate (4500 MW)
Brightener
Sodium Carbonate
Polyethylene Glycol (MW 8000) C12"13 alcohol polyethoxylate (6.5)*
Miεcellaneous + Water
Protease**
Figure imgf000037_0001
♦Alcohol and monoethoxylate alcohol removed. **mg active enzyme/g (2.0 mg active enzyme/g stock)
A 0.1 weight percent εolution of thiε compoεition in water had a pH of 10.0. The composition with subtiliεin mutant of the invention (Fig. 7) provided εuperior cleaning of enzyme-εensitive stains, when compared to Bacillus lentus at 0.068 mg active enzyme/g product, in a 95"F (35'C) wash at 6 grains per gallon (gpg) hardnesε (3:1 Ca/Mg) .
Throughout thiε application reference iε made to variouε amino acidε by way of common one-and three-letter codeε. Such codeε are identified in Proteins: Structures and Molecular Proteases. Thomas E. Creighton, eds. W.N. Freeman, N.Y., N.Y. (1983), p.3. Although the preferred form of the invention has been described above, it will be obvious to those skilled in the art to which the invention pertains, that, after understanding the invention as a whole, various changes and equivalent modifications may be made without departing from the scope of the invention as defined by the appended claimε.
All publicationε are expressly incorporated herein by reference.

Claims

WHAT IS CLAIMED IS:
1. A carbonyl hydrolase mutant having an amino acid εequence not found in nature which iε derived form a precurεor carbonylhydrolaseby subεtituting adifferent amino acid for the amino acid residue at a poεition in εaid precurεor equivalent to +123 or +274 in Bacilluε amyloliquefacienε εubtilisin.
2. The carbonyl hydrolase mutant of Claim 1 wherein εaid precurεor carbonyl hydrolaεe iε a εubtiliεin.
3. The εubtiliεin mutant according to Claim 2 wherein εaid εubεtitution is at a poεition equivalent to +123.
4. The εubtiliεin mutant of Claim 3 wherein the amino acid reεidue in εaid εubtiliεin mutant at εaid poεition iε εerine.
5. The εubtiliεin mutant according to Claim 2 which is derived from a Bacillus εubtilisin.
6. Amutant Bacillus subtiliεin exhibiting improved proteolytic activity which is derived from naturally- occurring or mutant precursor Bacillus subtiliεin which has the amino acid residue at a position equivalent to +123 in Bacillus amyloliguefaciens subtiliεin changed to εerine.
7. A Bacillus εubtilisin having εerine at a poεition equivalent to +123 in Bacilluε amyloliquefacienε subtiliεin.
8. A mutant Bacillus εubtiliεin having the amino acid εequence:
AQSVPWGOSRVQAPAAHNRGLTGSGVRVAVLDTGISTHPDLNIRGGASFVPGE PSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSYSSIA QGLEWAGNNGMHVASLSLGSPSPSATLEQAVNSATSRGVLWAASGNSGAGSI SYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLN GTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAE AAAR.
9. DNA encoding the carbonyl hydrolaεe mutant of claim 1.
10. Expreεsion vector encoding the DNA of Claim 9.
11. Host cell transformed with the expresεion vector of Claim 10.
12. An enzymatic cleaning compoεition capable of degrading proteinε compriεing: a) a surfactant end; and b) a carbonyl hydrolase mutant having an amino acid εequence not found in nature which iε derived form a precurεor carbonyl hydrolaεeby εubεtituting a different amino acid for the amino acid reεidue at a poεition in εaid precurεor equivalent to +123 or +274 in Bacilluε amyloliquefaciens subtilisin.
13. The composition of Claim 12 wherein εaid carbonyl hydrolase enzyme compriεeε a εubtiliεin.
14. The compoεition of Claim 13 wherein said subtilisin haε the following amino acid sequence:
AQSVPWGOSRVQAPAAHNRGLTGSGVRVAVLDTGISTHPDLNIRGGASFVPGE PSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSYSSIA QGLEWAGNNGMHVASLSLGSPSPSATLEQAVNSATSRGVLWAASGNSGAGSI .
SYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLN GTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAE AAAR.
15. The composition of Claim 12 wherein the surfactant comprises a detergent.
16. A composition according to Claim 15 comprising a spray-dried detergent granule.
PCT/US1990/006084 1989-10-31 1990-10-26 Subtilisin mutants WO1991006637A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
DE69032852T DE69032852T2 (en) 1989-10-31 1990-10-26 SUBTILISIN MUTANTS
KR1019910700677A KR970004938B1 (en) 1989-10-31 1990-10-26 Subtilisin mutants
DK96120247T DK0775749T4 (en) 1989-10-31 1990-10-26 subtilisin
BR909006993A BR9006993A (en) 1989-10-31 1990-10-26 CARBONYL HYDROLASE MUTANT, BACILLUS SUBTILISIN, DNA, EXPRESSION VECTOR, HOST CELL AND ENZYMATIC COMPOUND FOR CLEANING
EP90915958A EP0451244B9 (en) 1989-10-31 1990-10-26 Subtilisin mutants
DK90915958T DK0451244T3 (en) 1989-10-31 1990-10-26 subtilisin
CA002044630A CA2044630C (en) 1989-10-31 1990-10-26 Subtilisin mutants
TR90/1065A TR25991A (en) 1989-10-31 1990-11-08 MUTANTS OF SUBTILIS USED IN CLEANING OF COMPUTERS AND SIMILAR.
FI913166A FI103052B1 (en) 1989-10-31 1991-06-28 Subtilisin mutant and enzymatic cleaning composition containing it
NO912567A NO301081B1 (en) 1989-10-31 1991-06-28 Subtilisin mutant with altered proteolytic activity or stability, DNA encoding mutants, expression vector, host cell as well as enzymatic purification mixture capable of degrading proteins

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US42988289A 1989-10-31 1989-10-31
US429,882 1989-10-31
US600,430 1990-10-19
US07/600,430 US5185258A (en) 1984-05-29 1990-10-19 Subtilisin mutants

Publications (1)

Publication Number Publication Date
WO1991006637A1 true WO1991006637A1 (en) 1991-05-16

Family

ID=27028376

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US1990/006084 WO1991006637A1 (en) 1989-10-31 1990-10-26 Subtilisin mutants

Country Status (21)

Country Link
US (1) US5185258A (en)
EP (2) EP0775749B2 (en)
JP (1) JP3335623B2 (en)
KR (1) KR970004938B1 (en)
CN (1) CN1052897A (en)
AR (1) AR244339A1 (en)
AT (2) ATE174961T1 (en)
AU (1) AU633376B2 (en)
BR (1) BR9006993A (en)
CA (1) CA2044630C (en)
DE (2) DE69032852T2 (en)
DK (2) DK0451244T3 (en)
ES (2) ES2242963T5 (en)
FI (1) FI103052B1 (en)
IE (1) IE62771B1 (en)
MA (1) MA22573A1 (en)
NO (1) NO301081B1 (en)
NZ (1) NZ235883A (en)
PT (1) PT95741B (en)
TR (1) TR25991A (en)
WO (1) WO1991006637A1 (en)

Cited By (86)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0571014A1 (en) * 1992-05-18 1993-11-24 Solvay Enzymes, Inc. Alkaline proteases, bacteria producing them, process for the production of these alkaline proteases, uses of these alkaline proteases and detergent compositions containing them
WO1995010591A1 (en) * 1993-10-14 1995-04-20 The Procter & Gamble Company Protease-containing cleaning compositions
WO1995010615A1 (en) * 1993-10-14 1995-04-20 Genencor International, Inc. Subtilisin variants
US5453372A (en) * 1991-07-27 1995-09-26 Solvay Enzymes Gmbh & Co. Kg Stabilized enzymes and process for preparing them
EP0687733A1 (en) * 1994-06-16 1995-12-20 The Procter & Gamble Company Detergent composition containing wool compatible high alkaline proteases
WO1996005739A1 (en) * 1994-08-19 1996-02-29 Finnfeeds International Limited An enzyme feed additive and animal feed including it
EP0699745A2 (en) 1994-08-31 1996-03-06 The Procter & Gamble Company Automatic dishwashing compositions comprising quaternary ammonium compounds bleach activators and quaternary ammonium
AU682314B2 (en) * 1992-07-17 1997-10-02 Genencor International, Inc. High alkaline serine proteases
US5677272A (en) * 1993-10-14 1997-10-14 The Procter & Gamble Company Bleaching compositions comprising protease enzymes
EP0563169B1 (en) * 1990-12-21 1997-10-29 Novo Nordisk A/S ENZYME MUTANTS HAVING A LOW DEGREE OF VARIATION OF THE MOLECULAR CHARGE OVER A pH RANGE
WO1999032613A1 (en) 1997-12-20 1999-07-01 Genencor International, Inc. Matrix granule
US5932532A (en) * 1993-10-14 1999-08-03 Procter & Gamble Company Bleach compositions comprising protease enzyme
US6066611A (en) * 1994-10-13 2000-05-23 The Procter & Gamble Company Bleaching compositions comprising protease enzymes
US6284246B1 (en) 1997-07-30 2001-09-04 The Procter & Gamble Co. Modified polypeptides with high activity and reduced allergenicity
US6291414B1 (en) 1994-06-16 2001-09-18 The Procter & Gamble Company Detergent composition containing wool compatible high alkaline proteases
US6310027B1 (en) 1998-11-13 2001-10-30 Genencor International, Inc. Fluidized bed low density granule
US6413749B1 (en) 1998-10-27 2002-07-02 Genencor International, Inc. Granule containing protein and corn starch layered on an inert particle
US6423517B2 (en) 1997-12-20 2002-07-23 Genecor International, Inc. Granule containing protein and salt layered on an inert particle
EP1241112A2 (en) 2001-03-15 2002-09-18 The Procter & Gamble Company Flexible multiple compartment pouch
US6534466B2 (en) 1999-01-08 2003-03-18 Genencor International, Inc. Low-density compositions and particulates including same
US6602841B1 (en) 1997-12-20 2003-08-05 Genencor International, Inc. Granule with hydrated barrier material
US6653093B1 (en) 1997-12-20 2003-11-25 Genencor International, Inc. Accelerated stability test
EP1523553A2 (en) * 2002-01-16 2005-04-20 Genencor International, Inc. Multiply-substituted protease variants
WO2005116180A1 (en) 2004-05-17 2005-12-08 The Procter & Gamble Company Bleaching composition comprising a carbohydrate oxidase
EP1632561A1 (en) 1999-10-15 2006-03-08 Genencor International, Inc. Protein-containing granules and granule formulations
US7018821B2 (en) 2001-06-22 2006-03-28 Genencor International, Inc. Highly impact-resistant granules
WO2006050247A2 (en) 2004-10-29 2006-05-11 Neose Technologies, Inc. Remodeling and glycopegylation of fibroblast growth factor (fgf)
US7122334B2 (en) 1997-12-24 2006-10-17 Genencor International, Inc. Method of assaying wash performance of enzymes on a microtiter plate
WO2008028896A2 (en) 2006-09-08 2008-03-13 Henkel Ag & Co. Kgaa High-concentration enzyme granules and detergents or cleaners comprising such high-concentration enzyme granules
US7686892B2 (en) 2004-11-19 2010-03-30 The Procter & Gamble Company Whiteness perception compositions
US7691618B2 (en) 2004-04-23 2010-04-06 Henkel Ag & Co. Kgaa Alkaline proteases and detergents and cleaners comprising these alkaline proteases
WO2010108002A1 (en) 2009-03-18 2010-09-23 The Procter & Gamble Company Structured fluid detergent compositions comprising dibenzylidene sorbitol acetal derivatives
WO2010108000A1 (en) 2009-03-18 2010-09-23 The Procter & Gamble Company Structured fluid detergent compositions comprising dibenzylidene polyol acetal derivatives and detersive enzymes
US7811076B2 (en) 2003-12-23 2010-10-12 Henkel Ag & Co. Kgaa Alkaline protease and washing and cleaning products containing said novel alkaline protease
WO2011005623A1 (en) 2009-07-09 2011-01-13 The Procter & Gamble Company Laundry detergent composition comprising low level of bleach
WO2011005830A1 (en) 2009-07-09 2011-01-13 The Procter & Gamble Company Laundry detergent composition comprising low level of sulphate
EP2284272A1 (en) 1998-06-10 2011-02-16 Novozymes A/S Mannanases
US7901772B2 (en) 2005-09-27 2011-03-08 The Procter & Gamble Company Microcapsule and method of producing same
US8076113B2 (en) * 2001-04-02 2011-12-13 Danisco Us Inc. Method for producing granules with reduced dust potential comprising an antifoam agent
US8088722B2 (en) 2009-05-26 2012-01-03 The Procter & Gamble Company Aqueous liquid composition for pre-treating soiled dishware
EP2583744A1 (en) 2006-03-31 2013-04-24 Genencor International, Inc. Permeate product of tangential flow filtration process
EP2641652A2 (en) 2007-09-12 2013-09-25 Danisco US Inc. Filtration with internal fouling control
US8636918B2 (en) 2011-08-05 2014-01-28 Ecolab Usa Inc. Cleaning composition containing a polysaccharide hybrid polymer composition and methods of controlling hard water scale
US8679366B2 (en) 2011-08-05 2014-03-25 Ecolab Usa Inc. Cleaning composition containing a polysaccharide graft polymer composition and methods of controlling hard water scale
JP2014507489A (en) * 2010-12-17 2014-03-27 ビーエーエスエフ ソシエタス・ヨーロピア Storage-stable liquid detergent and detergent containing protease and cellulase
US8841246B2 (en) 2011-08-05 2014-09-23 Ecolab Usa Inc. Cleaning composition containing a polysaccharide hybrid polymer composition and methods of improving drainage
US8853144B2 (en) 2011-08-05 2014-10-07 Ecolab Usa Inc. Cleaning composition containing a polysaccharide graft polymer composition and methods of improving drainage
US8945314B2 (en) 2012-07-30 2015-02-03 Ecolab Usa Inc. Biodegradable stability binding agent for a solid detergent
US9051406B2 (en) 2011-11-04 2015-06-09 Akzo Nobel Chemicals International B.V. Graft dendrite copolymers, and methods for producing the same
US9109068B2 (en) 2005-07-21 2015-08-18 Akzo Nobel N.V. Hybrid copolymer compositions
US9365805B2 (en) 2014-05-15 2016-06-14 Ecolab Usa Inc. Bio-based pot and pan pre-soak
EP3075832A1 (en) 2015-03-30 2016-10-05 Dalli-Werke GmbH & Co. KG Manganese-amino acid compounds in cleaning compositions
EP3196302A1 (en) 2008-02-14 2017-07-26 Danisco US Inc. Small enzyme-containing granules
EP3205393A1 (en) 2016-02-12 2017-08-16 Basf Se Process for preparation of microcapsules
EP3205392A1 (en) 2016-02-12 2017-08-16 Basf Se Microcapsules and process for preparation of microcapsules
WO2017182295A1 (en) 2016-04-18 2017-10-26 Basf Se Liquid cleaning compositions
WO2018029021A1 (en) 2016-08-08 2018-02-15 Basf Se Liquid laundry formulation
WO2018089211A1 (en) 2016-11-08 2018-05-17 Ecolab Usa Inc. Non-aqueous cleaner for vegetable oil soils
US9988526B2 (en) 2011-11-04 2018-06-05 Akzo Nobel Chemicals International B.V. Hybrid dendrite copolymers, compositions thereof and methods for producing the same
WO2018099762A1 (en) 2016-12-01 2018-06-07 Basf Se Stabilization of enzymes in compositions
EP3456809A1 (en) 2012-10-04 2019-03-20 Ecolab USA, Inc. Pre-soak technology for laundry and other hard surface cleaning
WO2019105780A1 (en) 2017-11-29 2019-06-06 Basf Se Compositions, their manufacture and use
WO2019238761A1 (en) 2018-06-15 2019-12-19 Basf Se Water soluble multilayer films containing wash active chemicals and enzymes
WO2020030623A1 (en) 2018-08-10 2020-02-13 Basf Se Packaging unit comprising a detergent composition containing an enzyme and at least one chelating agent
WO2020069915A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing hydrolases in liquids
WO2020069914A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing amylases in liquids
WO2020069913A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing hydrolases in liquids
WO2020104231A1 (en) 2018-11-19 2020-05-28 Basf Se Powders and granules containing a chelating agent and an enzyme
EP3677676A1 (en) 2019-01-03 2020-07-08 Basf Se Compounds stabilizing amylases in liquids
WO2020229480A1 (en) 2019-05-14 2020-11-19 Basf Se Compounds stabilizing hydrolases in liquids
WO2021030676A1 (en) 2019-08-14 2021-02-18 Ecolab Usa Inc. Methods of cleaning and soil release of highly oil absorbing substrates employing optimized extended chain nonionic surfactants
WO2021074430A1 (en) 2019-10-18 2021-04-22 Basf Se Storage-stable hydrolase containing liquids
WO2021115912A1 (en) 2019-12-09 2021-06-17 Basf Se Formulations comprising a hydrophobically modified polyethyleneimine and one or more enzymes
WO2021160818A1 (en) 2020-02-14 2021-08-19 Basf Se Mannanase variants
US11103118B2 (en) 2014-08-01 2021-08-31 Ecolab Usa Inc. Method of manual surface cleaning using cleaning textiles and of washing said cleaning textiles
WO2022010893A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Foaming mixed alcohol/water compositions comprising a combination of alkyl siloxane and a hydrotrope/solubilizer
WO2022010911A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Foaming mixed alcohol/water compositions comprising a structured alkoxylated siloxane
WO2022008732A1 (en) 2020-07-10 2022-01-13 Basf Se Enhancing the activity of antimicrobial preservatives
WO2022010906A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Peg-modified castor oil based compositions for microemulsifying and removing multiple oily soils
US11492572B2 (en) 2019-12-06 2022-11-08 Alene Candles LLC Effervescing compositions and tablets for treating toilets
WO2022243533A1 (en) 2021-05-20 2022-11-24 Nouryon Chemicals International B.V. Manufactured polymers having altered oligosaccharide or polysaccharide functionality or narrowed oligosaccharide distribution, processes for preparing them, compositions containing them, and methods of using them
WO2022243367A1 (en) 2021-05-18 2022-11-24 Nouryon Chemicals International B.V. Polyester polyquats in cleaning applications
WO2023275269A1 (en) 2021-06-30 2023-01-05 Nouryon Chemicals International B.V. Chelate-amphoteric surfactant liquid concentrates and use thereof in cleaning applications
WO2023057367A1 (en) 2021-10-08 2023-04-13 Unilever Ip Holdings B.V. Laundry composition
WO2023225459A2 (en) 2022-05-14 2023-11-23 Novozymes A/S Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections
WO2024020445A1 (en) 2022-07-20 2024-01-25 Ecolab Usa Inc. Novel nonionic extended surfactants, compositions and methods of use thereof

Families Citing this family (57)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6287841B1 (en) * 1988-02-11 2001-09-11 Genencor International, Inc. High alkaline serine protease
US5665587A (en) * 1989-06-26 1997-09-09 Novo Nordisk A/S Modified subtilisins and detergent compositions containing same
US5352603A (en) * 1989-08-31 1994-10-04 Kali-Chemie Ag Highly alkaline proteases
DK271490D0 (en) * 1990-11-14 1990-11-14 Novo Nordisk As detergent composition
US5482849A (en) * 1990-12-21 1996-01-09 Novo Nordisk A/S Subtilisin mutants
DK0583339T3 (en) * 1991-05-01 1999-04-19 Novo Nordisk As Stabilized enzymes and detergent compositions
US5340735A (en) * 1991-05-29 1994-08-23 Cognis, Inc. Bacillus lentus alkaline protease variants with increased stability
US6300122B1 (en) 1991-12-20 2001-10-09 Genencor International Method for applying enzyme to non-finished cellulosic-containing fabrics to improve appearance and feel characteristics
US6251144B1 (en) 1992-06-12 2001-06-26 Genencor International, Inc. Enzymatic compositions and methods for producing stonewashed look on indigo-dyed denim fabric and garments
US5470733A (en) * 1993-06-01 1995-11-28 University Of Maryland Calcium free subtilisin mutants
US5567601A (en) * 1993-06-01 1996-10-22 University Of Maryland Subtilisin mutants lacking a primary calcium binding site
US6436690B1 (en) * 1993-09-15 2002-08-20 The Procter & Gamble Company BPN′ variants having decreased adsorption and increased hydrolysis wherein one or more loop regions are substituted
US6440717B1 (en) * 1993-09-15 2002-08-27 The Procter & Gamble Company BPN′ variants having decreased adsorption and increased hydrolysis
US6187579B1 (en) * 1993-10-28 2001-02-13 Carlsberg A/S Customized proteases
ES2364776T3 (en) * 1994-02-24 2011-09-14 HENKEL AG &amp; CO. KGAA IMPROVED AND DETERGENT ENZYMES THAT CONTAIN THEM.
US6599730B1 (en) * 1994-05-02 2003-07-29 Procter & Gamble Company Subtilisin 309 variants having decreased adsorption and increased hydrolysis
NZ291984A (en) * 1994-08-11 1998-04-27 Genencor Int Bleach-containing cleaning composition comprising a mutant alpha-amylase and optionally a mutant protease
US6455295B1 (en) * 1995-03-08 2002-09-24 The Procter & Gamble Company Subtilisin Carlsberg variants having decreased adsorption and increased hydrolysis
US6475765B1 (en) * 1995-03-09 2002-11-05 Procter & Gamble Company Subtilisin DY variants having decreased adsorption and increased hydrolysis
IL117350A0 (en) * 1995-03-09 1996-07-23 Procter & Gamble Proteinase k variants having decreased adsorption and increased hydrolysis
US5837517A (en) * 1995-05-05 1998-11-17 Novo Nordisk A/S Protease variants and compositions
US6682924B1 (en) * 1995-05-05 2004-01-27 Novozymes A/S Protease variants and compositions
US6946280B1 (en) * 1996-03-29 2005-09-20 Genencor International, Inc. Enzyme multimer and process of producing same
US5985627A (en) * 1997-02-28 1999-11-16 Carlsberg Laboratory Modified carboxypeptidase
ES2368718T3 (en) 1997-10-23 2011-11-21 Danisco Us Inc. SUBTILISINE VARIATIONS WITH MULTIPLE SUBSTITUTIONS.
US6835550B1 (en) 1998-04-15 2004-12-28 Genencor International, Inc. Mutant proteins having lower allergenic response in humans and methods for constructing, identifying and producing such proteins
US6642011B2 (en) 1998-04-15 2003-11-04 Genencor International, Inc. Human protease and use of such protease for pharmaceutical applications and for reducing the allergenicity of non-human proteins
US6936249B1 (en) * 1998-04-15 2005-08-30 Genencor International, Inc. Proteins producing an altered immunogenic response and methods of making and using the same
US6376450B1 (en) 1998-10-23 2002-04-23 Chanchal Kumar Ghosh Cleaning compositions containing multiply-substituted protease variants
US6831053B1 (en) 1998-10-23 2004-12-14 The Procter & Gamble Company Bleaching compositions comprising multiply-substituted protease variants
US6579841B1 (en) 1998-12-18 2003-06-17 Genencor International, Inc. Variant EGIII-like cellulase compositions
US7297354B2 (en) * 2000-04-26 2007-11-20 Land O'lakes, Inc. Protein material
AU2001280968A1 (en) * 2000-07-31 2002-02-13 Menzel, Rolf Compositions and methods for directed gene assembly
US6623949B1 (en) * 2000-08-04 2003-09-23 Genencor International, Inc. Variant EGIII-like cellulase compositions
US6635465B1 (en) 2000-08-04 2003-10-21 Genencor International, Inc. Mutant EGIII cellulase, DNA encoding such EGIII compositions and methods for obtaining same
US7303907B2 (en) 2001-01-08 2007-12-04 Health Protection Agency Degradation and detection of TSE infectivity
CA2441595C (en) * 2001-03-23 2012-07-03 Genencor International, Inc. Proteins producing an altered immunogenic response and methods of making and using the same
US7157416B2 (en) * 2001-07-20 2007-01-02 Genencor International, Inc. Stabilization of enzymes
EP1554378A4 (en) * 2001-12-31 2006-01-11 Genencor Int Proteases producing an altered immunogenic response and methods of making and using the same
JP2005514026A (en) * 2001-12-31 2005-05-19 ジェネンコー・インターナショナル・インク Protease that produces a change in immune response, and method for producing and using the same
EP2287321B1 (en) * 2002-01-16 2014-08-13 Danisco US Inc. Multiply-substituted protease variants
JP4430944B2 (en) * 2002-02-26 2010-03-10 ジェネンコー・インターナショナル・インク Population-based assessment and tools for ranking the relative immunogenicity of proteins
ATE457352T1 (en) * 2002-02-26 2010-02-15 Genencor Int SUBTILISIN CARLSBERG PROTEINS WITH REDUCED IMMUNOGENICITY
WO2003099843A2 (en) 2002-05-20 2003-12-04 Dow Corning Corporation Peptide derivatives, and their use for the synthesis of silicon-based composite materials
KR101211445B1 (en) 2002-07-30 2012-12-12 다니스코 유에스 인크. Reduced aerosol generating formulations
KR101132555B1 (en) * 2002-10-02 2012-04-02 리전츠 오브 더 유니버시티 오브 캘리포니아 Methods of generating and screening for proteases with altered specificity
US20070025974A1 (en) * 2003-02-26 2007-02-01 Hardings Fiona A Amylases producing an altered immunogenic response and methods of making and using the same
EP2500423B1 (en) 2003-02-26 2015-06-17 Danisco US Inc. Amylases producing an altered immunogenic response and methods of making and using the same
EP1740952A2 (en) * 2004-04-26 2007-01-10 Genencor International, Inc. Population based prediction methods for immune response determinations and methods for verifying immunological response data
US20090060933A1 (en) * 2004-06-14 2009-03-05 Estell David A Proteases producing an altered immunogenic response and methods of making and using the same
GB0603775D0 (en) * 2006-02-24 2006-04-05 Health Prot Agency Infectivity assay
US10087401B2 (en) 2012-03-16 2018-10-02 Monosol, Llc Water soluble compositions incorporating enzymes, and method of making same
US9394092B2 (en) 2012-04-16 2016-07-19 Monosol, Llc Powdered pouch and method of making same
EP3327122B1 (en) 2014-07-04 2021-02-17 Novozymes A/S Subtilase variants and polynucleotides encoding same
US10626388B2 (en) 2014-07-04 2020-04-21 Novozymes A/S Subtilase variants and polynucleotides encoding same
WO2017213168A1 (en) * 2016-06-09 2017-12-14 花王株式会社 Alkaline protease variant
CN107937372B (en) * 2017-12-19 2020-03-24 江南大学 Nattokinase with improved acid resistance

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4760025A (en) * 1984-05-29 1988-07-26 Genencor, Inc. Modified enzymes and methods for making same
US4914031A (en) * 1987-04-10 1990-04-03 Amgen, Inc. Subtilisin analogs
EP0130756B1 (en) * 1983-06-24 1991-02-06 Genencor International, Inc. Procaryotic carbonyl hydrolases, methods, dna, vectors and transformed hosts for producing them, and detergent compositions containing them

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4261868A (en) 1979-08-08 1981-04-14 Lever Brothers Company Stabilized enzymatic liquid detergent composition containing a polyalkanolamine and a boron compound
US4404128A (en) 1981-05-29 1983-09-13 The Procter & Gamble Company Enzyme detergent composition
US5013657A (en) 1988-04-12 1991-05-07 Bryan Philip N Subtilisin mutations
US4990452A (en) 1986-02-12 1991-02-05 Genex Corporation Combining mutations for stabilization of subtilisin
ATE116365T1 (en) 1986-04-30 1995-01-15 Genencor Int MUTANT OF A NON-HUMAN CARBONYL HYDROLASE, FOR THESE DNA SEQUENCES AND VECTORS CODING AND HOSTS TRANSFORMED BY THESE VECTORS.
EP0896062A3 (en) 1987-02-27 1999-04-07 Genencor International, Inc. Transformation of alkalophilic bacillus strains
DK6488D0 (en) 1988-01-07 1988-01-07 Novo Industri As ENZYMES
WO1989006276A2 (en) 1988-01-08 1989-07-13 Dpz Deutsches Primatenzentrum Gesellschaft Mbh Hiv-2-type retroviruses of primates, vaccines, diagnostic and pharmaceutical compositions
CN1056187C (en) 1988-02-11 2000-09-06 金克克国际有限公司 Proteolytic enzymes and their use in detergents

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0130756B1 (en) * 1983-06-24 1991-02-06 Genencor International, Inc. Procaryotic carbonyl hydrolases, methods, dna, vectors and transformed hosts for producing them, and detergent compositions containing them
US4760025A (en) * 1984-05-29 1988-07-26 Genencor, Inc. Modified enzymes and methods for making same
US4914031A (en) * 1987-04-10 1990-04-03 Amgen, Inc. Subtilisin analogs

Cited By (114)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0563169B1 (en) * 1990-12-21 1997-10-29 Novo Nordisk A/S ENZYME MUTANTS HAVING A LOW DEGREE OF VARIATION OF THE MOLECULAR CHARGE OVER A pH RANGE
US5453372A (en) * 1991-07-27 1995-09-26 Solvay Enzymes Gmbh & Co. Kg Stabilized enzymes and process for preparing them
US5518917A (en) * 1992-05-18 1996-05-21 Solvay Enzymes, Inc. Bacillus proteolyticus species which produce an alkaline protease
US5385837A (en) * 1992-05-18 1995-01-31 Solvay Enzymes, Inc. Alkaline proteases derived from Bacillus proteolyticus
EP0571014A1 (en) * 1992-05-18 1993-11-24 Solvay Enzymes, Inc. Alkaline proteases, bacteria producing them, process for the production of these alkaline proteases, uses of these alkaline proteases and detergent compositions containing them
US5565348A (en) * 1992-05-18 1996-10-15 Solvay Enzymes, Inc. Alkaline protease from Bacillus proteolyticus species
AU682314B2 (en) * 1992-07-17 1997-10-02 Genencor International, Inc. High alkaline serine proteases
EP1526182A2 (en) * 1993-10-14 2005-04-27 Genencor International, Inc. Subtilisin variants
US6017871A (en) * 1993-10-14 2000-01-25 The Procter & Gamble Company Protease-containing cleaning compositions
US7250281B2 (en) 1993-10-14 2007-07-31 Genencor International, Inc. Subtilisin variants
US6586221B2 (en) 1993-10-14 2003-07-01 Genencor International, Inc. Subtilisin variants multiply-substituted subtilising variants having a substitution at position 76
WO1995010591A1 (en) * 1993-10-14 1995-04-20 The Procter & Gamble Company Protease-containing cleaning compositions
US5677272A (en) * 1993-10-14 1997-10-14 The Procter & Gamble Company Bleaching compositions comprising protease enzymes
US5679630A (en) * 1993-10-14 1997-10-21 The Procter & Gamble Company Protease-containing cleaning compositions
WO1995010615A1 (en) * 1993-10-14 1995-04-20 Genencor International, Inc. Subtilisin variants
EP1526182A3 (en) * 1993-10-14 2005-05-04 Genencor International, Inc. Subtilisin variants
US5932532A (en) * 1993-10-14 1999-08-03 Procter & Gamble Company Bleach compositions comprising protease enzyme
EP0687733A1 (en) * 1994-06-16 1995-12-20 The Procter & Gamble Company Detergent composition containing wool compatible high alkaline proteases
US6291414B1 (en) 1994-06-16 2001-09-18 The Procter & Gamble Company Detergent composition containing wool compatible high alkaline proteases
EP0704167A1 (en) 1994-08-19 1996-04-03 Finnfeeds International Ltd. An enzyme feed additive and animal feed including it
WO1996005739A1 (en) * 1994-08-19 1996-02-29 Finnfeeds International Limited An enzyme feed additive and animal feed including it
EP0699745A2 (en) 1994-08-31 1996-03-06 The Procter & Gamble Company Automatic dishwashing compositions comprising quaternary ammonium compounds bleach activators and quaternary ammonium
US6066611A (en) * 1994-10-13 2000-05-23 The Procter & Gamble Company Bleaching compositions comprising protease enzymes
US6284246B1 (en) 1997-07-30 2001-09-04 The Procter & Gamble Co. Modified polypeptides with high activity and reduced allergenicity
US6423517B2 (en) 1997-12-20 2002-07-23 Genecor International, Inc. Granule containing protein and salt layered on an inert particle
US6602841B1 (en) 1997-12-20 2003-08-05 Genencor International, Inc. Granule with hydrated barrier material
WO1999032613A1 (en) 1997-12-20 1999-07-01 Genencor International, Inc. Matrix granule
US6653093B1 (en) 1997-12-20 2003-11-25 Genencor International, Inc. Accelerated stability test
US7122334B2 (en) 1997-12-24 2006-10-17 Genencor International, Inc. Method of assaying wash performance of enzymes on a microtiter plate
EP2284272A1 (en) 1998-06-10 2011-02-16 Novozymes A/S Mannanases
EP2287318A1 (en) 1998-06-10 2011-02-23 Novozymes A/S Mannanases
US6413749B1 (en) 1998-10-27 2002-07-02 Genencor International, Inc. Granule containing protein and corn starch layered on an inert particle
US6790643B2 (en) 1998-10-27 2004-09-14 Genencor International, Inc. Granule containing enzyme, corn starch and sugar layered on an inert particle
US7300779B2 (en) 1998-10-27 2007-11-27 Genencor International, Inc. Preparation of a granule containing protein, corn starch and sugar layered on an inert particle
US6635611B2 (en) 1998-11-13 2003-10-21 Genencor International, Inc. Fluidized bed low density granule
US6310027B1 (en) 1998-11-13 2001-10-30 Genencor International, Inc. Fluidized bed low density granule
US6583099B2 (en) 1999-01-08 2003-06-24 Robert I. Christensen, Jr. Low-density compositions and particulates including same
US6534466B2 (en) 1999-01-08 2003-03-18 Genencor International, Inc. Low-density compositions and particulates including same
EP1632561A1 (en) 1999-10-15 2006-03-08 Genencor International, Inc. Protein-containing granules and granule formulations
EP1241112A2 (en) 2001-03-15 2002-09-18 The Procter & Gamble Company Flexible multiple compartment pouch
US8535924B2 (en) 2001-04-02 2013-09-17 Danisco Us Inc. Granules with reduced dust potential comprising an antifoam agent
US8076113B2 (en) * 2001-04-02 2011-12-13 Danisco Us Inc. Method for producing granules with reduced dust potential comprising an antifoam agent
US7018821B2 (en) 2001-06-22 2006-03-28 Genencor International, Inc. Highly impact-resistant granules
US8309334B2 (en) 2001-06-22 2012-11-13 Danisco Us Inc. Method for producing highly impact-resistant granules
EP1523553A4 (en) * 2002-01-16 2006-06-21 Genencor Int Multiply-substituted protease variants
EP1523553A2 (en) * 2002-01-16 2005-04-20 Genencor International, Inc. Multiply-substituted protease variants
US7811076B2 (en) 2003-12-23 2010-10-12 Henkel Ag & Co. Kgaa Alkaline protease and washing and cleaning products containing said novel alkaline protease
US7985570B2 (en) 2004-04-23 2011-07-26 B.R.A.I.N. Biotechnology Research And Information Network A.G. Alkaline proteases and detergents and cleaners comprising these alkaline proteases
US7691618B2 (en) 2004-04-23 2010-04-06 Henkel Ag & Co. Kgaa Alkaline proteases and detergents and cleaners comprising these alkaline proteases
WO2005116180A1 (en) 2004-05-17 2005-12-08 The Procter & Gamble Company Bleaching composition comprising a carbohydrate oxidase
WO2006050247A2 (en) 2004-10-29 2006-05-11 Neose Technologies, Inc. Remodeling and glycopegylation of fibroblast growth factor (fgf)
EP2586456A1 (en) 2004-10-29 2013-05-01 BioGeneriX AG Remodeling and glycopegylation of fibroblast growth factor (FGF)
US7846268B2 (en) 2004-11-19 2010-12-07 The Procter & Gamble Company Whiteness perception compositions comprising a dye-polymer conjugate
US7686892B2 (en) 2004-11-19 2010-03-30 The Procter & Gamble Company Whiteness perception compositions
US9109068B2 (en) 2005-07-21 2015-08-18 Akzo Nobel N.V. Hybrid copolymer compositions
US9321873B2 (en) 2005-07-21 2016-04-26 Akzo Nobel N.V. Hybrid copolymer compositions for personal care applications
US7901772B2 (en) 2005-09-27 2011-03-08 The Procter & Gamble Company Microcapsule and method of producing same
US8460792B2 (en) 2005-09-27 2013-06-11 The Procter & Gamble Company Microcapsule and method of producing same
EP2583744A1 (en) 2006-03-31 2013-04-24 Genencor International, Inc. Permeate product of tangential flow filtration process
WO2008028896A2 (en) 2006-09-08 2008-03-13 Henkel Ag & Co. Kgaa High-concentration enzyme granules and detergents or cleaners comprising such high-concentration enzyme granules
EP2641652A2 (en) 2007-09-12 2013-09-25 Danisco US Inc. Filtration with internal fouling control
EP3196302A1 (en) 2008-02-14 2017-07-26 Danisco US Inc. Small enzyme-containing granules
WO2010108000A1 (en) 2009-03-18 2010-09-23 The Procter & Gamble Company Structured fluid detergent compositions comprising dibenzylidene polyol acetal derivatives and detersive enzymes
WO2010108002A1 (en) 2009-03-18 2010-09-23 The Procter & Gamble Company Structured fluid detergent compositions comprising dibenzylidene sorbitol acetal derivatives
US8088722B2 (en) 2009-05-26 2012-01-03 The Procter & Gamble Company Aqueous liquid composition for pre-treating soiled dishware
WO2011005830A1 (en) 2009-07-09 2011-01-13 The Procter & Gamble Company Laundry detergent composition comprising low level of sulphate
WO2011005623A1 (en) 2009-07-09 2011-01-13 The Procter & Gamble Company Laundry detergent composition comprising low level of bleach
JP2014507489A (en) * 2010-12-17 2014-03-27 ビーエーエスエフ ソシエタス・ヨーロピア Storage-stable liquid detergent and detergent containing protease and cellulase
US8636918B2 (en) 2011-08-05 2014-01-28 Ecolab Usa Inc. Cleaning composition containing a polysaccharide hybrid polymer composition and methods of controlling hard water scale
US8853144B2 (en) 2011-08-05 2014-10-07 Ecolab Usa Inc. Cleaning composition containing a polysaccharide graft polymer composition and methods of improving drainage
US9309489B2 (en) 2011-08-05 2016-04-12 Ecolab Usa Inc Cleaning composition containing a polysaccharide hybrid polymer composition and methods of improving drainage
US9309490B2 (en) 2011-08-05 2016-04-12 Ecolab Usa Inc. Cleaning composition containing a polysaccharide graft polymer compositon and methods of improving drainage
US8841246B2 (en) 2011-08-05 2014-09-23 Ecolab Usa Inc. Cleaning composition containing a polysaccharide hybrid polymer composition and methods of improving drainage
US8679366B2 (en) 2011-08-05 2014-03-25 Ecolab Usa Inc. Cleaning composition containing a polysaccharide graft polymer composition and methods of controlling hard water scale
US9051406B2 (en) 2011-11-04 2015-06-09 Akzo Nobel Chemicals International B.V. Graft dendrite copolymers, and methods for producing the same
US9988526B2 (en) 2011-11-04 2018-06-05 Akzo Nobel Chemicals International B.V. Hybrid dendrite copolymers, compositions thereof and methods for producing the same
US8945314B2 (en) 2012-07-30 2015-02-03 Ecolab Usa Inc. Biodegradable stability binding agent for a solid detergent
EP3456809A1 (en) 2012-10-04 2019-03-20 Ecolab USA, Inc. Pre-soak technology for laundry and other hard surface cleaning
US9365805B2 (en) 2014-05-15 2016-06-14 Ecolab Usa Inc. Bio-based pot and pan pre-soak
US10053652B2 (en) 2014-05-15 2018-08-21 Ecolab Usa Inc. Bio-based pot and pan pre-soak
US11103118B2 (en) 2014-08-01 2021-08-31 Ecolab Usa Inc. Method of manual surface cleaning using cleaning textiles and of washing said cleaning textiles
EP3075832A1 (en) 2015-03-30 2016-10-05 Dalli-Werke GmbH & Co. KG Manganese-amino acid compounds in cleaning compositions
WO2017137293A1 (en) 2016-02-12 2017-08-17 Basf Se Process for preparation of microcapsules
EP3205393A1 (en) 2016-02-12 2017-08-16 Basf Se Process for preparation of microcapsules
EP3205392A1 (en) 2016-02-12 2017-08-16 Basf Se Microcapsules and process for preparation of microcapsules
WO2017182295A1 (en) 2016-04-18 2017-10-26 Basf Se Liquid cleaning compositions
WO2018029021A1 (en) 2016-08-08 2018-02-15 Basf Se Liquid laundry formulation
WO2018089211A1 (en) 2016-11-08 2018-05-17 Ecolab Usa Inc. Non-aqueous cleaner for vegetable oil soils
WO2018099762A1 (en) 2016-12-01 2018-06-07 Basf Se Stabilization of enzymes in compositions
WO2019105781A1 (en) 2017-11-29 2019-06-06 Basf Se Storage-stable enzyme preparations, their production and use
WO2019105780A1 (en) 2017-11-29 2019-06-06 Basf Se Compositions, their manufacture and use
WO2019238761A1 (en) 2018-06-15 2019-12-19 Basf Se Water soluble multilayer films containing wash active chemicals and enzymes
WO2020030623A1 (en) 2018-08-10 2020-02-13 Basf Se Packaging unit comprising a detergent composition containing an enzyme and at least one chelating agent
WO2020069915A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing hydrolases in liquids
WO2020069914A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing amylases in liquids
WO2020069913A1 (en) 2018-10-05 2020-04-09 Basf Se Compounds stabilizing hydrolases in liquids
WO2020104231A1 (en) 2018-11-19 2020-05-28 Basf Se Powders and granules containing a chelating agent and an enzyme
EP3677676A1 (en) 2019-01-03 2020-07-08 Basf Se Compounds stabilizing amylases in liquids
WO2020229480A1 (en) 2019-05-14 2020-11-19 Basf Se Compounds stabilizing hydrolases in liquids
WO2021030676A1 (en) 2019-08-14 2021-02-18 Ecolab Usa Inc. Methods of cleaning and soil release of highly oil absorbing substrates employing optimized extended chain nonionic surfactants
WO2021074430A1 (en) 2019-10-18 2021-04-22 Basf Se Storage-stable hydrolase containing liquids
US11492572B2 (en) 2019-12-06 2022-11-08 Alene Candles LLC Effervescing compositions and tablets for treating toilets
WO2021115912A1 (en) 2019-12-09 2021-06-17 Basf Se Formulations comprising a hydrophobically modified polyethyleneimine and one or more enzymes
WO2021160818A1 (en) 2020-02-14 2021-08-19 Basf Se Mannanase variants
WO2022010893A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Foaming mixed alcohol/water compositions comprising a combination of alkyl siloxane and a hydrotrope/solubilizer
WO2022010911A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Foaming mixed alcohol/water compositions comprising a structured alkoxylated siloxane
WO2022010906A1 (en) 2020-07-06 2022-01-13 Ecolab Usa Inc. Peg-modified castor oil based compositions for microemulsifying and removing multiple oily soils
WO2022008732A1 (en) 2020-07-10 2022-01-13 Basf Se Enhancing the activity of antimicrobial preservatives
WO2022243367A1 (en) 2021-05-18 2022-11-24 Nouryon Chemicals International B.V. Polyester polyquats in cleaning applications
WO2022243533A1 (en) 2021-05-20 2022-11-24 Nouryon Chemicals International B.V. Manufactured polymers having altered oligosaccharide or polysaccharide functionality or narrowed oligosaccharide distribution, processes for preparing them, compositions containing them, and methods of using them
WO2023275269A1 (en) 2021-06-30 2023-01-05 Nouryon Chemicals International B.V. Chelate-amphoteric surfactant liquid concentrates and use thereof in cleaning applications
WO2023057367A1 (en) 2021-10-08 2023-04-13 Unilever Ip Holdings B.V. Laundry composition
WO2023225459A2 (en) 2022-05-14 2023-11-23 Novozymes A/S Compositions and methods for preventing, treating, supressing and/or eliminating phytopathogenic infestations and infections
WO2024020445A1 (en) 2022-07-20 2024-01-25 Ecolab Usa Inc. Novel nonionic extended surfactants, compositions and methods of use thereof

Also Published As

Publication number Publication date
NZ235883A (en) 1992-09-25
DE69034195T3 (en) 2009-10-22
NO301081B1 (en) 1997-09-08
FI913166A0 (en) 1991-06-28
IE903905A1 (en) 1991-05-08
CA2044630A1 (en) 1991-05-01
IE62771B1 (en) 1995-02-22
EP0451244B9 (en) 2005-01-26
EP0451244A1 (en) 1991-10-16
TR25991A (en) 1993-11-01
ATE297997T1 (en) 2005-07-15
DE69032852T2 (en) 1999-05-20
MA22573A1 (en) 1993-04-01
JP3335623B2 (en) 2002-10-21
JPH04505263A (en) 1992-09-17
ES2242963T3 (en) 2005-11-16
US5185258A (en) 1993-02-09
EP0775749B1 (en) 2005-06-15
DK0775749T4 (en) 2009-07-20
ATE174961T1 (en) 1999-01-15
DE69034195T2 (en) 2006-03-23
ES2242963T5 (en) 2009-08-27
FI103052B (en) 1999-04-15
CN1052897A (en) 1991-07-10
EP0775749A1 (en) 1997-05-28
PT95741B (en) 1997-10-31
DK0775749T3 (en) 2005-09-12
PT95741A (en) 1991-09-13
EP0451244B1 (en) 1998-12-23
AU6634190A (en) 1991-05-31
CA2044630C (en) 2000-05-30
EP0451244A4 (en) 1992-06-03
EP0775749B2 (en) 2009-04-01
DE69032852D1 (en) 1999-02-04
AU633376B2 (en) 1993-01-28
NO912567D0 (en) 1991-06-28
DK0451244T3 (en) 1999-08-23
ES2125224T3 (en) 1999-03-01
FI103052B1 (en) 1999-04-15
BR9006993A (en) 1991-11-26
AR244339A1 (en) 1993-10-29
DE69034195D1 (en) 2005-07-21
KR970004938B1 (en) 1997-04-10
NO912567L (en) 1991-06-28

Similar Documents

Publication Publication Date Title
AU633376B2 (en) Subtilisin mutants
US5204015A (en) Subtilisin mutants
US7250281B2 (en) Subtilisin variants
KR100612981B1 (en) Multiply-substituted protease variants
EP1523553B1 (en) Multiply-substituted protease variants
WO2000024924A2 (en) Methods for screening protease variants for use in detergent compositions
MXPA00003801A (en) Multiply-substituted protease variants
MXPA00003807A (en) Multiply-substituted protease variants

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A1

Designated state(s): AU BR CA FI JP KR NO

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): AT BE CH DE DK ES FR GB GR IT LU NL SE

WWE Wipo information: entry into national phase

Ref document number: 1990915958

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2044630

Country of ref document: CA

Ref document number: 913166

Country of ref document: FI

WWP Wipo information: published in national office

Ref document number: 1990915958

Country of ref document: EP

WWG Wipo information: grant in national office

Ref document number: 1990915958

Country of ref document: EP

WWG Wipo information: grant in national office

Ref document number: 913166

Country of ref document: FI