US20230058309A1 - Serum amyloid p derivatives and their preparation and use - Google Patents
Serum amyloid p derivatives and their preparation and use Download PDFInfo
- Publication number
- US20230058309A1 US20230058309A1 US17/695,071 US202217695071A US2023058309A1 US 20230058309 A1 US20230058309 A1 US 20230058309A1 US 202217695071 A US202217695071 A US 202217695071A US 2023058309 A1 US2023058309 A1 US 2023058309A1
- Authority
- US
- United States
- Prior art keywords
- sap
- polypeptide
- sap polypeptide
- linked
- human
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 210000002966 serum Anatomy 0.000 title claims abstract description 34
- 238000002360 preparation method Methods 0.000 title description 11
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 304
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 277
- 229920001184 polypeptide Polymers 0.000 claims abstract description 262
- 238000000034 method Methods 0.000 claims abstract description 116
- 101001092910 Homo sapiens Serum amyloid P-component Proteins 0.000 claims abstract description 57
- 241000282414 Homo sapiens Species 0.000 claims abstract description 43
- 238000000338 in vitro Methods 0.000 claims abstract description 21
- 210000004027 cell Anatomy 0.000 claims description 110
- 150000002482 oligosaccharides Polymers 0.000 claims description 69
- 210000000630 fibrocyte Anatomy 0.000 claims description 45
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 42
- 125000005629 sialic acid group Chemical group 0.000 claims description 39
- 208000035475 disorder Diseases 0.000 claims description 33
- 210000001616 monocyte Anatomy 0.000 claims description 28
- 230000004069 differentiation Effects 0.000 claims description 26
- 150000001413 amino acids Chemical class 0.000 claims description 24
- 239000003795 chemical substances by application Substances 0.000 claims description 22
- 210000004978 chinese hamster ovary cell Anatomy 0.000 claims description 14
- 230000008569 process Effects 0.000 claims description 13
- 241000124008 Mammalia Species 0.000 claims description 10
- 108020001507 fusion proteins Proteins 0.000 claims description 10
- 102000037865 fusion proteins Human genes 0.000 claims description 10
- 230000002401 inhibitory effect Effects 0.000 claims description 10
- 238000004519 manufacturing process Methods 0.000 claims description 9
- 239000000825 pharmaceutical preparation Substances 0.000 claims description 8
- 206010020751 Hypersensitivity Diseases 0.000 claims description 7
- 208000026935 allergic disease Diseases 0.000 claims description 7
- 206010028116 Mucosal inflammation Diseases 0.000 claims description 6
- 201000010927 Mucositis Diseases 0.000 claims description 6
- 230000009610 hypersensitivity Effects 0.000 claims description 6
- 208000023275 Autoimmune disease Diseases 0.000 claims description 5
- 230000003176 fibrotic effect Effects 0.000 claims description 5
- 208000027866 inflammatory disease Diseases 0.000 claims description 5
- 125000000539 amino acid group Chemical group 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 3
- 230000000893 fibroproliferative effect Effects 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 235000000346 sugar Nutrition 0.000 abstract description 68
- 230000013595 glycosylation Effects 0.000 abstract description 40
- 238000006206 glycosylation reaction Methods 0.000 abstract description 40
- 239000000203 mixture Substances 0.000 abstract description 29
- 150000004676 glycans Chemical group 0.000 abstract description 24
- 230000004048 modification Effects 0.000 abstract description 23
- 238000012986 modification Methods 0.000 abstract description 23
- 238000007792 addition Methods 0.000 abstract description 15
- 238000001727 in vivo Methods 0.000 abstract description 13
- 230000004071 biological effect Effects 0.000 abstract description 8
- 238000012217 deletion Methods 0.000 abstract description 8
- 230000037430 deletion Effects 0.000 abstract description 8
- 108010045517 Serum Amyloid P-Component Proteins 0.000 abstract 1
- 108090000623 proteins and genes Proteins 0.000 description 102
- -1 glycosyl halides Chemical class 0.000 description 72
- 102000004169 proteins and genes Human genes 0.000 description 67
- 235000018102 proteins Nutrition 0.000 description 63
- 230000000694 effects Effects 0.000 description 60
- 239000003814 drug Substances 0.000 description 35
- 238000011282 treatment Methods 0.000 description 31
- 230000014509 gene expression Effects 0.000 description 27
- 230000001225 therapeutic effect Effects 0.000 description 23
- 229930182830 galactose Natural products 0.000 description 22
- 239000000126 substance Substances 0.000 description 21
- 102000004190 Enzymes Human genes 0.000 description 20
- 108090000790 Enzymes Proteins 0.000 description 20
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 19
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 19
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 18
- 150000007523 nucleic acids Chemical class 0.000 description 18
- 239000000523 sample Substances 0.000 description 18
- 229920001542 oligosaccharide Polymers 0.000 description 17
- 102000039446 nucleic acids Human genes 0.000 description 16
- 108020004707 nucleic acids Proteins 0.000 description 16
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 16
- 229940079593 drug Drugs 0.000 description 15
- 230000004761 fibrosis Effects 0.000 description 15
- 210000001519 tissue Anatomy 0.000 description 15
- 206010016654 Fibrosis Diseases 0.000 description 14
- 238000003556 assay Methods 0.000 description 14
- 229940124597 therapeutic agent Drugs 0.000 description 14
- 230000004988 N-glycosylation Effects 0.000 description 13
- 235000001014 amino acid Nutrition 0.000 description 13
- 229940024606 amino acid Drugs 0.000 description 13
- 150000001720 carbohydrates Chemical group 0.000 description 13
- 238000006243 chemical reaction Methods 0.000 description 13
- 150000001875 compounds Chemical class 0.000 description 13
- 125000003729 nucleotide group Chemical group 0.000 description 13
- 108700023372 Glycosyltransferases Proteins 0.000 description 12
- 239000000872 buffer Substances 0.000 description 12
- 238000009472 formulation Methods 0.000 description 12
- 238000002347 injection Methods 0.000 description 12
- 239000007924 injection Substances 0.000 description 12
- 239000002773 nucleotide Substances 0.000 description 12
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 12
- 239000013592 cell lysate Substances 0.000 description 11
- 230000002255 enzymatic effect Effects 0.000 description 11
- 239000003550 marker Substances 0.000 description 11
- 102000006433 Chemokine CCL22 Human genes 0.000 description 10
- 108010083701 Chemokine CCL22 Proteins 0.000 description 10
- 241001465754 Metazoa Species 0.000 description 10
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 10
- 230000015572 biosynthetic process Effects 0.000 description 10
- 230000004927 fusion Effects 0.000 description 10
- 229950006780 n-acetylglucosamine Drugs 0.000 description 10
- 150000008163 sugars Chemical class 0.000 description 10
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 9
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 9
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- 201000010099 disease Diseases 0.000 description 9
- 102000045442 glycosyltransferase activity proteins Human genes 0.000 description 9
- 108700014210 glycosyltransferase activity proteins Proteins 0.000 description 9
- 239000008194 pharmaceutical composition Substances 0.000 description 9
- 229920000642 polymer Polymers 0.000 description 9
- 238000000746 purification Methods 0.000 description 9
- 239000012634 fragment Substances 0.000 description 8
- 125000000524 functional group Chemical group 0.000 description 8
- 238000004128 high performance liquid chromatography Methods 0.000 description 8
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 8
- 102000040430 polynucleotide Human genes 0.000 description 8
- 108091033319 polynucleotide Proteins 0.000 description 8
- 239000002157 polynucleotide Substances 0.000 description 8
- 239000000047 product Substances 0.000 description 8
- 238000003786 synthesis reaction Methods 0.000 description 8
- 239000003981 vehicle Substances 0.000 description 8
- 241000196324 Embryophyta Species 0.000 description 7
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical group C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 7
- 108090000141 Sialyltransferases Proteins 0.000 description 7
- 102000003838 Sialyltransferases Human genes 0.000 description 7
- 235000014633 carbohydrates Nutrition 0.000 description 7
- 230000022811 deglycosylation Effects 0.000 description 7
- 238000012377 drug delivery Methods 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- 125000003147 glycosyl group Chemical group 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 230000001404 mediated effect Effects 0.000 description 7
- 229920002477 rna polymer Polymers 0.000 description 7
- 241000894007 species Species 0.000 description 7
- 238000006467 substitution reaction Methods 0.000 description 7
- 230000009885 systemic effect Effects 0.000 description 7
- 230000008685 targeting Effects 0.000 description 7
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 6
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 6
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 6
- 102000053602 DNA Human genes 0.000 description 6
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 6
- 239000007995 HEPES buffer Substances 0.000 description 6
- 206010028980 Neoplasm Diseases 0.000 description 6
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 6
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 6
- 239000013543 active substance Substances 0.000 description 6
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 230000001939 inductive effect Effects 0.000 description 6
- 239000000758 substrate Substances 0.000 description 6
- 230000000699 topical effect Effects 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 5
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 5
- 102000002068 Glycopeptides Human genes 0.000 description 5
- 108010015899 Glycopeptides Proteins 0.000 description 5
- 241000238631 Hexapoda Species 0.000 description 5
- 108091005804 Peptidases Proteins 0.000 description 5
- 239000004365 Protease Substances 0.000 description 5
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 5
- 150000001412 amines Chemical class 0.000 description 5
- 239000000969 carrier Substances 0.000 description 5
- 238000004587 chromatography analysis Methods 0.000 description 5
- 239000013611 chromosomal DNA Substances 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 230000002538 fungal effect Effects 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- 238000001802 infusion Methods 0.000 description 5
- 239000003112 inhibitor Substances 0.000 description 5
- 230000003834 intracellular effect Effects 0.000 description 5
- 150000002632 lipids Chemical class 0.000 description 5
- 125000000311 mannosyl group Chemical group C1([C@@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 5
- 239000002243 precursor Substances 0.000 description 5
- 238000012545 processing Methods 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 230000032258 transport Effects 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 229920003169 water-soluble polymer Polymers 0.000 description 5
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- KRHYYFGTRYWZRS-UHFFFAOYSA-N Fluorane Chemical compound F KRHYYFGTRYWZRS-UHFFFAOYSA-N 0.000 description 4
- KRHYYFGTRYWZRS-UHFFFAOYSA-M Fluoride anion Chemical compound [F-] KRHYYFGTRYWZRS-UHFFFAOYSA-M 0.000 description 4
- 108010070675 Glutathione transferase Proteins 0.000 description 4
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 4
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 4
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 4
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 239000000443 aerosol Substances 0.000 description 4
- 238000001042 affinity chromatography Methods 0.000 description 4
- 238000005349 anion exchange Methods 0.000 description 4
- 239000000427 antigen Substances 0.000 description 4
- 108091007433 antigens Proteins 0.000 description 4
- 102000036639 antigens Human genes 0.000 description 4
- 208000010668 atopic eczema Diseases 0.000 description 4
- 238000004166 bioassay Methods 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 239000000386 donor Substances 0.000 description 4
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 229930182470 glycoside Natural products 0.000 description 4
- 150000002338 glycosides Chemical class 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 230000006801 homologous recombination Effects 0.000 description 4
- 238000002744 homologous recombination Methods 0.000 description 4
- 230000002209 hydrophobic effect Effects 0.000 description 4
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 4
- 230000004807 localization Effects 0.000 description 4
- 239000006166 lysate Substances 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 230000004060 metabolic process Effects 0.000 description 4
- 210000004940 nucleus Anatomy 0.000 description 4
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 230000004481 post-translational protein modification Effects 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 238000012552 review Methods 0.000 description 4
- 239000004055 small Interfering RNA Substances 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 239000013598 vector Substances 0.000 description 4
- 241000283690 Bos taurus Species 0.000 description 3
- TXCIAUNLDRJGJZ-UHFFFAOYSA-N CMP-N-acetyl neuraminic acid Natural products O1C(C(O)C(O)CO)C(NC(=O)C)C(O)CC1(C(O)=O)OP(O)(=O)OCC1C(O)C(O)C(N2C(N=C(N)C=C2)=O)O1 TXCIAUNLDRJGJZ-UHFFFAOYSA-N 0.000 description 3
- TXCIAUNLDRJGJZ-BILDWYJOSA-N CMP-N-acetyl-beta-neuraminic acid Chemical compound O1[C@@H]([C@H](O)[C@H](O)CO)[C@H](NC(=O)C)[C@@H](O)C[C@]1(C(O)=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(N=C(N)C=C2)=O)O1 TXCIAUNLDRJGJZ-BILDWYJOSA-N 0.000 description 3
- 241000282472 Canis lupus familiaris Species 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 3
- 241000282326 Felis catus Species 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 102000051366 Glycosyltransferases Human genes 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 231100000111 LD50 Toxicity 0.000 description 3
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- SQVRNKJHWKZAKO-LUWBGTNYSA-N N-acetylneuraminic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)CC(O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-LUWBGTNYSA-N 0.000 description 3
- 108010006232 Neuraminidase Proteins 0.000 description 3
- 102000005348 Neuraminidase Human genes 0.000 description 3
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 3
- SUHOOTKUPISOBE-UHFFFAOYSA-N O-phosphoethanolamine Chemical compound NCCOP(O)(O)=O SUHOOTKUPISOBE-UHFFFAOYSA-N 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 108091000080 Phosphotransferase Proteins 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 201000009594 Systemic Scleroderma Diseases 0.000 description 3
- 206010042953 Systemic sclerosis Diseases 0.000 description 3
- HSCJRCZFDFQWRP-UHFFFAOYSA-N Uridindiphosphoglukose Natural products OC1C(O)C(O)C(CO)OC1OP(O)(=O)OP(O)(=O)OCC1C(O)C(O)C(N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-UHFFFAOYSA-N 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 230000000172 allergic effect Effects 0.000 description 3
- 210000004102 animal cell Anatomy 0.000 description 3
- 208000006673 asthma Diseases 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 239000000227 bioadhesive Substances 0.000 description 3
- 230000008499 blood brain barrier function Effects 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 229910002092 carbon dioxide Inorganic materials 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 210000003169 central nervous system Anatomy 0.000 description 3
- 208000019425 cirrhosis of liver Diseases 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 230000021615 conjugation Effects 0.000 description 3
- 239000000470 constituent Substances 0.000 description 3
- 238000013270 controlled release Methods 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000009826 distribution Methods 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 235000019441 ethanol Nutrition 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 239000000017 hydrogel Substances 0.000 description 3
- 230000007062 hydrolysis Effects 0.000 description 3
- 238000006460 hydrolysis reaction Methods 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 210000004072 lung Anatomy 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 229940060155 neuac Drugs 0.000 description 3
- 210000003463 organelle Anatomy 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 239000012071 phase Substances 0.000 description 3
- 235000021317 phosphate Nutrition 0.000 description 3
- 102000020233 phosphotransferase Human genes 0.000 description 3
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 3
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 3
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 3
- 125000006239 protecting group Chemical group 0.000 description 3
- 208000005069 pulmonary fibrosis Diseases 0.000 description 3
- 230000004043 responsiveness Effects 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 125000003396 thiol group Chemical group [H]S* 0.000 description 3
- 239000012049 topical pharmaceutical composition Substances 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 235000015112 vegetable and seed oil Nutrition 0.000 description 3
- 239000008158 vegetable oil Substances 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 229920003176 water-insoluble polymer Polymers 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- HOEWKBQADMRCLO-YKNQQZBYSA-N (2r,4s,5r,6r)-2-[[(2r,3s,4r)-5-(4-amino-2-oxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-4-hydroxy-5-[(2-hydroxyacetyl)amino]-6-[(1r,2r)-1,2,3-trihydroxypropyl]oxane-2-carboxylic acid Chemical compound O=C1N=C(N)C=CN1C1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)O[C@@]2(O[C@H]([C@H](NC(=O)CO)[C@@H](O)C2)[C@H](O)[C@H](O)CO)C(O)=O)O1 HOEWKBQADMRCLO-YKNQQZBYSA-N 0.000 description 2
- 206010002198 Anaphylactic reaction Diseases 0.000 description 2
- 241000203069 Archaea Species 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 201000001320 Atherosclerosis Diseases 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 102100032487 Beta-mannosidase Human genes 0.000 description 2
- 101100130886 Candida albicans (strain SC5314 / ATCC MYA-2876) MNT1 gene Proteins 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 229920000858 Cyclodextrin Polymers 0.000 description 2
- 239000004338 Dichlorodifluoromethane Substances 0.000 description 2
- 238000005698 Diels-Alder reaction Methods 0.000 description 2
- 201000003066 Diffuse Scleroderma Diseases 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 238000012286 ELISA Assay Methods 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- LQEBEXMHBLQMDB-UHFFFAOYSA-N GDP-L-fucose Natural products OC1C(O)C(O)C(C)OC1OP(O)(=O)OP(O)(=O)OCC1C(O)C(O)C(N2C3=C(C(N=C(N)N3)=O)N=C2)O1 LQEBEXMHBLQMDB-UHFFFAOYSA-N 0.000 description 2
- LQEBEXMHBLQMDB-JGQUBWHWSA-N GDP-beta-L-fucose Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C3=C(C(NC(N)=N3)=O)N=C2)O1 LQEBEXMHBLQMDB-JGQUBWHWSA-N 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 2
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 2
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 2
- 102000004877 Insulin Human genes 0.000 description 2
- 108090001061 Insulin Proteins 0.000 description 2
- CLRLHXKNIYJWAW-UHFFFAOYSA-N KDN Natural products OCC(O)C(O)C1OC(O)(C(O)=O)CC(O)C1O CLRLHXKNIYJWAW-UHFFFAOYSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 241000270322 Lepidosauria Species 0.000 description 2
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 2
- 208000019693 Lung disease Diseases 0.000 description 2
- 101150075484 MNN9 gene Proteins 0.000 description 2
- 108010085220 Multiprotein Complexes Proteins 0.000 description 2
- 102000007474 Multiprotein Complexes Human genes 0.000 description 2
- OVRNDRQMDRJTHS-CBQIKETKSA-N N-Acetyl-D-Galactosamine Chemical compound CC(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@H](O)[C@@H]1O OVRNDRQMDRJTHS-CBQIKETKSA-N 0.000 description 2
- MBLBDJOUHNCFQT-UHFFFAOYSA-N N-acetyl-D-galactosamine Natural products CC(=O)NC(C=O)C(O)C(O)C(O)CO MBLBDJOUHNCFQT-UHFFFAOYSA-N 0.000 description 2
- SQVRNKJHWKZAKO-PFQGKNLYSA-N N-acetyl-beta-neuraminic acid Chemical group CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-PFQGKNLYSA-N 0.000 description 2
- FDJKUWYYUZCUJX-UHFFFAOYSA-N N-glycolyl-beta-neuraminic acid Natural products OCC(O)C(O)C1OC(O)(C(O)=O)CC(O)C1NC(=O)CO FDJKUWYYUZCUJX-UHFFFAOYSA-N 0.000 description 2
- FDJKUWYYUZCUJX-KVNVFURPSA-N N-glycolylneuraminic acid Chemical group OC[C@H](O)[C@H](O)[C@@H]1O[C@](O)(C(O)=O)C[C@H](O)[C@H]1NC(=O)CO FDJKUWYYUZCUJX-KVNVFURPSA-N 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- 229930040373 Paraformaldehyde Natural products 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 206010035664 Pneumonia Diseases 0.000 description 2
- 229920000954 Polyglycolide Polymers 0.000 description 2
- ATUOYWHBWRKTHZ-UHFFFAOYSA-N Propane Chemical compound CCC ATUOYWHBWRKTHZ-UHFFFAOYSA-N 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 108010001267 Protein Subunits Proteins 0.000 description 2
- 102000002067 Protein Subunits Human genes 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 101150036627 SAP gene Proteins 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 101100184479 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) MNN4 gene Proteins 0.000 description 2
- 206010039710 Scleroderma Diseases 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 108091027967 Small hairpin RNA Proteins 0.000 description 2
- 108020004459 Small interfering RNA Proteins 0.000 description 2
- 241000282898 Sus scrofa Species 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- LFTYTUAZOPRMMI-UHFFFAOYSA-N UNPD164450 Natural products O1C(CO)C(O)C(O)C(NC(=O)C)C1OP(O)(=O)OP(O)(=O)OCC1C(O)C(O)C(N2C(NC(=O)C=C2)=O)O1 LFTYTUAZOPRMMI-UHFFFAOYSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- USAZACJQJDHAJH-KDEXOMDGSA-N [[(2r,3s,4r,5s)-5-(2,4-dioxo-1h-pyrimidin-6-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] hydrogen phosphate Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](C=2NC(=O)NC(=O)C=2)O1 USAZACJQJDHAJH-KDEXOMDGSA-N 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 150000001266 acyl halides Chemical class 0.000 description 2
- 230000001464 adherent effect Effects 0.000 description 2
- 238000001261 affinity purification Methods 0.000 description 2
- 150000001298 alcohols Chemical class 0.000 description 2
- 150000001299 aldehydes Chemical class 0.000 description 2
- 125000000217 alkyl group Chemical group 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 230000036783 anaphylactic response Effects 0.000 description 2
- 208000003455 anaphylaxis Diseases 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 2
- 108010055059 beta-Mannosidase Proteins 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 229920002988 biodegradable polymer Polymers 0.000 description 2
- 239000004621 biodegradable polymer Substances 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 210000001218 blood-brain barrier Anatomy 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 102000021178 chitin binding proteins Human genes 0.000 description 2
- 108091011157 chitin binding proteins Proteins 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 208000017760 chronic graft versus host disease Diseases 0.000 description 2
- 229910017052 cobalt Inorganic materials 0.000 description 2
- 239000010941 cobalt Substances 0.000 description 2
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 2
- 230000001268 conjugating effect Effects 0.000 description 2
- 239000013068 control sample Substances 0.000 description 2
- 238000012937 correction Methods 0.000 description 2
- 239000002537 cosmetic Substances 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 229940097362 cyclodextrins Drugs 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- PXBRQCKWGAHEHS-UHFFFAOYSA-N dichlorodifluoromethane Chemical compound FC(F)(Cl)Cl PXBRQCKWGAHEHS-UHFFFAOYSA-N 0.000 description 2
- 235000019404 dichlorodifluoromethane Nutrition 0.000 description 2
- 150000002031 dolichols Chemical class 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 238000005538 encapsulation Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 150000002256 galaktoses Chemical class 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 210000002288 golgi apparatus Anatomy 0.000 description 2
- 150000004820 halides Chemical class 0.000 description 2
- 239000000185 hemagglutinin Substances 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 229940125396 insulin Drugs 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 208000036971 interstitial lung disease 2 Diseases 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- 208000017169 kidney disease Diseases 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 108091070501 miRNA Proteins 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 150000002772 monosaccharides Chemical class 0.000 description 2
- BQJCRHHNABKAKU-KBQPJGBKSA-N morphine Chemical compound O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O BQJCRHHNABKAKU-KBQPJGBKSA-N 0.000 description 2
- 239000003158 myorelaxant agent Substances 0.000 description 2
- 239000002088 nanocapsule Substances 0.000 description 2
- 239000006199 nebulizer Substances 0.000 description 2
- CERZMXAJYMMUDR-UHFFFAOYSA-N neuraminic acid Natural products NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO CERZMXAJYMMUDR-UHFFFAOYSA-N 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 2
- 238000010534 nucleophilic substitution reaction Methods 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 239000002674 ointment Substances 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 229920002866 paraformaldehyde Polymers 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 229920001983 poloxamer Polymers 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 229920000139 polyethylene terephthalate Polymers 0.000 description 2
- 239000005020 polyethylene terephthalate Substances 0.000 description 2
- 229920001296 polysiloxane Polymers 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 239000003380 propellant Substances 0.000 description 2
- 230000004952 protein activity Effects 0.000 description 2
- 238000000164 protein isolation Methods 0.000 description 2
- 230000017854 proteolysis Effects 0.000 description 2
- 208000002815 pulmonary hypertension Diseases 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 231100000241 scar Toxicity 0.000 description 2
- 230000037390 scarring Effects 0.000 description 2
- 230000009450 sialylation Effects 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- PUZPDOWCWNUUKD-UHFFFAOYSA-M sodium fluoride Chemical compound [F-].[Na+] PUZPDOWCWNUUKD-UHFFFAOYSA-M 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 229940124530 sulfonamide Drugs 0.000 description 2
- 150000003456 sulfonamides Chemical class 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 239000001226 triphosphate Substances 0.000 description 2
- 235000011178 triphosphate Nutrition 0.000 description 2
- 125000002264 triphosphate group Chemical group [H]OP(=O)(O[H])OP(=O)(O[H])OP(=O)(O[H])O* 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 210000004127 vitreous body Anatomy 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- NEMRTLVVBHEBLV-KGJVWPDLSA-N (2R,3S,4R,5S,6S)-2-fluoro-6-methyloxane-3,4,5-triol Chemical compound C[C@@H]1O[C@H](F)[C@@H](O)[C@H](O)[C@@H]1O NEMRTLVVBHEBLV-KGJVWPDLSA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- DQJCDTNMLBYVAY-ZXXIYAEKSA-N (2S,5R,10R,13R)-16-{[(2R,3S,4R,5R)-3-{[(2S,3R,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-5-(ethylamino)-6-hydroxy-2-(hydroxymethyl)oxan-4-yl]oxy}-5-(4-aminobutyl)-10-carbamoyl-2,13-dimethyl-4,7,12,15-tetraoxo-3,6,11,14-tetraazaheptadecan-1-oic acid Chemical compound NCCCC[C@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@@H](C)NC(=O)C(C)O[C@@H]1[C@@H](NCC)C(O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O)[C@@H](CO)O1 DQJCDTNMLBYVAY-ZXXIYAEKSA-N 0.000 description 1
- WHVNYMMWPUHYES-LECHCGJUSA-N (2r,3r,4s,5r)-2-fluorooxane-3,4,5-triol Chemical compound O[C@@H]1CO[C@H](F)[C@H](O)[C@H]1O WHVNYMMWPUHYES-LECHCGJUSA-N 0.000 description 1
- ATMYEINZLWEOQU-PHYPRBDBSA-N (2r,3r,4s,5r,6r)-2-fluoro-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound OC[C@H]1O[C@H](F)[C@H](O)[C@@H](O)[C@H]1O ATMYEINZLWEOQU-PHYPRBDBSA-N 0.000 description 1
- ATMYEINZLWEOQU-DVKNGEFBSA-N (2r,3r,4s,5s,6r)-2-fluoro-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound OC[C@H]1O[C@H](F)[C@H](O)[C@@H](O)[C@@H]1O ATMYEINZLWEOQU-DVKNGEFBSA-N 0.000 description 1
- ATMYEINZLWEOQU-PQMKYFCFSA-N (2r,3s,4s,5s,6r)-2-fluoro-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound OC[C@H]1O[C@H](F)[C@@H](O)[C@@H](O)[C@@H]1O ATMYEINZLWEOQU-PQMKYFCFSA-N 0.000 description 1
- WHVNYMMWPUHYES-KKQCNMDGSA-N (2s,3r,4s,5r)-2-fluorooxane-3,4,5-triol Chemical compound O[C@@H]1CO[C@@H](F)[C@H](O)[C@H]1O WHVNYMMWPUHYES-KKQCNMDGSA-N 0.000 description 1
- ATMYEINZLWEOQU-FPRJBGLDSA-N (2s,3r,4s,5r,6r)-2-fluoro-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound OC[C@H]1O[C@@H](F)[C@H](O)[C@@H](O)[C@H]1O ATMYEINZLWEOQU-FPRJBGLDSA-N 0.000 description 1
- NEMRTLVVBHEBLV-SXUWKVJYSA-N (2s,3s,4r,5s,6s)-2-fluoro-6-methyloxane-3,4,5-triol Chemical compound C[C@@H]1O[C@@H](F)[C@@H](O)[C@H](O)[C@@H]1O NEMRTLVVBHEBLV-SXUWKVJYSA-N 0.000 description 1
- ATMYEINZLWEOQU-RWOPYEJCSA-N (2s,3s,4s,5s,6r)-2-fluoro-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound OC[C@H]1O[C@@H](F)[C@@H](O)[C@@H](O)[C@@H]1O ATMYEINZLWEOQU-RWOPYEJCSA-N 0.000 description 1
- FFTVPQUHLQBXQZ-KVUCHLLUSA-N (4s,4as,5ar,12ar)-4,7-bis(dimethylamino)-1,10,11,12a-tetrahydroxy-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1C2=C(N(C)C)C=CC(O)=C2C(O)=C2[C@@H]1C[C@H]1[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]1(O)C2=O FFTVPQUHLQBXQZ-KVUCHLLUSA-N 0.000 description 1
- OYHQOLUKZRVURQ-NTGFUMLPSA-N (9Z,12Z)-9,10,12,13-tetratritiooctadeca-9,12-dienoic acid Chemical compound C(CCCCCCC\C(=C(/C\C(=C(/CCCCC)\[3H])\[3H])\[3H])\[3H])(=O)O OYHQOLUKZRVURQ-NTGFUMLPSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- DDMOUSALMHHKOS-UHFFFAOYSA-N 1,2-dichloro-1,1,2,2-tetrafluoroethane Chemical compound FC(F)(Cl)C(F)(F)Cl DDMOUSALMHHKOS-UHFFFAOYSA-N 0.000 description 1
- ASOKPJOREAFHNY-UHFFFAOYSA-N 1-Hydroxybenzotriazole Chemical class C1=CC=C2N(O)N=NC2=C1 ASOKPJOREAFHNY-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- GZCWLCBFPRFLKL-UHFFFAOYSA-N 1-prop-2-ynoxypropan-2-ol Chemical compound CC(O)COCC#C GZCWLCBFPRFLKL-UHFFFAOYSA-N 0.000 description 1
- MVMSCBBUIHUTGJ-UHFFFAOYSA-N 10108-97-1 Natural products C1=2NC(N)=NC(=O)C=2N=CN1C(C(C1O)O)OC1COP(O)(=O)OP(O)(=O)OC1OC(CO)C(O)C(O)C1O MVMSCBBUIHUTGJ-UHFFFAOYSA-N 0.000 description 1
- ZIIUUSVHCHPIQD-UHFFFAOYSA-N 2,4,6-trimethyl-N-[3-(trifluoromethyl)phenyl]benzenesulfonamide Chemical compound CC1=CC(C)=CC(C)=C1S(=O)(=O)NC1=CC=CC(C(F)(F)F)=C1 ZIIUUSVHCHPIQD-UHFFFAOYSA-N 0.000 description 1
- QPYWTEPJJSGXST-UHFFFAOYSA-N 2-chloro-4-methylbenzenesulfonyl bromide Chemical compound ClC1=C(S(=O)(=O)Br)C=CC(=C1)C QPYWTEPJJSGXST-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 1
- LZKGFGLOQNSMBS-UHFFFAOYSA-N 4,5,6-trichlorotriazine Chemical compound ClC1=NN=NC(Cl)=C1Cl LZKGFGLOQNSMBS-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 108010029607 4-nitrophenyl-alpha-glucosidase Proteins 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 208000007122 AIDS-Associated Nephropathy Diseases 0.000 description 1
- 241000238876 Acari Species 0.000 description 1
- DLFVBJFMPXGRIB-UHFFFAOYSA-N Acetamide Chemical class CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 1
- 102000013563 Acid Phosphatase Human genes 0.000 description 1
- 108010051457 Acid Phosphatase Proteins 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- 206010049153 Allergic sinusitis Diseases 0.000 description 1
- 235000019489 Almond oil Nutrition 0.000 description 1
- 102100026611 Alpha-1,2-mannosyltransferase ALG9 Human genes 0.000 description 1
- 208000024985 Alport syndrome Diseases 0.000 description 1
- 241000223600 Alternaria Species 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- 108010064733 Angiotensins Proteins 0.000 description 1
- 108010087765 Antipain Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 108010039627 Aprotinin Proteins 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 208000033116 Asbestos intoxication Diseases 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- YXSLJKQTIDHPOT-UHFFFAOYSA-N Atracurium Dibesylate Chemical compound C1=C(OC)C(OC)=CC=C1CC1[N+](CCC(=O)OCCCCCOC(=O)CC[N+]2(C)C(C3=CC(OC)=C(OC)C=C3CC2)CC=2C=C(OC)C(OC)=CC=2)(C)CCC2=CC(OC)=C(OC)C=C21 YXSLJKQTIDHPOT-UHFFFAOYSA-N 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 206010064539 Autoimmune myocarditis Diseases 0.000 description 1
- 101000588395 Bacillus subtilis (strain 168) Beta-hexosaminidase Proteins 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 101001092903 Bos taurus Serum amyloid P-component Proteins 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 206010006482 Bronchospasm Diseases 0.000 description 1
- 108010074051 C-Reactive Protein Proteins 0.000 description 1
- 102100036150 C-X-C motif chemokine 5 Human genes 0.000 description 1
- 102100032752 C-reactive protein Human genes 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 101100184477 Candida albicans (strain SC5314 / ATCC MYA-2876) MNN2 gene Proteins 0.000 description 1
- 101100184475 Candida albicans (strain SC5314 / ATCC MYA-2876) MNN24 gene Proteins 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 229930186147 Cephalosporin Natural products 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 241000283153 Cetacea Species 0.000 description 1
- 102100040428 Chitobiosyldiphosphodolichol beta-mannosyltransferase Human genes 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- 208000000419 Chronic Hepatitis B Diseases 0.000 description 1
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 1
- 208000032544 Cicatrix Diseases 0.000 description 1
- 101710094648 Coat protein Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 208000027932 Collagen disease Diseases 0.000 description 1
- 206010010744 Conjunctivitis allergic Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699679 Cricetulus migratorius Species 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 241000223208 Curvularia Species 0.000 description 1
- 201000003883 Cystic fibrosis Diseases 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- CKLJMWTZIZZHCS-UWTATZPHSA-N D-aspartic acid Chemical compound OC(=O)[C@H](N)CC(O)=O CKLJMWTZIZZHCS-UWTATZPHSA-N 0.000 description 1
- MQJKPEGWNLWLTK-UHFFFAOYSA-N Dapsone Chemical compound C1=CC(N)=CC=C1S(=O)(=O)C1=CC=C(N)C=C1 MQJKPEGWNLWLTK-UHFFFAOYSA-N 0.000 description 1
- 201000004624 Dermatitis Diseases 0.000 description 1
- 206010012438 Dermatitis atopic Diseases 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 208000007342 Diabetic Nephropathies Diseases 0.000 description 1
- 206010012689 Diabetic retinopathy Diseases 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 102100040381 Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase Human genes 0.000 description 1
- 102100039059 Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase Human genes 0.000 description 1
- 102100032339 Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase Human genes 0.000 description 1
- 102100020746 Dolichol-phosphate mannosyltransferase subunit 1 Human genes 0.000 description 1
- 102100032086 Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase Human genes 0.000 description 1
- 102100034583 Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 1 Human genes 0.000 description 1
- 102100039216 Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 2 Human genes 0.000 description 1
- 102100039486 Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 4 Human genes 0.000 description 1
- 102100039104 Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit DAD1 Human genes 0.000 description 1
- 108010089072 Dolichyl-diphosphooligosaccharide-protein glycotransferase Proteins 0.000 description 1
- 102100027189 Dolichyl-phosphate beta-glucosyltransferase Human genes 0.000 description 1
- 208000000059 Dyspnea Diseases 0.000 description 1
- 206010013975 Dyspnoeas Diseases 0.000 description 1
- 108700034637 EC 3.2.-.- Proteins 0.000 description 1
- 102100021771 Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase Human genes 0.000 description 1
- BRLQWZUYTZBJKN-UHFFFAOYSA-N Epichlorohydrin Chemical compound ClCC1CO1 BRLQWZUYTZBJKN-UHFFFAOYSA-N 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 206010015124 Ergot poisoning Diseases 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241000306559 Exserohilum Species 0.000 description 1
- 208000024720 Fabry Disease Diseases 0.000 description 1
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 108010019236 Fucosyltransferases Proteins 0.000 description 1
- 102000006471 Fucosyltransferases Human genes 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 102100033821 GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase Human genes 0.000 description 1
- MVMSCBBUIHUTGJ-GDJBGNAASA-N GDP-alpha-D-mannose Chemical compound C([C@H]1O[C@H]([C@@H]([C@@H]1O)O)N1C=2N=C(NC(=O)C=2N=C1)N)OP(O)(=O)OP(O)(=O)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]1O MVMSCBBUIHUTGJ-GDJBGNAASA-N 0.000 description 1
- 108060003306 Galactosyltransferase Proteins 0.000 description 1
- 102000030902 Galactosyltransferase Human genes 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 206010064147 Gastrointestinal inflammation Diseases 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 241000699694 Gerbillinae Species 0.000 description 1
- 208000010412 Glaucoma Diseases 0.000 description 1
- 206010018367 Glomerulonephritis chronic Diseases 0.000 description 1
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108010056771 Glucosidases Proteins 0.000 description 1
- 102000004366 Glucosidases Human genes 0.000 description 1
- 108010055629 Glucosyltransferases Proteins 0.000 description 1
- 102000000340 Glucosyltransferases Human genes 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 102100023177 Glycoprotein endo-alpha-1,2-mannosidase Human genes 0.000 description 1
- 101710162064 Glycoprotein endo-alpha-1,2-mannosidase Proteins 0.000 description 1
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 1
- 208000003084 Graves Ophthalmopathy Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 206010070737 HIV associated nephropathy Diseases 0.000 description 1
- 108700024827 HOC1 Proteins 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 238000007341 Heck reaction Methods 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 208000006933 Hermanski-Pudlak Syndrome Diseases 0.000 description 1
- 206010071775 Hermansky-Pudlak syndrome Diseases 0.000 description 1
- 102100024023 Histone PARylation factor 1 Human genes 0.000 description 1
- 101000717828 Homo sapiens Alpha-1,2-mannosyltransferase ALG9 Proteins 0.000 description 1
- 101000891547 Homo sapiens Alpha-1,3/1,6-mannosyltransferase ALG2 Proteins 0.000 description 1
- 101000947186 Homo sapiens C-X-C motif chemokine 5 Proteins 0.000 description 1
- 101000891557 Homo sapiens Chitobiosyldiphosphodolichol beta-mannosyltransferase Proteins 0.000 description 1
- 101000890957 Homo sapiens Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase Proteins 0.000 description 1
- 101000958975 Homo sapiens Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase Proteins 0.000 description 1
- 101000797862 Homo sapiens Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase Proteins 0.000 description 1
- 101000932202 Homo sapiens Dolichol-phosphate mannosyltransferase subunit 1 Proteins 0.000 description 1
- 101000776319 Homo sapiens Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase Proteins 0.000 description 1
- 101001130785 Homo sapiens Dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48 kDa subunit Proteins 0.000 description 1
- 101000848781 Homo sapiens Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 1 Proteins 0.000 description 1
- 101000670093 Homo sapiens Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 2 Proteins 0.000 description 1
- 101000609775 Homo sapiens Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit 4 Proteins 0.000 description 1
- 101000884921 Homo sapiens Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit DAD1 Proteins 0.000 description 1
- 101000694130 Homo sapiens Dolichyl-phosphate beta-glucosyltransferase Proteins 0.000 description 1
- 101000779347 Homo sapiens GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101001051674 Homo sapiens Meiosis-specific nuclear structural protein 1 Proteins 0.000 description 1
- 101000717815 Homo sapiens Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase Proteins 0.000 description 1
- 101000579716 Homo sapiens Protein RFT1 homolog Proteins 0.000 description 1
- 101000797874 Homo sapiens Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 Proteins 0.000 description 1
- 101000739046 Homo sapiens RNA-binding protein PNO1 Proteins 0.000 description 1
- 101000836466 Homo sapiens UDP-N-acetylglucosamine transferase subunit ALG14 homolog Proteins 0.000 description 1
- 101001033034 Homo sapiens UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase Proteins 0.000 description 1
- 101000649993 Homo sapiens WW domain-binding protein 1 Proteins 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 208000014919 IgG4-related retroperitoneal fibrosis Diseases 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- 208000029523 Interstitial Lung disease Diseases 0.000 description 1
- 208000003456 Juvenile Arthritis Diseases 0.000 description 1
- 208000012528 Juvenile dermatomyositis Diseases 0.000 description 1
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 1
- 208000002260 Keloid Diseases 0.000 description 1
- 101100488151 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) YEA4 gene Proteins 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 239000004166 Lanolin Substances 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- GDBQQVLCIARPGH-UHFFFAOYSA-N Leupeptin Natural products CC(C)CC(NC(C)=O)C(=O)NC(CC(C)C)C(=O)NC(C=O)CCCN=C(N)N GDBQQVLCIARPGH-UHFFFAOYSA-N 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 101150053531 MNN1 gene Proteins 0.000 description 1
- 101150093457 MNN2 gene Proteins 0.000 description 1
- 101150042047 MNN5 gene Proteins 0.000 description 1
- 235000019759 Maize starch Nutrition 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 108010054377 Mannosidases Proteins 0.000 description 1
- 102000001696 Mannosidases Human genes 0.000 description 1
- 102100025315 Mannosyl-oligosaccharide glucosidase Human genes 0.000 description 1
- 108010087568 Mannosyltransferases Proteins 0.000 description 1
- 102000006722 Mannosyltransferases Human genes 0.000 description 1
- 102100024962 Meiosis-specific nuclear structural protein 1 Human genes 0.000 description 1
- XADCESSVHJOZHK-UHFFFAOYSA-N Meperidine Chemical compound C=1C=CC=CC=1C1(C(=O)OCC)CCN(C)CC1 XADCESSVHJOZHK-UHFFFAOYSA-N 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 238000006845 Michael addition reaction Methods 0.000 description 1
- 238000006957 Michael reaction Methods 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 208000031888 Mycoses Diseases 0.000 description 1
- 206010028594 Myocardial fibrosis Diseases 0.000 description 1
- 108010093077 N-Acetylglucosaminyltransferases Proteins 0.000 description 1
- 102000002493 N-Acetylglucosaminyltransferases Human genes 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical class ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 125000003047 N-acetyl group Chemical group 0.000 description 1
- FDJKUWYYUZCUJX-AJKRCSPLSA-N N-glycoloyl-beta-neuraminic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@@H]1O[C@](O)(C(O)=O)C[C@H](O)[C@H]1NC(=O)CO FDJKUWYYUZCUJX-AJKRCSPLSA-N 0.000 description 1
- SUHQNCLNRUAGOO-UHFFFAOYSA-N N-glycoloyl-neuraminic acid Natural products OCC(O)C(O)C(O)C(NC(=O)CO)C(O)CC(=O)C(O)=O SUHQNCLNRUAGOO-UHFFFAOYSA-N 0.000 description 1
- 241000244206 Nematoda Species 0.000 description 1
- 206010065673 Nephritic syndrome Diseases 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 230000004989 O-glycosylation Effects 0.000 description 1
- 101150024689 OST3 gene Proteins 0.000 description 1
- 206010029888 Obliterative bronchiolitis Diseases 0.000 description 1
- 206010030216 Oesophagitis Diseases 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 101150012394 PHO5 gene Proteins 0.000 description 1
- 101000713179 Papio hamadryas Solute carrier family 52, riboflavin transporter, member 2 Proteins 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 208000031481 Pathologic Constriction Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000721454 Pemphigus Species 0.000 description 1
- 208000004362 Penile Induration Diseases 0.000 description 1
- 102000000447 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Human genes 0.000 description 1
- 108010055817 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Proteins 0.000 description 1
- 206010034665 Peritoneal fibrosis Diseases 0.000 description 1
- 208000020758 Peyronie disease Diseases 0.000 description 1
- CXOFVDLJLONNDW-UHFFFAOYSA-N Phenytoin Chemical compound N1C(=O)NC(=O)C1(C=1C=CC=CC=1)C1=CC=CC=C1 CXOFVDLJLONNDW-UHFFFAOYSA-N 0.000 description 1
- 108010064785 Phospholipases Proteins 0.000 description 1
- 102000015439 Phospholipases Human genes 0.000 description 1
- 108090001050 Phosphoric Diester Hydrolases Proteins 0.000 description 1
- 102000004861 Phosphoric Diester Hydrolases Human genes 0.000 description 1
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 1
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 1
- 206010035742 Pneumonitis Diseases 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 229920001305 Poly(isodecyl(meth)acrylate) Polymers 0.000 description 1
- 229920002319 Poly(methyl acrylate) Polymers 0.000 description 1
- 229920001665 Poly-4-vinylphenol Polymers 0.000 description 1
- 229920001283 Polyalkylene terephthalate Polymers 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 206010065159 Polychondritis Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 101710083689 Probable capsid protein Proteins 0.000 description 1
- 102100026610 Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase Human genes 0.000 description 1
- 102100034785 Programmed cell death protein 6 Human genes 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 108010007568 Protamines Proteins 0.000 description 1
- 102000007327 Protamines Human genes 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 102100028269 Protein RFT1 homolog Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 102100032337 Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 Human genes 0.000 description 1
- 102100037294 RNA-binding protein PNO1 Human genes 0.000 description 1
- 208000032056 Radiation Fibrosis Syndrome Diseases 0.000 description 1
- 208000019155 Radiation injury Diseases 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- 206010038979 Retroperitoneal fibrosis Diseases 0.000 description 1
- 206010039085 Rhinitis allergic Diseases 0.000 description 1
- 101150099625 STT3 gene Proteins 0.000 description 1
- 101100178273 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HOC1 gene Proteins 0.000 description 1
- 101100454113 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) KRE2 gene Proteins 0.000 description 1
- 101100181259 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) KTR1 gene Proteins 0.000 description 1
- 101100181260 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) KTR2 gene Proteins 0.000 description 1
- 101100181261 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) KTR3 gene Proteins 0.000 description 1
- 101100181264 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) KTR6 gene Proteins 0.000 description 1
- 101100457678 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) MNN10 gene Proteins 0.000 description 1
- 101100457679 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) MNN11 gene Proteins 0.000 description 1
- 101100188881 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OST6 gene Proteins 0.000 description 1
- 101100545063 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) YUR1 gene Proteins 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 201000010001 Silicosis Diseases 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 239000004141 Sodium laurylsulphate Substances 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 208000007107 Stomach Ulcer Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 101710137500 T7 RNA polymerase Proteins 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 102100036407 Thioredoxin Human genes 0.000 description 1
- 208000031737 Tissue Adhesions Diseases 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- LFTYTUAZOPRMMI-NESSUJCYSA-N UDP-N-acetyl-alpha-D-galactosamine Chemical compound O1[C@H](CO)[C@H](O)[C@H](O)[C@@H](NC(=O)C)[C@H]1O[P@](O)(=O)O[P@](O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 LFTYTUAZOPRMMI-NESSUJCYSA-N 0.000 description 1
- LFTYTUAZOPRMMI-CFRASDGPSA-N UDP-N-acetyl-alpha-D-glucosamine Chemical compound O1[C@H](CO)[C@@H](O)[C@H](O)[C@@H](NC(=O)C)[C@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 LFTYTUAZOPRMMI-CFRASDGPSA-N 0.000 description 1
- 102100027277 UDP-N-acetylglucosamine transferase subunit ALG14 homolog Human genes 0.000 description 1
- 102100038413 UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase Human genes 0.000 description 1
- CYKLRRKFBPBYEI-KBQKSTHMSA-N UDP-alpha-D-galactosamine Chemical compound O1[C@H](CO)[C@H](O)[C@H](O)[C@@H](N)[C@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 CYKLRRKFBPBYEI-KBQKSTHMSA-N 0.000 description 1
- CYKLRRKFBPBYEI-NQQHDEILSA-N UDP-alpha-D-glucosamine Chemical compound O1[C@H](CO)[C@@H](O)[C@H](O)[C@@H](N)[C@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 CYKLRRKFBPBYEI-NQQHDEILSA-N 0.000 description 1
- HSCJRCZFDFQWRP-JZMIEXBBSA-N UDP-alpha-D-glucose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-JZMIEXBBSA-N 0.000 description 1
- 208000024780 Urticaria Diseases 0.000 description 1
- 101150111043 VAN1 gene Proteins 0.000 description 1
- 206010046996 Varicose vein Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 102100028279 WW domain-binding protein 1 Human genes 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 238000010306 acid treatment Methods 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- 125000003342 alkenyl group Chemical group 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 201000009961 allergic asthma Diseases 0.000 description 1
- 208000002205 allergic conjunctivitis Diseases 0.000 description 1
- 201000010105 allergic rhinitis Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- OFCNXPDARWKPPY-UHFFFAOYSA-N allopurinol Chemical compound OC1=NC=NC2=C1C=NN2 OFCNXPDARWKPPY-UHFFFAOYSA-N 0.000 description 1
- 229960003459 allopurinol Drugs 0.000 description 1
- 239000008168 almond oil Substances 0.000 description 1
- 102000012086 alpha-L-Fucosidase Human genes 0.000 description 1
- 108010061314 alpha-L-Fucosidase Proteins 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 239000002269 analeptic agent Substances 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 210000002159 anterior chamber Anatomy 0.000 description 1
- 208000010123 anthracosis Diseases 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001078 anti-cholinergic effect Effects 0.000 description 1
- 230000002686 anti-diuretic effect Effects 0.000 description 1
- 230000003474 anti-emetic effect Effects 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 230000001387 anti-histamine Effects 0.000 description 1
- 229940124599 anti-inflammatory drug Drugs 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 230000002921 anti-spasmodic effect Effects 0.000 description 1
- 239000003416 antiarrhythmic agent Substances 0.000 description 1
- 229940125681 anticonvulsant agent Drugs 0.000 description 1
- 239000001961 anticonvulsive agent Substances 0.000 description 1
- 239000000935 antidepressant agent Substances 0.000 description 1
- 229940124538 antidiuretic agent Drugs 0.000 description 1
- 239000002111 antiemetic agent Substances 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 239000000739 antihistaminic agent Substances 0.000 description 1
- 239000002220 antihypertensive agent Substances 0.000 description 1
- 229940127088 antihypertensive drug Drugs 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 229940127248 antinauseant drug Drugs 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 229940045985 antineoplastic platinum compound Drugs 0.000 description 1
- SDNYTAYICBFYFH-TUFLPTIASA-N antipain Chemical compound NC(N)=NCCC[C@@H](C=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 SDNYTAYICBFYFH-TUFLPTIASA-N 0.000 description 1
- 239000003908 antipruritic agent Substances 0.000 description 1
- 239000000164 antipsychotic agent Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 239000003434 antitussive agent Substances 0.000 description 1
- 229940124584 antitussives Drugs 0.000 description 1
- 239000003699 antiulcer agent Substances 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 239000002830 appetite depressant Substances 0.000 description 1
- 229960004405 aprotinin Drugs 0.000 description 1
- 210000001742 aqueous humor Anatomy 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000008135 aqueous vehicle Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 206010003441 asbestosis Diseases 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 208000024998 atopic conjunctivitis Diseases 0.000 description 1
- 201000008937 atopic dermatitis Diseases 0.000 description 1
- 229960001862 atracurium Drugs 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 229940125717 barbiturate Drugs 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 239000002876 beta blocker Substances 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 102000006995 beta-Glucosidase Human genes 0.000 description 1
- 108010047754 beta-Glucosidase Proteins 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 239000010836 blood and blood product Substances 0.000 description 1
- 229940125691 blood product Drugs 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 201000003848 bronchiolitis obliterans Diseases 0.000 description 1
- 208000023367 bronchiolitis obliterans with obstructive pulmonary disease Diseases 0.000 description 1
- 230000007885 bronchoconstriction Effects 0.000 description 1
- 239000000337 buffer salt Substances 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 1
- FFGPTBGBLSHEPO-UHFFFAOYSA-N carbamazepine Chemical compound C1=CC2=CC=CC=C2N(C(=O)N)C2=CC=CC=C21 FFGPTBGBLSHEPO-UHFFFAOYSA-N 0.000 description 1
- 229960000623 carbamazepine Drugs 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- CREMABGTGYGIQB-UHFFFAOYSA-N carbon carbon Chemical compound C.C CREMABGTGYGIQB-UHFFFAOYSA-N 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229960004424 carbon dioxide Drugs 0.000 description 1
- 239000011203 carbon fibre reinforced carbon Substances 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000021523 carboxylation Effects 0.000 description 1
- 238000006473 carboxylation reaction Methods 0.000 description 1
- 239000000496 cardiotonic agent Substances 0.000 description 1
- 210000001715 carotid artery Anatomy 0.000 description 1
- 230000005887 cellular phagocytosis Effects 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229940124587 cephalosporin Drugs 0.000 description 1
- 150000001780 cephalosporins Chemical class 0.000 description 1
- 206010008118 cerebral infarction Diseases 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 230000009920 chelation Effects 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 201000010415 childhood type dermatomyositis Diseases 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 208000003167 cholangitis Diseases 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 239000000812 cholinergic antagonist Substances 0.000 description 1
- 210000003161 choroid Anatomy 0.000 description 1
- ZCDOYSPFYFSLEW-UHFFFAOYSA-N chromate(2-) Chemical compound [O-][Cr]([O-])(=O)=O ZCDOYSPFYFSLEW-UHFFFAOYSA-N 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- 238000013375 chromatographic separation Methods 0.000 description 1
- 208000020403 chronic hepatitis C virus infection Diseases 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- 230000001886 ciliary effect Effects 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 210000000795 conjunctiva Anatomy 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 210000004087 cornea Anatomy 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- ATDGTVJJHBUTRL-UHFFFAOYSA-N cyanogen bromide Chemical compound BrC#N ATDGTVJJHBUTRL-UHFFFAOYSA-N 0.000 description 1
- 125000004122 cyclic group Chemical class 0.000 description 1
- 238000006352 cycloaddition reaction Methods 0.000 description 1
- 231100000409 cytocidal Toxicity 0.000 description 1
- 230000000445 cytocidal effect Effects 0.000 description 1
- 229960000860 dapsone Drugs 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000003795 desorption Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 208000033679 diabetic kidney disease Diseases 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 235000019700 dicalcium phosphate Nutrition 0.000 description 1
- 229940042935 dichlorodifluoromethane Drugs 0.000 description 1
- 229940087091 dichlorotetrafluoroethane Drugs 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 201000011257 dilated cardiomyopathy 1B Diseases 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- BVTBRVFYZUCAKH-UHFFFAOYSA-L disodium selenite Chemical compound [Na+].[Na+].[O-][Se]([O-])=O BVTBRVFYZUCAKH-UHFFFAOYSA-L 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 150000002019 disulfides Chemical class 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 239000002934 diuretic Substances 0.000 description 1
- 230000001882 diuretic effect Effects 0.000 description 1
- AFOSIXZFDONLBT-UHFFFAOYSA-N divinyl sulfone Chemical compound C=CS(=O)(=O)C=C AFOSIXZFDONLBT-UHFFFAOYSA-N 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 238000001647 drug administration Methods 0.000 description 1
- 208000000718 duodenal ulcer Diseases 0.000 description 1
- 239000000428 dust Substances 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 238000007336 electrophilic substitution reaction Methods 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 150000002081 enamines Chemical class 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 208000006852 ergotism Diseases 0.000 description 1
- 230000003628 erosive effect Effects 0.000 description 1
- 210000003617 erythrocyte membrane Anatomy 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 150000002170 ethers Chemical class 0.000 description 1
- 229960005293 etodolac Drugs 0.000 description 1
- XFBVBWWRPKNWHW-UHFFFAOYSA-N etodolac Chemical compound C1COC(CC)(CC(O)=O)C2=N[C]3C(CC)=CC=CC3=C21 XFBVBWWRPKNWHW-UHFFFAOYSA-N 0.000 description 1
- NPUKDXXFDDZOKR-LLVKDONJSA-N etomidate Chemical compound CCOC(=O)C1=CN=CN1[C@H](C)C1=CC=CC=C1 NPUKDXXFDDZOKR-LLVKDONJSA-N 0.000 description 1
- 229960001690 etomidate Drugs 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 208000004996 familial dilated cardiomyopathy Diseases 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 229960002428 fentanyl Drugs 0.000 description 1
- IVLVTNPOHDFFCJ-UHFFFAOYSA-N fentanyl citrate Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.C=1C=CC=CC=1N(C(=O)CC)C(CC1)CCN1CCC1=CC=CC=C1 IVLVTNPOHDFFCJ-UHFFFAOYSA-N 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 238000007306 functionalization reaction Methods 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 208000018925 gastrointestinal mucositis Diseases 0.000 description 1
- 230000004545 gene duplication Effects 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 239000003193 general anesthetic agent Substances 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 108010050669 glucosidase I Proteins 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- 239000000348 glycosyl donor Substances 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 125000001188 haloalkyl group Chemical group 0.000 description 1
- 125000005843 halogen group Chemical group 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 208000003215 hereditary nephritis Diseases 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 150000007857 hydrazones Chemical class 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 230000001969 hypertrophic effect Effects 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 150000002466 imines Chemical class 0.000 description 1
- 229940124622 immune-modulator drug Drugs 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 229960003444 immunosuppressant agent Drugs 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 102000009634 interleukin-1 receptor antagonist activity proteins Human genes 0.000 description 1
- 108040001669 interleukin-1 receptor antagonist activity proteins Proteins 0.000 description 1
- 230000010189 intracellular transport Effects 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- JDNTWHVOXJZDSN-UHFFFAOYSA-N iodoacetic acid Chemical compound OC(=O)CI JDNTWHVOXJZDSN-UHFFFAOYSA-N 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 239000003456 ion exchange resin Substances 0.000 description 1
- 229920003303 ion-exchange polymer Polymers 0.000 description 1
- 210000000554 iris Anatomy 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000001117 keloid Anatomy 0.000 description 1
- 125000000468 ketone group Chemical group 0.000 description 1
- DKYWVDODHFEZIM-UHFFFAOYSA-N ketoprofen Chemical compound OC(=O)C(C)C1=CC=CC(C(=O)C=2C=CC=CC=2)=C1 DKYWVDODHFEZIM-UHFFFAOYSA-N 0.000 description 1
- 229960000991 ketoprofen Drugs 0.000 description 1
- OZWKMVRBQXNZKK-UHFFFAOYSA-N ketorolac Chemical compound OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 OZWKMVRBQXNZKK-UHFFFAOYSA-N 0.000 description 1
- 229960004752 ketorolac Drugs 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 235000019388 lanolin Nutrition 0.000 description 1
- 229940039717 lanolin Drugs 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- GDBQQVLCIARPGH-ULQDDVLXSA-N leupeptin Chemical compound CC(C)C[C@H](NC(C)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C=O)CCCN=C(N)N GDBQQVLCIARPGH-ULQDDVLXSA-N 0.000 description 1
- 108010052968 leupeptin Proteins 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 208000002780 macular degeneration Diseases 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 108010005335 mannoproteins Proteins 0.000 description 1
- 108010009689 mannosyl-oligosaccharide 1,2-alpha-mannosidase Proteins 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 238000005649 metathesis reaction Methods 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 208000008275 microscopic colitis Diseases 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 229960004023 minocycline Drugs 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 229960005181 morphine Drugs 0.000 description 1
- 230000003843 mucus production Effects 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 229940035363 muscle relaxants Drugs 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 206010028537 myelofibrosis Diseases 0.000 description 1
- 210000000651 myofibroblast Anatomy 0.000 description 1
- 239000004081 narcotic agent Substances 0.000 description 1
- 201000008383 nephritis Diseases 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 235000014571 nuts Nutrition 0.000 description 1
- 101150061302 och1 gene Proteins 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 230000014207 opsonization Effects 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 101150026679 ost5 gene Proteins 0.000 description 1
- 150000002923 oximes Chemical class 0.000 description 1
- 150000002924 oxiranes Chemical class 0.000 description 1
- 125000000636 p-nitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1*)[N+]([O-])=O 0.000 description 1
- 229960005457 pancuronium Drugs 0.000 description 1
- GVEAYVLWDAFXET-XGHATYIMSA-N pancuronium Chemical compound C[N+]1([C@@H]2[C@@H](OC(C)=O)C[C@@H]3CC[C@H]4[C@@H]5C[C@@H]([C@@H]([C@]5(CC[C@@H]4[C@@]3(C)C2)C)OC(=O)C)[N+]2(C)CCCCC2)CCCCC1 GVEAYVLWDAFXET-XGHATYIMSA-N 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 235000020232 peanut Nutrition 0.000 description 1
- 210000003899 penis Anatomy 0.000 description 1
- 102000041715 pentraxin family Human genes 0.000 description 1
- 108091075331 pentraxin family Proteins 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- KHIWWQKSHDUIBK-UHFFFAOYSA-N periodic acid Chemical compound OI(=O)(=O)=O KHIWWQKSHDUIBK-UHFFFAOYSA-N 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 239000000575 pesticide Substances 0.000 description 1
- 229960000482 pethidine Drugs 0.000 description 1
- 235000019271 petrolatum Nutrition 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- DDBREPKUVSBGFI-UHFFFAOYSA-N phenobarbital Chemical compound C=1C=CC=CC=1C1(CC)C(=O)NC(=O)NC1=O DDBREPKUVSBGFI-UHFFFAOYSA-N 0.000 description 1
- 229960002695 phenobarbital Drugs 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 229960002036 phenytoin Drugs 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 150000003058 platinum compounds Chemical class 0.000 description 1
- 229920000233 poly(alkylene oxides) Polymers 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 229920001490 poly(butyl methacrylate) polymer Polymers 0.000 description 1
- 229920000111 poly(butyric acid) Polymers 0.000 description 1
- 229920001483 poly(ethyl methacrylate) polymer Polymers 0.000 description 1
- 229920000212 poly(isobutyl acrylate) Polymers 0.000 description 1
- 229920000205 poly(isobutyl methacrylate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 1
- 229920001306 poly(lactide-co-caprolactone) Polymers 0.000 description 1
- 229920000196 poly(lauryl methacrylate) Polymers 0.000 description 1
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 1
- 229920000184 poly(octadecyl acrylate) Polymers 0.000 description 1
- 229920002627 poly(phosphazenes) Polymers 0.000 description 1
- 229920001281 polyalkylene Polymers 0.000 description 1
- 229920001515 polyalkylene glycol Polymers 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 208000030761 polycystic kidney disease Diseases 0.000 description 1
- 229920000570 polyether Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920000129 polyhexylmethacrylate Polymers 0.000 description 1
- 229920002704 polyhistidine Polymers 0.000 description 1
- 229920000197 polyisopropyl acrylate Polymers 0.000 description 1
- 239000004926 polymethyl methacrylate Substances 0.000 description 1
- 229920000182 polyphenyl methacrylate Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 150000004804 polysaccharides Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920002635 polyurethane Polymers 0.000 description 1
- 239000004814 polyurethane Substances 0.000 description 1
- 229920002689 polyvinyl acetate Polymers 0.000 description 1
- 239000011118 polyvinyl acetate Substances 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229920000915 polyvinyl chloride Polymers 0.000 description 1
- 239000004800 polyvinyl chloride Substances 0.000 description 1
- 229920001290 polyvinyl ester Polymers 0.000 description 1
- 229920001289 polyvinyl ether Polymers 0.000 description 1
- 229920001291 polyvinyl halide Polymers 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229940124606 potential therapeutic agent Drugs 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 239000001294 propane Substances 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- OLBCVFGFOZPWHH-UHFFFAOYSA-N propofol Chemical compound CC(C)C1=CC=CC(C(C)C)=C1O OLBCVFGFOZPWHH-UHFFFAOYSA-N 0.000 description 1
- 229960004134 propofol Drugs 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical class CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229940048914 protamine Drugs 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000006268 reductive amination reaction Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 201000002793 renal fibrosis Diseases 0.000 description 1
- 210000005084 renal tissue Anatomy 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 208000037803 restenosis Diseases 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 210000003935 rough endoplasmic reticulum Anatomy 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 230000037387 scars Effects 0.000 description 1
- 210000003786 sclera Anatomy 0.000 description 1
- 235000014102 seafood Nutrition 0.000 description 1
- 101150044914 sec59 gene Proteins 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000000932 sedative agent Substances 0.000 description 1
- 230000001624 sedative effect Effects 0.000 description 1
- 150000007659 semicarbazones Chemical class 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 210000000783 smooth endoplasmic reticulum Anatomy 0.000 description 1
- 239000011775 sodium fluoride Substances 0.000 description 1
- 235000013024 sodium fluoride Nutrition 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 239000011781 sodium selenite Substances 0.000 description 1
- 229960001471 sodium selenite Drugs 0.000 description 1
- 235000015921 sodium selenite Nutrition 0.000 description 1
- 229940079832 sodium starch glycolate Drugs 0.000 description 1
- 239000008109 sodium starch glycolate Substances 0.000 description 1
- 229920003109 sodium starch glycolate Polymers 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 229940032147 starch Drugs 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000003637 steroidlike Effects 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 208000003265 stomatitis Diseases 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- AXOIZCJOOAYSMI-UHFFFAOYSA-N succinylcholine Chemical compound C[N+](C)(C)CCOC(=O)CCC(=O)OCC[N+](C)(C)C AXOIZCJOOAYSMI-UHFFFAOYSA-N 0.000 description 1
- 229940032712 succinylcholine Drugs 0.000 description 1
- 238000000856 sucrose gradient centrifugation Methods 0.000 description 1
- 125000002128 sulfonyl halide group Chemical group 0.000 description 1
- 150000003461 sulfonyl halides Chemical class 0.000 description 1
- MLKXDPUZXIRXEP-MFOYZWKCSA-N sulindac Chemical compound CC1=C(CC(O)=O)C2=CC(F)=CC=C2\C1=C/C1=CC=C(S(C)=O)C=C1 MLKXDPUZXIRXEP-MFOYZWKCSA-N 0.000 description 1
- 229960000894 sulindac Drugs 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000000756 surface-enhanced laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 150000007970 thio esters Chemical class 0.000 description 1
- 108060008226 thioredoxin Proteins 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 238000001269 time-of-flight mass spectrometry Methods 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 229940125725 tranquilizer Drugs 0.000 description 1
- 239000003204 tranquilizing agent Substances 0.000 description 1
- 230000002936 tranquilizing effect Effects 0.000 description 1
- 108010004486 trans-sialidase Proteins 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 108091092194 transporter activity Proteins 0.000 description 1
- 102000040811 transporter activity Human genes 0.000 description 1
- CYRMSUTZVYGINF-UHFFFAOYSA-N trichlorofluoromethane Chemical compound FC(Cl)(Cl)Cl CYRMSUTZVYGINF-UHFFFAOYSA-N 0.000 description 1
- 229940029284 trichlorofluoromethane Drugs 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-N triflic acid Chemical compound OS(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-N 0.000 description 1
- 150000004043 trisaccharides Chemical class 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- LSGOVYNHVSXFFJ-UHFFFAOYSA-N vanadate(3-) Chemical compound [O-][V]([O-])([O-])=O LSGOVYNHVSXFFJ-UHFFFAOYSA-N 0.000 description 1
- 208000027185 varicose disease Diseases 0.000 description 1
- 208000019553 vascular disease Diseases 0.000 description 1
- 239000005526 vasoconstrictor agent Substances 0.000 description 1
- 239000003071 vasodilator agent Substances 0.000 description 1
- 229960003819 vecuronium Drugs 0.000 description 1
- BGSZAXLLHYERSY-XQIGCQGXSA-N vecuronium Chemical compound N1([C@@H]2[C@@H](OC(C)=O)C[C@@H]3CC[C@H]4[C@@H]5C[C@@H]([C@@H]([C@]5(CC[C@@H]4[C@@]3(C)C2)C)OC(=O)C)[N+]2(C)CCCCC2)CCCCC1 BGSZAXLLHYERSY-XQIGCQGXSA-N 0.000 description 1
- 239000002435 venom Substances 0.000 description 1
- 210000001048 venom Anatomy 0.000 description 1
- 231100000611 venom Toxicity 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 125000000969 xylosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)CO1)* 0.000 description 1
- 229910000166 zirconium phosphate Inorganic materials 0.000 description 1
- 150000003952 β-lactams Chemical class 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/04—Drugs for skeletal disorders for non-specific disorders of the connective tissue
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- SAP Serum Amyloid P
- Fc ⁇ R Fc ⁇ R receptors
- SAP can be used as a therapeutic agent to treat various disorders, including fibrosis-related disorders, hypersensitivity disorders, autoimmune disorders, mucositis, and inflammatory disorders such as those cause by microbial infection. See, for example, U.S. patent application Ser. Nos. 11/707,333, 12/217,617, 12/720,845, and 12/720,847.
- Protein therapeutics for treating human disease have revolutionized the health care industry.
- Many potential therapeutic agents are modified to increase their biological activity, such as plasma half-life, relative to the naturally-derived protein.
- Recombinant expression technology is usually implemented to produce polypeptides in sufficient quantity.
- many recombinant systems produce polypeptides having different biological properties than the naturally-derived forms, which may affect the pharmacokinetics, safety, and efficacy of a therapeutic product.
- the disclosure provides variant Serum Amyloid P (SAP) polypeptides and methods for producing them.
- SAP Serum Amyloid P
- the present invention includes methods and compositions for in vitro and in vivo addition, deletion, or modification of sugar residues to produce variant SAP polypeptides having a desired glycosylation pattern.
- the disclosure provides a glycosylated human SAP polypeptide, comprising an N-linked or O-linked oligosaccharide chain that has at least one branch terminating with a ⁇ 2,3-linked sialic acid moiety.
- the disclosure provides a glycosylated human SAP polypeptide, comprising an N-linked or O-linked oligosaccharide chain that has at least 50% fewer ⁇ 2,6-linked sialic acid moieties than wild-type SAP isolated from human serum.
- the disclosure provides methods of making a glycosylated human SAP polypeptide, comprising expressing a SAP polypeptide in a cell and isolating the SAP polypeptide from the cell.
- the cell is a CHO cell.
- the cell is a CHO-S cell.
- the disclosure provides methods of making a human SAP polypeptide, comprising expressing a human SAP polypeptide in a CHO cell and isolating the human SAP polypeptide from the cell.
- the disclosure provides methods of making a human SAP polypeptide, comprising providing a glycosylated human SAP polypeptide containing an N-linked or O-linked oligosaccharide chain and enzymatically or chemically altering the N-linked or O-linked oligosaccharide chain of the SAP polypeptide to produce a modified glycosylated SAP polypeptide.
- the disclosure provides methods of making a human SAP polypeptide, comprising providing a human SAP polypeptide and enzymatically or chemically altering the SAP polypeptide to produce a glycosylated SAP polypeptide comprising an N-linked or O-linked oligosaccharide.
- the disclosure provides a human SAP polypeptide prepared by a process comprising expressing a SAP polypeptide in a CHO cell and isolating the SAP polypeptide from the cell.
- the disclosure provides a CHO cell that contains a human SAP polypeptide with an N-linked oligosaccharide chain having at least one branch of the oligosaccharide chain terminating with a ⁇ 2,3-linked sialic acid moiety.
- the disclosure provides a CHO cell containing a polynucleotide sequence encoding a human SAP polypeptide.
- the disclosure provides a human SAP polypeptide having an IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than one-half, less than one-third, less than one-fourth, less than one-tenth, or less than one-hundredth than that of a corresponding sample of wild-type SAP isolated from human serum.
- human SAP polypeptides of the invention have an N-linked oligosaccharide chain.
- at least one branch of the N-linked oligosaccharide chain terminates with a ⁇ 2,3-linked sialic acid moiety.
- the N-linked oligosaccharide chain has at least 50% fewer ⁇ 2,6-linked sialic acid moieties than a wild-type SAP isolated from human serum.
- all branches of the N-linked oligosaccharide chain terminate with ⁇ 2,3-linked sialic acid moieties.
- the N-linked oligosaccharide chain is substantially free of ⁇ 2,6-linked sialic acid moieties.
- Glycovariant SAP polypeptides of the invention may comprise one or more branches, e.g., the N-linked oligosaccharide chain may be characterized as having a bi-antennary, tri-antennary, tetra-antennary, or a penta-antennary structure.
- the N-linked oligosaccharide chain comprises a pentasaccharide core of Man[( ⁇ 1,6-)-(Man( ⁇ 1,3)]-Man( ⁇ 1,4)-GlcNAc( ⁇ 1,4)-GlcNAc( ⁇ 1,N)-Asn.
- the N-linked oligosaccharide chain comprises at least one branch having the structure NeuNAc2 ⁇ 3Gal ⁇ 4GlcNAc ⁇ 2Man ⁇ 6. In some embodiments, at least one branch of the N-linked oligosaccharide chain is substantially free of galactose and N-acetylglucosamine. In some embodiments, all the branches of the N-linked oligosaccharide chain are substantially free of galactose and N-acetylglucosamine. In some embodiments, at least one branch of the N-linked oligosaccharide chain comprises one or more mannose residues. In some embodiments, the N-linked oligosaccharide chain comprises at least one fucose residue.
- Any of the glycovariant SAP polypeptides of the invention may comprise at least one modified glycosyl residue.
- a modified glycosyl residue may be conjugated to one or more modifying groups selected from water-soluble and -insoluble polymers, therapeutic moieties, diagnostic agents, and biomolecules.
- the SAP polypeptide of the invention may be a recombinant polypeptide.
- SAP polypeptide of the invention may comprise an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID Nos. 1, 2, 3, or 4.
- the SAP polypeptide is a human SAP protein.
- a human SAP polypeptide of the invention may comprise an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 1.
- the human SAP polypeptide of the invention is a fusion protein comprising an SAP domain and one or more heterologous domains.
- the heterologous domain may enhance one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
- the human SAP polypeptide of the invention comprises one or more modified amino acid residues, e.g., a PEGylated amino acid, a glycosylated (e.g., O-linked glycosylation) amino acid, a prenylated amino acid, an acetylated amino acid, a biotinylated amino acid, and/or an amino acid conjugated to an organic derivatizing agent.
- the modified amino acid residues may enhance one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
- human SAP polypeptides of the invention have increased biological activity relative to a corresponding sample of wild-type SAP isolated from human serum.
- the SAP polypeptides of the invention have an IC 50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than one-half, less than one-third, less than one-fourth, less than one-tenth, or less than one-hundredth that of a corresponding sample of wild-type SAP isolated from human serum.
- methods of making any of the human SAP polypeptides of the invention comprise an additional step of enzymatically or chemically altering the SAP polypeptide to attach an N-linked or O-linked oligosaccharide chain to the SAP polypeptide or to modify the existing N-linked or O-linked oligosaccharide chain of the SAP polypeptide.
- enzymatically or chemically altering the SAP polypeptide comprises treating the SAP polypeptide with one or more enzymatic proteins selected from glycosyltransferases, glycosidases, and phosphatases.
- the process of enzymatically or chemically altering the SAP polypeptide is effected in the presence of one or more sugar precursors.
- Suitable sugar precursors include, but are not limited to, UDP-N-acetylglucosamine, CMP-N-glycolylneuraminic acid UDP-N-acetylgalactosamine, CMP-N-acetylneuraminic acid, UDP-galactose, and GDP-fucose.
- the process of enzymatically or chemically altering the SAP polypeptide removes one or more terminal ⁇ 2,6-linked sialic acid moieties from the N-linked or O-linked oligosaccharide chain.
- the process of enzymatically or chemically altering the isolated SAP polypeptide replaces one or more terminal ⁇ 2,6-linked sialic acid moieties on the oligosaccharide chain with one or more ⁇ 2,3-linked sialic acid moieties.
- compositions of human SAP polypeptides of the invention suitable for use in a mammal.
- Pharmaceutical preparations of the invention include at least one of the SAP polypeptides disclosed herein and a pharmaceutically acceptable carrier.
- the pharmaceutical preparation further comprises an additional active agent.
- the pharmaceutical preparation is prepared as a sustained release formulation.
- pharmaceutical preparations of the disclosure are suitable for administration to a patient topically, by injection, by intravenous injection, by inhalation, by continuous depot, or by pump.
- SAP-responsive disorders or conditions include, but are not limited to, fibrotic or fibroproliferative disorders or conditions, hypersensitivity disorders or conditions, autoimmune disorders or conditions, inflammatory diseases or conditions, and mucositis.
- the SAP polypeptide of the invention may be administered to a patient topically, by injection, by intravenous injection, by inhalation, by continuous depot or pump, or a combination thereof In some embodiments, the SAP polypeptide of the invention is administered with one or more additional active agents.
- FIG. 1 Fibrocyte differentiation assay.
- An ELISA-based assay was used to measure production of MDC after incubation of monocytes with SAP polypeptides.
- the Y-axis indicates the average potency (i.e., average of 7 independent experiments) of human serum-derived SAP (hSAP) compared to recombinant human SAP (rhSAP) isolated from CHO-S cells. Relative activity of hSAP is set at 1.0.
- FIGS. 2 A- 2 F Glycan structural analysis of variant SAP polypeptides.
- Liquid Chromatography Mass Spectrometry (LCMS) analysis (A) and Anion-Exchange High Performance Liquid Chromatography (AEX-HPLC) analysis (B) was used to determine the sialic acid linkages on glycoremodeled recombinant human SAP isolated from CHO-S cells.
- Liquid Chromatography Mass Spectrometry (LCMS) analysis (C) and Anion-Exchange High Performance Liquid Chromatography (AEX-HPLC) analysis (D) was used to determine the sialic acid linkages on glycoremodeled hSAP (human serum-derived SAP).
- LCMS Liquid Chromatography Mass Spectrometry
- AEX-HPLC Anion-Exchange High Performance Liquid Chromatography
- FIG. 3 Fibrocyte differentiation assay.
- An ELISA-based assay was used to measure production of MDC after incubation of monocytes with SAP variant polypeptides.
- the Y-axis indicates the average relative activity of each SAP variant compared to a hSAP reference standard, for which the activity is set at 1.0 (see the left-most bar).
- FIG. 4 Fibrocyte differentiation assay. Monocytes were treated with hMCSF and then subsequently quantified for fibrocyte differentiation. The X-axis represents the concentration of hMCSF incubated with donor monocytes. The Y-axis indicates the amount of fibrocyte proliferation at day five as measured by the enumeration of fibrocytes per 5.0 ⁇ 10 4 cells.
- FIGS. 5 Fibrocyte differentiation assay. Monocytes were treated with hSAP and then subsequently quantified for fibrocyte differentiation. The X-axis indicates the concentration of hSAP incubated with donor monocytes. The Y-axis indicates the amount of fibrocyte proliferation at day five as measured by the enumeration of fibrocytes per 5.0 ⁇ 10 4 cells.
- glycans carbohydrate moieties
- the glycosylation pattern on any given peptide can have enormous implications for the function of that peptide.
- the structure of the N-linked glycans on a peptide can impact various characteristics of the peptide, including protease susceptibility, intracellular trafficking, secretion, tissue targeting, biological half-life, and antigenicity. The alteration of one or more of these characteristics greatly affects the efficacy of a peptide in its natural setting.
- the glycan structures found in naturally occurring glycopeptides are typically divided into two classes, N-linked and O-linked glycans.
- Peptides expressed in eukaryotic cells are typically N-glycosylated on asparagine residues at sites in the peptide primary structure containing the sequence asparagine-X-serine/threonine, where X can be any amino acid except proline and aspartic acid.
- the carbohydrate portion of such peptides is known as an N-linked glycan or N-linked oligosaccharide.
- the early events of N-glycosylation occur in the endoplasmic reticulum (ER) and are conserved in mammals, plants, insects and other higher eukaryotes.
- an oligosaccharide chain comprising fourteen sugar residues is constructed on a lipid carrier molecule.
- the entire oligosaccharide chain is transferred to the amide group of the asparagine residue in a reaction catalyzed by a membrane-bound glycosyltransferase enzyme.
- the N-linked glycan is further processed both in the ER and in the Golgi apparatus.
- the further processing generally entails removal of some of the sugar residues and addition of other sugar residues in reactions catalyzed by glycosylases and glycosyltransferases specific for the sugar residues removed and added.
- the final structures of the N-linked glycans are dependent upon the organism in which the peptide is produced.
- peptides produced in bacteria are generally unglycosylated.
- Peptides expressed in insect cells typically contain high mannose or pauci-mannose N-linked oligosaccharide chains.
- Peptides produced in mammalian cell culture are usually differentially glycosylated depending upon the species and cell culture conditions. Even in the same species and under the same conditions, a certain amount of heterogeneity in the glycosyl chain is sometimes encountered.
- peptides produced in plant cells comprise glycan structures that differ significantly from those produced in animal cells.
- glycosyltransferases Two principal classes of enzymes are used in the synthesis of carbohydrates: glycosyltransferases and glycosidases.
- Glycosyltransferases add or modify the existing oligosaccharide structures on a peptide. Glycosyltransferases are effective for producing specific products with good stereochemical and regiochemical control. Glycosyltransferases have been used to prepare oligosaccharides and to modify terminal N- and O-linked carbohydrate structures, particularly on peptides produced in mammalian cells.
- terminal oligosaccharides of glycopeptides can be completely sialylated and/or fucosylated to provide more consistent sugar structures using glycosyltransferases, which may improves glycopeptide pharmacodynamics and a variety of other biological properties.
- glycosidases are further classified as exoglycosidases (e.g., ⁇ -mannosidase, ⁇ -glucosidase), and endoglycosidases (e.g. Endo-A, Endo-M).
- exoglycosidases e.g., ⁇ -mannosidase, ⁇ -glucosidase
- endoglycosidases e.g. Endo-A, Endo-M.
- Glycosidases normally catalyze the hydrolysis of a glycosidic bond. However, under appropriate conditions, they can be used to form this linkage.
- Most glycosidases used for carbohydrate synthesis are exoglycosidases; the glycosyl transfer occurs at the non-reducing terminus of the substrate.
- the glycosidase binds a glycosyl donor in a glycosyl-enzyme intermediate that is either intercepted by water to yield the hydrolysis product, or by an acceptor, to generate a new glycoside or oligosaccharide.
- An exemplary pathway using an exoglycosidase is the synthesis of the core trisaccharide of all N-linked glycopeptides, including the ⁇ -mannoside linkage, which is formed by the action of ⁇ -mannosidase (Singh et al., Chem. Commun. 993-994 (1996)). Although their use is less common than that of the exoglycosidases, endoglycosidases are also utilized to prepare carbohydrates.
- Endoglycosidases can be used to transfer an entire oligosaccharide chain, rather than a monosaccharide, onto a polypeptide. Oligosaccharide fragments have been added to substrates using endo- ⁇ -N-acetylglucosamines, such as endo-F andendo-M (Wang et al., Tetrahedron Lett. 37: 1975-1978; and Haneda et al., Carbohydr. Res. 292: 61-70 (1996). Each of these classes of enzymes has been successfully used produce glycosylated peptides. For a general review, see, Crout et al., Curr. Opin. Chem. Biol. 2: 98-111 (1998).
- Serum amyloid P is a naturally occurring serum protein in mammals composed of five identical subunits, or “promoters”, which are non-covalently associated in a disk-like complex.
- SAP belongs to the pentraxin super family of proteins, which are characterized by this cyclic pentameric structure.
- the classical short pentraxins include SAP as well as C-reactive protein (Osmand, A. P., et al., Proc. Nat. Acad. Sci., 74: 739-743, 1997).
- SAP is normally synthesized in the liver and has a physiological half-life of twenty-four hours.
- the sequence of the human SAP subunit is disclosed below, which corresponds to amino acids 20-223 of Gene bank Accession NO. NP_001630 (signal sequence not depicted).
- One aspect of the present invention relates to the surprising discovery that modification of a glycan structure on a human SAP polypeptide can increase the biological activity of the SAP polypeptide relative to a corresponding sample of wild-type SAP isolated from human serum.
- isolated SAP from human serum contains only ⁇ 2,6-linked sialic acid residues.
- recombinant human SAP produced in CHO cells contains only ⁇ 2,3-linked sialic acid residues.
- ⁇ 2,3-linked sialic acid SAP polypeptides were demonstrated to have consistently higher activity than wild-type SAP (i.e., SAP comprising ⁇ 2,6-linked sialic acid moieties) isolated from human serum.
- the variant SAP polypeptides of the invention would be more effective as therapeutic agents due to their increased biological potency. For example, more potent SAP variants may require lower dosing and/or less frequent dosing relative to wild-type SAP isolated from human serum.
- the present disclosure provides both variant human SAP polypeptides and methods for making the same. In particular, the disclosure includes methods and compositions for in vitro and in vivo addition, deletion, or modification of sugar residues to produce a human SAP polypeptide having a desired glycosylation pattern.
- an element means one element or more than one element.
- treatment refers to obtaining a desired pharmacologic and/or physiologic effect.
- the effect may be prophylactic in terms of completely or partially preventing a disorder or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disorder and/or adverse affect attributable to the disorder.
- Treatment covers any treatment of a disease in a mammal, particularly in a human, and includes: (a) increasing survival time; (b) decreasing the risk of death due to the disease; (c) inhibiting the disease, i.e., arresting its development or reducing the rate of disease progression; and (d) relieving the disease, i.e., causing regression of the disease.
- a therapeutic that “inhibits” or “prevents” a disorder or condition is a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
- subject and “patient” refer to animals including mammals, such as humans.
- mammal includes primates, domesticated animals including dogs, cats, sheep, cattle, horses, goats, pigs, mice, rats, rabbits, guinea pigs, captive animals such as zoo animals, and wild animals.
- tissue refers to an organ or set of specialized cells such as skin tissue, lung tissue, kidney tissue, and other types of cells.
- therapeutic effect is art-recognized and refers to a local or systemic effect in animals, particularly mammals, and more particularly humans caused by a pharmacologically active substance.
- therapeutically effective amount means that amount of such a substance that produces some desired local or systemic effect at a reasonable benefit/risk ratio applicable to any treatment.
- the therapeutically effective amount of such substance will vary depending upon the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration, which can readily be determined by one of ordinary skill in the art. For example, certain compositions described herein may be administered in a sufficient amount to produce a desired effect at a reasonable benefit/risk ratio applicable to such treatment.
- nucleic acid refers to a polynucleotide such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA).
- DNA deoxyribonucleic acid
- RNA ribonucleic acid
- the term should also be understood to include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs, and, as applicable to the embodiment being described, single-stranded (such as sense or antisense) and double-stranded polynucleotide.
- purified protein refers to a preparation of a protein or proteins that are preferably isolated from, or otherwise substantially free of, other proteins normally associated with the protein(s) in a cell or cell lysate.
- substantially free of other cellular proteins or “substantially free of other contaminating proteins” is defined as encompassing individual preparations of each of the proteins comprising less than 20% (by dry weight) contaminating protein, and preferably comprises less than 5% contaminating protein.
- Functional forms of each of the proteins can be prepared as purified preparations by using a cloned gene as is well known in the art.
- purified it is meant that the indicated molecule is present in the substantial absence of other biological macromolecules, such as other proteins (particularly other proteins which may substantially mask, diminish, confuse or alter the characteristics of the component proteins either as purified preparations or in their function in the subject reconstituted mixture).
- the term “purified” as used herein preferably means at least 80% by dry weight, more preferably in the range of 85% by weight, more preferably 95-99% by weight, and most preferably at least 99.8% by weight, of biological macromolecules of the same type present (but water, buffers, and other small molecules, especially molecules having a molecular weight of less than 5000, can be present).
- pure as used herein preferably has the same numerical limits as “purified” immediately above.
- N-linked oligosaccharides are those oligosaccharides that are linked to a peptide backbone through asparagine, by way of an asparagine-N-acetylglucosamine linkage. N-linked oligosaccharides are also called “N-glycans.” Naturally occurring N-linked oligosaccharides have a common pentasaccharide core of Man[( ⁇ 1,6-)-(Man(a1,3)]-Man( ⁇ 1,4)-GlcNAc( ⁇ 1,4)-GlcNAc( ⁇ 1,N).
- this structure may also contain a core fucose molecule and/or a xylose molecule.
- sialic acid refers to any member of a family of nine-carbon carboxylated sugars.
- the most common member of the sialic acid family is N-acetyl-neuraminic acid (often abbreviated as Neu5Ac, NeuAc, or NANA).
- a second member of the family is N-glycolyl-neuraminic acid (Neu5Gc or NeuGc), in which the N-acetyl group of NeuAc is hydroxylated.
- a third sialic acid family member is 2-keto-3-deoxy-nonulosonic acid (KDN) (Nadano et al. (1986) J. Biol. Chem. 261: 11550-11557; Kanamori et al., J.
- sialic acids such as a 9-O-C 1 C 6 -acyl-Neu5Ac like 9-O-lactyl-Neu5Ac or 9-O-acetyl-Neu5Ac, 9-deoxy-9-fluoro-Neu5Ac and 9-azido-9-deoxy-Neu5Ac.
- sialic acid family see, e.g., Varki, Glycobiology 2: 25-40 (1992); Sialic Acids: Chemistry, Metabolism and Function, R. Schauer, Ed. (Springer-Verlag, New York (1992)).
- a “genetically engineered” or “recombinant” cell is a cell having one or more modifications to the genetic material of the cell. Such modifications include, but are not limited to, insertions of genetic material, deletions of genetic material and insertion of genetic material that is extrachromosomal whether such material is stably maintained or not.
- modified sugar refers to a naturally- or non-naturally-occurring carbohydrate that is enzymatically added onto an amino acid or a glycosyl residue of a peptide in a process of the invention.
- the modified sugar is selected from a number of enzyme substrates including, but not limited to, sugar nucleotides (mono-, di-, and tri-phosphates), activated sugars (e.g., glycosyl halides, glycosyl mesylates) and sugars that are neither activated nor nucleotides.
- a “modified sugar” maybe covalently functionalized with a “modifying group.”
- Useful modifying groups include, but are not limited to, water-soluble and -insoluble polymers, therapeutic moieties, diagnostic moieties, biomolecules. The locus of functionalization with the modifying group is selected such that it does not prevent the “modified sugar” from being added enzymatically to a peptide or glycosyl residue of the peptide.
- SAP variants of the invention include glycosylated human SAP polypeptides that comprise one or more N-linked or O-linked oligosaccharide chains each independently having one, two, three, four, five or more branches terminating with an ⁇ 2,3-linked sialic acid moiety. In some embodiments, all the branches of the N-linked or O-linked oligosaccharide chains terminate in ⁇ 2,3-linked moieties.
- SAP variants of the invention include glycosylated human SAP polypeptides that contain an N-linked or O-linked oligosaccharide chains having at least 20%, 25%, 30%, 35% 40%, 45%, 50%, 55%, 60%, 65% 75%, 80%, 85%, or even at least 95% fewer ⁇ 2,6-linked sialic acid moieties than a wild-type SAP polypeptide derived from human serum.
- the N-linked or O-linked oligosaccharide chains are substantially free of ⁇ 2,6-linked sialic acid moieties, e.g., having less than 80%, 85%, 90%, 95%, 97%, 98% or even less than 99% ⁇ 2,6-linked sialic acid moieties relative to a wild-type SAP polypeptide derived from human serum).
- Glycovariant SAP polypeptides of the invention may comprise an N-linked oligosaccharide or O-linked chain having one or more branches (e.g., having a bi-antennary, tri-antennary, tetra-antennary, penta-antennary, etc. structure).
- SAP polypeptides of the invention comprise an N-linked or O-linked oligosaccharide chain wherein one, two, three, four, or five branches of the oligosaccharide chain are substantially free of galactose and N-acetylglucosamine (e.g., having less than 80%, 85%, 90%, 95%, 97%, 98% or even less than 99% N-acetylglucosamine relative to a wild-type SAP polypeptide derived from human serum).
- SAP polypeptides of the invention have N-linked or O-linked oligosaccharide chains that are substantially free of galactose and N-acetylglucosamine (e.g., having less than 80%, 85%, 90%, 95%, 97%, 98% or even less than 99% galactose and/or N-acetylglucosamine relative to a wild-type SAP polypeptide derived from human serum).
- SAP polypeptides of the invention comprise an N-linked or O-linked oligosaccharide chain wherein one, two, three, four, or five branches of the oligosaccharide chain contain one or more mannose residues.
- the SAP polypeptide of the invention comprises an N-linked oligosaccharide having a pentasaccharide core of Man[( ⁇ 1,6-)-(Man( ⁇ 1,3)]-Man( ⁇ 1,4)-GlcNAc( ⁇ 1,4)-GlcNAc( ⁇ 1,N)-Asn.
- This pentasaccharide core also may comprise one or more fucose or xylose residues.
- SAP polypeptides of the invention comprise an N-linked oligosaccharide chain wherein one, two, three, four, or five branches of the oligosaccharide chain have the structure NeuNAc2 ⁇ 3Gal ⁇ 34GlcNAc ⁇ 32Mana6.
- SAP polypeptides of the invention also may comprise an N-linked oligosaccharide chain wherein all branches have the structure NeuNAc2 ⁇ 3Gal ⁇ 34G1cNAc ⁇ 32Man ⁇ 6.
- Variant SAP polypeptides of the invention may comprise one or more “modified” sugar residues.
- Modified sugars are substituted at any position that allows for the attachment of the modifying moiety or group.
- modified sugar is substituted at a position that still allows the sugar to function as a substrate for an enzyme used to couple the modified sugar to the SAP peptide.
- a modifying group can be attached to a sugar moiety by enzymatic means, chemical means or a combination thereof, thereby producing a modified sugar, e.g., modified galactose, fucose, or sialic acid. Modifying groups suitable for use in the present invention as well as methods for conjugating these modifying groups to sugar residues are described in the following section.
- variant SAP polypeptides of the invention have an IC 50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than one-half that of a corresponding sample of wild-type SAP isolated from human serum. In some embodiments, variant SAP polypeptides of the invention have an IC 50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than 1 ⁇ 3, less than 1 ⁇ 4, less than 1/10, or less than 1/100 that of a corresponding sample of wild-type SAP isolated from human serum.
- Variant SAP polypeptides of the invention may be at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 1, as determined using the FASTDB computer program based on the algorithm of Brutlag et al. (Comp. App. Biosci., 6:237-245 (1990)).
- SAP polypeptide encompasses functional fragments and fusion proteins comprising any of the preceding.
- an SAP polypeptide will be designed to be soluble in aqueous solutions at biologically relevant temperatures, pH levels and osmolarity.
- the SAP protomers that non-covalently associate together to form a pentameric SAP complex may have identical amino acid sequences and/or post-translational modifications or, alternatively, individual SAP protomers within a single complex may have different sequences and/or modifications.
- SAP polypeptide includes polypeptides comprising any naturally occurring SAP polypeptide as well as any variant thereof (including mutants, fragments, and fusions).
- a SAP polypeptide of the invention may be a recombinant polypeptide.
- the SAP polypeptide of the invention is a human SAP polypeptide.
- compositions comprising a variant SAP polypeptide of the invention, or a functional fragment thereof
- the amino acid sequence of a SAP variant may differ from SEQ ID NO: 1 by one or more conservative or non-conservative substitutions.
- conservative substitutions are residues that are physically or functionally similar to the corresponding reference residues, i.e., a conservative substitution and its reference residue have similar size, shape, electric charge, and/or chemical properties (e.g., the ability to form covalent or hydrogen bonds).
- Preferred conservative substitutions are those fulfilling the criteria defined for an accepted point mutation in Dayhoff et al., Atlas of Protein Sequence and Structure 5:345-352 (1978 & Supp.).
- conservative substitutions are substitutions within the following groups: (a) valine, glycine; (b) glycine, alanine; (c) valine, isoleucine, leucine; (d) aspartic acid, glutamic acid; (e) asparagine, glutamine; (f) serine, threonine; (g) lysine, arginine, methionine; and (h) phenylalanine, tyrosine. Additional guidance concerning which amino acid changes are likely to be phenotypically silent can be found in Bowie et al., Science 247:1306-1310 (1990).
- variant SAP polypeptides and fragments thereof that retain biological function are useful in the pharmaceutical compositions and methods described herein.
- a variant SAP polypeptide or fragment thereof binds Fc ⁇ RI, Fc ⁇ RIIA, and/or Fc ⁇ RIIIB
- a variant SAP polypeptide or fragment thereof inhibits one or more of fibrocyte, fibrocyte precursor, myofibroblast precursor, and/or hematopoietic monocyte precursor differentiation.
- SAP variants may be generated by modifying the structure of an SAP polypeptide for such purposes as enhancing therapeutic efficacy or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
- the variant SAP polypeptides of the disclosure may further comprise post-translational modifications in addition to any that are naturally present in the SAP polypeptide.
- modifications include, but are not limited to, acetylation, carboxylation, glycosylation (e.g., O-linked oligosaccharides, N-linked oligosaccharides, etc.), phosphorylation, and lipidation.
- the modified SAP polypeptide may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharides, and phosphates.
- one or more modifications to the SAP polypeptide described herein may enhance the stability of the SAP polypeptide.
- modifications may enhance the in vivo half-life of the SAP polypeptide or reduce proteolytic degradation of the SAP polypeptide.
- variant SAP polypeptides of the invention include fusion proteins having at least a portion of the human SAP polypeptide and one or more fusion domains or heterologous portions.
- fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, and immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
- GST glutathione S transferase
- Fc immunoglobulin heavy chain constant region
- MBP maltose binding protein
- human serum albumin human serum albumin.
- a fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
- relevant matrices for affinity chromatography such as glutathione-, amylase-, and nickel-, or cobalt-conjugated resins are used.
- a fusion domain may be selected so as to facilitate detection of the SAP polypeptides.
- detection domains include the various fluorescent protein (e.g., GFP) as well as “epitope tags,” which are usually short peptide sequences for which a specific antibody is available.
- epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus hemagglutinin (HA) and c-myc tags.
- the fusion domains have a protease cleavage site that allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant protein therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
- the SAP polypeptide may be fused to a heterologous domain that stabilizes the SAP polypeptide in vivo.
- stabilizing is meant anything that increases serum half-life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect. Fusions with the Fc portion of an immunoglobulin and serum albumin are known to confer increased stability.
- an SAP polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to an SAP polypeptide.
- the SAP polypeptide and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences (e.g., linker sequences) may be included C- or N-terminal to either domain or between the domains.
- the methods generally involve a step of contacting an SAP polypeptide with one or more chemical or enzymatic agents to produce or modify a glycosylation structure on the SAP polypeptide.
- the methods can be cell-based or non-cell based.
- Enzymes useful for producing or modifying glycan structures are well known in the art. Most enzymes/proteins useful in the methods of the disclosure can be categorized into one of two functional classes: glycosyltransferases and glycosidases.
- Glycosyltransferases e.g., N- acetylglucosaminyl-transferases, galactosyl-transferases, fucosyl-transferases, sialyl-transferases, glucosyl-transferases, mannosyl-transferases, etc.
- Glycosyltransferases e.g., N- acetylglucosaminyl-transferases, galactosyl-transferases, fucosyl-transferases, sialyl-transferases, glucosyl-transferases, mannosyl-transferases, etc.
- Glycosidases e.g., glucosidases, mannosidases, N-acetylglucosaminidases, sialidases, fucosidases, etc.
- glucosidases e.g., mannosidases, N-acetylglucosaminidases, sialidases, fucosidases, etc.
- glucosidases e.g., mannosidases, N-acetylglucosaminidases, sialidases, fucosidases, etc.
- Cell-based methods for producing altered glyco-forms of an SAP polypeptide use either wild-type (e.g., CHO cells) or genetically engineered cells that have at least one modified glycosylation activity relative to a human cell.
- Cells suitable for the methods of the disclosure include, for example, fungal cells, prokaryotic cell (i.e., bacteria, Archaea) plant cells, or animal cells (e.g., nematode, insect, plant, bird, reptile, or mammal (e.g., a mouse, rat, rabbit, hamster, gerbil, dog, cat, goat, pig, cow, horse, whale, monkey, or human)).
- the cells can be primary cells, immortalized cells, or transformed cells. Such cells can be obtained from a variety of commercial sources and research resource facilities, e.g., the American Type Culture Collection (Rockville, Md.).
- the cell used for producing a variant SAP polypeptide is a CHO cell.
- glycosylation activity refers to any activity that is (i) capable of adding N-linked or O-linked glycans to a target molecule (i.e., an oligosaccharyl-transferase activity); (ii) removing N-linked or O-linked glycans from a target molecule; (iii) modifying one or more N-linked or O-linked glycans on a target molecule; (iv) modifying dolichol-linked oligosaccharides; (v) capable of aiding the activity of one or more of the activities under i-iv.
- glycosylation activity includes, for example, glycosidase activity, glycosyltransferase activity, sugar nucleotide synthesis, modification, or transporter activity.
- Modification of one or more N-linked or O-linked glycans on a target molecule includes the action of a mannosylphosphoryl-transferase activity, a kinase activity, or a phosphatase activity, e.g., a mannosylphosphoryl-transferase, a kinase, or a phosphatase activity that alters the phosphorylation state of glycans on target molecules.
- Engineered cells useful in the methods of the disclosure may have one or more genetic modifications including, but not limited to: (i) deletion of an endogenous gene encoding a protein having glycosylation activity; (ii) introduction of a recombinant nucleic acid encoding a mutant form of a protein (e.g., endogenous or exogenous protein) having an glycosylation activity; (iii) introduction or expression of an RNA molecule that interferes with the functional expression of a protein having the glycosylation activity; (iv) introduction of a recombinant nucleic acid encoding a wild-type (e.g., endogenous or exogenous) protein having glycosylation activity; or (v) altering the promoter or enhancer elements of one or more endogenous genes encoding proteins having glycosylation activity to thus alter the expression of the encoded proteins.
- RNA molecules described above include, for example, small-interfering RNA (siRNA), short hairpin RNA (shRNA), anti-sense RNA, or micro RNA (miRNA). It is understood that item (ii) includes, for example, replacement of an endogenous gene (e.g., by homologous recombination) with a gene encoding a protein having greater glycosylation activity relative to the endogenous gene so replaced.
- siRNA small-interfering RNA
- shRNA short hairpin RNA
- miRNA micro RNA
- the genetically engineered cells described herein have one or more altered glycosylation activities such as: (i) an increase in one or more glycosylation activities in the genetically modified cell, (ii) a decrease in one or more glycosylation activities in the genetically modified cell, (iii) a change in the localization or intracellular distribution of one or more glycosylation activities in the genetically modified cell, or (iv) a change in the ratio of one or more glycosylation activities in the genetically modified cell relative to an unmodified cell of the same origin.
- altered glycosylation activities such as: (i) an increase in one or more glycosylation activities in the genetically modified cell, (ii) a decrease in one or more glycosylation activities in the genetically modified cell, (iii) a change in the localization or intracellular distribution of one or more glycosylation activities in the genetically modified cell, or (iv) a change in the ratio of one or more glycosylation activities in the genetically modified cell relative to an unmod
- an increase in the amount of glycosylation activity can be due to overexpression of one or more proteins having glycosylation activity, an increase in copy number of an endogenous gene (e.g., gene duplication), or an alteration in the promoter, enhancer, or suppressor of an endogenous gene that stimulates an increase in expression of the protein encoded by the gene.
- an increase in copy number of an endogenous gene e.g., gene duplication
- an alteration in the promoter, enhancer, or suppressor of an endogenous gene that stimulates an increase in expression of the protein encoded by the gene e.g., gene duplication
- a decrease in one or more glycosylation activities can be due to overexpression of a mutant form (e.g., a dominant negative form) of one or more proteins having glycosylation -altering activities, introduction or expression of one or more interfering RNA molecules that reduce the expression of one or more proteins having an glycosylation activity, or deletion of one or more endogenous genes that encode a protein having glycosylation activity.
- a mutant form e.g., a dominant negative form
- Genetically engineered cells used by the methods of the disclosure can express (e.g., overexpress) wild-type or mutant genes encoding proteins having glycosylation activity.
- genes include, but are not limited to, ALG7, ALG13, ALG14, ALG1, ALG2, ALG11, RFT1, ALG3, ALG9, ALG12, ALG6, ALG8, ANL1, ALG10, ALG5, OST3, OST4, OST6, STT3, OST1, OST5, WBP1, SWP1, OST2, DPM1, SEC59, OCH1, MNN9, VAN1, MNN8, MNN10, MNN11, HOC1, MNN2, MNN5, MNN6, KTR1, YUR1, MNN4, KRE2, KTR2, KTR3, MNN1, MNS1, MNN4, PNO1, MNN9, glucosidase I, glucosidase II, or endomannosidase.
- Genes encoding proteins having glycosylation activity can be from any species (e.g., lower eukaryotes (e.g., fungus (including yeasts) or trypanosomes), prokaryotes (i.e., bacteria or Archaea), plant, or animal (e.g., insect, bird, reptile, or mammal, such as mouse or rat, dog, cat, horse, goat, cow, pig, non-human primate, or human).
- lower eukaryotes e.g., fungus (including yeasts) or trypanosomes
- prokaryotes i.e., bacteria or Archaea
- plant e.g., insect, bird, reptile, or mammal, such as mouse or rat, dog, cat, horse, goat, cow, pig, non-human primate, or human.
- genetically engineered cells used for the methods of the disclosure can express any number of genes (e.g., genes encoding proteins having glycosylation activity) and/or any combination of one or more (e.g., 2, 3, 4, 5,6, 7, 8, 9 10, 11, 12, 15, or 20 or more) of any of the genes recited herein.
- any genetically engineered cells used by the methods of the disclosure may comprise any number of mutations that alter or abrogate one or more glycosylation activities.
- the term “gene expression” or “expression” refers to the cellular processes by which a biologically active polypeptide is produced from a DNA sequence and exhibits a biological activity in a cell.
- gene expression involves the processes of transcription and translation, but also involves post-transcriptional and post-translational processes that can influence a biological activity of a gene or gene product. These processes include, but are not limited to, RNA syntheses, processing, and transport, as well as polypeptide synthesis, transport, and post-translational modification of polypeptides.
- the disclosure provides methods for making an SAP polypeptide of the invention by expressing a SAP gene in a cell.
- the cell may contain an endogenous SAP gene or fragment thereof.
- a polynucleotide coding for an exogenous SAP polypeptide or fragment thereof may be introduced (e.g., transformed, transfected, etc.) into a cell.
- Suitable SAP polynucleotides that can be introduced into a cell include nucleic acid fragments as well as nucleic acid constructs or expression vectors.
- the endogenous or exogenous gene encodes a human SAP polypeptide.
- the nucleic acid fragment, e.g., encoding a human SAP polypeptide, used to transform the host cell may include a Shine-Dalgarno site (e.g., a ribosome binding site) and a start site (e.g., the codon ATG) to initiate translation of the transcribed message to produce the enzyme. It may, also include a termination sequence to end translation. A termination sequence is typically a codon for which there exists no corresponding aminoacetyl-tRNA, thus ending polypeptide synthesis.
- a nucleic acid construct encoding an SAP polypeptide can be delivered, for example, as an expression plasmid that, when transcribed in the cell, produces as SAP polypeptide.
- a suitable expression vector comprises a nucleotide sequence encoding an SAP polypeptide of the invention operably linked to at least one regulatory sequence.
- regulatory sequences are art-recognized and are selected to direct expression of any of the polypeptides of the disclosure. Accordingly, the term regulatory sequence includes promoters, enhancers and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, Calif. (1990). For instance, any expression control sequence that regulates the expression of a DNA sequence when operatively linked to it may be used in these vectors to express any of the polypeptides of the disclosure.
- Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- T7 promoter whose expression is directed by T7 RNA polymerase
- the major operator and promoter regions of phage lambda the control regions for f
- the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
- the nucleic acid fragment or expression system used to transform the host cell optionally may include one or more marker sequences.
- suitable marker sequences typically encode a gene product, usually an enzyme that inactivates or otherwise detects or is detected by a compound in the growth medium.
- the inclusion of a marker sequence may render the transformed cell resistant to an antibiotic, or it may confer compound-specific metabolism on the transformed cell.
- suitable marker sequences that confer resistance include kanamycin, ampicillin, chloramphenicol and tetracycline.
- a marker gene may be used that allows for detection of particular colonies containing the gene, such as ⁇ -galactosidase, where a substrate is employed that provides for a colored product.
- a variety of methods are suitable for transforming a cell of the present invention with a nucleic acid fragment or expression vector.
- Common transformation methods include electroporation, liposomal-mediated transformation, calcium-mediated transformation, and viral-mediated transfection.
- the gene e.g., human SAP
- the gene in said system can be integrated into the chromosomal DNA of the host cells by a so-called homologous recombination and the expression system will be carried stably in the host.
- an appropriate selection marker gene may be used wherein said marker gene has a sequence homologous to the gene on chromosomal DNA of the specific host cell.
- Selection markers for such a purpose can be easily selected by a skilled person.
- a preferred marker is a gene that exists on a chromosome and relates to the metabolism of the host cells. Namely, it is preferred to use a host which has been modified in such a manner that the above-mentioned gene on the chromosome will be inactivated by an appropriate means such as a mutation.
- the host can then be subjected to a homologous recombination with an expression vector containing the corresponding intact gene, whereupon only transformants which contain the normal metabolism gene can grow to be selected. Therefore, if such a marker gene has been introduced to the expression vector, a homologous recombination will take place between the marker gene in said expression vector and the corresponding portion of the chromosomal DNA, whereby the expression cassette of the heterologous gene will simultaneously be integrated into the chromosomal DNA.
- the term “expressing” a protein in a cell also includes methods of introducing a protein itself into cells. Therefore, in certain aspects, the disclosure provides methods for making an SAP polypeptide of the invention by introducing an SAP polypeptide into a cell. Techniques for introducing polypeptides directly into a cell are known in the art and generally involve a process of cell membrane permeation.
- Such techniques include, but are not limited to, microinjection of SAP polypeptides; encapsulating an SAP polypeptide within membrane vesicles (e.g., liposomes, capsular bodies, erythrocyte ghosts, protoplasts, etc.) and contacting them with a cell membrane to thereby cause intracellular introduction of the SAP polypeptide by fusion; using physical methods (e.g., mechanical, chemical, electrical, etc.) that rely on macromolcules entering cells by diffusion through holes transiently introduced in their plasma membranes (e.g., scrape-loading, bead-loading, etc.); and by uptake through natural endocytosis owing to cellular phagocytosis.
- membrane vesicles e.g., liposomes, capsular bodies, erythrocyte ghosts, protoplasts, etc.
- a method of intracellular introduction may utilize a receptor-mediated pathway, wherein one of various receptors expressed on the cell surface is set as a target and an SAP polypeptide is attached (covalently or non-covalently) to the cognate ligand that acts as a carrier moiety.
- a receptor-mediated pathway wherein one of various receptors expressed on the cell surface is set as a target and an SAP polypeptide is attached (covalently or non-covalently) to the cognate ligand that acts as a carrier moiety.
- the disclosure provides CHO cells that express a SAP polypeptide.
- the CHO cell expresses an exogenous SAP polypeptide.
- the CHO cell expresses a human SAP polypeptide.
- the disclosure provides CHO cells comprising a polynucleotide sequence encoding an SAP polypeptide.
- the polynucleotide sequence encodes a human SAP polypeptide. Any of the aforementioned techniques may be used to “express” an SAP polypeptide of the invention in a CHO cell or any other suitable cell disclosed herein.
- the wild-type or genetically engineered cell can, optionally, be cultured in the presence of an inducing agent before, during, or subsequent to the introduction of the nucleic acid encoding a SAP polypeptide or a SAP polypeptide.
- an inducing agent for example, following introduction of the SAP polypeptide into the cell can be exposed to a chemical inducing agent that is capable of promoting the expression of one or more proteins having a wild-type or altered N-glycosylation activity.
- a cell can be contacted with multiple inducing agents.
- the culture medium may be modified to produce the desired glycan structure on the SAP polypeptide.
- the serum, glucose, and/or lipid (e.g., dolichol) concentration of the medium may be modified for optimal production of the desired SAP glycovariant.
- the temperature, pH, and/or osmolarity of culture medium may be altered for optimal production of the desired SAP glycovariant.
- a variant SAP polypeptide of the invention can be further processed in vivo or can be processed in vitro prior to or following isolation from the cell or cell medium.
- the further processing can include modification of one or more glycan residues of the SAP polypeptide or modification to the SAP polypeptide other than to its glycan structure(s).
- the additional processing of the SAP polypeptide can include the addition (covalent or non-covalent joining) of one or more heterologous moieties.
- the further processing involves enzymatic or chemical treatment of the SAP polypeptide.
- Enzymatic treatment can involve contacting the SAP polypeptide with one or more glycosidase, phosphodiesterase, phospholipase, glycosyltransferase, or protease for a time sufficient to induce the modification, addition, or deletion of glycan residues (e.g., galactose, mannose, fucose, sialic acid, xylose, N-acetylglucosamine, etc.) on the SAP polypeptide.
- Customization of an N-linked oligosaccharide chain may be accomplished by the sequential modification, addition, or deletion of the desired sugar moieties, using techniques well known in the art.
- Enzymatic cleavage of carbohydrate moieties on peptide variants can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al., 1987, Meth. Enzymol. 138:350.
- Exemplary methods of adding sugar moieties are disclosed in U.S. Pat. Nos. 5,876,980, 6,030,815, 5,728,554, and 5,922,577.
- modification of the SAP glycan structure requires the presence of one or more sugar nucleotides.
- sugar nucleotides that are used in the present invention include nucleotide mono-, di- or triphosphates or analogs thereof
- the modified sugar nucleotide is selected from a UDP-glycoside, CMP-glycoside, or a GDP-glycoside.
- the sugar nucleotide is selected from an UDP-galactose, UDP-galactosamine, UDP-glucose, UDP-glucosamine, GDP-mannose, GDP-fucose, CMP-sialic acid, CMP-N-glycolylneuraminic acid or CMP-NeuAc.
- a modified sugar nucleotide is utilized to add a modified sugar residue to the SAP polypeptide.
- N-acetylamine derivatives of the sugar nucleotides are also of use in the method of the invention.
- glycosyl moieties can be carried out by any suitable method.
- chemical deglycosylation may involve exposure of the SAP polypeptide to trifluoromethanesulfonic acid, or another strong acid. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the peptide intact.
- Methods of chemical deglycosylation are described by Haldmuddin et al., 1987, Arch. Biochem. Biophys. 259: 52 and by Edge et al., 1981, Anal. Biochem. 118: 131.
- Chemical treatment can, for example, involve contacting the altered SAP polypeptide with an acid, such as hydrofluoric acid, for a time sufficient to induce modification of the SAP polypeptide.
- Hydrofluoric acid treatment under certain conditions, specifically removes the mannose residues that are phosphodiester-linked to glycans, while leaving the phosphate on the glycan.
- An altered SAP polypeptide can be further processed by addition or removal of a phosphate group from one or more N-glycans.
- an altered SAP polypeptide can be contacted with a mannosyl kinase or a mannosyl phosphatase.
- the SAP polypeptide glycan structure N-linked or O-linked oligosaccharide.
- one or more branches of the SAP glycan structure are modified by the addition, removal, substitution or modification of at least one terminal sialic acid residue.
- Suitable methods for modifying glycans described herein may be used to alter only the terminal sugar moiety on the SAP glycan structure.
- a terminal sialic acid residue having an ⁇ 2,6-linkage, ⁇ 2,8-linkage, or ⁇ 2,9-linkage is replaced with one or more terminal ⁇ 2,3-linked sialic acid residue.
- human SAP comprising terminal ⁇ 2,6-linked sialic residues is modified according to one of methods of the disclosure in order to replace one or more of the terminal ⁇ 2,6-linked sialic residues with one or more ⁇ 2,3-linked sialic acid residues.
- a terminal ⁇ 2,3-linked sialic acid residue is modified to add one or more ⁇ 2,6-linked, ⁇ 2,8-linked, and/or ⁇ 2,9-linked sialic acid residues.
- the process of making an SAP polypeptide of the invention involves a first step of deglycosylating the SAP polypeptide.
- the SAP polypeptide may be partially or fully deglycosylated.
- the first step of deglycosylation involves removing only terminal sugar moieties from at least one branch of the glycan structure on the SAP polypeptide.
- the first step of deglycosylation removes at least one ⁇ 2,6-linked sialic acid residue.
- the first step of deglycosylation removes at least one O-linked glycan.
- the first step of deglycosylation removes at least one N-linked glycan.
- the first step of deglycosylation removes all O-linked and N-linked glycans.
- a deglycosylated SAP polypeptide (partially or fully) is further processed according to the methods of the disclosure, which includes but is not limited to, enzymatically or chemically modifying the partially or fully deglycosylated SAP polypeptide, introducing the partially or fully deglycosylated SAP polypeptide into a cell, or combination thereof, wherein the method(s) produce a variant SAP polypeptide of the invention.
- a partially or fully deglycosylated SAP polypeptide after a partially or fully deglycosylated SAP polypeptide has been introduced into a cell, it may be further modified, in vivo or in vitro, according to the methods of the disclosure to produce a variant SAP polypeptide of the invention.
- a partial or fully deglycosylated SAP polypeptide that is modified in vitro, using enzymatic or chemical methods described herein, may be introduced into a cell to produce a variant SAP polypeptide of the invention.
- an SAP polypeptide of the invention can be, but need not be, processed in a cell.
- the disclosure also provides cell-free methods of producing a variant SAP polypeptide of the invention.
- the cell-free methods include the step of contacting an SAP polypeptide, under glycosylation conditions, with a cell lysate prepared from a wild-type cell (e.g., a fungal cell, a plant cell, or an animal cell) or genetically engineered cell having at least one modified glycosylation activity, wherein contacting the SAP polypeptide with the cell lysate attaches an N-linked or O-linked oligosaccharide to the SAP polypeptide or modifies an existing N-linked or O-linked oligosaccharide on the SAP polypeptide.
- N-glycosylation conditions is meant that a mixture (e.g., of SAP polypeptide and cell lysate) is incubated under conditions that allow for the desired altered N-glycosylation.
- Suitable methods for obtaining cell lysates that preserve the activity or integrity of one or more glycosylation activities in the lysate can include the use of appropriate buffers and/or inhibitors, including nuclease, protease and phosphatase inhibitors that preserve or minimize changes in N-glycosylation activities in the cell lysate.
- Such inhibitors include, for example, chelators such as ethylenediaminetetraacetic acid (EDTA), ethylene glycol bis(P-aminoethyl ether) N,N,N1,N1-tetraacetic acid (EGTA), protease inhibitors such as phenylmethylsulfonyl fluoride (PMSF), aprotinin, leupeptin, antipain, and phosphatase inhibitors such as phosphate, sodium fluoride, and vanadate.
- chelators such as ethylenediaminetetraacetic acid (EDTA), ethylene glycol bis(P-aminoethyl ether) N,N,N1,N1-tetraacetic acid (EGTA), protease inhibitors such as phenylmethylsulfonyl fluoride (PMSF), aprotinin, leupeptin, antipain, and phosphatase inhibitors such as phosphate, sodium fluoride, and vana
- a cell lysate can be further processed to eliminate or minimize the presence of interfering substances, as appropriate.
- a cell lysate can be fractionated by any of a variety of methods well known to those skilled in the art, including subcellular fractionation, and chromatographic techniques such as ion exchange, hydrophobic and reverse phase, size exclusion, affinity, and hydrophobic charge-induction chromatography (see, e.g., Scopes, Protein Purification: Principles and Practice, third edition, Springer-Verlag, New York (1993); Burton and Harding, J. Chromatogr. A 814:71-81 (1998)), or any other suitable purification technique.
- a cell lysate can be prepared in which whole cellular organelles remain intact and/or functional.
- a lysate can contain one or more of intact rough endoplasmic reticulum, intact smooth endoplasmic reticulum, or intact Golgi apparatus.
- Suitable methods for preparing lysates containing intact cellular organelles and testing for the functionality of the organelles are described in, e.g., Moreau et al. (1991) J. Biol. Chem. 266(7):4329-4333; Moreau et al. (1991) J. Biol. Chem. 266(7):4322-4328; Rexach et al. (1991) J. Cell Biol. 114(2):219-229; and Paulik et al. (1999) Arch. Biochem. Biophys. 367(2):265-273; the disclosures of each of which are incorporated herein by reference in their entirety.
- the SAP polypeptide can be contacted with just one purified protein having glycosylation activity. In some embodiments, the SAP polypeptide can be contacted with more than one purified proteins having glycosylation activity. One or more proteins having glycosylation activity can be purified using standard protein isolation techniques. An SAP polypeptide can be contacted with one or more proteins in a suitable buffer for a time sufficient to induce modification of the SAP polypeptides as described above. The SAP polypeptide can be contacted with more than one protein at the same time or sequentially. Where the SAP polypeptide is contacted sequentially to more than one protein having glycosylation activity, the SAP polypeptide can, but need not, be purified after one or more steps.
- an SAP polypeptide can be contacted with protein activity “A” and then purified before contacting the molecule to protein activity “B”.
- Methods of modifying peptides as such are known in the art, e.g., Lee and Park (2002) 30(6):716-720 and Fujita and Takegawa (2001) Biochem. Biophys. Res. Commun. 282(3):678-682, the disclosures of which are incorporated herein by reference in their entirety.
- the methods of the disclosure comprise a step of isolating an SAP polypeptide, e.g., from a cell or from components of a cell lysate.
- an SAP polypeptide e.g., from a cell or from components of a cell lysate.
- Many standard techniques for protein isolation are known in the art.
- methods of isolating polypeptides include, but are not limited to, size-exclusion chromatography, reverse-phase chromatography, liquid chromatography (e.g., HPLC), affinity chromatography (e.g., metal chelation or immunoaffinity chromatography), ion-exchange chromatography, hydrophobic-interaction chromatography, precipitation, differential solubilization, immunoprecipitation, centrifugation (e.g., ultracentrifugation, sucrose gradient centrifugation, etc.) or any combination thereof
- the SAP polypeptide may be conjugated to an affinity tag to facilitate purification of the polypeptide.
- Suitable affinity tags for SAP purification include, but are not limited to, chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), streptavidin, biotin, and poly(His) tags.
- CBP chitin binding protein
- MBP maltose binding protein
- GST glutathione-S-transferase
- streptavidin biotin
- biotin biotin
- poly(His) tags poly(His) tags.
- Affinity tags may be produced as part of the recombinant protein (i.e., as a fusion protein comprising a heterologous affinity tag domain and an SAP polypeptide domain) or attached (covalently or non-covalently) in vivo or in vitro to the SAP polypeptide.
- multiple steps of purification can be used to isolate an SAP polypeptide.
- an SAP polypeptide comprising a purification tag can be affinity-purified from a cell lysate or multi-component mixture using affinity purification. Then the affinity-purified SAP polypeptide can be further purified to remove any minor unwanted contaminants by an additional purification step, e.g., size exclusion chromatography or RP-HPLC.
- an additional purification step e.g., size exclusion chromatography or RP-HPLC.
- the SAP polypeptide can be isolated from the cell itself or from the media in which cell was cultured.
- SAP polypeptides of the invention are produced and secreted from a cell into the culture media. In these embodiments, isolation may comprise separation of the cellular fraction from the soluble, SAP-containing fraction (e.g., by centrifugation).
- Suitable solid-phase supports include, but are not limited to, multi-well assay plates, particles (e.g., magnetic or encoded particles), a chromatography column, or a membrane.
- any of the altered SAP polypeptides described herein can be attached to a heterologous moiety using enzymatic or chemical means.
- a “heterologous moiety” refers to any constituent that is joined (e.g., covalently or non-covalently) to the altered target molecule, which constituent is different from a constituent originally present on the SAP polypeptide.
- Heterologous moieties include, for example, water-soluble and—insoluble polymers, targeting moieties, therapeutic moieties, diagnostic moieties, and biomolecules.
- SAP polypeptides of the invention may comprise one or more “modified” sugar residues.
- a modifying group can be attached to a sugar moiety by enzymatic means, chemical means or a combination thereof, thereby producing a modified sugar, e.g., modified galactose, fucose, or sialic acid.
- a modified sialic acid either a sialyl-transferase or a trans-sialidase can be used in these methods.
- the sugars may be substituted at any position that allows for the attachment of the modifying moiety, yet which still allows the sugar to function as a substrate for the enzyme used to couple the modified sugar to the peptide.
- the sugar moiety and the modifying group are linked together through the use of reactive groups, which are typically transformed by the linking process into a new organic functional group or unreactive species.
- the sugar reactive functional group(s) may be located at any position on the sugar moiety.
- Reactive groups and classes of reactions useful in practicing the present invention are generally those that are well known in the art of bioconjugate chemistry. Currently favored classes of reactions available with reactive sugar moieties are those which proceed under relatively mild conditions.
- nucleophilic substitutions e.g., reactions of amines and alcohols with acyl halides, active esters
- electrophilic substitutions e.g., enamine reactions
- additions to carbon-carbon and carbon-heteroatom multiple bonds e.g., Michael reaction, Diels-Alder addition.
- Useful reactive functional groups pendent from a sugar nucleus or modifying group include, but are not limited to: (a) carboxyl groups and various derivatives thereof (e.g., N-hydroxysuccinimide esters, N-hydroxybenzotriazole esters, acid halides, acyl imidazoles, thioesters, p-nitrophenyl esters, alkyl, alkenyl, alkynyl and aromatic esters); (b) hydroxyl groups, which can be converted to, e.g., esters, ethers, aldehydes, etc.; (c) haloalkyl groups, wherein the halide can be later displaced with a nucleophilic group such as, for example, an amine, a carboxylate anion, thiol anion, carbanion, or an alkoxide ion, thereby resulting in the covalent attachment of a new group at the functional group of the halogen atom; (d) dienophile groups
- the reactive functional groups can be chosen such that they do not participate in, or interfere with, the reactions necessary to assemble the reactive sugar nucleus or modifying group.
- a reactive functional group can be protected from participating in the reaction by the presence of a protecting group.
- protecting groups see, for example, Greene et al., Protective Groups in Organic Synthesis, John Wiley & Sons, New York, 1991.
- the modified sugar is an activated sugar.
- Activated modified sugars useful in the present invention are typically glycosides which have been synthetically altered to include an activated leaving group.
- the term “activated leaving group” refers to those moieties which are easily displaced in enzyme-regulated nucleophilic substitution reactions.
- Many activated sugars are known in the art. See, for example, Vocadlo et al., In Carbohydrate Chemistry and Biology, Vol. 2, Ernst et al. Ed., Wiley-VCH Verlag: Weinheim, Germany, 2000; Kodama et al., Tetrahedron Lett. 34: 6419 (1993); Lougheed, et al., J. Biol. Chem.
- activated leaving groups include fluoro, chloro, bromo, tosylate, mesylate, triflate and the like.
- Preferred activated leaving groups for use in the present invention are those that do not significantly sterically encumber the enzymatic transfer of the glycoside to the acceptor. Accordingly, preferred embodiments of activated glycoside derivatives include glycosyl fluorides and glycosyl mesylates, with glycosyl fluorides being particularly preferred.
- glycosyl fluorides ⁇ -galactosyl fluoride, ⁇ -mannosyl fluoride, ⁇ -glucosyl fluoride, ⁇ -fucosyl fluoride, ⁇ -xylosyl fluoride, ⁇ -sialyl fluoride, ⁇ -N-acetylglucosaminyl fluoride, ⁇ -N-acetylglucosaminyl fluoride, ⁇ -galactosyl fluoride, ⁇ -mannosyl fluoride, .beta.-glucosyl fluoride, ⁇ -fucosyl fluoride, ⁇ -xylosyl fluoride, ⁇ -sialyl fluoride, ⁇ -N-acetylglucosaminyl fluoride and ⁇ -N-acetylgalactosaminyl fluoride are most preferred.
- a modified sugar residue is conjugated to one or more water-soluble polymers.
- Many water-soluble polymers are known to those of skill in the art and are useful in practicing the present invention.
- the term water-soluble polymer encompasses species such as saccharides (e.g., dextran, amylose, hyaluronic acid, poly(sialic acid), heparans, heparins, etc.); poly(amino acids); nucleic acids; synthetic polymers (e.g., poly(acrylic acid), poly(ethers), e.g., poly(ethylene glycol)); peptides, proteins, and the like.
- the present invention may be practiced with any water-soluble polymer with the sole limitation that the polymer must include a point at which the remainder of the conjugate can be attached.
- a modified sugar residue is conjugated to one or more water-insoluble polymers.
- conjugation to a water-insoluble polymer can be used to deliver a therapeutic peptide in a controlled manner.
- Polymeric drug delivery systems are known in the art. See, for example, Dunn et al., Eds. Polymeric drugs and Drug Delivery Systems, ACS Symposium Series Vol. 469, American Chemical Society, Washington, D.C. 1991. Those of skill in the art will appreciate that substantially any known drug delivery system is applicable to the conjugates of the present invention.
- Representative water-insoluble polymers include, but are not limited to, polyphosphazenes, poly(vinyl alcohols), polyamides, polycarbonates, polyalkylenes, polyacrylamides, polyalkylene glycols, polyalkylene oxides, polyalkylene terephthalates, polyvinyl ethers, polyvinyl esters, polyvinyl halides, polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyurethanes, poly(methyl methacrylate), poly(ethyl methacrylate), poly(butyl methacrylate), poly(isobutyl methacrylate), poly(hexyl methacrylate), poly(isodecyl methacrylate), poly(lauryl methacrylate), poly(phenyl methacrylate), poly(methyl acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate), poly(octadecyl acrylate
- biodegradable polymers useful in the conjugates of the invention include, but are not limited to, polylactides, polyglycolides and copolymers thereof poly(ethylene terephthalate), poly(butyric acid), poly(valeric acid), poly(lactide-co-caprolactone), poly(lactide-co-glycolide), polyanhydrides, polyorthoesters, blends and copolymers thereof.
- compositions that form gels such as those including collagen, and pluronics.
- one or more modified sugar residues are conjugated to one or more PEG molecules.
- the modified sugar is conjugated to a biomolecule.
- Biomolecule of the invention may include, but are not limited to, functional proteins, enzymes, antigens, antibodies, peptides, nucleic acids (e.g., single nucleotides or nucleosides, oligonucleotides, polynucleotides and single- and higher-stranded nucleic acids), lectins, receptors or a combination thereof.
- Some preferred biomolecules are essentially non-fluorescent, or emit such a minimal amount of fluorescence that they are inappropriate for use as a fluorescent marker in an assay. Other biomolecules may be fluorescent.
- the biomolecule is a targeting moiety.
- a “targeting moiety” and “targeting agent”, as used herein, refer to species that will selectively localize in a particular tissue or region of the body.
- a biomolecule is selected to direct the SAP polypeptide of the invention to a specific intracellular compartment, thereby enhancing the delivery of the peptide to that intracellular compartment relative to the amount of underivatized peptide that is delivered to the tissue.
- the localization is mediated by specific recognition of molecular determinants, molecular size of the targeting agent or conjugate, ionic interactions, hydrophobic interactions and the like. Other mechanisms of targeting an agent to a particular tissue or region are known to those of still in the art.
- the modified sugar includes a therapeutic moiety.
- therapeutic moieties e.g., many biomolecules have therapeutic properties or potential.
- Classes of useful therapeutic moieties include, for example, non-steroidal anti-inflammatory drugs; steroidal anti-inflammatory drugs; adjuvants; antihistaminic drugs; antitussive drugs; antipruritic drugs; anticholinergic drugs; anti-emetic and antinauseant drugs; anorexic drugs; central stimulant drugs; antiarrhythmic drugs; ⁇ -adrenergic blocker drugs; cardiotonic drugs; antihypertensive drugs; diuretic drugs; vasodilator drugs; vasoconstrictor drugs; antiulcer drugs; anesthetic drugs; antidepressant drugs; tranquilizer and sedative drugs; antipsychotic drugs; and antimicrobial drugs.
- drug moieties useful in practicing the present invention include antineoplastic drugs, cytocidal agents, anti-estrogens, and antimetabolites. Also included within this class are radioisotope-based agents for both diagnosis (e.g., imaging) and therapy, and conjugated toxins.
- the therapeutic moiety can also be a hormone, a muscle relaxant, an antispasmodic, bone activating agent, endocrine modulating agent, modulator of diabetes, androgen, antidiuretics, or calcitonin drug.
- modifying groups include immunomodulating drugs, immunosuppressants, etc.
- Groups with anti-inflammatory activity such as sulindac, etodolac, ketoprofen and ketorolac, are also of use.
- Other drugs of use in conjunction with the present invention will be apparent to those of skill in the art.
- the altered N-glycosylation SAP polypeptides produced by the methods of the disclosure can be homogeneous (i.e., the sample of SAP polypeptide is uniform in specific N-glycan structure) or substantially homogeneous.
- substantially homogeneous is meant that at least about 25% (e.g., at least about 27%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least about 95%, or at least about 99%) of the SAP polypeptides contain the same specific N-glycan structure.
- variant SAP polypeptides of the invention have an IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than 1 ⁇ 2, less than 1 ⁇ 3, less than 1 ⁇ 4, less than 1/10, or less than 1/100 that of a corresponding sample of wild-type SAP isolated from human serum.
- IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro is less than 1 ⁇ 2, less than 1 ⁇ 3, less than 1 ⁇ 4, less than 1/10, or less than 1/100 that of a corresponding sample of wild-type SAP isolated from human serum.
- PBMCs Peripheral Blood Mononuclear Cells
- monocyte cells to SAP for fibrocyte differentiation.
- PBMCs or monocytes suitable for use in these methods may be obtained from various tissue culture lines.
- suitable cells for fibrocyte differentiation assays may be obtained from any biological sample that contains PBMC or monocyte cells.
- the biological sample may be obtained from serum, plasma, healthy tissue, or fibrotic tissue.
- fibrocyte differentiation assays are conducted by incubating PBMC or monocyte cells in media with various concentrations of a SAP polypeptide to determine the degree of fibrocyte differentiation.
- the concentration of SAP can range from 0.0001 ⁇ g/mL to 1 mg/ml, and in some embodiments is 0.001 ⁇ g/mL, 1.0 ⁇ g/mL, 5 ⁇ g/mL, 10 ⁇ g/mL, 15 ⁇ g/mL, 20 ⁇ g/mL, 25 ⁇ g/mL, 30 ⁇ g/mL, 35 ⁇ g/mL, 40 ⁇ g/mL, 45 ⁇ g/mL, 50 ⁇ g/mL, 100 ⁇ g/mL, 200 ⁇ g/mL, 300 ⁇ g/mL, or 500 ⁇ g/mL.
- the media can be supplemented with between 1-100 ng/ml hMCSF; the preferred concentration of hMCSF being 25 ng/mL.
- the indication that PBMC and monocytes have differentiated into fibrocytes can be determined by one skilled in the art.
- fibrocytes are morphologically defined as adherent cells with an elongated spindle-shape and the presence of an oval nucleus.
- cells are fixed and stained with Hema 3 before enumerating fibrocytes by direct counting, e.g., using an inverted microscope.
- the amount of fibrocyte differentiation is interpreted by one skilled in the art as an indication of a cell's responsiveness to SAP.
- a greater suppression of fibrocyte differentiation indicates a greater degree of SAP responsiveness.
- An alternative method of measuring fibrocyte differentiation involves determining the expression of fibrocyte-specific cell surface markers or secreted factors ,e.g., cytokines (e.g., IL-1ra, ENA-78/CXCL-5, PAI-1), fibronectin, collagen-1.
- cytokines e.g., IL-1ra, ENA-78/CXCL-5, PAI-1
- Methods of detecting and/or quantifying cell surface markers or secreted factors are well known in the art, including but not limited to various ELISA- and FACS-based techniques using immunoreactive antibodies against one or more fibrocyte specific markers.
- measuring the expression of Macrophage Derived Chemokine (MDC) is an effective method of determining fibrocyte differentiation.
- Methods for detecting and/or characterizing N-glycosylation (e.g., altered N-glycosylation) of a SAP polypeptide include DNA sequencer-assisted (DSA), fluorophore-assisted carbohydrate electrophoresis (FACE) or surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF MS).
- DSA DNA sequencer-assisted
- FACE fluorophore-assisted carbohydrate electrophoresis
- SELDI-TOF MS surface-enhanced laser desorption/ionization time-of-flight mass spectrometry
- an analysis can utilize DSA-FACE in which, for example, glycoproteins are denatured followed by immobilization on, e.g., a membrane. The glycoproteins can then be reduced with a suitable reducing agent such as dithiothreitol (DATA) or ⁇ -mercaptoethanol.
- DATA dithi
- the sulfhydryl groups of the proteins can be carboxylated using an acid such as iodoacetic acid.
- the N-glycans can be released from the protein using an enzyme such as N-glycosidase F.
- N-glycans optionally, can be reconstituted and derivatized by reductive amination.
- the derivatized N-glycans can then be concentrated.
- Instrumentation suitable for N-glycan analysis includes, for example, the ABI PRISM® 377 DNA sequencer (Applied Biosystems). Data analysis can be performed using, for example, GENESCAN®. 3.1 software (Applied Biosystems).
- isolated mannoproteins can be further treated with one or more enzymes to confirm their N-glycan status.
- enzymes include, for example, a-mannosidase or ⁇ -1,2 mannosidase,.
- Additional methods of N-glycan analysis include, for example, mass spectrometry (e.g., MALDI-TOF-MS), high-pressure liquid chromatography (HPLC) on normal phase, reversed phase and ion exchange chromatography (e.g., with pulsed amperometric detection when glycans are not labeled and with UV absorbance or fluorescence if glycans are appropriately labeled). See also Callewaert et al. (2001) Glycobiology 11(4):275-281 and Freire et al. (2006) Bioconjug. Chem. 17(2):559-564, the disclosures of each of which are incorporated herein by reference in their entirety.
- the disclosure provides methods for treating an SAP-responsive disorder in a patient by administering a therapeutically effective amount of a variant SAP polypeptide of the invention to a patient in need thereof.
- the dosage and frequency of treatment can be determined by one skilled in the art and will vary depending on the symptoms, age and body weight of the patient, and the nature and severity of the disorder to be treated or prevented.
- a variant SAP polypeptide is administered to a patient once or twice per day, once or twice per week, once or twice per month, or just prior to or at the onset of symptoms.
- Toxicity and therapeutic efficacy of SAP may be determined by standard pharmaceutical procedures in experimental animals, for example, determining the LD 50 and the ED 50 .
- the ED 50 Effective Dose 50
- the LD 50 Lethal Dose 50
- the LD 50 is the dose of drug which kills 50% of a sample population.
- the SAP-responsive disorder is fibrosis.
- Fibrosis related disorders that may be amenable to treatment with the subject method include, but are not limited to, collagen disease, interstitial lung disease, human fibrotic lung disease (e.g., obliterative bronchiolitis, idiopathic pulmonary fibrosis, pulmonary fibrosis from a known etiology, tumor stroma in lung disease, systemic sclerosis affecting the lungs, Hermansky-Pudlak syndrome, coal worker's pneumoconiosis, asbestosis, silicosis, chronic pulmonary hypertension, AIDS-associated pulmonary hypertension, sarcoidosis, moderate to severe asthma and the like), fibrotic vascular disease, arterial sclerosis, atherosclerosis, varicose veins, coronary infarcts
- the fibrosis related disorder is selected from systemic or local scleroderma, keloids, hypertrophic scars, atherosclerosis, restenosis, pulmonary inflammation and fibrosis, idiopathic pulmonary fibrosis, liver cirrhosis, fibrosis as a result of chronic hepatitis B or C infection, kidney disease, heart disease resulting from scar tissue, macular degeneration, and retinal and vitreal retinopathy.
- the fibrosis related disorder results from chemotherapeutic drugs, radiation-induced fibrosis, and injuries and burns.
- the fibrosis-related disorder or condition results from post-surgical scarring, e.g., following trabeculectomy or other filtration surgery of the eye.
- the SAP-responsive disorder is a hypersensitivity disorder such as those mediated by Th1 or Th2 responses.
- a hypersensitivity disorder such as those mediated by Th1 or Th2 responses.
- the use of SAP as a therapeutic treatment for hypersensitivity disorders is also described in U.S. Provisional Application No. 61/209,795, which is hereby incorporated by reference.
- Hypersensitivity related disorders that may be amenable to treatment with SAP include, but are not limited to, allergic rhinitis, allergic sinusitis, allergic conjunctivitis, allergic bronchoconstriction, allergic dyspnea, allergic increase in mucus production in the lungs, atopic eczema, dermatitis, urticaria, anaphylaxis, pneumonitis, and allergic-asthma.
- a variant SAP polypeptide of the invention may be used to treat allergen-specific immune responses, such as anaphylaxis, to various antigens, including, but not limited to, antimicrobials (e.g., cephalosporins, sulfonamides, penicillin and other ⁇ -lactams), anticonvulsants (e.g., phenytoin, phenobarbital, carbamazepine, dapsone, allopurinol, and minocycline), chemotherapeutics (e.g., taxanes, platinum compounds, asparaginases, and epipodophyllotoxins), heparin, insulin, protamine, aspirin and other non-steroidal anti-inflammatory drugs, muscle relaxants (e.g., succinylcholine, atracurium, vecuronium, and pancuronium), induction agents (e.g., barbiturates, etomidate, propofol), narcotic
- the SAP-responsive disorder is an autoimmune disorder such as those mediated by Th1 or Th2 responses.
- autoimmune disorders such as those mediated by Th1 or Th2 responses.
- the use of SAP as a therapeutic treatment for autoimmune disorders is also described in U.S. Provisional Application No 61/209,845, which is hereby incorporated by reference.
- Autoimmune related disorders that may be amenable to treatment with SAP include, but are not limited to, type I diabetes, multiple sclerosis, rheumatoid arthritis, psoriatic arthritis, autoimmune myocarditis, pemphigus, myasthenia gravis, Hashimoto's thyroiditis, Graves' disease, Addison's disease, autoimmune hepatitis, chronic Lyme arthritis, familial dilated cardiomyopathy, juvenile dermatomyositis, polychondritis, Sjogren's syndrome, psoriasis, juvenile idiopathic arthritis, inflammatory bowel disease, systemic lupus erythematosus, chronic obstructive pulmonary disease, and graft-versus-host disease.
- the SAP-responsive disorder is a mucositis.
- the use of SAP as a therapeutic treatment for mucositis is also described in U.S. application Ser. No. 12/217,614, which is hereby incorporated by reference.
- Methods of the invention may be useful for treating oral, esophageal, and gastrointestinal mucositis, as well as gastric and duodenal ulcers, or erosions of the stomach and esophagus.
- a variant SAP polypeptide of the invention may be used to treat an inflammatory disease or condition.
- the inflammatory disease may be a viral, bacterial, fungal, or parasitic infection.
- the use of SAP as a therapeutic treatment for viral infection has also been described in U.S. Pat. No. 6,406,698 and in International Patent Application No. WO1997/026906, which are both incorporated by reference herein.
- the methods described herein involve administration of at least one variant SAP polypeptide of the invention to a subject as a therapeutic agent.
- the therapeutic agents of the invention may be formulated in a conventional manner using one or more physiologically acceptable carriers or excipients.
- therapeutic agents and their physiologically acceptable salts and solvates may be formulated for administration by, for example, injection (e.g. SubQ, IM, IP), inhalation or insufflation (either through the mouth or the nose) or oral, buccal, sublingual, transdermal, nasal, parenteral or rectal administration.
- therapeutic agents may be administered locally, at the site where the target cells are present, i.e., in a specific tissue, organ, or fluid (e.g., blood, cerebrospinal fluid, tumor mass, etc.).
- the present invention further provides use of any variant SAP polypeptide of the invention in the manufacture of a medicament for the treatment or prevention of a disorder or a condition, as described herein, in a patient, for example, the use of a variant SAP polypeptide in the manufacture of medicament for the treatment of a disorder or condition described herein.
- any variant SAP polypeptide of the invention may be used to make a pharmaceutical preparation for the use in treating or preventing a disease or condition described herein.
- Therapeutic agents can be formulated for a variety of modes of administration, including systemic and topical or localized administration. Techniques and formulations generally may be found in Remington's Pharmaceutical Sciences, Meade Publishing Co., Easton, PA.
- parenteral administration injection is preferred, including intramuscular, intravenous, intraperitoneal, and subcutaneous.
- the compounds can be formulated in liquid solutions, preferably in physiologically compatible buffers such as Hank's solution or Ringer's solution.
- the compounds may be formulated in solid form and dissolved or suspended immediately prior to use. Lyophilized forms are also included.
- the therapeutic agents can be administered to cells by a variety of methods know to those familiar in the art, including, but not restricted to, encapsulation in liposomes, by iontophoresis, or by incorporation into other vehicles, such as hydrogels, cyclodextrins, biodegradable nanocapsules, and bioadhesive microspheres.
- the pharmaceutical compositions may take the form of, for example, tablets, lozenges, or capsules prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinized maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulphate).
- binding agents e.g., pregelatinized maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose
- fillers e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate
- lubricants e.g., magnesium stearate, talc or silica
- disintegrants e.g
- Liquid preparations for oral administration may take the form of, for example, solutions, syrups or suspensions, or they may be presented as a dry product for constitution with water or other suitable vehicle before use.
- Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid).
- the preparations may also contain buffer salts, flavoring, coloring and sweetening agents as appropriate.
- Preparations for oral administration may be suitably formulated to give controlled release of the active compound.
- therapeutic agents may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- the pharmaceutical compounds can also be administered by intranasal or intrabronchial routes including insufflation, powders, and aerosol formulations (for examples of steroid inhalants, see Rohatagi (1995) J. Clin. Pharmacology. 35:1187-1193; Tjwa (1995) Ann. Allergy Asthma Immunol. 75:107-111).
- aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like. They also may be formulated as pharmaceuticals for non-pressured preparations such as in a nebulizer or an atomizer. Typically, such administration is in an aqueous pharmacologically acceptable buffer.
- compositions suitable for respiratory delivery e.g., intranasal, inhalation, etc.
- compositions suitable for respiratory delivery e.g., intranasal, inhalation, etc.
- compositions suitable for respiratory delivery e.g., intranasal, inhalation, etc.
- of variant SAP polypeptides may be prepared in either solid or liquid form.
- SAP polypeptides of the invention may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion.
- Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative.
- the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- SAP polypeptides of the invention may also be formulated as a depot preparation.
- Such long-acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection.
- therapeutic agents may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- Controlled release formula also includes patches.
- the compounds described herein can be formulated for delivery to the central nervous system (CNS) (reviewed in Begley, Pharmacology & Therapeutics 104: 29-45 (2004)).
- CNS central nervous system
- Conventional approaches for drug delivery to the CNS include: neurosurgical strategies (e.g., intracerebral injection or intracerebroventricular infusion); molecular manipulation of the agent (e.g., production of a chimeric fusion protein that comprises a transport peptide that has an affinity for an endothelial cell surface molecule in combination with an agent that is itself incapable of crossing the blood-brain-barrier in an attempt to exploit one of the endogenous transport pathways of the blood-brain-barrier); pharmacological strategies designed to increase the lipid solubility of an agent (e.g., conjugation of water-soluble agents to lipid or cholesterol carriers); and the transitory disruption of the integrity of the BBB by hyperosmotic disruption (resulting from the infusion of a mannitol solution into the carotid
- SAP polypeptides of the invention are incorporated into a topical formulation containing a topical carrier that is generally suited to topical drug administration and comprising any such material known in the art.
- the topical carrier may be selected so as to provide the composition in the desired form, e.g., as an ointment, lotion, cream, microemulsion, gel, oil, solution, or the like, and may be comprised of a material of either naturally occurring or synthetic origin. It is preferable that the selected carrier not adversely affect the active agent or other components of the topical formulation.
- suitable topical carriers for use herein include water, alcohols and other nontoxic organic solvents, glycerin, mineral oil, silicone, petroleum jelly, lanolin, fatty acids, vegetable oils, parabens, waxes, and the like.
- compositions may comprise from about 0.00001 to 100% such as from 0.001 to 10% or from 0.1% to 5% by weight of one or more of the variant SAP polypeptides described herein.
- the active agent is present in an amount in the range of approximately 0.25 wt. % to 75 wt. % of the formulation, preferably in the range of approximately 0.25 wt. % to 30 wt. % of the formulation, more preferably in the range of approximately 0.5 wt. % to 15 wt. % of the formulation, and most preferably in the range of approximately 1.0 wt. % to 10 wt. % of the formulation.
- Conditions of the eye can be treated or prevented by, e.g., systemic, topical, intraocular injection of therapeutic agents, or by insertion of a sustained release device that releases therapeutic agents.
- SAP polypeptides of the invention may be delivered in a pharmaceutically acceptable ophthalmic vehicle, such that the compound is maintained in contact with the ocular surface for a sufficient time period to allow the compound to penetrate the corneal and internal regions of the eye, as for example the anterior chamber, conjunctiva, posterior chamber, vitreous body, aqueous humor, vitreous humor, cornea, iris/ciliary, lens, choroid/retina and sclera.
- the pharmaceutically acceptable ophthalmic vehicle may, for example, be an ointment, vegetable oil or an encapsulating material.
- the compounds may be injected directly into the vitreous and aqueous humour.
- the compounds may be administered systemically, such as by intravenous infusion or injection, for treatment of the eye.
- Therapeutic agents described herein may be stored in oxygen-free environment according to methods in the art.
- compositions comprise an SAP polypeptide with one or more pharmaceutically acceptable carriers and, optionally, other therapeutic ingredients.
- the carrier(s) must be “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of the composition and not eliciting an unacceptable deleterious effect in the subject. Such carriers are described herein or are otherwise well known to those skilled in the art of pharmacology.
- the pharmaceutical compositions are pyrogen-free and are suitable for administration to a human patient.
- the pharmaceutical compositions are irritant-free and are suitable for administration to a human patient.
- the pharmaceutical compositions are allergen-free and are suitable for administration to a human patient.
- the compositions may be prepared by any of the methods well known in the art of pharmacy.
- an SAP polypeptide is administered in a time release formulation, for example in a composition which includes a slow release polymer.
- An SAP polypeptide can be prepared with carriers that will protect against rapid release. Examples include a controlled release vehicle, such as a polymer, microencapsulated delivery system, or bioadhesive gel.
- prolonged delivery of an SAP polypeptide may be achieved by including in the composition agents that delay absorption, for example, aluminum monostearate hydrogels and gelatin.
- nucleic acid compounds Methods for delivering nucleic acid compounds are known in the art (see, e.g., Akhtar et al., 1992, Trends Cell Bio., 2, 139; and Delivery Strategies for Antisense Oligonucleotide Therapeutics, ed. Akhtar, 1995; Sullivan et al., International Application No. WO 94/02595). These protocols can be utilized for the delivery of virtually any nucleic acid compound.
- Nucleic acid compounds can be administered to cells by a variety of methods known to those familiar to the art, including, but not restricted to, encapsulation in liposomes, by iontophoresis, or by incorporation into other vehicles, such as hydrogels, cyclodextrins, biodegradable nanocapsules, and bioadhesive microspheres.
- the nucleic acid/vehicle combination is locally delivered by direct injection or by use of an infusion pump.
- Other routes of delivery include, but are not limited to, oral (tablet or pill form) and/or intrathecal delivery (Gold, 1997, Neuroscience, 76, 1153-1158).
- Other approaches include the use of various transport and carrier systems, for example though the use of conjugates and biodegradable polymers.
- rhSAP CHO-S cells
- hSAP human serum-derived SAP
- monocyte enriched Peripheral Blood Mononuclear Cells (PBMCs) were incubated with varying concentrations of either rhSAP or hSAP for 96 hours.
- PBMCs Peripheral Blood Mononuclear Cells
- resulting culture supernatants were removed and assayed by ELISA to quantify the amount of Macrophage Derived Chemokine (MDC) that was produced.
- MDC Macrophage Derived Chemokine
- the relative potency of a SAP glycovariant can be determined. The result is expressed as an IC 50 ratio of the sample versus the hSAP reference standard.
- SAP samples and standards were initially diluted to a concentration of 1.0 mg/mL in Supplemented FibroLife Media.
- SAP standards were serially diluted to generate working standard concentrations of 60, 30, 20, 13.4, 8.8, 6.0, 3.0, 1.5, and 0.75 ⁇ g/mL (final standard concentration of 30, 15, 10, 6.7, 4.4, 3.0. 1.5, 0.75, and 0.375 ⁇ g/mL). See the following Table 1.
- the capture antibody i.e., mouse anti-human MDC
- PBS without carrier protein
- the diluted capture antibody was used to coat 96-well plates, and then each plate was sealed and incubated overnight at room temperature. Before using the coated plates, each well was aspirated and washed with wash buffer, repeating the process two times for a total of three washes. The plates were then blocked by adding 300 ⁇ L of reagent diluent to each well and incubating at room temperature for one hour. After incubation the aspiration and well-washing procedure was repeated.
- the ELISA assay 100 ⁇ L samples of either the supernatants from the monocyte/fibrocyte cultures or the SAP standards were added to each well. The plate was then incubated at room temperature for 2 hours before aspirating and washing the wells. Then 100 ⁇ L of a working dilution of Streptavidin-HRP was added to each well. The plate was incubated for 20 minutes at room temperature before adding 50 ⁇ L of Stop Solution to each well. Immediately, the optical density of each well was measured using a microplate reader set to 450 nm. If wavelength correction was available, the microplate reader was set to 540 nm or 570 nm. If wavelength correction was not available, then the readings at 540 nm or 570 nm were subtracted from the readings at 450 nm. This subtraction corrects for optical imperfections in the plate.
- glycan moieties on a sample of recombinant human SAP were modified to replace terminal ⁇ 2,3-linked sialic acid moieties with ⁇ 2,6-linked sialic acid moieties ( FIG. 2 , A and B).
- a sample of human serum-derived SAP was also modified to replace terminal ⁇ 2,6-linked sialic acid moieties with ⁇ 2,3-linked sialic acid moieties ( FIG. 2 , C and D).
- rhSAP and hSAP were treated with a ⁇ 2,3,6,8,9-sialidase (Sigma Cat #N8271) to fully desialylate the polypeptides.
- sialidase treatment for 17 hours desialylated (i.e. asialo) rhSAP and hSAP were purified using phosphoethanolamine (PE) affinity and size exclusion (Sephadex 200 prep grade) chromatography.
- PE phosphoethanolamine
- Asialo rhSAP Reactions Treatment with ⁇ 2,3 sialyltransferase (ST3Gal3) parameter units value rhSAP, ST3Gal3 [asialo rhSAP] stk mg/mL 10.8 reagent stocks asialo rhSAP MW g/mol 116293 [asialo rhSAP] stk ⁇ M 93 max [Galactose] ⁇ M 929 [ST3Gal3] stk mg/mL 0.9 ST3Gal3 MW g/mol 84000 [ST3Gal3] stk ⁇ M 10.7 [CMP-SA] stk mg/mL 25 CMP-SA MW g/mol 658.4 [CMP-SA] stk mM 38 rxn volumes ⁇ L asialo rhSAP in rxn ⁇ L 260 ⁇ L ST3Gal3 in r
- sialylated rhSAP and hSAP variants were purified using PE affinity chromatography followed by dialysis into 10 mM NaPi/5% sorbitol pH 7.5 (P5S buffer). Confirmation of the desired sialic acid linkages (i.e, ⁇ 2,3-linked hSAP and ⁇ 2,6-linked RHSAP) was preformed using both Liquid Chromatography Mass Spectrometry ( FIG. 2 ; A, C, and E) and Anion-Exchange High Performance Liquid Chromatography ( FIG. 2 ; B, D, and F) following treatment of the glycovariant SAP polypeptides with ⁇ 2,3 sialidase (Calbiochem Cat#480706) at 37° C. for 24 hours.
- EXAMPLE3 IN VITRO BIOASSAYS TO DETERMINE SAP GLYCOVARIANT POTENCY FOR INHIBITING MONOCYTE DIFFERENTIATION INTO FIBROCYTES
- Glycoremodeled rhSAP and hSAP were assayed for bioactivity using the same in vitro bioassay described in Example 1.
- monocyte enriched peripheral blood mononuclear cells (PBMCs) were incubated with varying concentrations of an SAP polypeptide for 96 hours.
- PBMCs peripheral blood mononuclear cells
- resulting culture supernatants were removed and assayed by ELISA to quantify the about of Macrophage Derived Chemokine (MDC) that was produced.
- MDC Macrophage Derived Chemokine
- All ⁇ 2,3-sialic acid linkage containing test materials are ⁇ 2.4-fold more active than hSAP ( FIG. 3 ).
- Equal mixtures of ⁇ 2,3-and ⁇ 2,6-linked sialic acid derivatives of SAP show intermediate activity levels between 100% ⁇ 2,6-linked and 100% ⁇ 2,3-linked SAP as expected (two rightmost bars in FIG. 3 ).
- An alternative method of quantifying fibrocyte differentiation involves directly enumerating the number of fibrocytes that are generated after monocytes are incubated with a fibrocyte suppressant (e.g., SAP or variant thereof) or activating agent (e.g., M-CSF).
- a fibrocyte suppressant e.g., SAP or variant thereof
- activating agent e.g., M-CSF
- monocytes were purified from whole blood-derived PBMC using negative magnetic bead selection standard in the art (e.g. CAT# 113-41D, Invitrogen, Carlsbad, Calif.) and cultured in a 96-Well tissue culture plate containing FibroLife Media supplemented with 25 or 50 ng/ml of M-CSF in triplicate. The plate was incubated for 96 hours at 37 ° C. in a 5% CO2 incubator.
- a fibrocyte suppressant e.g., SAP or variant thereof
- M-CSF activating agent
- the cells were then fixed with paraformaldehyde and stained with Hema 3 stain (Cat # 122-911, Hema 3 Stain, Fisher Scientific, Hampton, N.H.).
- the number of fibrocytes per well were determined by summing the count of five different fields per well using an inverted microscope. Fibrocytes were defined morphologically as adherent cells with an elongated spindle-shape and the presence of an oval nucleus. The data indicated that either 25 or 50 ng/ml of M-CSF was sufficient to increase the number of fibrocytes differentiating from monocytes by ⁇ 50% in this donor ( FIG. 4 ). Subsequent experiments used FibroLife Media supplemented with 25 ng/ml of M-CSF as needed and defined below.
- PBMC or monocytes were purified from whole blood and cultured in FibroLife Media supplemented with various amounts of SAP in triplicate (as described above). The plate was incubated for 96 hours at 37° C. in a 5% CO2 incubator. The cells were then fixed with paraformaldehyde and stained with Hema 3 stain (Cat # 122-911, Hema 3 Stain, Fisher Scientific, Hampton, N.H.). The number of fibrocytes per well were determined by summing the count of five different fields per well using an inverted microscope. The minimum concentration of SAP necessary to provide maximum inhibition of fibrocyte differentiation in this system was determined to be 2ug/m1 ( FIG. 5 ). The number of fibrocytes decreases with increasing SAP concentration in all donors.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Physical Education & Sports Medicine (AREA)
- Rheumatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Neurology (AREA)
- Pulmonology (AREA)
- Pain & Pain Management (AREA)
- Transplantation (AREA)
- Biomedical Technology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Steroid Compounds (AREA)
- Medicinal Preparation (AREA)
Abstract
One aspect of the present invention relates to the surprising discovery that modification of a glycan structure on a human SAP polypeptide can increase the biological activity of the SAP polypeptide relative to a corresponding sample of wild-type SAP isolated from human serum. The disclosure provides both variant human SAP polypeptides and methods for making the same. In particular, the present invention provides methods and compositions for in vitro and in vivo addition, deletion, or modification of sugar residues to produce SAP polypeptides, such as a human SAP polypeptide, having a desired glycosylation pattern.
Description
- This application is a continuation of U.S. patent application Ser. No. 16/941,515, filed Jul. 28, 2020 (pending), which is a continuation of U.S. patent application Ser. No. 16/731,320, filed Dec. 31, 2019, (abandoned), which is a continuation of U.S. application Ser. No. 16/417,537, filed May 20, 2019, (abandoned), which is a continuation of U.S. patent application Ser. No. 16/156,978, filed Oct. 10, 2018, (abandoned) which is a continuation of U.S. patent application Ser. No. 15/492,085, filed Apr. 20, 2017, (abandoned) which is a continuation of U.S. patent application Ser. No. 15/264,707, filed Sep. 14, 2016 (abandoned), which is a continuation of U.S. patent application Ser. No. 15/054,640, filed Feb. 26, 2016 (abandoned), which is a continuation of U.S. patent application Ser. No. 12/794,132, filed Jun. 4, 2010, now U.S. Pat. No. 9,296,800, which claims the benefit of U.S. Provisional Application Ser. No. 61/217,931 (expired), filed on Jun. 4, 2009. All of the teachings of each of the above-referenced applications are incorporated herein by reference.
- Serum Amyloid P (SAP) is a member of the pentraxin family of proteins. SAP is secreted by the liver and circulates in the blood as a stable pentamer. Previous research demonstrates SAP has an important role in both the initiation and resolution phases of the immune response. SAP can bind to sugar residues on the surface of bacteria and thereby promote their opsonization and engulfment by antigen-presenting cells. SAP also binds to free DNA and chromatin generated by apoptotic cells at the resolution of an immune response, thus preventing a secondary inflammatory response against these antigens. Molecules bound by SAP are removed from extracellular areas due to the ability of SAP to bind to all three classical Fcγ. receptors (FcγR), having a particular affinity for FcγRII (CD32) and FcγRIII (CD16). After receptor binding, SAP and any attached complex are generally internalized and processed by the cell.
- Recently, it has been suggested that SAP can be used as a therapeutic agent to treat various disorders, including fibrosis-related disorders, hypersensitivity disorders, autoimmune disorders, mucositis, and inflammatory disorders such as those cause by microbial infection. See, for example, U.S. patent application Ser. Nos. 11/707,333, 12/217,617, 12/720,845, and 12/720,847. Protein therapeutics for treating human disease have revolutionized the health care industry. However, there are many difficulties in producing a protein therapeutic having the necessary potency and/or in sufficient quantity to be useful as a therapeutic agent. Many potential therapeutic agents are modified to increase their biological activity, such as plasma half-life, relative to the naturally-derived protein. Recombinant expression technology is usually implemented to produce polypeptides in sufficient quantity. Unfortunately, many recombinant systems produce polypeptides having different biological properties than the naturally-derived forms, which may affect the pharmacokinetics, safety, and efficacy of a therapeutic product.
- Therefore, a need remains for developing SAP polypeptides, and methods of manufacturing them, suitable for therapeutic treatment of humans.
- In part, the disclosure provides variant Serum Amyloid P (SAP) polypeptides and methods for producing them. The present invention includes methods and compositions for in vitro and in vivo addition, deletion, or modification of sugar residues to produce variant SAP polypeptides having a desired glycosylation pattern.
- In certain aspects, the disclosure provides a glycosylated human SAP polypeptide, comprising an N-linked or O-linked oligosaccharide chain that has at least one branch terminating with a α2,3-linked sialic acid moiety.
- In certain aspects, the disclosure provides a glycosylated human SAP polypeptide, comprising an N-linked or O-linked oligosaccharide chain that has at least 50% fewer α2,6-linked sialic acid moieties than wild-type SAP isolated from human serum.
- In certain aspects, the disclosure provides methods of making a glycosylated human SAP polypeptide, comprising expressing a SAP polypeptide in a cell and isolating the SAP polypeptide from the cell. In a preferred embodiment, the cell is a CHO cell. In certain aspects, the cell is a CHO-S cell.
- In certain aspects, the disclosure provides methods of making a human SAP polypeptide, comprising expressing a human SAP polypeptide in a CHO cell and isolating the human SAP polypeptide from the cell.
- In certain aspects, the disclosure provides methods of making a human SAP polypeptide, comprising providing a glycosylated human SAP polypeptide containing an N-linked or O-linked oligosaccharide chain and enzymatically or chemically altering the N-linked or O-linked oligosaccharide chain of the SAP polypeptide to produce a modified glycosylated SAP polypeptide.
- In certain aspects, the disclosure provides methods of making a human SAP polypeptide, comprising providing a human SAP polypeptide and enzymatically or chemically altering the SAP polypeptide to produce a glycosylated SAP polypeptide comprising an N-linked or O-linked oligosaccharide.
- In certain aspects, the disclosure provides a human SAP polypeptide prepared by a process comprising expressing a SAP polypeptide in a CHO cell and isolating the SAP polypeptide from the cell.
- In certain aspects, the disclosure provides a CHO cell that contains a human SAP polypeptide with an N-linked oligosaccharide chain having at least one branch of the oligosaccharide chain terminating with a α2,3-linked sialic acid moiety.
- In certain aspects, the disclosure provides a CHO cell containing a polynucleotide sequence encoding a human SAP polypeptide.
- In certain aspects, the disclosure provides a human SAP polypeptide having an IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than one-half, less than one-third, less than one-fourth, less than one-tenth, or less than one-hundredth than that of a corresponding sample of wild-type SAP isolated from human serum.
- In preferred embodiments, human SAP polypeptides of the invention have an N-linked oligosaccharide chain. In some embodiments, at least one branch of the N-linked oligosaccharide chain terminates with a α2,3-linked sialic acid moiety. In some embodiments, the N-linked oligosaccharide chain has at least 50% fewer α2,6-linked sialic acid moieties than a wild-type SAP isolated from human serum. In some embodiments, all branches of the N-linked oligosaccharide chain terminate with α2,3-linked sialic acid moieties. In some embodiments, the N-linked oligosaccharide chain is substantially free of α2,6-linked sialic acid moieties. Glycovariant SAP polypeptides of the invention may comprise one or more branches, e.g., the N-linked oligosaccharide chain may be characterized as having a bi-antennary, tri-antennary, tetra-antennary, or a penta-antennary structure. In some embodiments, the N-linked oligosaccharide chain comprises a pentasaccharide core of Man[(α1,6-)-(Man(α1,3)]-Man(β1,4)-GlcNAc(β1,4)-GlcNAc(β1,N)-Asn. In some embodiments, the N-linked oligosaccharide chain comprises at least one branch having the structure NeuNAc2α3Galβ4GlcNAcβ2Manα6. In some embodiments, at least one branch of the N-linked oligosaccharide chain is substantially free of galactose and N-acetylglucosamine. In some embodiments, all the branches of the N-linked oligosaccharide chain are substantially free of galactose and N-acetylglucosamine. In some embodiments, at least one branch of the N-linked oligosaccharide chain comprises one or more mannose residues. In some embodiments, the N-linked oligosaccharide chain comprises at least one fucose residue. Any of the glycovariant SAP polypeptides of the invention may comprise at least one modified glycosyl residue. A modified glycosyl residue may be conjugated to one or more modifying groups selected from water-soluble and -insoluble polymers, therapeutic moieties, diagnostic agents, and biomolecules.
- In certain aspects, the SAP polypeptide of the invention may be a recombinant polypeptide. SAP polypeptide of the invention may comprise an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID Nos. 1, 2, 3, or 4. Preferably, the SAP polypeptide is a human SAP protein. A human SAP polypeptide of the invention may comprise an amino acid sequence at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 1.
- In certain aspects, the human SAP polypeptide of the invention is a fusion protein comprising an SAP domain and one or more heterologous domains. The heterologous domain may enhance one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
- In certain aspects, the human SAP polypeptide of the invention comprises one or more modified amino acid residues, e.g., a PEGylated amino acid, a glycosylated (e.g., O-linked glycosylation) amino acid, a prenylated amino acid, an acetylated amino acid, a biotinylated amino acid, and/or an amino acid conjugated to an organic derivatizing agent. The modified amino acid residues may enhance one or more of in vivo stability, in vivo half-life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
- In preferred embodiments, human SAP polypeptides of the invention have increased biological activity relative to a corresponding sample of wild-type SAP isolated from human serum. In certain aspects, the SAP polypeptides of the invention have an IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than one-half, less than one-third, less than one-fourth, less than one-tenth, or less than one-hundredth that of a corresponding sample of wild-type SAP isolated from human serum.
- In certain aspects, methods of making any of the human SAP polypeptides of the invention comprise an additional step of enzymatically or chemically altering the SAP polypeptide to attach an N-linked or O-linked oligosaccharide chain to the SAP polypeptide or to modify the existing N-linked or O-linked oligosaccharide chain of the SAP polypeptide. In some embodiments, enzymatically or chemically altering the SAP polypeptide comprises treating the SAP polypeptide with one or more enzymatic proteins selected from glycosyltransferases, glycosidases, and phosphatases. In some embodiments, the process of enzymatically or chemically altering the SAP polypeptide is effected in the presence of one or more sugar precursors. Suitable sugar precursors include, but are not limited to, UDP-N-acetylglucosamine, CMP-N-glycolylneuraminic acid UDP-N-acetylgalactosamine, CMP-N-acetylneuraminic acid, UDP-galactose, and GDP-fucose. In some embodiments, the process of enzymatically or chemically altering the SAP polypeptide removes one or more terminal α2,6-linked sialic acid moieties from the N-linked or O-linked oligosaccharide chain. In some embodiments, the process of enzymatically or chemically altering the isolated SAP polypeptide replaces one or more terminal α2,6-linked sialic acid moieties on the oligosaccharide chain with one or more α2,3-linked sialic acid moieties.
- The disclosure further provides pharmaceutical preparations of human SAP polypeptides of the invention suitable for use in a mammal. Pharmaceutical preparations of the invention include at least one of the SAP polypeptides disclosed herein and a pharmaceutically acceptable carrier. In some embodiments, the pharmaceutical preparation further comprises an additional active agent. In some embodiments, the pharmaceutical preparation is prepared as a sustained release formulation. In some embodiments, pharmaceutical preparations of the disclosure are suitable for administration to a patient topically, by injection, by intravenous injection, by inhalation, by continuous depot, or by pump.
- The disclosure further provides methods for treating or preventing SAP-responsive disorders or conditions by administering to a patient in need thereof a therapeutically effective amount of one or more of the SAP polypeptides of the invention. SAP-responsive disorders or conditions include, but are not limited to, fibrotic or fibroproliferative disorders or conditions, hypersensitivity disorders or conditions, autoimmune disorders or conditions, inflammatory diseases or conditions, and mucositis. The SAP polypeptide of the invention may be administered to a patient topically, by injection, by intravenous injection, by inhalation, by continuous depot or pump, or a combination thereof In some embodiments, the SAP polypeptide of the invention is administered with one or more additional active agents.
-
FIG. 1 . Fibrocyte differentiation assay. An ELISA-based assay was used to measure production of MDC after incubation of monocytes with SAP polypeptides. The Y-axis indicates the average potency (i.e., average of 7 independent experiments) of human serum-derived SAP (hSAP) compared to recombinant human SAP (rhSAP) isolated from CHO-S cells. Relative activity of hSAP is set at 1.0. -
FIGS. 2A-2F . Glycan structural analysis of variant SAP polypeptides. Liquid Chromatography Mass Spectrometry (LCMS) analysis (A) and Anion-Exchange High Performance Liquid Chromatography (AEX-HPLC) analysis (B) was used to determine the sialic acid linkages on glycoremodeled recombinant human SAP isolated from CHO-S cells. Liquid Chromatography Mass Spectrometry (LCMS) analysis (C) and Anion-Exchange High Performance Liquid Chromatography (AEX-HPLC) analysis (D) was used to determine the sialic acid linkages on glycoremodeled hSAP (human serum-derived SAP). Liquid Chromatography Mass Spectrometry (LCMS) analysis (E) and Anion-Exchange High Performance Liquid Chromatography (AEX-HPLC) analysis (F) was used to determine the sialic acid linkages on rhSAP that was treated with an α2,3-sialyltransferase to increase the number ofterminal 2,3-linked sialic acids on the SAP glycans. For LCMS figures, the X-axis represents mass in Daltons, and the Y-axis is represents relative intensity. For the HPLC traces, the X-axis is the time in minutes, and the Y-axis is absorbance units (mAU). -
FIG. 3 . Fibrocyte differentiation assay. An ELISA-based assay was used to measure production of MDC after incubation of monocytes with SAP variant polypeptides. The Y-axis indicates the average relative activity of each SAP variant compared to a hSAP reference standard, for which the activity is set at 1.0 (see the left-most bar). -
FIG. 4 . Fibrocyte differentiation assay. Monocytes were treated with hMCSF and then subsequently quantified for fibrocyte differentiation. The X-axis represents the concentration of hMCSF incubated with donor monocytes. The Y-axis indicates the amount of fibrocyte proliferation at day five as measured by the enumeration of fibrocytes per 5.0×104 cells. -
FIGS. 5 . Fibrocyte differentiation assay. Monocytes were treated with hSAP and then subsequently quantified for fibrocyte differentiation. The X-axis indicates the concentration of hSAP incubated with donor monocytes. The Y-axis indicates the amount of fibrocyte proliferation at day five as measured by the enumeration of fibrocytes per 5.0×104 cells. - Most naturally occurring peptides have carbohydrate moieties (i.e., glycans) attached to the peptide via specific linkages to certain amino acids along the length of the primary peptide chain, thus forming “glycopeptides.” The glycosylation pattern on any given peptide can have enormous implications for the function of that peptide. For example, the structure of the N-linked glycans on a peptide can impact various characteristics of the peptide, including protease susceptibility, intracellular trafficking, secretion, tissue targeting, biological half-life, and antigenicity. The alteration of one or more of these characteristics greatly affects the efficacy of a peptide in its natural setting.
- The glycan structures found in naturally occurring glycopeptides are typically divided into two classes, N-linked and O-linked glycans. Peptides expressed in eukaryotic cells are typically N-glycosylated on asparagine residues at sites in the peptide primary structure containing the sequence asparagine-X-serine/threonine, where X can be any amino acid except proline and aspartic acid. The carbohydrate portion of such peptides is known as an N-linked glycan or N-linked oligosaccharide. The early events of N-glycosylation occur in the endoplasmic reticulum (ER) and are conserved in mammals, plants, insects and other higher eukaryotes. First, an oligosaccharide chain comprising fourteen sugar residues is constructed on a lipid carrier molecule. As the nascent peptide is translated and translocated into the ER, the entire oligosaccharide chain is transferred to the amide group of the asparagine residue in a reaction catalyzed by a membrane-bound glycosyltransferase enzyme. The N-linked glycan is further processed both in the ER and in the Golgi apparatus. The further processing generally entails removal of some of the sugar residues and addition of other sugar residues in reactions catalyzed by glycosylases and glycosyltransferases specific for the sugar residues removed and added.
- Typically, the final structures of the N-linked glycans are dependent upon the organism in which the peptide is produced. For example, peptides produced in bacteria are generally unglycosylated. Peptides expressed in insect cells typically contain high mannose or pauci-mannose N-linked oligosaccharide chains. Peptides produced in mammalian cell culture are usually differentially glycosylated depending upon the species and cell culture conditions. Even in the same species and under the same conditions, a certain amount of heterogeneity in the glycosyl chain is sometimes encountered. In general, peptides produced in plant cells comprise glycan structures that differ significantly from those produced in animal cells.
- A variety of methods have been proposed in the art to customize the glycosylation pattern of a peptide, including methods described in the Published International Applications Nos. WO 99/22764, WO 98/58964, and WO 99/54342 as well as in U.S. Pat. No. 5,047,335. Essentially, many of the enzymes required for the in vitro glycosylation of peptides have been cloned and sequenced. In some instances, these enzymes have been used in vitro to add specific sugars to a glycan on a peptide. In other instances, cells have been genetically engineered to express a combination of enzymes and desired peptides such that addition of a desired sugar moiety to an expressed peptide occurs within the cell.
- Two principal classes of enzymes are used in the synthesis of carbohydrates: glycosyltransferases and glycosidases. Glycosyltransferases add or modify the existing oligosaccharide structures on a peptide. Glycosyltransferases are effective for producing specific products with good stereochemical and regiochemical control. Glycosyltransferases have been used to prepare oligosaccharides and to modify terminal N- and O-linked carbohydrate structures, particularly on peptides produced in mammalian cells. For example, the terminal oligosaccharides of glycopeptides can be completely sialylated and/or fucosylated to provide more consistent sugar structures using glycosyltransferases, which may improves glycopeptide pharmacodynamics and a variety of other biological properties.
- The glycosidases are further classified as exoglycosidases (e.g., β-mannosidase, β-glucosidase), and endoglycosidases (e.g. Endo-A, Endo-M). Glycosidases normally catalyze the hydrolysis of a glycosidic bond. However, under appropriate conditions, they can be used to form this linkage. Most glycosidases used for carbohydrate synthesis are exoglycosidases; the glycosyl transfer occurs at the non-reducing terminus of the substrate. The glycosidase binds a glycosyl donor in a glycosyl-enzyme intermediate that is either intercepted by water to yield the hydrolysis product, or by an acceptor, to generate a new glycoside or oligosaccharide. An exemplary pathway using an exoglycosidase is the synthesis of the core trisaccharide of all N-linked glycopeptides, including the β-mannoside linkage, which is formed by the action of β-mannosidase (Singh et al., Chem. Commun. 993-994 (1996)). Although their use is less common than that of the exoglycosidases, endoglycosidases are also utilized to prepare carbohydrates. Endoglycosidases can be used to transfer an entire oligosaccharide chain, rather than a monosaccharide, onto a polypeptide. Oligosaccharide fragments have been added to substrates using endo-β-N-acetylglucosamines, such as endo-F andendo-M (Wang et al., Tetrahedron Lett. 37: 1975-1978; and Haneda et al., Carbohydr. Res. 292: 61-70 (1996). Each of these classes of enzymes has been successfully used produce glycosylated peptides. For a general review, see, Crout et al., Curr. Opin. Chem. Biol. 2: 98-111 (1998).
- Serum amyloid P (SAP) is a naturally occurring serum protein in mammals composed of five identical subunits, or “promoters”, which are non-covalently associated in a disk-like complex. SAP belongs to the pentraxin super family of proteins, which are characterized by this cyclic pentameric structure. The classical short pentraxins include SAP as well as C-reactive protein (Osmand, A. P., et al., Proc. Nat. Acad. Sci., 74: 739-743, 1997). SAP is normally synthesized in the liver and has a physiological half-life of twenty-four hours. The sequence of the human SAP subunit is disclosed below, which corresponds to amino acids 20-223 of Gene bank Accession NO. NP_001630 (signal sequence not depicted).
-
(SEQ ID NO: 1) HTDLSGKVFVFPRESVTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSL FSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVS WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFD RSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIR GYVIIKPLVWV
The sequence of the Gallus gallus SAP subunit is disclosed below. -
(SEQ ID NO: 2) QEDLYRKVFVFREDPSDAYVLLQVQLERPLLNFTVCLRSYTDLTRPHS LFSYATKAQDNEILLFKPKPGEYRFYVGGKYVTFRVPENRGEWEHVC ASWESGSGIAEFWLNGRPWPRKGLQKGYEVGNEAVVMLGQEQDAY GGGFDVYNSFTGEMADVHLWDAGLSPDKMRSAYLALRLPPAPLAWG RLRYEAKGDVVVKPRLREALGA
The sequence of the Bos taurus SAP subunit is disclosed below. -
(SEQ ID NO: 3) QTDLRGKVFVFPRESSTDHVTLITKLEKPLKNLTLCLRAYSDLSRGYSL FSYNIHSKDNELLVFKNGIGEYSLYIGKTKVTVRATEKFPSPVHICTSW ESSTGIAEFWINGKPLVKRGLKQGYAVGAHPKIVLGQEQDSYGGGFD KNQSFMGEIGDLYMWDSVLSPEEILLVYQGSSSISPTILDWQALKYEIK GYVIVKPMVWG
The sequence of the Cricetulus migratorius SAP subunit is disclosed below. -
(SEQ ID NO: 4) QTDLTGKVFVFPRESESDYVKLIPRLEKPLENFTLCFRTYTDLSRPHSLF SYNTKNKDNELLIYKERMGEYGLYIENVGAIVRGVEEFASPVHFCTSW ESSSGIADFWVNGIPWVKKGLKKGYTVKTQPSIILGQEQDNYGGGFDK SQSFVGEMGDLNMWDSVLTPEEIKSVYEGSWLEPNILDWRALNYEMS GYAVIRPRVWH - One aspect of the present invention relates to the surprising discovery that modification of a glycan structure on a human SAP polypeptide can increase the biological activity of the SAP polypeptide relative to a corresponding sample of wild-type SAP isolated from human serum. As demonstrated by the examples of the disclosure, isolated SAP from human serum contains only α2,6-linked sialic acid residues. In contrast, recombinant human SAP produced in CHO cells contains only α2,3-linked sialic acid residues. Using in vitro cell-based bioassays, α2,3-linked sialic acid SAP polypeptides were demonstrated to have consistently higher activity than wild-type SAP (i.e., SAP comprising α2,6-linked sialic acid moieties) isolated from human serum. The variant SAP polypeptides of the invention would be more effective as therapeutic agents due to their increased biological potency. For example, more potent SAP variants may require lower dosing and/or less frequent dosing relative to wild-type SAP isolated from human serum. The present disclosure provides both variant human SAP polypeptides and methods for making the same. In particular, the disclosure includes methods and compositions for in vitro and in vivo addition, deletion, or modification of sugar residues to produce a human SAP polypeptide having a desired glycosylation pattern.
- Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art. Generally, the nomenclature used herein and the laboratory procedures in cell culture, molecular genetics, organic chemistry, and nucleic acid chemistry and hybridization are those well known and commonly employed in the art. Standard techniques are used for nucleic acid and peptide synthesis. The techniques and procedures are generally performed according to conventional methods in the art and various general references (e.g., Sambrook et al., 1989, Molecular Cloning: A Laboratory Manual, 2d ed. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.), which are provided throughout this document.
- The articles “a” and “an” are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, “an element” means one element or more than one element.
- As used herein, the terms “treatment” and “treating”, refer to obtaining a desired pharmacologic and/or physiologic effect. The effect may be prophylactic in terms of completely or partially preventing a disorder or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disorder and/or adverse affect attributable to the disorder. “Treatment”, as used herein, covers any treatment of a disease in a mammal, particularly in a human, and includes: (a) increasing survival time; (b) decreasing the risk of death due to the disease; (c) inhibiting the disease, i.e., arresting its development or reducing the rate of disease progression; and (d) relieving the disease, i.e., causing regression of the disease.
- As used herein, a therapeutic that “inhibits” or “prevents” a disorder or condition is a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
- As used herein the terms “subject” and “patient” refer to animals including mammals, such as humans. The term “mammal” includes primates, domesticated animals including dogs, cats, sheep, cattle, horses, goats, pigs, mice, rats, rabbits, guinea pigs, captive animals such as zoo animals, and wild animals.
- As used herein the term “tissue” refers to an organ or set of specialized cells such as skin tissue, lung tissue, kidney tissue, and other types of cells.
- The term “therapeutic effect” is art-recognized and refers to a local or systemic effect in animals, particularly mammals, and more particularly humans caused by a pharmacologically active substance. The phrase “therapeutically effective amount” means that amount of such a substance that produces some desired local or systemic effect at a reasonable benefit/risk ratio applicable to any treatment. The therapeutically effective amount of such substance will vary depending upon the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration, which can readily be determined by one of ordinary skill in the art. For example, certain compositions described herein may be administered in a sufficient amount to produce a desired effect at a reasonable benefit/risk ratio applicable to such treatment.
- As used herein, the term “nucleic acid” refers to a polynucleotide such as deoxyribonucleic acid (DNA), and, where appropriate, ribonucleic acid (RNA). The term should also be understood to include, as equivalents, analogs of either RNA or DNA made from nucleotide analogs, and, as applicable to the embodiment being described, single-stranded (such as sense or antisense) and double-stranded polynucleotide.
- The terms “peptides”, “proteins” and “polypeptides” are used interchangeably herein. The term “purified protein” refers to a preparation of a protein or proteins that are preferably isolated from, or otherwise substantially free of, other proteins normally associated with the protein(s) in a cell or cell lysate. The term “substantially free of other cellular proteins” or “substantially free of other contaminating proteins” is defined as encompassing individual preparations of each of the proteins comprising less than 20% (by dry weight) contaminating protein, and preferably comprises less than 5% contaminating protein. Functional forms of each of the proteins can be prepared as purified preparations by using a cloned gene as is well known in the art. By “purified”, it is meant that the indicated molecule is present in the substantial absence of other biological macromolecules, such as other proteins (particularly other proteins which may substantially mask, diminish, confuse or alter the characteristics of the component proteins either as purified preparations or in their function in the subject reconstituted mixture). The term “purified” as used herein preferably means at least 80% by dry weight, more preferably in the range of 85% by weight, more preferably 95-99% by weight, and most preferably at least 99.8% by weight, of biological macromolecules of the same type present (but water, buffers, and other small molecules, especially molecules having a molecular weight of less than 5000, can be present). The term “pure” as used herein preferably has the same numerical limits as “purified” immediately above.
- “N-linked” oligosaccharides are those oligosaccharides that are linked to a peptide backbone through asparagine, by way of an asparagine-N-acetylglucosamine linkage. N-linked oligosaccharides are also called “N-glycans.” Naturally occurring N-linked oligosaccharides have a common pentasaccharide core of Man[(α1,6-)-(Man(a1,3)]-Man(β1,4)-GlcNAc(β1,4)-GlcNAc(β1,N). They differ in the presence of, and in the number of branches (also called antennae) of peripheral sugars such as N-acetylglucosamine, galactose, N-acetylgalactosamine, fucose, and sialic acid. Optionally, this structure may also contain a core fucose molecule and/or a xylose molecule.
- The term “sialic acid” refers to any member of a family of nine-carbon carboxylated sugars. The most common member of the sialic acid family is N-acetyl-neuraminic acid (often abbreviated as Neu5Ac, NeuAc, or NANA). A second member of the family is N-glycolyl-neuraminic acid (Neu5Gc or NeuGc), in which the N-acetyl group of NeuAc is hydroxylated. A third sialic acid family member is 2-keto-3-deoxy-nonulosonic acid (KDN) (Nadano et al. (1986) J. Biol. Chem. 261: 11550-11557; Kanamori et al., J. Biol. Chem. 265: 21811-21819 (1990)). Also included are 9-substituted sialic acids such as a 9-O-C1C6-acyl-Neu5Ac like 9-O-lactyl-Neu5Ac or 9-O-acetyl-Neu5Ac, 9-deoxy-9-fluoro-Neu5Ac and 9-azido-9-deoxy-Neu5Ac. For review of the sialic acid family, see, e.g., Varki, Glycobiology 2: 25-40 (1992); Sialic Acids: Chemistry, Metabolism and Function, R. Schauer, Ed. (Springer-Verlag, New York (1992)).
- A “genetically engineered” or “recombinant” cell is a cell having one or more modifications to the genetic material of the cell. Such modifications include, but are not limited to, insertions of genetic material, deletions of genetic material and insertion of genetic material that is extrachromosomal whether such material is stably maintained or not.
- As used herein, the term “modified sugar,” refers to a naturally- or non-naturally-occurring carbohydrate that is enzymatically added onto an amino acid or a glycosyl residue of a peptide in a process of the invention. The modified sugar is selected from a number of enzyme substrates including, but not limited to, sugar nucleotides (mono-, di-, and tri-phosphates), activated sugars (e.g., glycosyl halides, glycosyl mesylates) and sugars that are neither activated nor nucleotides. A “modified sugar” maybe covalently functionalized with a “modifying group.” Useful modifying groups include, but are not limited to, water-soluble and -insoluble polymers, therapeutic moieties, diagnostic moieties, biomolecules. The locus of functionalization with the modifying group is selected such that it does not prevent the “modified sugar” from being added enzymatically to a peptide or glycosyl residue of the peptide.
- In part, the disclosure provides variant Serum Amyloid P (SAP) polypeptides. In particular, SAP variants of the invention include glycosylated human SAP polypeptides that comprise one or more N-linked or O-linked oligosaccharide chains each independently having one, two, three, four, five or more branches terminating with an α2,3-linked sialic acid moiety. In some embodiments, all the branches of the N-linked or O-linked oligosaccharide chains terminate in α2,3-linked moieties. Other SAP variants of the invention include glycosylated human SAP polypeptides that contain an N-linked or O-linked oligosaccharide chains having at least 20%, 25%, 30%, 35% 40%, 45%, 50%, 55%, 60%, 65% 75%, 80%, 85%, or even at least 95% fewer α2,6-linked sialic acid moieties than a wild-type SAP polypeptide derived from human serum. In some embodiments, the N-linked or O-linked oligosaccharide chains are substantially free of α2,6-linked sialic acid moieties, e.g., having less than 80%, 85%, 90%, 95%, 97%, 98% or even less than 99% α2,6-linked sialic acid moieties relative to a wild-type SAP polypeptide derived from human serum). Glycovariant SAP polypeptides of the invention may comprise an N-linked oligosaccharide or O-linked chain having one or more branches (e.g., having a bi-antennary, tri-antennary, tetra-antennary, penta-antennary, etc. structure). In certain embodiments, SAP polypeptides of the invention comprise an N-linked or O-linked oligosaccharide chain wherein one, two, three, four, or five branches of the oligosaccharide chain are substantially free of galactose and N-acetylglucosamine (e.g., having less than 80%, 85%, 90%, 95%, 97%, 98% or even less than 99% N-acetylglucosamine relative to a wild-type SAP polypeptide derived from human serum). Certain SAP polypeptides of the invention have N-linked or O-linked oligosaccharide chains that are substantially free of galactose and N-acetylglucosamine (e.g., having less than 80%, 85%, 90%, 95%, 97%, 98% or even less than 99% galactose and/or N-acetylglucosamine relative to a wild-type SAP polypeptide derived from human serum). In some embodiments, SAP polypeptides of the invention comprise an N-linked or O-linked oligosaccharide chain wherein one, two, three, four, or five branches of the oligosaccharide chain contain one or more mannose residues. In certain embodiments, the SAP polypeptide of the invention comprises an N-linked oligosaccharide having a pentasaccharide core of Man[(α1,6-)-(Man(α1,3)]-Man(β1,4)-GlcNAc(β1,4)-GlcNAc(β1,N)-Asn. This pentasaccharide core also may comprise one or more fucose or xylose residues. In certain embodiments, SAP polypeptides of the invention comprise an N-linked oligosaccharide chain wherein one, two, three, four, or five branches of the oligosaccharide chain have the structure NeuNAc2α3Galβ34GlcNAcβ32Mana6. SAP polypeptides of the invention also may comprise an N-linked oligosaccharide chain wherein all branches have the structure NeuNAc2α3Galβ34G1cNAcβ32Manα6.
- Variant SAP polypeptides of the invention may comprise one or more “modified” sugar residues. Modified sugars are substituted at any position that allows for the attachment of the modifying moiety or group. In preferred aspects, modified sugar is substituted at a position that still allows the sugar to function as a substrate for an enzyme used to couple the modified sugar to the SAP peptide. A modifying group can be attached to a sugar moiety by enzymatic means, chemical means or a combination thereof, thereby producing a modified sugar, e.g., modified galactose, fucose, or sialic acid. Modifying groups suitable for use in the present invention as well as methods for conjugating these modifying groups to sugar residues are described in the following section.
- In preferred aspects, variant SAP polypeptides of the invention have an IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than one-half that of a corresponding sample of wild-type SAP isolated from human serum. In some embodiments, variant SAP polypeptides of the invention have an IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than ⅓, less than ¼, less than 1/10, or less than 1/100 that of a corresponding sample of wild-type SAP isolated from human serum.
- Variant SAP polypeptides of the invention may be at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the amino acid sequence of SEQ ID NO: 1, as determined using the FASTDB computer program based on the algorithm of Brutlag et al. (Comp. App. Biosci., 6:237-245 (1990)). In a specific embodiment, parameters employed to calculate percent identity and similarity of an amino acid alignment comprise: Matrix=PAM 150, k-tuple=2, Mismatch Penalty=1, Joining Penalty=20, Randomization Group Length=0, Cutoff Score=1, Gap Penalty=5 and Gap Size Penalty=0.05.
- The term “SAP polypeptide” encompasses functional fragments and fusion proteins comprising any of the preceding. Generally, an SAP polypeptide will be designed to be soluble in aqueous solutions at biologically relevant temperatures, pH levels and osmolarity. The SAP protomers that non-covalently associate together to form a pentameric SAP complex may have identical amino acid sequences and/or post-translational modifications or, alternatively, individual SAP protomers within a single complex may have different sequences and/or modifications. The term SAP polypeptide includes polypeptides comprising any naturally occurring SAP polypeptide as well as any variant thereof (including mutants, fragments, and fusions). A SAP polypeptide of the invention may be a recombinant polypeptide. In preferred embodiments, the SAP polypeptide of the invention is a human SAP polypeptide.
- In some embodiments, pharmaceutical compositions are provided comprising a variant SAP polypeptide of the invention, or a functional fragment thereof In some aspects, the amino acid sequence of a SAP variant may differ from SEQ ID NO: 1 by one or more conservative or non-conservative substitutions. As used herein, “conservative substitutions” are residues that are physically or functionally similar to the corresponding reference residues, i.e., a conservative substitution and its reference residue have similar size, shape, electric charge, and/or chemical properties (e.g., the ability to form covalent or hydrogen bonds). Preferred conservative substitutions are those fulfilling the criteria defined for an accepted point mutation in Dayhoff et al., Atlas of Protein Sequence and Structure 5:345-352 (1978 & Supp.). Examples of conservative substitutions are substitutions within the following groups: (a) valine, glycine; (b) glycine, alanine; (c) valine, isoleucine, leucine; (d) aspartic acid, glutamic acid; (e) asparagine, glutamine; (f) serine, threonine; (g) lysine, arginine, methionine; and (h) phenylalanine, tyrosine. Additional guidance concerning which amino acid changes are likely to be phenotypically silent can be found in Bowie et al., Science 247:1306-1310 (1990).
- Variant SAP polypeptides and fragments thereof that retain biological function are useful in the pharmaceutical compositions and methods described herein. In some embodiments, a variant SAP polypeptide or fragment thereof binds FcγRI, FcγRIIA, and/or FcγRIIIB In some embodiments, a variant SAP polypeptide or fragment thereof inhibits one or more of fibrocyte, fibrocyte precursor, myofibroblast precursor, and/or hematopoietic monocyte precursor differentiation. SAP variants may be generated by modifying the structure of an SAP polypeptide for such purposes as enhancing therapeutic efficacy or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
- In certain aspects, the variant SAP polypeptides of the disclosure may further comprise post-translational modifications in addition to any that are naturally present in the SAP polypeptide. Such modifications include, but are not limited to, acetylation, carboxylation, glycosylation (e.g., O-linked oligosaccharides, N-linked oligosaccharides, etc.), phosphorylation, and lipidation. As a result, the modified SAP polypeptide may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharides, and phosphates.
- In certain aspects, one or more modifications to the SAP polypeptide described herein may enhance the stability of the SAP polypeptide. For example, such modifications may enhance the in vivo half-life of the SAP polypeptide or reduce proteolytic degradation of the SAP polypeptide.
- In certain aspects, variant SAP polypeptides of the invention include fusion proteins having at least a portion of the human SAP polypeptide and one or more fusion domains or heterologous portions. Well known examples of such fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, and immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), or human serum albumin. A fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography. For the purpose of affinity purification, relevant matrices for affinity chromatography, such as glutathione-, amylase-, and nickel-, or cobalt-conjugated resins are used. As another example, a fusion domain may be selected so as to facilitate detection of the SAP polypeptides. Examples of such detection domains include the various fluorescent protein (e.g., GFP) as well as “epitope tags,” which are usually short peptide sequences for which a specific antibody is available. Well known epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus hemagglutinin (HA) and c-myc tags. In some cases, the fusion domains have a protease cleavage site that allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant protein therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation. In some cases, the SAP polypeptide may be fused to a heterologous domain that stabilizes the SAP polypeptide in vivo. By “stabilizing” is meant anything that increases serum half-life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect. Fusions with the Fc portion of an immunoglobulin and serum albumin are known to confer increased stability.
- It is understood that different elements of the fusion proteins may be arranged in any manner that is consistent with the desired functionality. For example, an SAP polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to an SAP polypeptide. The SAP polypeptide and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences (e.g., linker sequences) may be included C- or N-terminal to either domain or between the domains.
- Described herein are methods of producing variant human SAP polypeptides. The methods generally involve a step of contacting an SAP polypeptide with one or more chemical or enzymatic agents to produce or modify a glycosylation structure on the SAP polypeptide. The methods can be cell-based or non-cell based.
- Enzymes useful for producing or modifying glycan structures are well known in the art. Most enzymes/proteins useful in the methods of the disclosure can be categorized into one of two functional classes: glycosyltransferases and glycosidases. Glycosyltransferases (e.g., N- acetylglucosaminyl-transferases, galactosyl-transferases, fucosyl-transferases, sialyl-transferases, glucosyl-transferases, mannosyl-transferases, etc.), as used herein, refers to any enzyme/protein that has the ability to transfer a donor sugar to an acceptor moiety. Glycosidases (e.g., glucosidases, mannosidases, N-acetylglucosaminidases, sialidases, fucosidases, etc.), as used herein, refers to any enzyme/protein that has the ability to catalyze the hydrolysis of the glycosidic linkage between sugar moieties.
- Cell-based methods for producing altered glyco-forms of an SAP polypeptide use either wild-type (e.g., CHO cells) or genetically engineered cells that have at least one modified glycosylation activity relative to a human cell. Cells suitable for the methods of the disclosure include, for example, fungal cells, prokaryotic cell (i.e., bacteria, Archaea) plant cells, or animal cells (e.g., nematode, insect, plant, bird, reptile, or mammal (e.g., a mouse, rat, rabbit, hamster, gerbil, dog, cat, goat, pig, cow, horse, whale, monkey, or human)). The cells can be primary cells, immortalized cells, or transformed cells. Such cells can be obtained from a variety of commercial sources and research resource facilities, e.g., the American Type Culture Collection (Rockville, Md.). In certain aspects, the cell used for producing a variant SAP polypeptide is a CHO cell.
- The term “glycosylation activity” refers to any activity that is (i) capable of adding N-linked or O-linked glycans to a target molecule (i.e., an oligosaccharyl-transferase activity); (ii) removing N-linked or O-linked glycans from a target molecule; (iii) modifying one or more N-linked or O-linked glycans on a target molecule; (iv) modifying dolichol-linked oligosaccharides; (v) capable of aiding the activity of one or more of the activities under i-iv. Accordingly, glycosylation activity includes, for example, glycosidase activity, glycosyltransferase activity, sugar nucleotide synthesis, modification, or transporter activity. Modification of one or more N-linked or O-linked glycans on a target molecule includes the action of a mannosylphosphoryl-transferase activity, a kinase activity, or a phosphatase activity, e.g., a mannosylphosphoryl-transferase, a kinase, or a phosphatase activity that alters the phosphorylation state of glycans on target molecules.
- Engineered cells useful in the methods of the disclosure may have one or more genetic modifications including, but not limited to: (i) deletion of an endogenous gene encoding a protein having glycosylation activity; (ii) introduction of a recombinant nucleic acid encoding a mutant form of a protein (e.g., endogenous or exogenous protein) having an glycosylation activity; (iii) introduction or expression of an RNA molecule that interferes with the functional expression of a protein having the glycosylation activity; (iv) introduction of a recombinant nucleic acid encoding a wild-type (e.g., endogenous or exogenous) protein having glycosylation activity; or (v) altering the promoter or enhancer elements of one or more endogenous genes encoding proteins having glycosylation activity to thus alter the expression of the encoded proteins. RNA molecules described above include, for example, small-interfering RNA (siRNA), short hairpin RNA (shRNA), anti-sense RNA, or micro RNA (miRNA). It is understood that item (ii) includes, for example, replacement of an endogenous gene (e.g., by homologous recombination) with a gene encoding a protein having greater glycosylation activity relative to the endogenous gene so replaced.
- The genetically engineered cells described herein have one or more altered glycosylation activities such as: (i) an increase in one or more glycosylation activities in the genetically modified cell, (ii) a decrease in one or more glycosylation activities in the genetically modified cell, (iii) a change in the localization or intracellular distribution of one or more glycosylation activities in the genetically modified cell, or (iv) a change in the ratio of one or more glycosylation activities in the genetically modified cell relative to an unmodified cell of the same origin. It is understood that an increase in the amount of glycosylation activity can be due to overexpression of one or more proteins having glycosylation activity, an increase in copy number of an endogenous gene (e.g., gene duplication), or an alteration in the promoter, enhancer, or suppressor of an endogenous gene that stimulates an increase in expression of the protein encoded by the gene. A decrease in one or more glycosylation activities can be due to overexpression of a mutant form (e.g., a dominant negative form) of one or more proteins having glycosylation -altering activities, introduction or expression of one or more interfering RNA molecules that reduce the expression of one or more proteins having an glycosylation activity, or deletion of one or more endogenous genes that encode a protein having glycosylation activity.
- Genetically engineered cells used by the methods of the disclosure can express (e.g., overexpress) wild-type or mutant genes encoding proteins having glycosylation activity. Such genes include, but are not limited to, ALG7, ALG13, ALG14, ALG1, ALG2, ALG11, RFT1, ALG3, ALG9, ALG12, ALG6, ALG8, ANL1, ALG10, ALG5, OST3, OST4, OST6, STT3, OST1, OST5, WBP1, SWP1, OST2, DPM1, SEC59, OCH1, MNN9, VAN1, MNN8, MNN10, MNN11, HOC1, MNN2, MNN5, MNN6, KTR1, YUR1, MNN4, KRE2, KTR2, KTR3, MNN1, MNS1, MNN4, PNO1, MNN9, glucosidase I, glucosidase II, or endomannosidase. Genes encoding proteins having glycosylation activity can be from any species (e.g., lower eukaryotes (e.g., fungus (including yeasts) or trypanosomes), prokaryotes (i.e., bacteria or Archaea), plant, or animal (e.g., insect, bird, reptile, or mammal, such as mouse or rat, dog, cat, horse, goat, cow, pig, non-human primate, or human). It is understood that genetically engineered cells used for the methods of the disclosure can express any number of genes (e.g., genes encoding proteins having glycosylation activity) and/or any combination of one or more (e.g., 2, 3, 4, 5,6, 7, 8, 9 10, 11, 12, 15, or 20 or more) of any of the genes recited herein. In addition, any genetically engineered cells used by the methods of the disclosure may comprise any number of mutations that alter or abrogate one or more glycosylation activities.
- In some embodiments, the term “gene expression” or “expression” refers to the cellular processes by which a biologically active polypeptide is produced from a DNA sequence and exhibits a biological activity in a cell. As such, gene expression involves the processes of transcription and translation, but also involves post-transcriptional and post-translational processes that can influence a biological activity of a gene or gene product. These processes include, but are not limited to, RNA syntheses, processing, and transport, as well as polypeptide synthesis, transport, and post-translational modification of polypeptides.
- For example, the disclosure provides methods for making an SAP polypeptide of the invention by expressing a SAP gene in a cell. In some embodiments, the cell may contain an endogenous SAP gene or fragment thereof. In other embodiments, a polynucleotide coding for an exogenous SAP polypeptide or fragment thereof may be introduced (e.g., transformed, transfected, etc.) into a cell. Suitable SAP polynucleotides that can be introduced into a cell include nucleic acid fragments as well as nucleic acid constructs or expression vectors. In preferred embodiments, the endogenous or exogenous gene encodes a human SAP polypeptide.
- In some embodiments, the nucleic acid fragment, e.g., encoding a human SAP polypeptide, used to transform the host cell may include a Shine-Dalgarno site (e.g., a ribosome binding site) and a start site (e.g., the codon ATG) to initiate translation of the transcribed message to produce the enzyme. It may, also include a termination sequence to end translation. A termination sequence is typically a codon for which there exists no corresponding aminoacetyl-tRNA, thus ending polypeptide synthesis. In some embodiments, a nucleic acid construct encoding an SAP polypeptide can be delivered, for example, as an expression plasmid that, when transcribed in the cell, produces as SAP polypeptide.
- In some embodiments, a suitable expression vector comprises a nucleotide sequence encoding an SAP polypeptide of the invention operably linked to at least one regulatory sequence. Regulatory sequences are art-recognized and are selected to direct expression of any of the polypeptides of the disclosure. Accordingly, the term regulatory sequence includes promoters, enhancers and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, Calif. (1990). For instance, any expression control sequence that regulates the expression of a DNA sequence when operatively linked to it may be used in these vectors to express any of the polypeptides of the disclosure. Such useful expression control sequences, include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast a-mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof. It should be understood that the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
- In some embodiments, the nucleic acid fragment or expression system used to transform the host cell optionally may include one or more marker sequences. Generally speaking, suitable marker sequences typically encode a gene product, usually an enzyme that inactivates or otherwise detects or is detected by a compound in the growth medium. For example, the inclusion of a marker sequence may render the transformed cell resistant to an antibiotic, or it may confer compound-specific metabolism on the transformed cell. Examples of suitable marker sequences that confer resistance include kanamycin, ampicillin, chloramphenicol and tetracycline. Alternatively, rather than selective pressure, a marker gene may be used that allows for detection of particular colonies containing the gene, such as β-galactosidase, where a substrate is employed that provides for a colored product.
- A variety of methods are suitable for transforming a cell of the present invention with a nucleic acid fragment or expression vector. Common transformation methods include electroporation, liposomal-mediated transformation, calcium-mediated transformation, and viral-mediated transfection.
- In certain aspects, when a host cell is transformed with a nucleic acid fragment or expression system of the present invention, the gene (e.g., human SAP) in said system can be integrated into the chromosomal DNA of the host cells by a so-called homologous recombination and the expression system will be carried stably in the host.
- In order to integrate the expression system in the vector into chromosomal DNA of the host cells, an appropriate selection marker gene may be used wherein said marker gene has a sequence homologous to the gene on chromosomal DNA of the specific host cell. Selection markers for such a purpose can be easily selected by a skilled person. As an example, a preferred marker is a gene that exists on a chromosome and relates to the metabolism of the host cells. Namely, it is preferred to use a host which has been modified in such a manner that the above-mentioned gene on the chromosome will be inactivated by an appropriate means such as a mutation. The host can then be subjected to a homologous recombination with an expression vector containing the corresponding intact gene, whereupon only transformants which contain the normal metabolism gene can grow to be selected. Therefore, if such a marker gene has been introduced to the expression vector, a homologous recombination will take place between the marker gene in said expression vector and the corresponding portion of the chromosomal DNA, whereby the expression cassette of the heterologous gene will simultaneously be integrated into the chromosomal DNA.
- In some embodiments, the term “expressing” a protein in a cell also includes methods of introducing a protein itself into cells. Therefore, in certain aspects, the disclosure provides methods for making an SAP polypeptide of the invention by introducing an SAP polypeptide into a cell. Techniques for introducing polypeptides directly into a cell are known in the art and generally involve a process of cell membrane permeation. Such techniques include, but are not limited to, microinjection of SAP polypeptides; encapsulating an SAP polypeptide within membrane vesicles (e.g., liposomes, capsular bodies, erythrocyte ghosts, protoplasts, etc.) and contacting them with a cell membrane to thereby cause intracellular introduction of the SAP polypeptide by fusion; using physical methods (e.g., mechanical, chemical, electrical, etc.) that rely on macromolcules entering cells by diffusion through holes transiently introduced in their plasma membranes (e.g., scrape-loading, bead-loading, etc.); and by uptake through natural endocytosis owing to cellular phagocytosis. A method of intracellular introduction may utilize a receptor-mediated pathway, wherein one of various receptors expressed on the cell surface is set as a target and an SAP polypeptide is attached (covalently or non-covalently) to the cognate ligand that acts as a carrier moiety. Several methods have been described for introducing proteins into living cells using electrostatic adsorption, wherein the protein is first cationized and then contacted with the negatively charged surface of a cell (See Japanese Patent Publication No. 2004/049214).
- In certain aspects, the disclosure provides CHO cells that express a SAP polypeptide. In some embodiments, the CHO cell expresses an exogenous SAP polypeptide. In preferred embodiments, the CHO cell expresses a human SAP polypeptide. In some embodiments, the disclosure provides CHO cells comprising a polynucleotide sequence encoding an SAP polypeptide. In preferred embodiments, the polynucleotide sequence encodes a human SAP polypeptide. Any of the aforementioned techniques may be used to “express” an SAP polypeptide of the invention in a CHO cell or any other suitable cell disclosed herein.
- Where any of the glycosylation activities of the wild-type or genetically engineered cell are inducible or conditional on the presence of an inducing cue (e.g., a chemical or physical cue), the wild-type or genetically engineered cell can, optionally, be cultured in the presence of an inducing agent before, during, or subsequent to the introduction of the nucleic acid encoding a SAP polypeptide or a SAP polypeptide. For example, following introduction of the SAP polypeptide into the cell can be exposed to a chemical inducing agent that is capable of promoting the expression of one or more proteins having a wild-type or altered N-glycosylation activity. Where multiple inducing cues induce conditional expression of one or more proteins having wild-type and/or altered N-glycosylation activity, a cell can be contacted with multiple inducing agents. In some embodiments, the culture medium may be modified to produce the desired glycan structure on the SAP polypeptide. For example, the serum, glucose, and/or lipid (e.g., dolichol) concentration of the medium may be modified for optimal production of the desired SAP glycovariant. In some embodiments, the temperature, pH, and/or osmolarity of culture medium may be altered for optimal production of the desired SAP glycovariant.
- A variant SAP polypeptide of the invention can be further processed in vivo or can be processed in vitro prior to or following isolation from the cell or cell medium. The further processing can include modification of one or more glycan residues of the SAP polypeptide or modification to the SAP polypeptide other than to its glycan structure(s). In some embodiments, the additional processing of the SAP polypeptide can include the addition (covalent or non-covalent joining) of one or more heterologous moieties. In some embodiments, the further processing involves enzymatic or chemical treatment of the SAP polypeptide. Enzymatic treatment can involve contacting the SAP polypeptide with one or more glycosidase, phosphodiesterase, phospholipase, glycosyltransferase, or protease for a time sufficient to induce the modification, addition, or deletion of glycan residues (e.g., galactose, mannose, fucose, sialic acid, xylose, N-acetylglucosamine, etc.) on the SAP polypeptide. Customization of an N-linked oligosaccharide chain may be accomplished by the sequential modification, addition, or deletion of the desired sugar moieties, using techniques well known in the art. Enzymatic cleavage of carbohydrate moieties on peptide variants can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al., 1987, Meth. Enzymol. 138:350. Exemplary methods of adding sugar moieties are disclosed in U.S. Pat. Nos. 5,876,980, 6,030,815, 5,728,554, and 5,922,577.
- In certain embodiments, modification of the SAP glycan structure requires the presence of one or more sugar nucleotides. Exemplary sugar nucleotides that are used in the present invention include nucleotide mono-, di- or triphosphates or analogs thereof In a preferred embodiment, the modified sugar nucleotide is selected from a UDP-glycoside, CMP-glycoside, or a GDP-glycoside. Even more preferably, the sugar nucleotide is selected from an UDP-galactose, UDP-galactosamine, UDP-glucose, UDP-glucosamine, GDP-mannose, GDP-fucose, CMP-sialic acid, CMP-N-glycolylneuraminic acid or CMP-NeuAc. In certain embodiments, a modified sugar nucleotide is utilized to add a modified sugar residue to the SAP polypeptide. N-acetylamine derivatives of the sugar nucleotides are also of use in the method of the invention.
- Chemical addition or removal of glycosyl moieties can be carried out by any suitable method. For example, chemical deglycosylation may involve exposure of the SAP polypeptide to trifluoromethanesulfonic acid, or another strong acid. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the peptide intact. Methods of chemical deglycosylation are described by Haldmuddin et al., 1987, Arch. Biochem. Biophys. 259: 52 and by Edge et al., 1981, Anal. Biochem. 118: 131. Chemical treatment can, for example, involve contacting the altered SAP polypeptide with an acid, such as hydrofluoric acid, for a time sufficient to induce modification of the SAP polypeptide. Hydrofluoric acid treatment, under certain conditions, specifically removes the mannose residues that are phosphodiester-linked to glycans, while leaving the phosphate on the glycan. An altered SAP polypeptide can be further processed by addition or removal of a phosphate group from one or more N-glycans. For example, an altered SAP polypeptide can be contacted with a mannosyl kinase or a mannosyl phosphatase.
- In certain aspects, it is desirable to modify only terminal sugar moieties on the SAP polypeptide glycan structure (N-linked or O-linked oligosaccharide). In some embodiments, one or more branches of the SAP glycan structure are modified by the addition, removal, substitution or modification of at least one terminal sialic acid residue. Suitable methods for modifying glycans described herein may be used to alter only the terminal sugar moiety on the SAP glycan structure. In some embodiments, a terminal sialic acid residue having an α2,6-linkage, α2,8-linkage, or α2,9-linkage is replaced with one or more terminal α2,3-linked sialic acid residue. In a particular aspect, human SAP comprising terminal α2,6-linked sialic residues is modified according to one of methods of the disclosure in order to replace one or more of the terminal α2,6-linked sialic residues with one or more α2,3-linked sialic acid residues. In some embodiments, a terminal α2,3-linked sialic acid residue is modified to add one or more α2,6-linked, α2,8-linked, and/or α2,9-linked sialic acid residues.
- In certain aspects, the process of making an SAP polypeptide of the invention involves a first step of deglycosylating the SAP polypeptide. The SAP polypeptide may be partially or fully deglycosylated. In some embodiments, the first step of deglycosylation involves removing only terminal sugar moieties from at least one branch of the glycan structure on the SAP polypeptide. In some embodiments, the first step of deglycosylation removes at least one α2,6-linked sialic acid residue. In some embodiments, the first step of deglycosylation removes at least one O-linked glycan. In some embodiments, the first step of deglycosylation removes at least one N-linked glycan. In some embodiments, the first step of deglycosylation removes all O-linked and N-linked glycans. In some embodiments, a deglycosylated SAP polypeptide (partially or fully) is further processed according to the methods of the disclosure, which includes but is not limited to, enzymatically or chemically modifying the partially or fully deglycosylated SAP polypeptide, introducing the partially or fully deglycosylated SAP polypeptide into a cell, or combination thereof, wherein the method(s) produce a variant SAP polypeptide of the invention. In some embodiments, after a partially or fully deglycosylated SAP polypeptide has been introduced into a cell, it may be further modified, in vivo or in vitro, according to the methods of the disclosure to produce a variant SAP polypeptide of the invention. Similarly, a partial or fully deglycosylated SAP polypeptide that is modified in vitro, using enzymatic or chemical methods described herein, may be introduced into a cell to produce a variant SAP polypeptide of the invention.
- It is understood that an SAP polypeptide of the invention can be, but need not be, processed in a cell. For example, the disclosure also provides cell-free methods of producing a variant SAP polypeptide of the invention. In some aspects the cell-free methods include the step of contacting an SAP polypeptide, under glycosylation conditions, with a cell lysate prepared from a wild-type cell (e.g., a fungal cell, a plant cell, or an animal cell) or genetically engineered cell having at least one modified glycosylation activity, wherein contacting the SAP polypeptide with the cell lysate attaches an N-linked or O-linked oligosaccharide to the SAP polypeptide or modifies an existing N-linked or O-linked oligosaccharide on the SAP polypeptide. By “N-glycosylation conditions” is meant that a mixture (e.g., of SAP polypeptide and cell lysate) is incubated under conditions that allow for the desired altered N-glycosylation.
- Suitable methods for obtaining cell lysates that preserve the activity or integrity of one or more glycosylation activities in the lysate can include the use of appropriate buffers and/or inhibitors, including nuclease, protease and phosphatase inhibitors that preserve or minimize changes in N-glycosylation activities in the cell lysate. Such inhibitors include, for example, chelators such as ethylenediaminetetraacetic acid (EDTA), ethylene glycol bis(P-aminoethyl ether) N,N,N1,N1-tetraacetic acid (EGTA), protease inhibitors such as phenylmethylsulfonyl fluoride (PMSF), aprotinin, leupeptin, antipain, and phosphatase inhibitors such as phosphate, sodium fluoride, and vanadate. Inhibitors can be chosen such that they do not interfere with or only minimally adversely affect the N-glycosylation activity, or activities, of interest. Appropriate buffers and conditions for obtaining lysates containing enzymatic activities are described in, e.g., Ausubel et al. Current Protocols in Molecular Biology (Supplement 47), John Wiley & Sons, New York (1999); Harlow and Lane, Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory Press (1988); Harlow and Lane, Using Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1999); Tietz Textbook of Clinical Chemistry, 3rd ed. Burtis and Ashwood, eds. W. B. Saunders, Philadelphia, (1999).
- A cell lysate can be further processed to eliminate or minimize the presence of interfering substances, as appropriate. If desired, a cell lysate can be fractionated by any of a variety of methods well known to those skilled in the art, including subcellular fractionation, and chromatographic techniques such as ion exchange, hydrophobic and reverse phase, size exclusion, affinity, and hydrophobic charge-induction chromatography (see, e.g., Scopes, Protein Purification: Principles and Practice, third edition, Springer-Verlag, New York (1993); Burton and Harding, J. Chromatogr. A 814:71-81 (1998)), or any other suitable purification technique.
- A cell lysate can be prepared in which whole cellular organelles remain intact and/or functional. For example, a lysate can contain one or more of intact rough endoplasmic reticulum, intact smooth endoplasmic reticulum, or intact Golgi apparatus. Suitable methods for preparing lysates containing intact cellular organelles and testing for the functionality of the organelles are described in, e.g., Moreau et al. (1991) J. Biol. Chem. 266(7):4329-4333; Moreau et al. (1991) J. Biol. Chem. 266(7):4322-4328; Rexach et al. (1991) J. Cell Biol. 114(2):219-229; and Paulik et al. (1999) Arch. Biochem. Biophys. 367(2):265-273; the disclosures of each of which are incorporated herein by reference in their entirety.
- The SAP polypeptide can be contacted with just one purified protein having glycosylation activity. In some embodiments, the SAP polypeptide can be contacted with more than one purified proteins having glycosylation activity. One or more proteins having glycosylation activity can be purified using standard protein isolation techniques. An SAP polypeptide can be contacted with one or more proteins in a suitable buffer for a time sufficient to induce modification of the SAP polypeptides as described above. The SAP polypeptide can be contacted with more than one protein at the same time or sequentially. Where the SAP polypeptide is contacted sequentially to more than one protein having glycosylation activity, the SAP polypeptide can, but need not, be purified after one or more steps. That is, an SAP polypeptide can be contacted with protein activity “A” and then purified before contacting the molecule to protein activity “B”. Methods of modifying peptides as such are known in the art, e.g., Lee and Park (2002) 30(6):716-720 and Fujita and Takegawa (2001) Biochem. Biophys. Res. Commun. 282(3):678-682, the disclosures of which are incorporated herein by reference in their entirety.
- In certain aspects, the methods of the disclosure comprise a step of isolating an SAP polypeptide, e.g., from a cell or from components of a cell lysate. Many standard techniques for protein isolation are known in the art. For example, methods of isolating polypeptides include, but are not limited to, size-exclusion chromatography, reverse-phase chromatography, liquid chromatography (e.g., HPLC), affinity chromatography (e.g., metal chelation or immunoaffinity chromatography), ion-exchange chromatography, hydrophobic-interaction chromatography, precipitation, differential solubilization, immunoprecipitation, centrifugation (e.g., ultracentrifugation, sucrose gradient centrifugation, etc.) or any combination thereof In some embodiments, the SAP polypeptide may be conjugated to an affinity tag to facilitate purification of the polypeptide. Suitable affinity tags for SAP purification include, but are not limited to, chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), streptavidin, biotin, and poly(His) tags. Affinity tags may be produced as part of the recombinant protein (i.e., as a fusion protein comprising a heterologous affinity tag domain and an SAP polypeptide domain) or attached (covalently or non-covalently) in vivo or in vitro to the SAP polypeptide. In some embodiments, multiple steps of purification can be used to isolate an SAP polypeptide. For example, an SAP polypeptide comprising a purification tag can be affinity-purified from a cell lysate or multi-component mixture using affinity purification. Then the affinity-purified SAP polypeptide can be further purified to remove any minor unwanted contaminants by an additional purification step, e.g., size exclusion chromatography or RP-HPLC. Where a polypeptide of the invention is produced in a cell, the SAP polypeptide can be isolated from the cell itself or from the media in which cell was cultured. In some embodiments, SAP polypeptides of the invention are produced and secreted from a cell into the culture media. In these embodiments, isolation may comprise separation of the cellular fraction from the soluble, SAP-containing fraction (e.g., by centrifugation).
- In some aspects, it can be advantageous to link the SAP polypeptide to a solid-phase support prior to contacting the target molecule with one or more N-glycosylation activities. Such linkage can allow for easier purification following the N-glycosylation modifications. Suitable solid-phase supports include, but are not limited to, multi-well assay plates, particles (e.g., magnetic or encoded particles), a chromatography column, or a membrane.
- In some embodiments, any of the altered SAP polypeptides described herein can be attached to a heterologous moiety using enzymatic or chemical means. A “heterologous moiety” refers to any constituent that is joined (e.g., covalently or non-covalently) to the altered target molecule, which constituent is different from a constituent originally present on the SAP polypeptide. Heterologous moieties include, for example, water-soluble and—insoluble polymers, targeting moieties, therapeutic moieties, diagnostic moieties, and biomolecules.
- SAP polypeptides of the invention may comprise one or more “modified” sugar residues. A modifying group can be attached to a sugar moiety by enzymatic means, chemical means or a combination thereof, thereby producing a modified sugar, e.g., modified galactose, fucose, or sialic acid. When a modified sialic acid is used, either a sialyl-transferase or a trans-sialidase can be used in these methods. The sugars may be substituted at any position that allows for the attachment of the modifying moiety, yet which still allows the sugar to function as a substrate for the enzyme used to couple the modified sugar to the peptide.
- In general, the sugar moiety and the modifying group are linked together through the use of reactive groups, which are typically transformed by the linking process into a new organic functional group or unreactive species. The sugar reactive functional group(s) may be located at any position on the sugar moiety. Reactive groups and classes of reactions useful in practicing the present invention are generally those that are well known in the art of bioconjugate chemistry. Currently favored classes of reactions available with reactive sugar moieties are those which proceed under relatively mild conditions. These include, but are not limited to nucleophilic substitutions (e.g., reactions of amines and alcohols with acyl halides, active esters), electrophilic substitutions (e.g., enamine reactions) and additions to carbon-carbon and carbon-heteroatom multiple bonds (e.g., Michael reaction, Diels-Alder addition). These and other useful reactions are discussed in, for example, Smith and March, Advanced Organic Chemistry, 5th Ed., John Wiley & Sons, New York, 2001; Hermanson, Bioconjugate Techniques, Academic Press, San Diego, 1996; and Feeney et al., Modification of Proteins; Advances in Chemistry Series, Vol. 198, American Chemical Society, Washington, D.C., 1982.
- Useful reactive functional groups pendent from a sugar nucleus or modifying group include, but are not limited to: (a) carboxyl groups and various derivatives thereof (e.g., N-hydroxysuccinimide esters, N-hydroxybenzotriazole esters, acid halides, acyl imidazoles, thioesters, p-nitrophenyl esters, alkyl, alkenyl, alkynyl and aromatic esters); (b) hydroxyl groups, which can be converted to, e.g., esters, ethers, aldehydes, etc.; (c) haloalkyl groups, wherein the halide can be later displaced with a nucleophilic group such as, for example, an amine, a carboxylate anion, thiol anion, carbanion, or an alkoxide ion, thereby resulting in the covalent attachment of a new group at the functional group of the halogen atom; (d) dienophile groups, which are capable of participating in Diels-Alder reactions such as, for example, maleimido groups (e) aldehyde or ketone groups, such that subsequent derivatization is possible via formation of carbonyl derivatives such as, for example, imines, hydrazones, semicarbazones or oximes, or via such mechanisms as Grignard addition or alkyllithium addition; (f) sulfonyl halide groups for subsequent reaction with amines, for example, to form sulfonamides; (e) thiol groups, which can be, for example, converted to disulfides or reacted with alkyl and acyl halides; (h) amine or sulfhydryl groups, which can be, for example, acylated, alkylated or oxidized; (i) alkenes, which can undergo, for example, cycloadditions, acylation, Michael addition, metathesis, Heck reaction, etc.; (j) epoxides, which can react with, for example, amines and hydroxyl compounds.
- The reactive functional groups can be chosen such that they do not participate in, or interfere with, the reactions necessary to assemble the reactive sugar nucleus or modifying group. Alternatively, a reactive functional group can be protected from participating in the reaction by the presence of a protecting group. Those of skill in the art understand how to protect a particular functional group such that it does not interfere with a chosen set of reaction conditions. For examples of useful protecting groups, see, for example, Greene et al., Protective Groups in Organic Synthesis, John Wiley & Sons, New York, 1991.
- In some embodiments, the modified sugar is an activated sugar. Activated modified sugars useful in the present invention are typically glycosides which have been synthetically altered to include an activated leaving group. As used herein, the term “activated leaving group” refers to those moieties which are easily displaced in enzyme-regulated nucleophilic substitution reactions. Many activated sugars are known in the art. See, for example, Vocadlo et al., In Carbohydrate Chemistry and Biology, Vol. 2, Ernst et al. Ed., Wiley-VCH Verlag: Weinheim, Germany, 2000; Kodama et al., Tetrahedron Lett. 34: 6419 (1993); Lougheed, et al., J. Biol. Chem. 274: 37717 (1999)). Examples of such leaving groups include fluoro, chloro, bromo, tosylate, mesylate, triflate and the like. Preferred activated leaving groups for use in the present invention are those that do not significantly sterically encumber the enzymatic transfer of the glycoside to the acceptor. Accordingly, preferred embodiments of activated glycoside derivatives include glycosyl fluorides and glycosyl mesylates, with glycosyl fluorides being particularly preferred. Among the glycosyl fluorides, α-galactosyl fluoride, α-mannosyl fluoride, α-glucosyl fluoride, α-fucosyl fluoride, α-xylosyl fluoride, α-sialyl fluoride, α-N-acetylglucosaminyl fluoride, α-N-acetylglucosaminyl fluoride, β-galactosyl fluoride, β-mannosyl fluoride, .beta.-glucosyl fluoride, β-fucosyl fluoride, β-xylosyl fluoride, β-sialyl fluoride, β-N-acetylglucosaminyl fluoride and β-N-acetylgalactosaminyl fluoride are most preferred.
- In certain aspects, a modified sugar residue is conjugated to one or more water-soluble polymers. Many water-soluble polymers are known to those of skill in the art and are useful in practicing the present invention. The term water-soluble polymer encompasses species such as saccharides (e.g., dextran, amylose, hyaluronic acid, poly(sialic acid), heparans, heparins, etc.); poly(amino acids); nucleic acids; synthetic polymers (e.g., poly(acrylic acid), poly(ethers), e.g., poly(ethylene glycol)); peptides, proteins, and the like. The present invention may be practiced with any water-soluble polymer with the sole limitation that the polymer must include a point at which the remainder of the conjugate can be attached.
- Methods and chemistry for activation of water-soluble polymers and saccharides as well as methods for conjugating saccharides and polymers to various species are described in the literature. Commonly used methods for activation of polymers include activation of functional groups with cyanogen bromide, periodate, glutaraldehyde, bi-epoxides, epichlorohydrin, divinyl sulfone, carbodiimide, sulfonyl halides, trichlorotriazine, etc. (see, R. F. Taylor, (1991), Protein Immobilization, Fundamentals and Applications, Marcel Dekker, N.Y.; S. S. Wong, (1992), Chemistry of Protein Conjugation and Crosslinking, CRC Press, Boca Raton; G. T. Hermanson et al., (1993), Immobilized Affinity Ligand Techniques, Academic Press, N.Y.; Dunn, R. L., et al., Eds. Polymeric Drugs and Drug Delivery Systems, ACS Symposium Series Vol. 469, American Chemical Society, Washington, D.C. 1991).
- In certain aspects, a modified sugar residue is conjugated to one or more water-insoluble polymers. In some embodiments, conjugation to a water-insoluble polymer can be used to deliver a therapeutic peptide in a controlled manner. Polymeric drug delivery systems are known in the art. See, for example, Dunn et al., Eds. Polymeric drugs and Drug Delivery Systems, ACS Symposium Series Vol. 469, American Chemical Society, Washington, D.C. 1991. Those of skill in the art will appreciate that substantially any known drug delivery system is applicable to the conjugates of the present invention.
- Representative water-insoluble polymers include, but are not limited to, polyphosphazenes, poly(vinyl alcohols), polyamides, polycarbonates, polyalkylenes, polyacrylamides, polyalkylene glycols, polyalkylene oxides, polyalkylene terephthalates, polyvinyl ethers, polyvinyl esters, polyvinyl halides, polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyurethanes, poly(methyl methacrylate), poly(ethyl methacrylate), poly(butyl methacrylate), poly(isobutyl methacrylate), poly(hexyl methacrylate), poly(isodecyl methacrylate), poly(lauryl methacrylate), poly(phenyl methacrylate), poly(methyl acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate), poly(octadecyl acrylate) polyethylene, polypropylene, poly(ethylene glycol), poly(ethylene oxide), poly (ethylene terephthalate), poly(vinyl acetate), polyvinyl chloride, polystyrene, polyvinyl pyrrolidone, pluronics, and polyvinylphenol, and copolymers thereof.
- These and the other polymers discussed herein can be readily obtained from commercial sources such as Sigma Chemical Co. (St. Louis, Mo.), Polysciences (Warrenton, Pa.), Aldrich (Milwaukee, Wis.), Fluka (Ronkonkoma, N.Y.), and BioRad (Richmond, Calif.), or else synthesized from monomers obtained from these suppliers using standard techniques. Representative biodegradable polymers useful in the conjugates of the invention include, but are not limited to, polylactides, polyglycolides and copolymers thereof poly(ethylene terephthalate), poly(butyric acid), poly(valeric acid), poly(lactide-co-caprolactone), poly(lactide-co-glycolide), polyanhydrides, polyorthoesters, blends and copolymers thereof. Of particular use are compositions that form gels, such as those including collagen, and pluronics.
- In a preferred embodiment, one or more modified sugar residues are conjugated to one or more PEG molecules.
- In certain aspects, the modified sugar is conjugated to a biomolecule. Biomolecule of the invention may include, but are not limited to, functional proteins, enzymes, antigens, antibodies, peptides, nucleic acids (e.g., single nucleotides or nucleosides, oligonucleotides, polynucleotides and single- and higher-stranded nucleic acids), lectins, receptors or a combination thereof. Some preferred biomolecules are essentially non-fluorescent, or emit such a minimal amount of fluorescence that they are inappropriate for use as a fluorescent marker in an assay. Other biomolecules may be fluorescent.
- In some embodiments, the biomolecule is a targeting moiety. A “targeting moiety” and “targeting agent”, as used herein, refer to species that will selectively localize in a particular tissue or region of the body. In some embodiments, a biomolecule is selected to direct the SAP polypeptide of the invention to a specific intracellular compartment, thereby enhancing the delivery of the peptide to that intracellular compartment relative to the amount of underivatized peptide that is delivered to the tissue. The localization is mediated by specific recognition of molecular determinants, molecular size of the targeting agent or conjugate, ionic interactions, hydrophobic interactions and the like. Other mechanisms of targeting an agent to a particular tissue or region are known to those of still in the art.
- In some embodiments, the modified sugar includes a therapeutic moiety. Those of skill in the art will appreciate that there is overlap between the category of therapeutic moieties and biomolecules, i.e., many biomolecules have therapeutic properties or potential.
- Classes of useful therapeutic moieties include, for example, non-steroidal anti-inflammatory drugs; steroidal anti-inflammatory drugs; adjuvants; antihistaminic drugs; antitussive drugs; antipruritic drugs; anticholinergic drugs; anti-emetic and antinauseant drugs; anorexic drugs; central stimulant drugs; antiarrhythmic drugs; β-adrenergic blocker drugs; cardiotonic drugs; antihypertensive drugs; diuretic drugs; vasodilator drugs; vasoconstrictor drugs; antiulcer drugs; anesthetic drugs; antidepressant drugs; tranquilizer and sedative drugs; antipsychotic drugs; and antimicrobial drugs.
- Other drug moieties useful in practicing the present invention include antineoplastic drugs, cytocidal agents, anti-estrogens, and antimetabolites. Also included within this class are radioisotope-based agents for both diagnosis (e.g., imaging) and therapy, and conjugated toxins.
- The therapeutic moiety can also be a hormone, a muscle relaxant, an antispasmodic, bone activating agent, endocrine modulating agent, modulator of diabetes, androgen, antidiuretics, or calcitonin drug.
- Other useful modifying groups include immunomodulating drugs, immunosuppressants, etc. Groups with anti-inflammatory activity, such as sulindac, etodolac, ketoprofen and ketorolac, are also of use. Other drugs of use in conjunction with the present invention will be apparent to those of skill in the art.
- The altered N-glycosylation SAP polypeptides produced by the methods of the disclosure can be homogeneous (i.e., the sample of SAP polypeptide is uniform in specific N-glycan structure) or substantially homogeneous. By “substantially homogeneous” is meant that at least about 25% (e.g., at least about 27%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least about 95%, or at least about 99%) of the SAP polypeptides contain the same specific N-glycan structure.
- In some embodiments, variant SAP polypeptides of the invention have an IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than ½, less than ⅓, less than ¼, less than 1/10, or less than 1/100 that of a corresponding sample of wild-type SAP isolated from human serum. There are many well characterized methods for determining the responsiveness of Peripheral Blood Mononuclear Cells (PBMCs) or monocyte cells to SAP for fibrocyte differentiation. These methods may be used to determine the relative potency of any of the SAP variant polypeptides of the invention in comparison to a sample of human serum-derived SAP, any other SAP variant polypeptide, or other fibrocyte suppressant or activating agent. PBMCs or monocytes suitable for use in these methods may be obtained from various tissue culture lines. Alternatively, suitable cells for fibrocyte differentiation assays may be obtained from any biological sample that contains PBMC or monocyte cells. The biological sample may be obtained from serum, plasma, healthy tissue, or fibrotic tissue. In general, fibrocyte differentiation assays are conducted by incubating PBMC or monocyte cells in media with various concentrations of a SAP polypeptide to determine the degree of fibrocyte differentiation. The concentration of SAP can range from 0.0001 μg/mL to 1 mg/ml, and in some embodiments is 0.001 μg/mL, 1.0 μg/mL, 5 μg/mL, 10 μg/mL, 15 μg/mL, 20 μg/mL, 25 μg/mL, 30 μg/mL, 35 μg/mL, 40 μg/mL, 45 μg/mL, 50 μg/mL, 100 μg/mL, 200 μg/mL, 300 μg/mL, or 500 μg/mL. In some assays, the media can be supplemented with between 1-100 ng/ml hMCSF; the preferred concentration of hMCSF being 25 ng/mL. The indication that PBMC and monocytes have differentiated into fibrocytes can be determined by one skilled in the art. In general, fibrocytes are morphologically defined as adherent cells with an elongated spindle-shape and the presence of an oval nucleus. In some assays, cells are fixed and stained with Hema 3 before enumerating fibrocytes by direct counting, e.g., using an inverted microscope. The amount of fibrocyte differentiation is interpreted by one skilled in the art as an indication of a cell's responsiveness to SAP. As indicated by the examples of the disclosure, a greater suppression of fibrocyte differentiation indicates a greater degree of SAP responsiveness. An alternative method of measuring fibrocyte differentiation involves determining the expression of fibrocyte-specific cell surface markers or secreted factors ,e.g., cytokines (e.g., IL-1ra, ENA-78/CXCL-5, PAI-1), fibronectin, collagen-1. Methods of detecting and/or quantifying cell surface markers or secreted factors are well known in the art, including but not limited to various ELISA- and FACS-based techniques using immunoreactive antibodies against one or more fibrocyte specific markers. As described in the examples of the disclosure, measuring the expression of Macrophage Derived Chemokine (MDC) is an effective method of determining fibrocyte differentiation.
- Methods for detecting and/or characterizing N-glycosylation (e.g., altered N-glycosylation) of a SAP polypeptide include DNA sequencer-assisted (DSA), fluorophore-assisted carbohydrate electrophoresis (FACE) or surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF MS). For example, an analysis can utilize DSA-FACE in which, for example, glycoproteins are denatured followed by immobilization on, e.g., a membrane. The glycoproteins can then be reduced with a suitable reducing agent such as dithiothreitol (DATA) or β-mercaptoethanol. The sulfhydryl groups of the proteins can be carboxylated using an acid such as iodoacetic acid. Next, the N-glycans can be released from the protein using an enzyme such as N-glycosidase F. N-glycans, optionally, can be reconstituted and derivatized by reductive amination. The derivatized N-glycans can then be concentrated. Instrumentation suitable for N-glycan analysis includes, for example, the ABI PRISM® 377 DNA sequencer (Applied Biosystems). Data analysis can be performed using, for example, GENESCAN®. 3.1 software (Applied Biosystems). Optionally, isolated mannoproteins can be further treated with one or more enzymes to confirm their N-glycan status. Exemplary enzymes include, for example, a-mannosidase or α-1,2 mannosidase,. Additional methods of N-glycan analysis include, for example, mass spectrometry (e.g., MALDI-TOF-MS), high-pressure liquid chromatography (HPLC) on normal phase, reversed phase and ion exchange chromatography (e.g., with pulsed amperometric detection when glycans are not labeled and with UV absorbance or fluorescence if glycans are appropriately labeled). See also Callewaert et al. (2001) Glycobiology 11(4):275-281 and Freire et al. (2006) Bioconjug. Chem. 17(2):559-564, the disclosures of each of which are incorporated herein by reference in their entirety.
- In one aspect, the disclosure provides methods for treating an SAP-responsive disorder in a patient by administering a therapeutically effective amount of a variant SAP polypeptide of the invention to a patient in need thereof. The dosage and frequency of treatment can be determined by one skilled in the art and will vary depending on the symptoms, age and body weight of the patient, and the nature and severity of the disorder to be treated or prevented. In some embodiments, a variant SAP polypeptide is administered to a patient once or twice per day, once or twice per week, once or twice per month, or just prior to or at the onset of symptoms.
- Dosages may be readily determined by techniques known to those of skill in the art or as taught herein. Toxicity and therapeutic efficacy of SAP may be determined by standard pharmaceutical procedures in experimental animals, for example, determining the LD50 and the ED50. The ED50 (Effective Dose 50) is the amount of drug required to produce a specified effect in 50% of an animal population. The LD50 (Lethal Dose 50) is the dose of drug which kills 50% of a sample population.
- In some embodiments, the SAP-responsive disorder is fibrosis. The use of SAP as a therapeutic treatment for fibrosis is described in U.S. Patent Application No. 2007/0243163, which is hereby incorporated by reference. Fibrosis related disorders that may be amenable to treatment with the subject method include, but are not limited to, collagen disease, interstitial lung disease, human fibrotic lung disease (e.g., obliterative bronchiolitis, idiopathic pulmonary fibrosis, pulmonary fibrosis from a known etiology, tumor stroma in lung disease, systemic sclerosis affecting the lungs, Hermansky-Pudlak syndrome, coal worker's pneumoconiosis, asbestosis, silicosis, chronic pulmonary hypertension, AIDS-associated pulmonary hypertension, sarcoidosis, moderate to severe asthma and the like), fibrotic vascular disease, arterial sclerosis, atherosclerosis, varicose veins, coronary infarcts, cerebral infarcts, myocardial fibrosis, musculoskeletal fibrosis, post-surgical adhesions, human kidney disease (e.g., nephritic syndrome, Alport syndrome, HIV-associated nephropathy, polycystic kidney disease, Fabry's disease, diabetic nephropathy, chronic glomerulonephritis, nephritis associated with systemic lupus, and the like), progressive systemic sclerosis (PSS), primary scalloping cholangitis (PSC), liver fibrosis, liver cirrhosis, renal fibrosis, pulmonary fibrosis, cystic fibrosis, chronic graft versus host disease, scleroderma (local and systemic), Grave's ophthalmopathy, diabetic retinopathy, glaucoma, Peyronie's disease, penis fibrosis, urethrostenosis after cystoscope, inner accretion after surgery, scarring, myelofibrosis, idiopathic retroperitoneal fibrosis, peritoneal fibrosis from a known etiology, drug-induced ergotism, fibrosis incident to benign or malignant cancer, fibrosis incident to microbial infection (e.g., viral, bacterial, parasitic, fungal, etc.), Alzheimer's disease, fibrosis incident to inflammatory bowel disease (including stricture formation in Crohn's disease and microscopic colitis), stromal cell tumors, mucositis, fibrosis induced by chemical or environmental insult (e.g., cancer chemotherapy, pesticides, or radiation (e.g., cancer radiotherapy)).
- In some embodiments, the fibrosis related disorder is selected from systemic or local scleroderma, keloids, hypertrophic scars, atherosclerosis, restenosis, pulmonary inflammation and fibrosis, idiopathic pulmonary fibrosis, liver cirrhosis, fibrosis as a result of chronic hepatitis B or C infection, kidney disease, heart disease resulting from scar tissue, macular degeneration, and retinal and vitreal retinopathy. In some embodiments, the fibrosis related disorder results from chemotherapeutic drugs, radiation-induced fibrosis, and injuries and burns. In some embodiments, the fibrosis-related disorder or condition results from post-surgical scarring, e.g., following trabeculectomy or other filtration surgery of the eye.
- In some embodiments, the SAP-responsive disorder is a hypersensitivity disorder such as those mediated by Th1 or Th2 responses. The use of SAP as a therapeutic treatment for hypersensitivity disorders is also described in U.S. Provisional Application No. 61/209,795, which is hereby incorporated by reference. Hypersensitivity related disorders that may be amenable to treatment with SAP include, but are not limited to, allergic rhinitis, allergic sinusitis, allergic conjunctivitis, allergic bronchoconstriction, allergic dyspnea, allergic increase in mucus production in the lungs, atopic eczema, dermatitis, urticaria, anaphylaxis, pneumonitis, and allergic-asthma.
- In some embodiments, a variant SAP polypeptide of the invention may be used to treat allergen-specific immune responses, such as anaphylaxis, to various antigens, including, but not limited to, antimicrobials (e.g., cephalosporins, sulfonamides, penicillin and other β-lactams), anticonvulsants (e.g., phenytoin, phenobarbital, carbamazepine, dapsone, allopurinol, and minocycline), chemotherapeutics (e.g., taxanes, platinum compounds, asparaginases, and epipodophyllotoxins), heparin, insulin, protamine, aspirin and other non-steroidal anti-inflammatory drugs, muscle relaxants (e.g., succinylcholine, atracurium, vecuronium, and pancuronium), induction agents (e.g., barbiturates, etomidate, propofol), narcotics (e.g., fentanyl, meperidine, morphine), colloids for intravascular volume expansion, radiocontrast materials, blood products, latex, animal products, animal dander, dust mites, insects (e.g., bites, stings or venom), cosmetics, metals (e.g., nickel, cobalt, and chromate), plants, spores, pollen, food (e.g., milk, eggs, wheat, soy, peanuts and tree nuts, seafood), vaccination, and fungal antigens (e.g., Aspergillus, Curvularia, Exserohilum, and Alternaria species).
- In some embodiments, the SAP-responsive disorder is an autoimmune disorder such as those mediated by Th1 or Th2 responses. The use of SAP as a therapeutic treatment for autoimmune disorders is also described in U.S. Provisional Application No 61/209,845, which is hereby incorporated by reference. Autoimmune related disorders that may be amenable to treatment with SAP include, but are not limited to, type I diabetes, multiple sclerosis, rheumatoid arthritis, psoriatic arthritis, autoimmune myocarditis, pemphigus, myasthenia gravis, Hashimoto's thyroiditis, Graves' disease, Addison's disease, autoimmune hepatitis, chronic Lyme arthritis, familial dilated cardiomyopathy, juvenile dermatomyositis, polychondritis, Sjogren's syndrome, psoriasis, juvenile idiopathic arthritis, inflammatory bowel disease, systemic lupus erythematosus, chronic obstructive pulmonary disease, and graft-versus-host disease.
- In some embodiments, the SAP-responsive disorder is a mucositis. The use of SAP as a therapeutic treatment for mucositis is also described in U.S. application Ser. No. 12/217,614, which is hereby incorporated by reference. Methods of the invention may be useful for treating oral, esophageal, and gastrointestinal mucositis, as well as gastric and duodenal ulcers, or erosions of the stomach and esophagus.
- In some embodiments, a variant SAP polypeptide of the invention may be used to treat an inflammatory disease or condition. In some embodiments, the inflammatory disease may be a viral, bacterial, fungal, or parasitic infection. The use of SAP as a therapeutic treatment for viral infection has also been described in U.S. Pat. No. 6,406,698 and in International Patent Application No. WO1997/026906, which are both incorporated by reference herein.
- In certain embodiments, the methods described herein involve administration of at least one variant SAP polypeptide of the invention to a subject as a therapeutic agent. The therapeutic agents of the invention may be formulated in a conventional manner using one or more physiologically acceptable carriers or excipients. For example, therapeutic agents and their physiologically acceptable salts and solvates may be formulated for administration by, for example, injection (e.g. SubQ, IM, IP), inhalation or insufflation (either through the mouth or the nose) or oral, buccal, sublingual, transdermal, nasal, parenteral or rectal administration. In certain embodiments, therapeutic agents may be administered locally, at the site where the target cells are present, i.e., in a specific tissue, organ, or fluid (e.g., blood, cerebrospinal fluid, tumor mass, etc.).
- The present invention further provides use of any variant SAP polypeptide of the invention in the manufacture of a medicament for the treatment or prevention of a disorder or a condition, as described herein, in a patient, for example, the use of a variant SAP polypeptide in the manufacture of medicament for the treatment of a disorder or condition described herein. In some aspects, any variant SAP polypeptide of the invention may be used to make a pharmaceutical preparation for the use in treating or preventing a disease or condition described herein.
- Therapeutic agents can be formulated for a variety of modes of administration, including systemic and topical or localized administration. Techniques and formulations generally may be found in Remington's Pharmaceutical Sciences, Meade Publishing Co., Easton, PA. For parenteral administration, injection is preferred, including intramuscular, intravenous, intraperitoneal, and subcutaneous. For injection, the compounds can be formulated in liquid solutions, preferably in physiologically compatible buffers such as Hank's solution or Ringer's solution. In addition, the compounds may be formulated in solid form and dissolved or suspended immediately prior to use. Lyophilized forms are also included. In some embodiments, the therapeutic agents can be administered to cells by a variety of methods know to those familiar in the art, including, but not restricted to, encapsulation in liposomes, by iontophoresis, or by incorporation into other vehicles, such as hydrogels, cyclodextrins, biodegradable nanocapsules, and bioadhesive microspheres.
- For oral administration, the pharmaceutical compositions may take the form of, for example, tablets, lozenges, or capsules prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinized maize starch, polyvinylpyrrolidone or hydroxypropyl methylcellulose); fillers (e.g., lactose, microcrystalline cellulose or calcium hydrogen phosphate); lubricants (e.g., magnesium stearate, talc or silica); disintegrants (e.g., potato starch or sodium starch glycolate); or wetting agents (e.g., sodium lauryl sulphate). The tablets may be coated by methods well known in the art. Liquid preparations for oral administration may take the form of, for example, solutions, syrups or suspensions, or they may be presented as a dry product for constitution with water or other suitable vehicle before use. Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g., sorbitol syrup, cellulose derivatives or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid). The preparations may also contain buffer salts, flavoring, coloring and sweetening agents as appropriate. Preparations for oral administration may be suitably formulated to give controlled release of the active compound.
- For administration by inhalation (e.g., pulmonary delivery), therapeutic agents may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of e.g., gelatin, for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
- In the methods of the invention, the pharmaceutical compounds can also be administered by intranasal or intrabronchial routes including insufflation, powders, and aerosol formulations (for examples of steroid inhalants, see Rohatagi (1995) J. Clin. Pharmacology. 35:1187-1193; Tjwa (1995) Ann. Allergy Asthma Immunol. 75:107-111). For example, aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like. They also may be formulated as pharmaceuticals for non-pressured preparations such as in a nebulizer or an atomizer. Typically, such administration is in an aqueous pharmacologically acceptable buffer.
- Pharmaceutical compositions suitable for respiratory delivery (e.g., intranasal, inhalation, etc.) of variant SAP polypeptides may be prepared in either solid or liquid form.
- SAP polypeptides of the invention may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- In addition, SAP polypeptides of the invention may also be formulated as a depot preparation. Such long-acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection. Thus, for example, therapeutic agents may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt. Controlled release formula also includes patches.
- In certain embodiments, the compounds described herein can be formulated for delivery to the central nervous system (CNS) (reviewed in Begley, Pharmacology & Therapeutics 104: 29-45 (2004)). Conventional approaches for drug delivery to the CNS include: neurosurgical strategies (e.g., intracerebral injection or intracerebroventricular infusion); molecular manipulation of the agent (e.g., production of a chimeric fusion protein that comprises a transport peptide that has an affinity for an endothelial cell surface molecule in combination with an agent that is itself incapable of crossing the blood-brain-barrier in an attempt to exploit one of the endogenous transport pathways of the blood-brain-barrier); pharmacological strategies designed to increase the lipid solubility of an agent (e.g., conjugation of water-soluble agents to lipid or cholesterol carriers); and the transitory disruption of the integrity of the BBB by hyperosmotic disruption (resulting from the infusion of a mannitol solution into the carotid artery or the use of a biologically active agent such as an angiotensin peptide).
- In certain embodiments, SAP polypeptides of the invention are incorporated into a topical formulation containing a topical carrier that is generally suited to topical drug administration and comprising any such material known in the art. The topical carrier may be selected so as to provide the composition in the desired form, e.g., as an ointment, lotion, cream, microemulsion, gel, oil, solution, or the like, and may be comprised of a material of either naturally occurring or synthetic origin. It is preferable that the selected carrier not adversely affect the active agent or other components of the topical formulation. Examples of suitable topical carriers for use herein include water, alcohols and other nontoxic organic solvents, glycerin, mineral oil, silicone, petroleum jelly, lanolin, fatty acids, vegetable oils, parabens, waxes, and the like.
- Pharmaceutical compositions (including cosmetic preparations) may comprise from about 0.00001 to 100% such as from 0.001 to 10% or from 0.1% to 5% by weight of one or more of the variant SAP polypeptides described herein. In certain topical formulations, the active agent is present in an amount in the range of approximately 0.25 wt. % to 75 wt. % of the formulation, preferably in the range of approximately 0.25 wt. % to 30 wt. % of the formulation, more preferably in the range of approximately 0.5 wt. % to 15 wt. % of the formulation, and most preferably in the range of approximately 1.0 wt. % to 10 wt. % of the formulation.
- Conditions of the eye can be treated or prevented by, e.g., systemic, topical, intraocular injection of therapeutic agents, or by insertion of a sustained release device that releases therapeutic agents. SAP polypeptides of the invention may be delivered in a pharmaceutically acceptable ophthalmic vehicle, such that the compound is maintained in contact with the ocular surface for a sufficient time period to allow the compound to penetrate the corneal and internal regions of the eye, as for example the anterior chamber, conjunctiva, posterior chamber, vitreous body, aqueous humor, vitreous humor, cornea, iris/ciliary, lens, choroid/retina and sclera. The pharmaceutically acceptable ophthalmic vehicle may, for example, be an ointment, vegetable oil or an encapsulating material. Alternatively, the compounds may be injected directly into the vitreous and aqueous humour. In a further alternative, the compounds may be administered systemically, such as by intravenous infusion or injection, for treatment of the eye.
- Therapeutic agents described herein may be stored in oxygen-free environment according to methods in the art.
- Exemplary compositions comprise an SAP polypeptide with one or more pharmaceutically acceptable carriers and, optionally, other therapeutic ingredients. The carrier(s) must be “pharmaceutically acceptable” in the sense of being compatible with the other ingredients of the composition and not eliciting an unacceptable deleterious effect in the subject. Such carriers are described herein or are otherwise well known to those skilled in the art of pharmacology. In some embodiments, the pharmaceutical compositions are pyrogen-free and are suitable for administration to a human patient. In some embodiments, the pharmaceutical compositions are irritant-free and are suitable for administration to a human patient. In some embodiments, the pharmaceutical compositions are allergen-free and are suitable for administration to a human patient. The compositions may be prepared by any of the methods well known in the art of pharmacy.
- In some embodiments, an SAP polypeptide is administered in a time release formulation, for example in a composition which includes a slow release polymer. An SAP polypeptide can be prepared with carriers that will protect against rapid release. Examples include a controlled release vehicle, such as a polymer, microencapsulated delivery system, or bioadhesive gel. Alternatively, prolonged delivery of an SAP polypeptide may be achieved by including in the composition agents that delay absorption, for example, aluminum monostearate hydrogels and gelatin.
- Methods for delivering nucleic acid compounds are known in the art (see, e.g., Akhtar et al., 1992, Trends Cell Bio., 2, 139; and Delivery Strategies for Antisense Oligonucleotide Therapeutics, ed. Akhtar, 1995; Sullivan et al., International Application No. WO 94/02595). These protocols can be utilized for the delivery of virtually any nucleic acid compound. Nucleic acid compounds can be administered to cells by a variety of methods known to those familiar to the art, including, but not restricted to, encapsulation in liposomes, by iontophoresis, or by incorporation into other vehicles, such as hydrogels, cyclodextrins, biodegradable nanocapsules, and bioadhesive microspheres. Alternatively, the nucleic acid/vehicle combination is locally delivered by direct injection or by use of an infusion pump. Other routes of delivery include, but are not limited to, oral (tablet or pill form) and/or intrathecal delivery (Gold, 1997, Neuroscience, 76, 1153-1158). Other approaches include the use of various transport and carrier systems, for example though the use of conjugates and biodegradable polymers. For a comprehensive review on drug delivery strategies, see Ho et al., 1999, Curr. Opin. Mol. Ther., 1, 336-343 and Jain, Drug Delivery Systems: Technologies and Commercial Opportunities, Decision Resources, 1998 and Groothuis et al., 1997, J. NeuroVirol., 3, 387-400. More detailed descriptions of nucleic acid delivery and administration are provided in Sullivan et al., supra, Draper et al., PCT WO93/23569, Beigelman et al., International Application No. WO99/05094, and Klimuk et al., International Publication No. WO99/04819.
- The following examples serve to more fully describe the manner of using the above-described invention, as well as to set forth the best modes contemplated for carrying out various aspects of the invention. It is understood that these examples in no way serve to limit the true scope of this invention, but rather are presented for illustrative purposes.
- Recombinant human SAP isolated from CHO-S cells (rhSAP) and human serum-derived SAP (hSAP) were assayed for bioactivity using an in vitro bioassay. In this assay, monocyte enriched Peripheral Blood Mononuclear Cells (PBMCs) were incubated with varying concentrations of either rhSAP or hSAP for 96 hours. Following this incubation, resulting culture supernatants were removed and assayed by ELISA to quantify the amount of Macrophage Derived Chemokine (MDC) that was produced. MDC is produced by fibrocytes and therefore an indicator of monocyte differentiation into fibrocytes. By comparing the inhibitory concentration, 50% (IC50) of the sample to the hSAP reference standard, the relative potency of a SAP glycovariant can be determined. The result is expressed as an IC50 ratio of the sample versus the hSAP reference standard.
- All SAP samples and standards were initially diluted to a concentration of 1.0 mg/mL in Supplemented FibroLife Media. SAP standards were serially diluted to generate working standard concentrations of 60, 30, 20, 13.4, 8.8, 6.0, 3.0, 1.5, and 0.75 μg/mL (final standard concentration of 30, 15, 10, 6.7, 4.4, 3.0. 1.5, 0.75, and 0.375 μg/mL). See the following Table 1.
-
Working rhSAP Standard Concentration Volume of Supplemented (μg/mL) Volume of Standard FibroLife Media 60 60 (1 mg/mL) 940 30 600 (60 μg/mL) 600 20 800 (30 μg/mL Std) 400 13.4 800 (20 μg/mL Std) 400 8.8 800 (13.4 μg/mL Std) 400 6.0 800 (8.8 μg/mL Std) 400 3.0 600 (6.0 μg/mL Std) 600 1.5 600 (3.0 μg/mL Std) 600 0.75 600 (1.5 μg/mL Std) 600 - To prepare for the ELISA assay, the capture antibody (i.e., mouse anti-human MDC) was diluted to the working concentration in PBS without carrier protein. The diluted capture antibody was used to coat 96-well plates, and then each plate was sealed and incubated overnight at room temperature. Before using the coated plates, each well was aspirated and washed with wash buffer, repeating the process two times for a total of three washes. The plates were then blocked by adding 300 μL of reagent diluent to each well and incubating at room temperature for one hour. After incubation the aspiration and well-washing procedure was repeated.
- For the ELISA assay, 100 μL samples of either the supernatants from the monocyte/fibrocyte cultures or the SAP standards were added to each well. The plate was then incubated at room temperature for 2 hours before aspirating and washing the wells. Then 100 μL of a working dilution of Streptavidin-HRP was added to each well. The plate was incubated for 20 minutes at room temperature before adding 50 μL of Stop Solution to each well. Immediately, the optical density of each well was measured using a microplate reader set to 450 nm. If wavelength correction was available, the microplate reader was set to 540 nm or 570 nm. If wavelength correction was not available, then the readings at 540 nm or 570 nm were subtracted from the readings at 450 nm. This subtraction corrects for optical imperfections in the plate.
- Both RHSAP and hSAP were assayed for bioactivity using this assay (
FIG. 1 ). On average, RHSAP is 3.4-fold more active than hSAP (average of 7 independent experiments). - Using in vitro glycoremodeling techniques, glycan moieties on a sample of recombinant human SAP (rhSAP) were modified to replace terminal α2,3-linked sialic acid moieties with α2,6-linked sialic acid moieties (
FIG. 2 , A and B). Similarly, a sample of human serum-derived SAP (hSAP) was also modified to replace terminal α2,6-linked sialic acid moieties with α2,3-linked sialic acid moieties (FIG. 2 , C and D). In addition, as rhSAP isolated from CHO-S cells is only partially sialylated, a sample of rhSAP was treated to fully sialylate the attached glycan structures with α2,3-linked sialic acid moieties (FIG. 2 , E and F). - Both rhSAP and hSAP (Calbiochem Cat#970549) were treated with a α2,3,6,8,9-sialidase (Sigma Cat #N8271) to fully desialylate the polypeptides. After sialidase treatment for 17 hours, desialylated (i.e. asialo) rhSAP and hSAP were purified using phosphoethanolamine (PE) affinity and size exclusion (Sephadex 200 prep grade) chromatography. Purified asialo SAP polypeptides were then enzymatically treated using either α2,3- or α2,6-sialyltransferases (Calbiochem Cat #566223) in the presence of CMP-sialic acid (Calbiochem Cat #233264) for 17 hours at 37° C. The following tables provide details on each reaction mixture.
-
Asialo rhSAP Reactions (Rxns) Treatment with α2,3 sialyltransferase (ST3Gal3) parameter units value rhSAP, ST3Gal3 [asialo rhSAP] stk mg/mL 10.8 reagent stocks asialo rhSAP MW g/mol 116293 [asialo rhSAP] stk μM 93 max [Galactose] μM 929 [ST3Gal3] stk mg/mL 0.9 ST3Gal3 MW g/mol 84000 [ST3Gal3] stk μM 10.7 [CMP-SA] stk mg/mL 25 CMP-SA MW g/mol 658.4 [CMP-SA] stk mM 38 rxn volumes μL asialo rhSAP in rxn μL 260 μL ST3Gal3 in rxn μL 50 μL CMP-SA in rxn μL 75 buffer (10 mM HEPES/ μL 615 150 mM NaCl, pH 8) tot rxn vol μL 1000 rxn [asialo rhSAP] rxn μM 24.1 concentrations max [Galactose] μM 241 [SAP] rxn mg/mL 2.8 [ST3Gal3] rxn μM 0.5357 [ST3Gal3] rxn mg/mL 0.045 [CMP-SA] rxn mM 2.85 asialo rhSAP:ST3 mass 62 ratio asialo rhSAP:ST3 molar 45 ratio CMP-SA:ST3 molar 5316 ratio CMP-SA:asialo rhSAP molar 118 ratio CMP-SA:Galactose molar 11.8 ratio -
Treatment with α2,6 sialyltransferase (ST6 Rxn) parameter units value rhSAP, ST6 [asialo rhSAP] stk mg/mL 10.8 reagent stocks asialo rhSAP MW g/mol 116293 [asialo rhSAP] stk μM 93 max [Galactose] μM 929 [ST6] stk mg/mL 0.205 ST6 MW g/mol 42000 [ST6] stk μM 4.9 [CMP-SA] stk mg/mL 25 CMP-SA MW g/mol 658.4 [CMP-SA] stk mM 38 rxn volumes μL asialo rhSAP 1 in rxn μL 260 μL ST6 in rxn μL 30 μL CMP-SA in rxn μL 75 buffer (10 mM HEPES/ μL 635 150 mM NaCl, pH 8) tot rxn vol μL 1000 rxn [asialo rhSAP] rxn μM 24.1 concentrations max [Galactose] μM 241 [asialo rhSAP] rxn mg/mL 2.8 [ST6] rxn μM 0.146 [ST6] rxn mg/mL 0.006 [CMP-SA] rxn mM 2.85 asialo rhSAP:ST6 mass 457 ratio asialo rhSAP:ST6 molar 165 ratio CMP-SA:ST6 molar 19448 ratio CMP-SA:asialo rhSAP molar 118 ratio CMP-SA:Galactose molar 11.8 ratio -
Asialo hSAP Rxns Treatment with α2,3 sialyltransferase (ST3Gal3) parameter units value hSAP, ST3Gal3 [asialo hSAP] stk mg/mL 5.6 reagent stocks SAP MW g/mol 116293 [asialo hSAP] stk μM 48 max [Galactose] μM 482 [ST3Gal3] stk mg/mL 0.9 ST3Gal3 MW g/mol 84000 [ST3Gal3] stk μM 10.7 [CMP-SA] stk mg/mL 25 CMP-SA MW g/mol 658.4 [CMP-SA] stk mM 38 rxn volumes μL asialo hSAP in rxn μL 500 μL ST3Gal3 in rxn μL 50 μL CMP-SA in rxn μL 75 buffer (10 mM HEPES/ μL 375 150 mM NaCl, pH 8) tot rxn vol μL 1000 rxn [asialo hSAP] rxn μM 24.1 concentrations max [Galactose] μM 241 [asialo hSAP] rxn mg/mL 2.8 [ST3Gal3] rxn μM 0.54 [ST3Gal3] rxn mg/mL 0.045 [CMP-SA] rxn mM 2.85 asialo hSAP:ST3 mass 62 ratio asialo hSAP:ST3 molar 45 ratio CMP-SA:ST3 molar 5316 ratio CMP-SA:asialo hSAP molar 118 ratio CMP-SA:Galactose molar 11.8 ratio -
Treatment with α2,6 sialyltransferase (ST6 Rxn) parameter units value hSAP, ST6 [asialo hSAP] stk mg/mL 5.6 reagent stocks asialo hSAP MW g/mol 116293 [asialo hSAP] stk μM 48 max [Galactose] μM 482 [ST6] stk mg/mL 0.205 ST6 MW g/mol 42000 [ST6] stk μM 4.9 [CMP-SA] stk mg/mL 25 CMP-SA MW g/mol 658.4 [CMP-SA] stk mM 38 rxn volumes μL asialo hSAP in rxn μL 500 μL ST6 in rxn μL 30 μL CMP-SA in rxn μL 75 buffer (10 mM HEPES/ μL 395 150 mM NaCl, pH 8) tot rxn vol μL 1000 rxn [asialo hSAP] rxn μM 24.1 concentrations max [Galactose] μM 241 [asialo hSAP] rxn mg/mL 2.8 [ST6] rxn μM 0.146 [ST6] rxn mg/mL 0.006 [CMP-SA] rxn mM 2.85 asialo hSAP:ST6 mass 455 ratio asialo hSAP:ST6 molar 164 ratio CMP-SA:ST6 molar 19448 ratio CMP-SA:asialo hSAP molar 118 ratio CMP-SA:Galactose molar 11.8 ratio - In a separate reaction, complete sialylation of rhSAP using the α2,3-sialyltransferase without first desialylating the molecule was preformed at 37° C. for 17 hours according to the following table.
-
Treatment with α2,3 sialyltransferase (ST3Gal3) parameter units value rhSAP ST3Gal3 [rhSAP] stk mg/mL 19.0 reagent stocks rhSAP MW g/mol 116293 [rhSAP] stk μM 163 max [Galactose] μM 1634 [ST3Gal3] stk mg/mL 0.9 ST3Gal3 MW g/mol 84000 [ST3Gal3] stk μM 10.7 [CMP-SA] stk mg/mL 25 CMP-SA MW g/mol 658.4 [CMP-SA] stk mM 38 rxn volumes μL rhSAP in rxn μL 500 μL ST3Gal3 in rxn μL 50 μL CMP-SA in rxn μL 100 buffer (10 mM HEPES/ μL 350 150 mM NaCl, pH 8) tot rxn vol μL 1000 rxn [rhSAP] rxn μM 81.7 concentrations max [Galactose] μM 817 [rhSAP] rxn mg/mL 9.5 [ST3Gal3] rxn μM 0.54 [ST3Gal3] rxn mg/mL 0.045 [CMP-SA] rxn mM 3.80 BTA-02-17:ST3 mass 211 ratio BTA-02-17:ST3 molar 152 ratio CMP-SA:ST3 molar 7088 ratio CMP-SA:BTA-02-17 molar 46 ratio CMP-SA:Galactose molar 4.6 ratio - After sialylation treatment, both sialylated rhSAP and hSAP variants were purified using PE affinity chromatography followed by dialysis into 10 mM NaPi/5% sorbitol pH 7.5 (P5S buffer). Confirmation of the desired sialic acid linkages (i.e, α2,3-linked hSAP and α2,6-linked RHSAP) was preformed using both Liquid Chromatography Mass Spectrometry (
FIG. 2 ; A, C, and E) and Anion-Exchange High Performance Liquid Chromatography (FIG. 2 ; B, D, and F) following treatment of the glycovariant SAP polypeptides with α2,3 sialidase (Calbiochem Cat#480706) at 37° C. for 24 hours. - Glycoremodeled rhSAP and hSAP were assayed for bioactivity using the same in vitro bioassay described in Example 1. In brief, monocyte enriched peripheral blood mononuclear cells (PBMCs) were incubated with varying concentrations of an SAP polypeptide for 96 hours. Following this incubation, resulting culture supernatants were removed and assayed by ELISA to quantify the about of Macrophage Derived Chemokine (MDC) that was produced. The results were expressed as an IC50 ratio of the sample versus the hSAP reference standard and plotted as relative activity (relative activity of hSAP=1). All α2,3-sialic acid linkage containing test materials are ≥2.4-fold more active than hSAP (
FIG. 3 ). Equal mixtures of α2,3-and α2,6-linked sialic acid derivatives of SAP show intermediate activity levels between 100% α2,6-linked and 100% α2,3-linked SAP as expected (two rightmost bars inFIG. 3 ). - An alternative method of quantifying fibrocyte differentiation involves directly enumerating the number of fibrocytes that are generated after monocytes are incubated with a fibrocyte suppressant (e.g., SAP or variant thereof) or activating agent (e.g., M-CSF). In one experiment, monocytes were purified from whole blood-derived PBMC using negative magnetic bead selection standard in the art (e.g. CAT# 113-41D, Invitrogen, Carlsbad, Calif.) and cultured in a 96-Well tissue culture plate containing FibroLife Media supplemented with 25 or 50 ng/ml of M-CSF in triplicate. The plate was incubated for 96 hours at 37 ° C. in a 5% CO2 incubator. The cells were then fixed with paraformaldehyde and stained with Hema 3 stain (Cat # 122-911, Hema 3 Stain, Fisher Scientific, Hampton, N.H.). The number of fibrocytes per well were determined by summing the count of five different fields per well using an inverted microscope. Fibrocytes were defined morphologically as adherent cells with an elongated spindle-shape and the presence of an oval nucleus. The data indicated that either 25 or 50 ng/ml of M-CSF was sufficient to increase the number of fibrocytes differentiating from monocytes by ˜50% in this donor (
FIG. 4 ). Subsequent experiments used FibroLife Media supplemented with 25 ng/ml of M-CSF as needed and defined below. -
- Fibrolife Media: (Cat # LM-0001, Lifeline Cell Technology, Walkersville, Md.) supplemented with 10 mM HEPES (Cat # H0887, Sigma-Aldrich), 1×non-essential amino acids (Cat # M7145, Sigma-Aldrich,), 1 mM sodium pyruvate (Cat # S8636, Sigma-Aldrich), 2 mM glutamine (Cat # 25030-149, Invitrogen), 100 U/ml penicillin and100 ug/ml streptomycin (Cat # P0781, Sigma-Aldrich), and ITS-3 (Cat # 12771, 500 ug/ml bovine serum albumin, 10 ug/ml insulin, 5 □ug/ml transferrin, 5 ng/ml sodium selenite, 5 ug/ml linoleic acid, and 5 ug/ml oleic acid; Sigma-Aldrich).
- In an additional experiment, PBMC or monocytes were purified from whole blood and cultured in FibroLife Media supplemented with various amounts of SAP in triplicate (as described above). The plate was incubated for 96 hours at 37° C. in a 5% CO2 incubator. The cells were then fixed with paraformaldehyde and stained with Hema 3 stain (Cat # 122-911, Hema 3 Stain, Fisher Scientific, Hampton, N.H.). The number of fibrocytes per well were determined by summing the count of five different fields per well using an inverted microscope. The minimum concentration of SAP necessary to provide maximum inhibition of fibrocyte differentiation in this system was determined to be 2ug/m1 (
FIG. 5 ). The number of fibrocytes decreases with increasing SAP concentration in all donors. - All publications and patents mentioned herein are hereby incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference.
- While specific embodiments of the subject matter have been discussed, the above specification is illustrative and not restrictive. Many variations will be apparent to those skilled in the art upon review of this specification and the below-listed claims. The full scope of the invention should be determined by reference to the claims, along with their full scope of equivalents, and the specification, along with such variations.
Claims (19)
1. A glycosylated human Serum Amyloid P (SAP) polypeptide comprising an N-linked oligosaccharide chain, wherein at least one branch of the oligosaccharide chain terminates with a α2,3-linked sialic acid moiety.
2. (canceled)
3. The glycosylated human SAP polypeptide of claim 1 , wherein all branches of the oligosaccharide chain terminate with α2,3-linked sialic acid moieties.
4. The glycosylated human SAP polypeptide of claim 1 , wherein the oligosaccharide chain is substantially free of α2,6-linked sialic acid moieties.
5. The glycosylated human SAP polypeptide of claim 1 , wherein the polypeptide comprises an amino acid sequence at least 95% identical to SEQ ID NO: 1.
6. The glycosylated human SAP polypeptide of claim 1 , wherein the polypeptide is a fusion protein comprising an SAP domain and one or more heterologous domains.
7. The glycosylated human SAP polypeptide of claim 1 , wherein the polypeptide comprises one or more modified amino acid residues.
8. The glycosylated human SAP polypeptide of claim 7 , wherein the one or more modified amino acid residues comprise a PEGylated amino acid, a prenylated amino acid, an acetylated amino acid, a biotinylated amino acid, and/or an amino acid conjugated to an organic derivatizing agent.
9. The glycosylated human SAP polypeptide of claim 1 , wherein the SAP polypeptide has an IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than one-half that of a corresponding sample of wild-type SAP isolated from human serum.
10. A pharmaceutical preparation suitable for use in a mammal comprising the human SAP polypeptide of claim 1 and a pharmaceutically acceptable carrier.
11. A method of treating or preventing a-disorder or condition in a patient, the method comprising administering to a patient in need thereof a therapeutically effective amount of the SAP polypeptide of claim 1 , wherein the disorder or condition is selected from a fibrotic or fibroproliferative disorder or condition, a hypersensitivity disorder or condition, an autoimmune disorder or condition, an inflammatory disorder or condition, and mucositis.
12. A method of making a human SAP polypeptide, comprising:
i) expressing a human SAP polypeptide in a CHO cell; and
ii) isolating the human SAP polypeptide from the cell.
13. The method of claim 12 , wherein the isolated SAP polypeptide comprises an N-linked oligosaccharide chain, and wherein at least one branch of the oligosaccharide chain terminates with a α2,3-linked sialic acid moiety.
14. The method claim 12 , wherein the isolated SAP polypeptide comprises an N-linked oligosaccharide chain, and wherein the oligosaccharide chain has at least 50% fewer α2,6-linked sialic acid moieties than wild-type SAP isolated from human serum.
15. The method of claim 12 , wherein the isolated human SAP polypeptide has an IC50 for inhibiting the differentiation of monocytes into fibrocytes in vitro that is less than one-half that of a corresponding sample wild-type SAP isolated from human serum.
16. The method of claim 12 , further comprising enzymatically or chemically altering the isolated SAP polypeptide to produce an SAP polypeptide having a modified oligosaccharide chain.
17. The method of claim 16 , wherein the process of enzymatically or chemically altering the isolated SAP polypeptide removes one or more terminal α2,6-linked sialic acid moieties from the oligosaccharide chain.
18. The method of claim 16 , wherein the process of enzymatically or chemically altering the isolated SAP polypeptide replaces one or more terminal α2,6-linked sialic acid moieties on the oligosaccharide chain with one or more α2,3-linked sialic acid moieties.
19-26. (canceled)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/695,071 US20230058309A1 (en) | 2009-06-04 | 2022-03-15 | Serum amyloid p derivatives and their preparation and use |
Applications Claiming Priority (10)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US21793109P | 2009-06-04 | 2009-06-04 | |
US12/794,132 US9296800B2 (en) | 2009-06-04 | 2010-06-04 | Serum amyloid P derivatives and their preparation and use |
US201615054640A | 2016-02-26 | 2016-02-26 | |
US201615264707A | 2016-09-14 | 2016-09-14 | |
US15/492,085 US20180044387A1 (en) | 2009-06-04 | 2017-04-20 | Serum amyloid p derivatives and their preparation and use |
US201816156978A | 2018-10-10 | 2018-10-10 | |
US201916417537A | 2019-05-20 | 2019-05-20 | |
US16/731,320 US20200369735A1 (en) | 2009-06-04 | 2019-12-31 | Serum amyloid p derivatives and their preparation and use |
US16/941,515 US20210179679A1 (en) | 2009-06-04 | 2020-07-28 | Serum amyloid p derivatives and their preparation and use |
US17/695,071 US20230058309A1 (en) | 2009-06-04 | 2022-03-15 | Serum amyloid p derivatives and their preparation and use |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/941,515 Continuation US20210179679A1 (en) | 2009-06-04 | 2020-07-28 | Serum amyloid p derivatives and their preparation and use |
Publications (1)
Publication Number | Publication Date |
---|---|
US20230058309A1 true US20230058309A1 (en) | 2023-02-23 |
Family
ID=43298203
Family Applications (5)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/794,132 Active 2032-05-26 US9296800B2 (en) | 2009-06-04 | 2010-06-04 | Serum amyloid P derivatives and their preparation and use |
US15/492,085 Abandoned US20180044387A1 (en) | 2009-06-04 | 2017-04-20 | Serum amyloid p derivatives and their preparation and use |
US16/731,320 Abandoned US20200369735A1 (en) | 2009-06-04 | 2019-12-31 | Serum amyloid p derivatives and their preparation and use |
US16/941,515 Abandoned US20210179679A1 (en) | 2009-06-04 | 2020-07-28 | Serum amyloid p derivatives and their preparation and use |
US17/695,071 Abandoned US20230058309A1 (en) | 2009-06-04 | 2022-03-15 | Serum amyloid p derivatives and their preparation and use |
Family Applications Before (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/794,132 Active 2032-05-26 US9296800B2 (en) | 2009-06-04 | 2010-06-04 | Serum amyloid P derivatives and their preparation and use |
US15/492,085 Abandoned US20180044387A1 (en) | 2009-06-04 | 2017-04-20 | Serum amyloid p derivatives and their preparation and use |
US16/731,320 Abandoned US20200369735A1 (en) | 2009-06-04 | 2019-12-31 | Serum amyloid p derivatives and their preparation and use |
US16/941,515 Abandoned US20210179679A1 (en) | 2009-06-04 | 2020-07-28 | Serum amyloid p derivatives and their preparation and use |
Country Status (28)
Country | Link |
---|---|
US (5) | US9296800B2 (en) |
EP (2) | EP2438083B1 (en) |
JP (3) | JP5801293B2 (en) |
CN (1) | CN102574902B (en) |
AU (1) | AU2010256426B2 (en) |
BR (2) | BR122020010980B1 (en) |
CA (1) | CA2764461C (en) |
CO (1) | CO6480917A2 (en) |
CR (1) | CR20110640A (en) |
CY (1) | CY1120817T1 (en) |
DK (2) | DK2438083T3 (en) |
EA (1) | EA030332B1 (en) |
ES (2) | ES2692815T3 (en) |
HK (1) | HK1168603A1 (en) |
HR (2) | HRP20160221T1 (en) |
HU (1) | HUE026737T2 (en) |
IL (1) | IL216744A (en) |
LT (1) | LT3042915T (en) |
MX (1) | MX2011012738A (en) |
MY (1) | MY158761A (en) |
NZ (1) | NZ596849A (en) |
PL (2) | PL2438083T3 (en) |
PT (1) | PT3042915T (en) |
SI (2) | SI3042915T1 (en) |
TR (1) | TR201815592T4 (en) |
UA (1) | UA110323C2 (en) |
WO (1) | WO2010141918A1 (en) |
ZA (1) | ZA201108857B (en) |
Families Citing this family (19)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8247370B2 (en) * | 2006-12-04 | 2012-08-21 | Promedior, Inc. | Conjoint therapy for treating fibrotic diseases |
US20090092574A1 (en) | 2006-12-29 | 2009-04-09 | Scott Richard W | Ophthalmic And Otic Compositions Of Facially Amphiphilic Polymers And Oligomers And Uses Thereof |
US9884899B2 (en) * | 2007-07-06 | 2018-02-06 | Promedior, Inc. | Methods for treating fibrosis using CRP antagonists |
US8497243B2 (en) * | 2007-07-06 | 2013-07-30 | Promedior, Inc. | Methods and compositions useful in the treatment of mucositis |
CA2755047C (en) | 2009-03-11 | 2018-12-04 | Promedior, Inc. | Treatment methods for autoimmune disorders |
JP5797565B2 (en) * | 2009-03-11 | 2015-10-21 | プロメディオール, インコーポレイテッド | Treatment and diagnosis method for hypersensitive disorder |
UA110323C2 (en) * | 2009-06-04 | 2015-12-25 | Promedior Inc | Derivative of serum amyloid p and their receipt and application |
ES2552793T3 (en) | 2009-06-17 | 2015-12-02 | Promedior Inc. | SAP variants and their use |
FR2969153B1 (en) * | 2010-12-17 | 2014-10-17 | Lab Francais Du Fractionnement | PROCESS FOR THE PURIFICATION OF AMYLOID P PROTEIN AND USE OF THE PROTEIN THUS PURIFIED |
WO2012158672A2 (en) | 2011-05-16 | 2012-11-22 | Polymedix, Inc. | Compounds for use in treatment of mucositis |
JP6340319B2 (en) * | 2011-12-21 | 2018-06-06 | プロメディオール, インコーポレイテッド | Serum amyloid P-antibody fusion protein |
EP3718558A1 (en) * | 2013-10-08 | 2020-10-07 | Promedior, Inc. | Methods for treating fibrotic cancers |
FR3012453B1 (en) | 2013-10-31 | 2015-11-13 | Lab Francais Du Fractionnement | CHIMERIC PROTEIN FOR THE TREATMENT OF AMYLOSIS |
CN105372214B (en) * | 2014-08-18 | 2019-06-28 | 中国科学院上海有机化学研究所 | A method of identifying the N- connection oligosaccharide structure of new erythropoiesis stimulating protein |
MX2019002734A (en) * | 2016-09-13 | 2019-05-27 | Bayer Healthcare Llc | Factor viia glycoforms. |
JP6852397B2 (en) | 2016-12-28 | 2021-03-31 | 株式会社島津製作所 | Preparation method and analysis method of analytical sample |
CN108114001B (en) * | 2017-12-23 | 2023-05-30 | 中国科学院海洋研究所 | Inducer for inducing spawning of marine bivalve shellfish and application method thereof |
WO2021248008A1 (en) | 2020-06-05 | 2021-12-09 | Innovation Pharmaceuticals Inc. | Arylamide compounds for treatment and prevention of viral infections |
IL302388A (en) * | 2020-11-02 | 2023-06-01 | Attralus Inc | Sap fc fusion proteins and methods of use |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6406898B1 (en) * | 1995-09-13 | 2002-06-18 | Daiichi Fine Chemical Co., Ltd. | D-pantolactone hydrolase and gene encoding the same |
US9296800B2 (en) * | 2009-06-04 | 2016-03-29 | Promedior, Inc. | Serum amyloid P derivatives and their preparation and use |
Family Cites Families (72)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB1562244A (en) * | 1976-11-11 | 1980-03-05 | Lock P M | Wound dressing materials |
GB1594389A (en) * | 1977-06-03 | 1981-07-30 | Max Planck Gesellschaft | Dressing material for wounds |
GB8516081D0 (en) | 1985-06-25 | 1985-07-31 | Ciba Geigy Ag | Assay & purification of amyloid components |
US6071517A (en) * | 1986-07-07 | 2000-06-06 | Medarex, Inc. | Bispecific heteroantibodies with dual effector functions |
EP0321703B1 (en) * | 1987-11-20 | 1993-04-28 | Kanegafuchi Kagaku Kogyo Kabushiki Kaisha | Absorbent for serum amyloid protein |
US7070994B2 (en) * | 1988-03-21 | 2006-07-04 | Oxford Biomedica (Uk) Ltd. | Packaging cells |
US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
US5092876A (en) * | 1989-08-30 | 1992-03-03 | The United States Of America As Represented By The Department Of Health And Human Services | Cell attachment peptides derived from amyloid P component |
EP0587777A4 (en) | 1991-05-31 | 1995-05-10 | New England Deaconess Hospital | Cea-binding proteins and methods for their isolation and use. |
US5591709A (en) * | 1991-08-30 | 1997-01-07 | Life Medical Sciences, Inc. | Compositions and methods for treating wounds |
CA2135646A1 (en) | 1992-05-11 | 1993-11-25 | Kenneth G. Draper | Method and reagent for inhibiting viral replication |
EP0786522A2 (en) | 1992-07-17 | 1997-07-30 | Ribozyme Pharmaceuticals, Inc. | Enzymatic RNA molecules for treatment of stenotic conditions |
US6054121A (en) * | 1993-02-26 | 2000-04-25 | The Picower Institute For Medical Research | Modulation of immune responses in blood-borne mesenchymal cells |
US5804446A (en) * | 1993-02-26 | 1998-09-08 | The Picower Institute For Medical Research | Blood-borne mesenchymal cells |
US5654186A (en) * | 1993-02-26 | 1997-08-05 | The Picower Institute For Medical Research | Blood-borne mesenchymal cells |
AU7043694A (en) | 1993-05-27 | 1994-12-20 | Regents Of The University Of Michigan, The | Method of treatment and prevention of immune complex-induced lung injury |
US5698589A (en) * | 1993-06-01 | 1997-12-16 | International Medical Innovations, Inc. | Water-based topical cream containing nitroglycerin and method of preparation and use thereof |
GB9317120D0 (en) * | 1993-08-17 | 1993-09-29 | Royal Postgrad Med School | Human serum amyloid p component |
US5981470A (en) | 1994-06-07 | 1999-11-09 | The University Of Birmingham | Uterine fibroid treatment |
US5989811A (en) * | 1994-09-29 | 1999-11-23 | Urocor, Inc. | Sextant core biopsy predictive mechanism for non-organ confined disease status |
US6030815A (en) | 1995-04-11 | 2000-02-29 | Neose Technologies, Inc. | Enzymatic synthesis of oligosaccharides |
US5922577A (en) | 1995-04-11 | 1999-07-13 | Cytel Corporation | Enzymatic synthesis of glycosidic linkages |
US5876980A (en) | 1995-04-11 | 1999-03-02 | Cytel Corporation | Enzymatic synthesis of oligosaccharides |
US5728554A (en) | 1995-04-11 | 1998-03-17 | Cytel Corporation | Enzymatic synthesis of glycosidic linkages |
US5750345A (en) | 1995-10-31 | 1998-05-12 | Evanston Hospital Corporation | Detection of human α-thalassemia mutations and their use as predictors of blood-related disorders |
AU712819B2 (en) | 1996-01-25 | 1999-11-18 | Profylakse Aps | Pharmaceutical composition comprising serum amyloid P component for proph ylactic or therapeutic treatment of virus infections and a kit for detecting binding of compositions to virus components |
ATE296315T1 (en) | 1997-06-24 | 2005-06-15 | Genentech Inc | COMPOSITIONS CONTAINING GALACTOSYLATED GLYCOPROTEINS AND METHOD FOR THE PRODUCTION THEREOF |
US6395713B1 (en) | 1997-07-23 | 2002-05-28 | Ribozyme Pharmaceuticals, Inc. | Compositions for the delivery of negatively charged molecules |
AU8525098A (en) | 1997-07-24 | 1999-02-16 | Inex Pharmaceuticals Corporation | Liposomal compositions for the delivery of nucleic acid catalysts |
US6365570B1 (en) * | 1997-10-10 | 2002-04-02 | Universiteit Utrecht | Pharmaceutical and diagnostic use of Serum Amyloid P component |
ATE419009T1 (en) | 1997-10-31 | 2009-01-15 | Genentech Inc | METHODS AND COMPOSITIONS CONSISTING OF GLYCOPROTEIN GLYCOFORMS |
IL137919A0 (en) * | 1998-02-17 | 2001-10-31 | Medarex Inc | Treating and diagnosing macrophage-mediated diseases using fc receptor ligands |
DE99907899T1 (en) | 1998-03-11 | 2005-01-13 | Kabushiki Kaisha Soken | SKIN NORMALIZATION MEDIUM |
PT1071700E (en) | 1998-04-20 | 2010-04-23 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
JPH11319542A (en) | 1998-05-08 | 1999-11-24 | Tokuyama Corp | Production ultrathin layer |
US6660843B1 (en) * | 1998-10-23 | 2003-12-09 | Amgen Inc. | Modified peptides as therapeutic agents |
US6600019B2 (en) * | 2000-01-06 | 2003-07-29 | Curagen Corporation | Polypeptides and nucleic acids encoding same |
EP1267795A1 (en) | 2000-03-30 | 2003-01-02 | Brennen Medical Inc. | Anti-microbial and immunostimulating composition |
US20040068095A1 (en) * | 2001-03-14 | 2004-04-08 | Shimkets Richard A. | Novel human proteins, polynucleotides encoding them and methods of using the same |
US7713705B2 (en) * | 2002-12-24 | 2010-05-11 | Biosite, Inc. | Markers for differential diagnosis and methods of use thereof |
US6872541B2 (en) * | 2001-07-25 | 2005-03-29 | Coulter International Corp. | Method and compositions for analysis of pentraxin receptors as indicators of disease |
US6537811B1 (en) * | 2001-08-01 | 2003-03-25 | Isis Pharmaceuticals, Inc. | Antisense inhibition of SAP-1 expression |
US20030199442A1 (en) | 2001-10-09 | 2003-10-23 | Alsobrook John P. | Therapeutic polypeptides, nucleic acids encoding same, and methods of use |
JP2004049214A (en) | 2001-11-29 | 2004-02-19 | Nippon Shokubai Co Ltd | Method for introducing protein or peptide into cell |
US7022476B2 (en) * | 2002-02-26 | 2006-04-04 | New York Society For Ruptured And Crippled Maintaining The Hospital For Special Surgery | Human FcγRIIB gene polymorphisms for assessing development of systemic lupus erythematosus and compositions for use thereof |
GB0211136D0 (en) | 2002-05-15 | 2002-06-26 | Univ London | Treatment and prevention of tissue damage |
US20050182042A1 (en) * | 2002-05-17 | 2005-08-18 | Feldman David L. | Pharmaceutical composition comprising a renin inhibitor, a calcium channel blocker and a diuretic |
GB0216648D0 (en) | 2002-07-18 | 2002-08-28 | Lonza Biologics Plc | Method of expressing recombinant protein in CHO cells |
CA2495251C (en) | 2002-08-14 | 2018-03-06 | Macrogenics, Inc. | Fc.gamma.riib-specific antibodies and methods of use thereof |
JP4819364B2 (en) * | 2002-12-23 | 2011-11-24 | ウイリアム、マーシュ、ライス、ユーニヴァーサティ | Method for detecting inhibition of fibrocyte formation, and method and compound for enhancing fibrocyte formation |
US7763256B2 (en) * | 2002-12-23 | 2010-07-27 | William Marsh Rice University | Compositions and methods for suppressing fibrocytes and for detecting fibrocyte differentiation |
US8012472B2 (en) * | 2002-12-23 | 2011-09-06 | William Marsh Rice University | Compositions and methods for suppressing fibrocytes |
JP2006526140A (en) | 2002-12-24 | 2006-11-16 | バイオサイト インコーポレイテッド | Marker for differential diagnosis and method of using the same |
US20070149450A1 (en) | 2003-02-27 | 2007-06-28 | Ranjit Bhardwaj | Method for reducing levels of c-reactive protein |
MXPA06011796A (en) | 2004-04-16 | 2007-05-07 | Macrogenics Inc | FCgammaRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF. |
KR101297146B1 (en) | 2004-05-10 | 2013-08-21 | 마크로제닉스, 인크. | HUMANIZED FcγRIIB SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF |
WO2006002438A2 (en) | 2004-06-03 | 2006-01-05 | Medarex, Inc. | Human monoclonal antibodies to fc gamma receptor i (cd64) |
WO2006002930A2 (en) | 2004-06-30 | 2006-01-12 | Friedrich-Alexander- Universitaet Erlangen- Nuernberg | FcϜRIIa POLYMORPHISM AND ITS USE IN DIAGNOSIS |
ZA200701783B (en) | 2004-09-02 | 2009-10-28 | Genentech Inc | Anti-Fc-gamma RIIB receptor antibody and uses therefor |
US7553653B2 (en) * | 2004-09-17 | 2009-06-30 | Biomarin Pharmaceutical Inc. | Variants and chemically-modified variants of phenylalanine ammonia-lyase |
WO2006039418A2 (en) | 2004-09-30 | 2006-04-13 | Medarex, Inc. | Human monoclonal antibodies to fc gamma receptor ii (cd32) |
US7405302B2 (en) | 2005-10-11 | 2008-07-29 | Amira Pharmaceuticals, Inc. | 5-lipoxygenase-activating protein (FLAP) inhibitors |
US20070099251A1 (en) | 2005-10-17 | 2007-05-03 | Institute For Systems Biology | Tissue-and serum-derived glycoproteins and methods of their use |
US20070243163A1 (en) | 2006-02-17 | 2007-10-18 | Chih-Ping Liu | Respiratory tract delivery of interferon-tau |
US8247370B2 (en) * | 2006-12-04 | 2012-08-21 | Promedior, Inc. | Conjoint therapy for treating fibrotic diseases |
US8497243B2 (en) * | 2007-07-06 | 2013-07-30 | Promedior, Inc. | Methods and compositions useful in the treatment of mucositis |
ES2554167T3 (en) | 2007-07-06 | 2015-12-16 | Promedior Inc. | Methods and compositions useful in the treatment of mucositis |
US9884899B2 (en) | 2007-07-06 | 2018-02-06 | Promedior, Inc. | Methods for treating fibrosis using CRP antagonists |
JP5797565B2 (en) * | 2009-03-11 | 2015-10-21 | プロメディオール, インコーポレイテッド | Treatment and diagnosis method for hypersensitive disorder |
CA2755047C (en) * | 2009-03-11 | 2018-12-04 | Promedior, Inc. | Treatment methods for autoimmune disorders |
US20100266643A1 (en) | 2009-04-01 | 2010-10-21 | Willett W Scott | Pulmonary and nasal delivery of serum amyloid p |
ES2552793T3 (en) * | 2009-06-17 | 2015-12-02 | Promedior Inc. | SAP variants and their use |
-
2010
- 2010-04-06 UA UAA201115614A patent/UA110323C2/en unknown
- 2010-06-04 EA EA201171490A patent/EA030332B1/en unknown
- 2010-06-04 MY MYPI2011005861A patent/MY158761A/en unknown
- 2010-06-04 PT PT15197076T patent/PT3042915T/en unknown
- 2010-06-04 EP EP10784210.6A patent/EP2438083B1/en active Active
- 2010-06-04 US US12/794,132 patent/US9296800B2/en active Active
- 2010-06-04 MX MX2011012738A patent/MX2011012738A/en active IP Right Grant
- 2010-06-04 BR BR122020010980-7A patent/BR122020010980B1/en active IP Right Grant
- 2010-06-04 JP JP2012514212A patent/JP5801293B2/en active Active
- 2010-06-04 CA CA2764461A patent/CA2764461C/en active Active
- 2010-06-04 CN CN201080028923.8A patent/CN102574902B/en active Active
- 2010-06-04 TR TR2018/15592T patent/TR201815592T4/en unknown
- 2010-06-04 NZ NZ596849A patent/NZ596849A/en unknown
- 2010-06-04 HU HUE10784210A patent/HUE026737T2/en unknown
- 2010-06-04 LT LTEP15197076.1T patent/LT3042915T/en unknown
- 2010-06-04 PL PL10784210T patent/PL2438083T3/en unknown
- 2010-06-04 WO PCT/US2010/037542 patent/WO2010141918A1/en active Application Filing
- 2010-06-04 BR BRPI1012924A patent/BRPI1012924B8/en active IP Right Grant
- 2010-06-04 ES ES15197076.1T patent/ES2692815T3/en active Active
- 2010-06-04 AU AU2010256426A patent/AU2010256426B2/en active Active
- 2010-06-04 SI SI201031760T patent/SI3042915T1/en unknown
- 2010-06-04 SI SI201031135T patent/SI2438083T1/en unknown
- 2010-06-04 DK DK10784210.6T patent/DK2438083T3/en active
- 2010-06-04 PL PL15197076T patent/PL3042915T3/en unknown
- 2010-06-04 DK DK15197076.1T patent/DK3042915T3/en active
- 2010-06-04 ES ES10784210.6T patent/ES2563748T3/en active Active
- 2010-06-04 EP EP15197076.1A patent/EP3042915B1/en active Active
-
2011
- 2011-11-29 CR CR20110640A patent/CR20110640A/en unknown
- 2011-12-01 IL IL216744A patent/IL216744A/en active IP Right Grant
- 2011-12-01 ZA ZA2011/08857A patent/ZA201108857B/en unknown
- 2011-12-21 CO CO11176414A patent/CO6480917A2/en active IP Right Grant
-
2012
- 2012-08-02 HK HK12107623.6A patent/HK1168603A1/en unknown
-
2015
- 2015-03-27 JP JP2015067656A patent/JP2015120754A/en active Pending
-
2016
- 2016-03-01 HR HRP20160221T patent/HRP20160221T1/en unknown
-
2017
- 2017-02-10 JP JP2017023183A patent/JP2017082008A/en active Pending
- 2017-04-20 US US15/492,085 patent/US20180044387A1/en not_active Abandoned
-
2018
- 2018-10-19 CY CY181101079T patent/CY1120817T1/en unknown
- 2018-10-31 HR HRP20181803TT patent/HRP20181803T1/en unknown
-
2019
- 2019-12-31 US US16/731,320 patent/US20200369735A1/en not_active Abandoned
-
2020
- 2020-07-28 US US16/941,515 patent/US20210179679A1/en not_active Abandoned
-
2022
- 2022-03-15 US US17/695,071 patent/US20230058309A1/en not_active Abandoned
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6406898B1 (en) * | 1995-09-13 | 2002-06-18 | Daiichi Fine Chemical Co., Ltd. | D-pantolactone hydrolase and gene encoding the same |
US9296800B2 (en) * | 2009-06-04 | 2016-03-29 | Promedior, Inc. | Serum amyloid P derivatives and their preparation and use |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230058309A1 (en) | Serum amyloid p derivatives and their preparation and use | |
US7214660B2 (en) | Erythropoietin: remodeling and glycoconjugation of erythropoietin | |
US7179617B2 (en) | Factor IX: remolding and glycoconjugation of Factor IX | |
US7173003B2 (en) | Granulocyte colony stimulating factor: remodeling and glycoconjugation of G-CSF | |
US7125843B2 (en) | Glycoconjugates including more than one peptide | |
US7226903B2 (en) | Interferon beta: remodeling and glycoconjugation of interferon beta | |
JP6124943B2 (en) | SAP variants and uses thereof | |
US20140341875A1 (en) | Human chondroitinase glycoprotein (CHASEGP), process for preparing the same, and pharmaceutical compositions comprising thereof | |
EP3054959B1 (en) | Methods for treating fibrotic cancers | |
JP2012530714A5 (en) | ||
US7084106B1 (en) | Application of a viral complement inhibitory protein in the treatment and diagnosis of Alzheimer's Disease | |
JP2006503091A (en) | Protein modification |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |