US20220290125A1 - Rna affinity purification - Google Patents

Rna affinity purification Download PDF

Info

Publication number
US20220290125A1
US20220290125A1 US17/830,742 US202217830742A US2022290125A1 US 20220290125 A1 US20220290125 A1 US 20220290125A1 US 202217830742 A US202217830742 A US 202217830742A US 2022290125 A1 US2022290125 A1 US 2022290125A1
Authority
US
United States
Prior art keywords
rnase iii
thio
pseudouridine
iii enzyme
methyl
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
US17/830,742
Inventor
Edward J. Miracco
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ModernaTx Inc
Original Assignee
ModernaTx Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by ModernaTx Inc filed Critical ModernaTx Inc
Priority to US17/830,742 priority Critical patent/US20220290125A1/en
Publication of US20220290125A1 publication Critical patent/US20220290125A1/en
Assigned to MODERNATX, INC. reassignment MODERNATX, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: MIRACCO, Edward J.
Pending legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/34—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
    • C12Q1/44—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase involving esterase
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N11/00—Carrier-bound or immobilised enzymes; Carrier-bound or immobilised microbial cells; Preparation thereof
    • C12N11/14—Enzymes or microbial cells immobilised on or in an inorganic carrier
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1003—Extracting or separating nucleic acids from biological samples, e.g. pure separation or isolation methods; Conditions, buffers or apparatuses therefor
    • C12N15/1006—Extracting or separating nucleic acids from biological samples, e.g. pure separation or isolation methods; Conditions, buffers or apparatuses therefor by means of a solid support carrier, e.g. particles, polymers
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22—Ribonucleases RNAses, DNAses
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6806—Preparing nucleic acids for analysis, e.g. for polymerase chain reaction [PCR] assay
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y301/00—Hydrolases acting on ester bonds (3.1)
    • C12Y301/26—Endoribonucleases producing 5'-phosphomonoesters (3.1.26)
    • C12Y301/26003—Ribonuclease III (3.1.26.3)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y301/00—Hydrolases acting on ester bonds (3.1)
    • C12Y301/27—Endoribonucleases producing 3'-phosphomonoesters (3.1.27)
    • C12Y301/27004—Ribonuclease U2 (3.1.27.4)

Definitions

  • RNA synthesis reactions e.g., in vitro transcription reactions
  • dsRNA double-stranded RNA fragments that are difficult to separate from reaction mixtures containing a full-length, single-stranded RNA (ssRNA) product of interest.
  • ssRNA e.g., messenger RNA (mRNA)
  • the affinity purification methods of the present disclosure are based, at least in part, on experimental results showing that immobilized ribonuclease III (RNase III) and immobilized catalytically inactive RNase III variants, as provided herein, bind specifically to dsRNA, without non-specific degradation of the ssRNA (e.g., mRNA) of interest.
  • RNase III immobilized ribonuclease III
  • mRNA messenger RNA
  • nucleic acid preparation comprising messenger ribonucleic acid (mRNA) (e.g., an in vitro-transcribed mRNA) with an RNase III enzyme that is immobilized on a solid support (e.g., a resin).
  • mRNA messenger ribonucleic acid
  • RNase III enzyme that is immobilized on a solid support (e.g., a resin).
  • a nucleic acid preparation comprises contaminating double-stranded RNA, therefore, affinity purification methods, as provided herein, may be performed under conditions that result in binding of the RNase III enzyme to double-stranded RNA.
  • the RNase III enzyme is catalytically inactive.
  • the RNase III enzyme e.g., a catalytically inactive RNase III enzymes
  • the RNase III enzyme comprises an amino acid sequence identified by SEQ ID NO: 3 (wild-type Thermotoga maritima RNase III (TmR3)).
  • the RNase III enzyme may comprise, for example, an amino acid sequence having a modification at an amino acid position corresponding to E130 of the sequence identified by SEQ ID NO: 3.
  • the RNase III enzyme comprises an amino acid sequence identified by SEQ ID NO: 4 (variant Thermotoga maritima RNase III (E130K)).
  • RNA e.g., DNA
  • RNase III enzyme e.g., a catalytically inactive RNase III enzyme
  • a solid support e.g., a resin, such as a carboxy-reactive resin or an amino-reactive resin
  • compositions comprising RNA purified according to methods that comprise contacting a nucleic acid preparation comprising mRNA with an RNase III enzyme that is immobilized on a solid support.
  • the composition e.g., comprising the purified RNA
  • the composition is substantially free of double-stranded RNA.
  • compositions containing RNA prepared according to a method that comprises performing an in vitro transcription reaction in the presence of a template nucleic acid (e.g., DNA) to produce an in vitro transcription product (e.g., mRNA); and contacting the in vitro transcription product with an RNase III enzyme that is immobilized on a solid support.
  • a template nucleic acid e.g., DNA
  • an in vitro transcription product e.g., mRNA
  • RNase III enzyme that is immobilized on a solid support.
  • the composition is substantially free of double-stranded RNA.
  • FIG. 1 shows a Coomassie blue stained polyacrylamide gel.
  • Thermotoga maritima RNase III (TmR3) was expressed and purified by Ni-NTA affinity column to >99% purity. Different amounts (0.5 ⁇ g or 1 ⁇ g) of the purified TmR3 were resolved on the polyacrylamide gel.
  • the molecular weight of TmR3 is 28.5 kDa.
  • FIGS. 2A-2D show spectrums from a size-exclusion experiment used to analyze the degradation of mRNAs by TmR3 at different temperatures.
  • a human erythropoietin (hEpo) mRNA containing a natural 5′ cap (GO) was incubated in reaction mixtures containing purified TmR3 at room temperature ( FIG. 2A ), 37° C. ( FIG. 2C ), 45° C. ( FIG. 2B ), or 65° C. ( FIG. 2D ), and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at all temperatures, with most degraded fragments of the mRNA observed at 65° C.
  • FIGS. 3A-3D show spectrums from a size-exclusion experiment designed to analyze the degradation of mRNAs by TmR3 at different temperatures.
  • a human erythropoietin (hEPO) mRNA containing a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) was incubated in reaction mixtures containing purified TmR3 at room temperature ( FIG. 3A ), 37° C. ( FIG. 3C ), 45° C. ( FIG. 3B ), or 65° C. ( FIG. 3D ), and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at room temperature, 45° C., and 65° C., with most degraded fragments of the mRNA observed at 65° C.
  • FIGS. 4A-4D show spectrums from a size-exclusion experiment designed to analyze the degradation of mRNAs by TmR3 at different temperatures.
  • a luciferase (Luc) mRNA containing a natural 5′ Cap (GO) was incubated with purified TmR3 at room temperature ( FIG. 4A ), 37° C. ( FIG. 4C ), 45° C. ( FIG. 4B ), or 65° C. ( FIG. 4D ) and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at all temperatures, with most degraded fragments of the mRNA observed at 65° C.
  • FIGS. 5A-5D show spectrums from a size-exclusion experiment designed to analyze the degradation of mRNAs by TmR3 at different temperatures.
  • a luciferase (Luc) mRNA containing a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) was incubated in reaction mixtures containing purified TmR3 at room temperature ( FIG. 5A ), 37° C. ( FIG. 5C ), 45° C. ( FIG. 5B ), or 65° C. ( FIG. 5D ) and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at 37° C. and 65° C., with most degraded fragments of the mRNA observed at 65° C.
  • FIG. 6 shows a sequence alignment of the RNase III protein sequences from Aquifex aeolicus (top sequence, SEQ ID NO: 5), Thermotoga maritima (middle sequence, SEQ ID NO: 3) and Escherichia coli (bottom sequence, SEQ ID NO: 1).
  • FIG. 7 shows spectrums from a reverse-phase HPLC used to detect non-specific RNase contamination in a purified TmR3-E130K mutant.
  • 20 ⁇ g of human erythropoietin (hEPO) mRNA containing a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) was incubated in reactions mixtures containing the designated purified enzymes at room temperature for 1 hour, and the mixtures were analyzed on a size exclusion column. No detectable non-specific RNase was present.
  • FIGS. 8A-8B are gels showing the results of coupling wild type TmRNase III (TmR3) ( FIG. 8A ) and E130K TmR3 variant ( FIG. 8B ) to N-hydroxysuccinimide (NHS) resin.
  • TmR3 wild type TmRNase III
  • E130K TmR3 variant FIG. 8B
  • NHS N-hydroxysuccinimide
  • FIGS. 9A-9B are gels showing the results of coupling wild type TmR3 ( FIG. 9A ) and E130K TmR3 variant ( FIG. 9B ) to CarboxyLinkTM Coupling Resin.
  • the coupling efficiency was analyzed using SDS-PAGE and Bradford assays.
  • the coupling efficiency for the CarboxyLinkTM resin was less than that of the NHS resin.
  • FIGS. 10A-10B are graphs showing the results of an ELISA for human erythropoietin (EPO) expression ( FIG. 10A ) and INF-beta cytokine expression ( FIG. 10B ) in BJ fibroblasts 48 hours after transfected with mRNA coding for the human erythropoietin (hEpo) protein and purified using an affinity purification method of the present disclosure.
  • EPO human erythropoietin
  • hEpo human erythropoietin
  • RNA synthesis reactions such as in vitro transcription (IVT) reactions
  • IVT in vitro transcription
  • RNA synthesis reactions often contains some amount of contaminating RNA, including double-stranded RNA.
  • contaminants can adversely impact downstream molecular and therapeutic application, for example.
  • Provided herein are methods of removing specifically dsRNA contaminants from a RNA preparation. More generally, the present disclosure provides methods of purifying a nucleic acid preparation. The methods may comprise, for example, contacting a nucleic acid preparation with a RNase III enzyme that is immobilized on a solid support.
  • RNA synthesis reactions such as in vitro transcription reactions, typically produce an end product preparation that includes a mixture of different nucleic acid species. Purification of the intended single-stranded species is typically required prior to its use in any particular application (e.g., therapeutic application). Thus, affinity purification methods as provided herein are typically used to purify a “nucleic acid preparation,” which is simply a solution comprising nucleic acid, for example, a mixture of different nucleic acid species (e.g., full-length and truncated ssRNA, dsRNA, dsDNA, etc.).
  • nucleic acid preparation is simply a solution comprising nucleic acid, for example, a mixture of different nucleic acid species (e.g., full-length and truncated ssRNA, dsRNA, dsDNA, etc.).
  • a nucleic acid preparation is the end product of an in vitro transcription reaction (for example, using bacteriophage T7 RNA polymerase (e.g., as described in Donzeet et al., Nucleic Acids Res 30:e46, 2002; and Yu et al., Proc Natl Acad Sci USA 99:6047-6052, 2002)).
  • RNA (e.g., mRNA) preparations produced by IVT often contain contaminants, such as nucleic acid contaminants (e.g., DNA template) and protein contaminants (e.g., T7 RNA polymerase).
  • RNA contaminants e.g., via digestion of the DNA by DNases
  • protein contaminants e.g., via pheno-chloroform precipitation
  • Additional contaminate include truncated fragments of the ssRNA (e.g., mRNA) of interest generated by the T7 RNA polymerase.
  • these truncated fragments contain complementary species and form double-stranded RNA (dsRNA) species (e.g., as described in Kariko et al., Nucleic Acids Research, 2011, Vol. 39, No. 21, e142, 2009). It is difficult to separate such dsRNA contaminants from the desired ssRNA because the dsRNA contaminants and the ssRNA have very similar biochemical and biophysical properties.
  • affinity purification methods that use immobilized RNase III, and in some embodiments, immobilized catalytically inactive RNase III variants, that specifically bind to (and thus capture) dsRNA species from a RNA preparation, without non-specific degradation of the intended ssRNA (e.g., mRNA) product, as discussed in greater detail herein.
  • the affinity purification methods makes use of specific binding interactions between RNase III and double-stranded RNA.
  • RNase III (or a catalytically inactive variant thereof) is chemically immobilized or “coupled” to a solid support so that when a nucleic acid preparation is passed over the solid support (e.g., column), dsRNA molecules become bound to the RNase III.
  • the “flow through” fraction is essentially free of dsRNA contaminants.
  • a nucleic acid preparation may be “purified” using affinity purification methods of the present disclosure, optionally in combination with other purification methods that remove DNA and protein contaminants.
  • Purification generally, refers to a process (one or more steps) of isolating one particular species (e.g., mRNA) or a subgroup of species from a larger group of species (e.g., a combination of RNA, DNA and protein). A purification process results in enrichment of the RNA of interest.
  • purification can be partial (e.g., as in fractionation).
  • purification yields RNA of interest that is substantially free of other, chemically dissimilar types of molecules.
  • nucleic acids are purified from mixtures comprising proteins, lipids, carbohydrates, etc.
  • purification results in a RNA of interest that is in pure form, i.e., free or substantially free from all other substances, whether chemically similar or not.
  • RNA of interest comprises less than 20%, less than 10%, less than 18%, less than 17%, less than 16%, less than 15%, less than 14%, less than 135, less than 12%, less than 11%, less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2%, less than 1%, less than 0.5%, less than 0.1%, or less than 0.01% of the substance by weight or by molarity.
  • a RNA of interest may be subjected to more than one purification process (in addition to the affinity purification methods of as provided herein).
  • RNase III Ribonuclease III
  • RNase III is an endoribonuclease that binds to and cleaves double stranded RNA.
  • the enzyme is expressed in many organisms and is highly conserved (e.g., Mian et al., Nucleic Acids Res., 1997, 25, 3187-95).
  • RNase III species cloned to date contain an RNase III signature sequence and vary in size from 25 to 50 kDa. Multiple functions have been ascribed to RNase III.
  • RNase III is involved in the processing of pre-ribosomal RNA (pre-rRNA) (e.g., Elela et al., Cell, 1996, 85, 115-24). RNase III is also involved in the processing of small molecular weight nuclear RNAs (snRNAs) and small molecular weight nucleolar RNAs (snoRNAs) in S. cerevisiae (e.g., Chanfreau et al., Genes Dev. 1996, 11, 2741-51; Qu et al., Mol. Cell. Biol. 1996, 19, 1144-58). In E. coli , RNase III is involved in the degradation of some mRNA species (e.g., Court et al., Control of messenger RNA stability, 1993, Academic Press, Inc, pp. 71-116).
  • pre-rRNA pre-ribosomal RNA
  • snRNAs small molecular weight nuclear RNAs
  • snoRNAs small molecular weight nucleolar RNA
  • Drosophila and Caenorhabditis elegans RNase III enzymes There are several types of Drosophila and Caenorhabditis elegans RNase III enzymes.
  • the canonical RNase III contains a single RNase III signature motif and a double-stranded RNA binding domain (dsRBD; e.g. RNC_CAEEL).
  • Drosha (Filippov et al. (2000) Gene 245: 213-221) is a Drosophila enzyme that contains two RNase III motifs and a dsRBD (CeDrosha in C. elegans ).
  • Another type of RNase III enzyme contains two RNase III signatures and an amino terminal helicase domain (e.g. Drosophila CG4792, CG6493, C.
  • elegans K12H4.8 may be RNAi nucleases (Bass (2000) Cell 101: 235-238). Enzymes from each Drosophila and Caenorhabditis elegans type produce discrete ⁇ 22 nucleotide (nt) RNAs from dsRNA substrates. Some RNase III enzymes specifically bind to dsRNA molecules without cleaving the dsRNA (e.g., Blaszczyk et al., Structure , vol. 12, 457-466, 2004).
  • RNase III enzymes that may be used in accordance with the present disclosure include RNase III enzymes that specifically bind to dsRNA.
  • a RNase III enzyme may be a bacterial enzyme or a eukaryotic (e.g., mammalian) enzyme.
  • a RNase III is an E. coli RNase III (EcR3).
  • a RNase III is a T. maritima RNase III.
  • a RNase III is an Aquifex aeolicus RNase III (AaR3).
  • a RNase III is a human RNase III.
  • RNase III enzymes and catalytically inactive variants thereof are immobilized on a solid support and then contacted with a nucleic acid preparation containing, for example, a mixture of single-stranded and double-stranded DNA.
  • Immobilized RNase III when in contact with double-stranded RNA (dsRNA) binds to (captures) the dsRNA such that the dsRNA remains associated with the solid support.
  • dsRNA double-stranded RNA
  • RNase III is considered “immobilized” on a solid support when the enzyme is covalently or non-covalently attached to the support such that the enzyme does not dissociate from the support when contacted with a pH neutral buffered solution.
  • a solid support may be a substance with a surface to which a RNase III enzyme or variant can be attached such that the polypeptide becomes immobilized with respect to the solid support.
  • a solid support of the present disclosure may be fabricated from one or more suitable materials, for example, plastics or synthetic polymers (e.g., polyethylene, polypropylene, polystyrene, polyamide, polyurethane, phenolic polymers, and/or nitrocellulose), naturally derived polymers (e.g., latex rubber, polysaccharides, and/or polypeptides), composite materials, ceramics, silica or silica-based materials, carbon, metals or metal compounds (e.g., comprising gold, silver, steel, aluminum, or copper), inorganic glasses, silica, and a variety of other suitable materials.
  • plastics or synthetic polymers e.g., polyethylene, polypropylene, polystyrene, polyamide, polyurethane, phenolic polymers, and/or nitrocellulose
  • Non-limiting examples of potentially suitable configurations include resins (e.g., agarose resin), beads (e.g., magnetic beads), tubes (e.g., nanotubes), plates, disks, dipsticks, chips, microchips, coverslips, or the like.
  • resins e.g., agarose resin
  • beads e.g., magnetic beads
  • tubes e.g., nanotubes
  • plates disks, dipsticks, chips, microchips, coverslips, or the like.
  • the surface of the support may comprise reactive functional groups that form covalent bonds with RNase III or a variant thereof.
  • the functional groups are chemical functionalities. That is, the binding surface may be derivatized such that a chemical functionality is presented at the binding surface, which can react with a chemical functionality on polypeptide to be attached, resulting in immobilization. Examples of functional groups for attachment that may be useful include, but are not limited to, amino-reactive groups, carboxyl-reactive groups, epoxide groups, maleimide groups, oxo groups, and thiol groups.
  • Crosslinkers for attaching proteins to a support member are known in the art; for example, homo- or hetero-bifunctional crosslinkers as are well known (e.g., see 1994 Pierce Chemical Company catalog, technical section on crosslinkers, pages 155-200, or “Bioconjugate Techniques” by Greg T. Hermanson, Academic Press, 1996).
  • Non-limiting example of crosslinkers include alkyl groups (including substituted alkyl groups and alkyl groups containing heteroatom moieties), esters, amide, amine, epoxy groups and ethylene glycol and derivatives.
  • a linker may also be a sulfone group, forming a sulfonamide.
  • the functional group is a light-activated functional group. That is, the functional group can be activated by light to attach the capture component to the capture object surface.
  • One example is PhotoLinkTM technology available from SurModics, Inc. in Eden Prairie, Minn.
  • the examples provided herein on the solid support and the surface composition are not meant to be limiting. Any solid support that are known in the art to be suitable for immobilization of polypeptides may be used in accordance with the present disclosure. Immobilization of RNase III to a solid support is carried out under conditions that maintains the structure and activity of RNase III. One skilled in the art is familiar with such conditions.
  • RNase III Enzymes Any RNase III or variant thereof (e.g., catalytically inactive variant) that binds specifically to dsRNA may be used in accordance with the present disclosure.
  • RNase III enzymes and catalytically inactivate RNase III variants are listed in Table 1.
  • a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 1.
  • a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 1.
  • a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 1.
  • a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 1.
  • a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 1 having an amino acid substitution mutation at position E117.
  • a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 1 having a lysine (K) at position 117 (E117K).
  • a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 1 having a lysine (K) at position 117 (E117K).
  • a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 1 having a lysine (K) at position 117 (E117K).
  • the RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 2.
  • a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 3.
  • a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 3.
  • a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 3.
  • a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 3.
  • a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 3 having an amino acid substitution mutation at position E130.
  • a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 3 having a lysine (K) at position 130 (E130K).
  • a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 3 having a lysine (K) at position 130 (E130K).
  • a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 3 having a lysine (K) at position 130 (E130K).
  • the RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 4.
  • a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 5.
  • a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 5.
  • a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 5.
  • a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 5.
  • a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 5 having an amino acid substitution mutation at position E110.
  • a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 5 having a lysine (K) at position 110 (E110K).
  • a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 5 having a lysine (K) at position 110 (E110K).
  • a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 5 having a lysine (K) at position 110 (E110K).
  • the RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 6.
  • thermostable RNase III e.g., Thermotoga maritima RNase III
  • a nucleic acid e.g., IVT RNA
  • Thermostability refers to the quality of enzymes to resist denaturation at high relative temperature. For example, if an enzyme is denatured (inactivated) at a temperature of 42° C., an enzyme having similar activity (e.g., exonuclease activity) is considered “thermostable” if it does not denature at 42° C. An enzyme (e.g., RNase III) is considered thermostable if the enzyme (a) retains activity (e.g., at least 50% activity) after temporary exposure to high temperatures that denature other non-thermostable enzymes or (b) functions at a high rate (e.g., greater than 50%) after temporary exposure to a medium to high temperature where non-thermostable enzymes function at low rates.
  • an enzyme having similar activity e.g., exonuclease activity
  • thermostable RNase III e.g., Thermotoga maritima RNase III
  • a thermostable RNase III retains greater than 50% activity (e.g., dsRNA binding and/or cleavage activity) following temporary exposure to high relative temperature (e.g., higher than 70° C. for Thermotoga maritima RNase III) that would otherwise denature a similar non-thermostable RNase III.
  • a thermostable RNase III retains 50-100% activity following temporary exposure to high relative temperature (e.g., at least 70, 80, 90, or 95° C.) that would otherwise denature a similar non-thermostable RNase III.
  • thermostable RNase III may retain 50-90%, 50-85%, 50-80%, 50-75%, 50-70%, 50-65%, 50-60%, or 50-55% activity following temporary exposure to high relative temperature that would otherwise denature a similar non-thermostable RNase III.
  • a thermostable RNase III retains 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% activity following temporary exposure to high relative temperature that would otherwise denature a similar non-thermostable RNase III.
  • the activity of a thermostable RNase III after temporary exposure medium to high temperature is greater than (e.g., 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% greater than) the activity of a similar non-thermostable RNase III.
  • Thermostable RNase III may remain active (able to bind and/or cleave dsRNA) at a temperatures of 40° C. to 95° C., or higher.
  • thermostable RNase III remain active at a temperature of 40-95° C., 40-90° C., 40-85° C., 40-80° C., 40-70° C., 40-60° C., 40-50° C., 40-45° C., 45-95° C., 45-90° C., 45-80° C., 45-70° C., 45-60° C., 45-50° C., 50-95° C., 50-90° C., 50-80° C., 50-70° C., 50-60° C., 60-95° C., 60-90° C., 60-80° C., 60-70° C., 70-95° C., 70-90° C., or 70-80° C.
  • thermostable RNase III may remain active at a temperature of 40° C., 41° C., 42° C., 43° C., 44° C., 45° C., 46° C., 47° C., 48° C., 49° C., 50° C., 51° C., 52° C., 53° C., 54° C., 55° C., 55° C., 56° C., 57° C., 58° C., 59° C., 60° C., 61° C., 62° C., 63° C., 64° C., 65° C., 66° C., 67° C., 68° C., 69° C., 70° C., 71° C., 72° C., 73° C., 74° C., 75° C., 76° C., 77° C., 78° C., 79° C., 80° C., 81° C., 82° C.
  • thermostable RNase III may remain active at high relative temperatures for 15 minutes to 48 hours, or longer.
  • thermostable RNase III may remain active at high relative temperatures for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 24, 36, 42, or 48 hours.
  • dsRNA binding activity may be monitored by an electrophoretic mobility shift assay (EMSA), using radioactive isotope (e.g., 32 P) or fluorescent dye labeled dsRNA substrates, and the dsRNA cleavage activity may be monitored by the emergence of RNA cleavage products.
  • ESA electrophoretic mobility shift assay
  • Some aspects of the present disclosure provide catalytically-inactive RNase III variants that may be used for the affinity purification methods.
  • Use of catalytically-inactive RNase III variants in the affinity purification methods prevent/reduce the occurrence of non-specific cleavage of ssRNA (e.g., mRNA) of interest.
  • a “catalytically inactive” form of RNase III is one the specifically binds to but does not cleave double-stranded RNA.
  • Catalytically inactive forms of RNase III therefore, may have at least one mutation (relative to wild-type RNase III) that impairs the endonucleolytic activity of the enzyme.
  • Non-limiting examples of catalytically inactive RNase III enzymes are listed in Table 1.
  • a RNase III used in the affinity purification methods as provided herein is an Escherichia coli RNase III variant comprising the amino acid sequence of SEQ ID NO: 1 having a lysine (K) residue at position 117 (e.g., SEQ ID NO: 2; E117K).
  • a RNase III used in the affinity purification methods as provided herein is an Thermotoga maritima RNase III variant comprising the amino acid sequence of SEQ ID NO: 3 having a lysine (K) residue at position 130 (e.g., SEQ ID NO: 4; E130K).
  • a RNase III used in the affinity purification methods as provided herein is an Aquifex aeolicus RNase III variant comprising the amino acid sequence of SEQ ID NO: 5 having a lysine (K) residue at position 130 (e.g., SEQ ID NO: 6; E110K).
  • K lysine residue
  • Other catalytically inactive RNase III variants may be used in accordance with the present disclosure, provided the variants bind specifically to double-stranded RNA.
  • RNase III homologs and fragments are also within the scope of the present disclosure.
  • RNase III fragments polypeptide sequences at least one amino acid residue shorter than a reference full-length RNase III enzyme sequence but otherwise identical having a length of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or greater than 100 amino acids.
  • RNase III polypeptide that includes a stretch of 20, 30, 40, 50, 60, 70, 80, 90, or 100 amino acids that are 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% identical to any of the RNase III sequences described herein may be utilized in an affinity purification method of the present disclosure, provided the polypeptide binds specifically to dsRNA (without non-specific cleavage of ssRNA).
  • Identity herein refers to the overall relatedness among polypeptides, for example, among RNase III and variants thereof.
  • the percent identity of two polypeptide sequences can be calculated by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes).
  • the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence.
  • the nucleotides at corresponding nucleotide positions are then compared.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two amino acid sequences can be determined using methods such as those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D.
  • Exemplary computer software to determine homology between two sequences include, but are not limited to, GCG program package, Devereux, J., et al., Nucleic Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN, and FASTA Altschul, S. F. et al., J. Molec. Biol., 215, 403 (1990)).
  • corresponding to an amino acid position in a sequence means that when two sequences (e.g., polypeptide sequence) are aligned (e.g., using any of the known sequence alignment programs in the art such as the ones described herein), a certain amino acid residue in one sequence aligns with the an amino acid residue in the other sequence, these two amino acid residues are considered to be “corresponding to” each other.
  • two amino acid residues that correspond to each other may not necessarily have the same numerical position.
  • catalytically essential glutamic acid (E) is located at position 117 of the amino acid identified by SEQ ID NO: 1 ( E.
  • catalytically essential glutamic (E) is located at position 130 of the amino acid identified by SEQ ID NO: 3 ( T. maritima ), and catalytically essential glutamic acid (E) is located at position 110 of the amino acid identified by SEQ ID NO: 5 ( A. aeolicus ).
  • RNase III enzymes, homologs, fragments and variants may be recombinantly produced and purified. Methods of expressing and purifying RNase III are known. For example, a nucleic acid sequence encoding an RNase III enzyme may be cloned into expression vectors, for the expression of the RNase III protein in a variety of host cells, e.g., bacterial cells, insect cells, or mammalian cells.
  • Affinity purification methods as provided herein are used, in some embodiments, to remove double-stranded RNA (dsRNA) from a preparation containing single-stranded RNA (ssRNA), such as in vitro transcribed mRNA.
  • dsRNA double-stranded RNA
  • ssRNA single-stranded RNA
  • a “single-stranded RNA” is a polymeric strand of contiguous ribonucleotides.
  • a “double-stranded RNA” is comprised of two polymeric strands of contiguous ribonucleotides bound to each other through complementary ribonucleotide base pairing.
  • Single-stranded RNA includes, without limitation, mRNA, ribosomal RNA (see, e.g., Widmann et al., Nucleic Acids Res.
  • a ssRNA is a messenger RNA (mRNA), such as a therapeutic mRNA.
  • mRNA messenger RNA
  • ssRNAs described herein may form intramolecular secondary structures and may be partially double-stranded.
  • a RNA molecule that is partially double-stranded due to intramolecular structures may be considered a “partially double-stranded” or a “partially single-stranded” molecule.
  • RNA molecules of the present disclosure may include a chemical modification (are chemically modified).
  • chemical modification refers to modification with respect to adenosine (A), guanosine (G), uridine (U), thymidine (T) or cytidine (C) ribonucleosides or deoxyribnucleosides in at least one of their position, pattern, percent or population. Generally, these terms do not refer to the ribonucleotide modifications in naturally occurring 5′-terminal mRNA cap moieties (5′ cap).
  • modification refers to a modification relative to the canonical set 20 amino acids.
  • Polypeptides, as provided herein, are also considered “modified” of they contain amino acid substitutions, insertions or a combination of substitutions and insertions.
  • Polynucleotides e.g., RNA polynucleotides, such as mRNA polynucleotides
  • RNA polynucleotides such as mRNA polynucleotides
  • a particular region of a polynucleotide contains one, two or more (optionally different) nucleoside or nucleotide modifications.
  • a modified RNA polynucleotide e.g., a modified mRNA polynucleotide
  • introduced to a cell or organism exhibits reduced degradation in the cell or organism, respectively, relative to an unmodified polynucleotide.
  • a modified RNA polynucleotide e.g., a modified mRNA polynucleotide
  • introduced into a cell or organism may exhibit reduced immunogenicity in the cell or organism, respectively (e.g., a reduced innate response).
  • RNA polynucleotides include, but are not limited to the following: 2-methylthio-N6-(cis-hydroxyisopentenyl)adenosine; 2-methylthio-N6-methyladenosine; 2-methylthio-N6-threonyl carbamoyladenosine; N6-glycinylcarbamoyladenosine; N6-isopentenyladenosine; N6-methyladenosine; N6-threonylcarbamoyladenosine; 1,2′-O-dimethyladenosine; 1-methyladenosine; 2′-O-methyladenosine; 2′-O-ribosyladenosine (phosphate); 2-methyladenosine; 2-methylthio-N6 isopentenyladenosine; 2-methylthio-N6-
  • polynucleotides e.g., RNA polynucleotides, such as mRNA polynucleotides
  • RNA polynucleotides include a combination of at least two (e.g., 2, 3, 4 or more) of the aforementioned modified nucleobases.
  • modified nucleobases in polynucleotides are selected from the group consisting of pseudouridine (W), N1-methylpseudouridine (mlyf), N1-ethylpseudouridine, 2-thiouridine, 4′-thiouridine, 5-methylcytosine, 2-thio-1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine, 2-thio-dihydropseudouridine, 2-thio-dihydrouridine, 2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine, 4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine, 4-thio-pseudouridine, 5-aza-uridine, di
  • polynucleotides e.g., RNA polynucleotides, such as mRNA polynucleotides
  • RNA polynucleotides include a combination of at least two (e.g., 2, 3, 4 or more) of the aforementioned modified nucleobases.
  • the purified ssRNA RNA of the present disclosure is a purified mRNA, it may comprise any additional modifications known to one of skill in the art and as described in US Patent Publications US20120046346 and US20120251618, and PCT Publication WO 2012/019168.
  • Other such components include, for example, a 5′ cap, a polyA tail, a Kozak sequence; a 3′ untranslated region (3′ UTR); a 5′ untranslated region (5′ UTR); one or more intronic nucleotide sequences capable of being excised from the nucleic acid, or any combination thereof.
  • the purified mRNAs of the present disclosure comprises a natural 5′ cap.
  • a 5′ cap may be a 5′ cap analog, such as, e.g., a 5′ diguanosine cap, tetraphosphate cap analogs having a methylene-bis (phosphonate) moiety, cap analogs having a sulfur substitution for a non-bridging oxygen, N7-benzylated dinucleoside tetraphosphate analogs, or anti-reverse cap analogs.
  • the 5′ cap is 7mG(5′)ppp(5′)NlmpNp.
  • the 5′cap analog is a 5′diguanosine cap.
  • the synthetic, modified mRNA of the present disclosure does not comprise a 5′ triphosphate.
  • Both the 5′UTR and the 3′UTR are typically transcribed from the genomic DNA and are elements of the premature mRNA.
  • Characteristic structural features of mature mRNA, such as the 5′-cap and the 3′-poly(A) tail are usually added to the transcribed (premature) mRNA during mRNA processing.
  • the 3′-poly(A) tail is typically a stretch of adenine nucleotides added to the 3′-end of the transcribed mRNA.
  • the length of the 3′-poly(A) tail may be an essential element with respect to the stability of the individual mRNA.
  • a poly-A tail may be greater than 30 nucleotides in length, greater than 35 nucleotides in length, at least 40 nucleotides, at least 45 nucleotides, at least 55 nucleotides, at least 60 nucleotide, at least 70 nucleotides, at least 80 nucleotides, at least 90 nucleotides, at least 100 nucleotides, at least 200 nucleotides, at least 300 nucleotides, at least 400 nucleotides, at least 500 nucleotides, at least 600 nucleotides, at least 700 nucleotides, at least 800 nucleotides, at least 900 nucleotides, at least 1000 nucleotides, or more.
  • the purified mRNA of the present disclosure encodes a protein.
  • the protein is an antigen, e.g., a viral antigen.
  • the modified mRNA purified using the methods described herein may be used as a mRNA vaccine.
  • Method of purifying a nucleic acid (e.g., mRNA) preparation of the present disclosure generally include contacting the nucleic acid preparation with an RNase III enzyme that is immobilized on a solid support.
  • An affinity purification method may, in some embodiments, include the following steps: (1) incubating a nucleic acid preparation (e.g., a solution containing in vitro-transcribed mRNA) with a solid support to which a RNase III enzyme (e.g., a thermostable RNase III enzyme) or variant thereof (e.g., a catalytically active RNase III) is immobilized under conditions that result in binding of double-stranded RNA (dsRNA) to the immobilized RNase III enzyme; (2) eluting unbound preparation components from the support using appropriate buffers that maintain the binding interaction between the RNase III enzyme and the dsRNA to produce a preparation enriched for single-stranded RNA (ssRNA) (a “ssRNA-enriched preparation”); and (3) optionally performing at least one additional purification process to isolate a ssRNA (e.g., mRNA) from the preparation.
  • a nucleic acid preparation e.g., a solution containing in vitro-tran
  • Methods may be performed “under conditions that result in binding of the RNase III enzyme to double-stranded RNA.” These conditions are readily determined by a skilled artisan and include, for example, temperature conditions, buffer (e.g., salt and pH) conditions, and reaction/process time.
  • buffer e.g., salt and pH
  • an affinity purification method as provided herein is performed using a RNase III enzyme (e.g., identified by SEQ ID NO: 1, 2, 5 or 6) that is optimally active at a temperature of 20° C.-42° C.
  • a RNase III enzyme e.g., identified by SEQ ID NO: 1, 2, 5 or 6
  • an affinity purification method is performed at 20° C.-42° C.
  • an affinity purification method may be performed at 20° C., 21° C., 22° C., 23° C., 24° C., 25° C., 26° C., 27° C., 28° C., 29° C., 30° C., 31° C., 32° C., 33° C., 34° C., 35° C., 36° C., 37° C., 38° C., 39° C., 40° C., 41° C., 42° C., or within a range having endpoints defined by any two of the foregoing temperatures.
  • an affinity purification method as provided herein is performed using a RNase III enzyme (e.g., identified by SEQ ID NO: 3 or 4) that is optimally active at a temperature of 40° C.-70° C.
  • a RNase III enzyme e.g., identified by SEQ ID NO: 3 or 4
  • an affinity purification method is performed at 40° C.-70° C.
  • an affinity purification method may be performed at 40° C., 41° C., 42° C., 43° C., 44° C., 45° C., 46° C., 47° C., 48° C., 49° C., 50° C., 51° C., 52° C., 53° C., 54° C., 55° C., 56° C., 57° C., 58° C., 59° C., 60° C., 61° C., 62° C., 63° C., 64° C., 65° C., 66° C., 67° C., 68° C., 69° C., 70° C., or within a range having endpoints defined by any two of the foregoing temperatures.
  • an affinity purification method is performed at a temperature greater than 70° C.
  • an affinity purification method may be performed at 75° C., 80° C., 85° C., 90° C., or 95° C
  • a nucleic acid preparation (e.g., an IVT preparation) is contacted with RNase III enzyme immobilized on a solid support for 5 minutes to 3 hours, or longer.
  • a nucleic acid preparation may be contacted with RNase III enzyme immobilized on a solid support for 5 minutes, 10 minutes, 15 minutes, 20 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, or longer.
  • affinity purification methods further comprise separating solid phase RNase III-dsRNA complexes from the liquid phase ssRNA-enriched preparation.
  • This separation step(s) depends on the type of solid support used in an affinity purification method. For example, for RNase III immobilized on a resin, the ssRNA-enriched preparation may be separated by centrifugation. For RNase III immobilized on magnetic beads, a magnet may be used to remove the beads from the ssRNA-enriched preparation. Separation of the solid phase from the liquid phase yields ssRNA that is substantially free of dsRNA contaminants.
  • the nucleic acid preparation may be subjected to one or more additional purification methods to remove DNA and/or protein contaminants.
  • additional purification methods to remove DNA and/or protein contaminants.
  • compositions comprising ssRNA (e.g., mRNA) prepared, for example, via IVT and purified according to the affinity purification methods as provided herein.
  • the compositions are therapeutic composition.
  • the RNA (e.g., mRNA) purified using the methods of the present disclosure may be used in a vaccine composition to treat or prevent cancer or an infectious disease.
  • a composition comprises a RNA (e.g., mRNA) purified by a method of the present disclosure having an open reading frame comprising at least one chemical modification or optionally no nucleotide modification, a 5′ terminal cap that is 7mG(5′)ppp(5′)NlmpNp, and a polyA tail.
  • 100% of the uracil in the open reading frame have a chemical modification.
  • a chemical modification is in the 5-position of the uracil.
  • a chemical modification is a N1-methyl pseudouridine.
  • 100% of the uracil in the open reading frame have a N1-methyl pseudouridine in the 5-position of the uracil.
  • the RNA (e.g., mRNA) purified using the methods of the present disclosure may be formulated in a nanoparticle, such as a lipid particle described, for example, in any one of International Application No. PCT/US16/58327, International Application No. PCT/US16/583140, and International Application No. PCT/US16/58324, each of which was filed Oct. 21, 2016 and is herein incorporated by reference.
  • the nanoparticle has a mean diameter of 50-200 nm.
  • the nanoparticle is a lipid nanoparticle.
  • the lipid nanoparticle comprises a cationic lipid, a PEG-modified lipid, a sterol and a non-cationic lipid. In some embodiments, the lipid nanoparticle comprises a molar ratio of about 20-60% cationic lipid, 0.5-15% PEG-modified lipid, 25-55% sterol, and 25% non-cationic lipid. In some embodiments, a lipid nanoparticle comprises a cationic lipid, a PEG-modified lipid, a sterol and a non-cationic lipid.
  • a cationic lipid is an ionizable cationic lipid and the non-cationic lipid is a neutral lipid, and the sterol is a cholesterol.
  • a cationic lipid is selected from the group consisting of 2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA), dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), di((Z)-non-2-en-1-yl) 9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), (12Z,15Z)—N,N-dimethyl-2-nonylhenicosa-12,15-dien-1-amine (L608), and N,N-dimethyl-1-[(1S,2R)-2-octy
  • a lipid nanoparticle comprises compounds of Formula (I) and/or Formula (II) and encapsulates a RNA (e.g., mRNA) purified using the methods of the present disclosure.
  • a RNA e.g., mRNA
  • a nanoparticle comprises compounds of Formula (I):
  • R 1 is selected from the group consisting of C 5-30 alkyl, C 5-20 alkenyl, —R*YR′′, —YR′′, and —R′′M′R′;
  • R 2 and R 3 are independently selected from the group consisting of H, C 1-14 alkyl, C 2-14 alkenyl, —R*YR′′, —YR′′, and —R*OR′′, or R 2 and R 3 , together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R 4 is selected from the group consisting of a C 3-6 carbocycle, —(CH 2 ) n Q, —(CH 2 ) n CHQR, —CHQR, —CQ(R) 2 , and unsubstituted C 1-6 alkyl, where Q is selected from a carbocycle, heterocycle, —OR, —O(CH 2 ) n N(R) 2 , —C(O)OR, —OC(O)R, —CX 3 , —CX 2 H, —CXH 2 , —CN, —N(R) 2 , —C(O)N(R) 2 , —N(R)C(O)R, —N(R)S(O) 2 R, —N(R)C(O)N(R) 2 , —N(R)C(S)N(R) 2 , —N(R)R 8 , —O(CH 2 ) n OR,
  • each R 5 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R 6 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O) 2 —, —S—S—, an aryl group, and a heteroaryl group;
  • R 7 is selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • R 8 is selected from the group consisting of C 3-6 carbocycle and heterocycle
  • R 9 is selected from the group consisting of H, CN, NO 2 , C 1-6 alkyl, —OR, —S(O) 2 R, —S(O) 2 N(R) 2 , C 2-6 alkenyl, C 3-6 carbocycle and heterocycle;
  • each R is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C 1-18 alkyl, C 2-18 alkenyl, —R*YR′′, —YR′′, and H;
  • each R′′ is independently selected from the group consisting of C 3-14 alkyl and C 3-14 alkenyl
  • each R* is independently selected from the group consisting of C 1-12 alkyl and C 2-12 alkenyl;
  • each Y is independently a C 3-6 carbocycle
  • each X is independently selected from the group consisting of F, Cl, Br, and I;
  • n is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13.
  • a subset of compounds of Formula (I) includes those in which when R 4 is —(CH 2 ) n Q, —(CH 2 ) n CHQR, —CHQR, or —CQ(R) 2 , then (i) Q is not —N(R) 2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2.
  • another subset of compounds of Formula (I) includes those in which
  • R 1 is selected from the group consisting of C 5-30 alkyl, C 5-20 alkenyl, —R*YR′′, —YR′′, and —R′′M′R′;
  • R 2 and R 3 are independently selected from the group consisting of H, C 1-14 alkyl, C 2-14 alkenyl, —R*YR′′, —YR′′, and —R*OR′′, or R 2 and R 3 , together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R 4 is selected from the group consisting of a C 3-6 carbocycle, —(CH 2 ) n Q, —(CH 2 ) n CHQR, —CHQR, —CQ(R) 2 , and unsubstituted C 1-6 alkyl, where Q is selected from a C 3-6 carbocycle, a 5- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S, —OR, —O(CH 2 ) n N(R) 2 , —C(O)OR, —OC(O)R, —CX 3 , —CX 2 H, —CXH 2 , —CN, —C(O)N(R) 2 , —N(R)C(O)R, —N(R)S(O) 2 R, —N(R)C(O)N(R) 2 , —N(R)C(S)N(R) 2 , —CRN
  • each R 5 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R 6 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O) 2 —, —S—S—, an aryl group, and a heteroaryl group;
  • R 7 is selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • R 8 is selected from the group consisting of C 3-6 carbocycle and heterocycle
  • R 9 is selected from the group consisting of H, CN, NO 2 , C 1-6 alkyl, —OR, —S(O) 2 R, —S(O) 2 N(R) 2 , C 2-6 alkenyl, C 3-6 carbocycle and heterocycle;
  • each R is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C 1-18 alkyl, C 2-18 alkenyl, —R*YR′′, —YR′′, and H;
  • each R′′ is independently selected from the group consisting of C 3-14 alkyl and C 3-14 alkenyl
  • each R* is independently selected from the group consisting of C 1-12 alkyl and C 2-12 alkenyl;
  • each Y is independently a C 3-6 carbocycle
  • each X is independently selected from the group consisting of F, Cl, Br, and I;
  • n is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • another subset of compounds of Formula (I) includes those in which
  • R 1 is selected from the group consisting of C 5-30 alkyl, C 5-20 alkenyl, —R*YR′′, —YR′′, and —R′′M′R′;
  • R 2 and R 3 are independently selected from the group consisting of H, C 1-14 alkyl, C 2-14 alkenyl, —R*YR′′, —YR′′, and —R*OR′′, or R 2 and R 3 , together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R 4 is selected from the group consisting of a C 3-6 carbocycle, —(CH 2 ) n Q, —(CH 2 ) n CHQR, —CHQR, —CQ(R) 2 , and unsubstituted C 1-6 alkyl, where Q is selected from a C 3-6 carbocycle, a 5- to 14-membered heterocycle having one or more heteroatoms selected from N, O, and S, —OR, —O(CH 2 ) n N(R) 2 , —C(O)OR, —OC(O)R, —CX 3 , —CX 2 H, —CXH 2 , —CN, —C(O)N(R) 2 , —N(R)C(O)R, —N(R)S(O) 2 R, —N(R)C(O)N(R) 2 , —N(R)C(S)N(R) 2 , —CRN(
  • each R 5 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R 6 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O) 2 —, —S—S—, an aryl group, and a heteroaryl group;
  • R 7 is selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • R 8 is selected from the group consisting of C 3-6 carbocycle and heterocycle
  • R 9 is selected from the group consisting of H, CN, NO 2 , C 1-6 alkyl, —OR, —S(O) 2 R, —S(O) 2 N(R) 2 , C 2-6 alkenyl, C 3-6 carbocycle and heterocycle;
  • each R is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C 1-18 alkyl, C 2-18 alkenyl, —R*YR′′, —YR′′, and H;
  • each R′′ is independently selected from the group consisting of C 3-14 alkyl and C 3-14 alkenyl
  • each R* is independently selected from the group consisting of C 1-12 alkyl and C 2-12 alkenyl;
  • each Y is independently a C 3-6 carbocycle
  • each X is independently selected from the group consisting of F, Cl, Br, and I;
  • n is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • another subset of compounds of Formula (I) includes those in which
  • R 1 is selected from the group consisting of C 5-30 alkyl, C 5-20 alkenyl, —R*YR′′, —YR′′, and —R′′M′R′;
  • R 2 and R 3 are independently selected from the group consisting of H, C 1-14 alkyl, C 2-14 alkenyl, —R*YR′′, —YR′′, and —R*OR′′, or R 2 and R 3 , together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R 4 is selected from the group consisting of a C 3-6 carbocycle, —(CH 2 ) n Q, —(CH 2 ) n CHQR, —CHQR, —CQ(R) 2 , and unsubstituted C 1-6 alkyl, where Q is selected from a C 3-6 carbocycle, a 5- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S, —OR, —O(CH 2 )n N(R) 2 , —C(O)OR, —OC(O)R, —CX 3 , —CX 2 H, —CXH 2 , —CN, —C(O)N(R) 2 , —N(R)C(O)R, —N(R)S(O) 2 R, —N(R)C(O)N(R) 2 , —N(R)C(S)N(R) 2 , —CRN(
  • each R 5 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R 6 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O) 2 —, —S—S—, an aryl group, and a heteroaryl group;
  • R 7 is selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • R 8 is selected from the group consisting of C 3-6 carbocycle and heterocycle
  • R 9 is selected from the group consisting of H, CN, NO 2 , C 1-6 alkyl, —OR, —S(O) 2 R, —S(O) 2 N(R) 2 , C 2-6 alkenyl, C 3-6 carbocycle and heterocycle;
  • each R is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C 1-18 alkyl, C 2-18 alkenyl, —R*YR′′, —YR′′, and H;
  • each R′′ is independently selected from the group consisting of C 3-14 alkyl and C 3-14 alkenyl
  • each R* is independently selected from the group consisting of C 1-12 alkyl and C 2-12 alkenyl;
  • each Y is independently a C 3-6 carbocycle
  • each X is independently selected from the group consisting of F, Cl, Br, and I;
  • n is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • another subset of compounds of Formula (I) includes those in which
  • R 1 is selected from the group consisting of C 5-30 alkyl, C 5-20 alkenyl, —R*YR′′, —YR′′, and —R′′M′R′;
  • R 2 and R 3 are independently selected from the group consisting of H, C 2-14 alkyl, C 2-14 alkenyl, —R*YR′′, —YR′′, and —R*OR′′, or R 2 and R 3 , together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R 4 is —(CH 2 ) n Q or —(CH 2 ) n CHQR, where Q is —N(R) 2 , and n is selected from 3, 4, and 5;
  • each R 5 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R 6 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O) 2 —, —S—S—, an aryl group, and a heteroaryl group;
  • R 7 is selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C 1-18 alkyl, C 2-18 alkenyl, —R*YR′′, —YR′′, and H;
  • each R′′ is independently selected from the group consisting of C 3-14 alkyl and C 3-14 alkenyl
  • each R* is independently selected from the group consisting of C 1-12 alkyl and C 1-12 alkenyl;
  • each Y is independently a C 3-6 carbocycle
  • each X is independently selected from the group consisting of F, Cl, Br, and I;
  • n is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • another subset of compounds of Formula (I) includes those in which
  • R 1 is selected from the group consisting of C 5-30 alkyl, C 5-20 alkenyl, —R*YR′′, —YR′′, and —R′′M′R′;
  • R 2 and R 3 are independently selected from the group consisting of C 1-14 alkyl, C 2-14 alkenyl, —R*YR′′, —YR′′, and —R*OR′′, or R 2 and R 3 , together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R 4 is selected from the group consisting of —(CH 2 ) n Q, —(CH 2 ) n CHQR, —CHQR, and —CQ(R) 2 , where Q is —N(R) 2 , and n is selected from 1, 2, 3, 4, and 5;
  • each R 5 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R 6 is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O) 2 —, —S—S—, an aryl group, and a heteroaryl group;
  • R 7 is selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R is independently selected from the group consisting of C 1-3 alkyl, C 2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C 1-18 alkyl, C 2-18 alkenyl, —R*YR′′, —YR′′, and H;
  • each R′′ is independently selected from the group consisting of C 3-14 alkyl and C 3-14 alkenyl
  • each R* is independently selected from the group consisting of C 1-12 alkyl and C 1-12 alkenyl;
  • each Y is independently a C 3-6 carbocycle
  • each X is independently selected from the group consisting of F, Cl, Br, and I;
  • n is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • a subset of compounds of Formula (I) includes those of Formula (IA):
  • M 1 is a bond or M′;
  • a subset of compounds of Formula (I) includes those of Formula (II):
  • M 1 is a bond or M′
  • a subset of compounds of Formula (I) includes those of Formula (IIa), (IIb), (IIc), or (IIe):
  • R 4 is as described herein.
  • a subset of compounds of Formula (I) includes those of Formula (Id):
  • each of R 2 and R 3 may be independently selected from the group consisting of C 5-14 alkyl and C 5-14 alkenyl.
  • a subset of compounds of Formula (I) includes those of Formula (IIa), (IIb), (IIc), or (IIe):
  • R 4 is as described herein.
  • a subset of compounds of Formula (I) includes those of Formula (IId):
  • each of R 2 and R 3 may be independently selected from the group consisting of C 5-14 alkyl and C 5-14 alkenyl.
  • the compound of Formula (I) is selected from the group consisting of:
  • the compound of Formula (I) is selected from the group consisting of:
  • the compound of Formula (I) is selected from the group consisting of:
  • a nanoparticle comprises the following compound:
  • a lipid nanoparticle comprises Compounds 3, 18, 20, 25, 26, 29, 30, 60, 108-112, or 122.
  • the nanoparticle has a polydispersity value of less than 0.4 (e.g., less than 0.3, 0.2 or 0.1).
  • the nanoparticle has a net neutral charge at a neutral pH value.
  • TmR3 thermostable Thermotoga maritima RNase III
  • the mutation in the catalytically-essential glutamic acid residue in the TmR3 protein, which renders the TmR3 catalytically inactive, does not alter its binding affinity (e.g., indicated by K M ) to dsRNA (e.g., Nicholson et al., Wiley Interdiscip Rev RNA. 2014 January; 5(1): 31-48).
  • the protein sequence of the recombinant TmR3 is identified by SEQ ID NO: 7.
  • TmR3 protein sequence with 8xHis tag (SEQ ID NO: 7) M HHHHHHHH NESERKIVEEFQKETGINFKNEELLFRALCH SSYANEQNQAGRKDVESNEKLEFLGDAVLELFVCEILYKK YPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFLFLGKG EEKTGGRDRDSILADAF E ALLAAIYLDQGYEKIKELFEQE FEFYIEKIMKGEMLFDYKTALQEIVQSEHKVPPEYILVRT EKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAY EKLLKERS (underlined sequence: 8xHis tag; bolded amino acid: glutamic acid residue critical for catalytic activity)
  • RNA e.g., mRNA
  • synthetic mRNA was incubated with the purified TmR3 described in Example 1 at different temperatures (37° C., 45° C., or 65° C.) and non-specific degradation of the mRNA was analyzed on a size-exclusion column. mRNA having different 5′cap structures were also tested.
  • FIGS. 2A-2D A human erythropoietin (hEPO) mRNA containing a natural 5′ cap (GO) ( FIGS. 2A-2D ) or a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) ( FIGS. 3A-3D ) was incubated in reaction mixtures containing purified TmR3 at room temperature, 37° C., 45° C., or 65° C., and non-specific degradation products were observed at all temperatures, with most degraded fragments of the mRNA observed at 65° C.
  • GO natural 5′ cap
  • FIGS. 3A-3D A human erythropoietin
  • a luciferase (Luc) mRNA containing a natural 5′ cap (GO) ( FIGS. 4A-4D ) or a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) ( FIGS. 5A-5D ) was incubated in reaction mixtures containing purified TmR3 at room temperature, 37° C., 45° C., or 65° C., and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at almost all temperatures, with most degraded fragments of the mRNA observed at 65° C.
  • TmR3 reduces the non-specific RNA degradation observed in Example 2 ( FIGS. 2A-5D ).
  • a E117K mutation abolished the catalytic activity of E. Coli RNase III.
  • the cognate mutation in TmR3 is E130K ( FIG. 6 ).
  • the TmR3-E130K mutant was expressed and purified. The expression and purification conditions and the yield are shown in Table 2.
  • TmR3 contains any non-specific RNase contamination
  • 20 ⁇ g of hEPO mRNA with a G5 cap was incubated with different amounts of TmR3 or TmR3-E130K in the buffer specified in Table 1.
  • a reaction containing no added RNase was also used as a negative control.
  • the reaction mixtures were incubated at room temperature for 1 hour, before the mixtures were subjected to the size exclusion analysis as described in Example 2. No detectable non-specific RNA contamination was observed ( FIG. 7 ).
  • RNA substrate tagged with a fluorescent reporter molecule (fluor) on one end and a quencher on the other were incubated at 37° C. for 1 hour with a test buffer containing a RNA substrate tagged with a fluorescent reporter molecule (fluor) on one end and a quencher on the other. Degradation of the RNA substrate separates the quencher and the fluor, producing green fluorescence when excited by light of appropriate wavelength. Green fluorescence was not observed for TmR3 or TmR3-E130K, indicating the absence of a contaminating non-specific RNase.
  • fluor fluorescent reporter molecule
  • the TmR3-E130K mutant protein is suitable for use in RNA purification.
  • RNA purification For example, in an in vitro transcription reaction where a mRNA is being produced, there often are short, double stranded RNA contaminants. Removing the dsRNA contaminants would yield pure mRNA.
  • the TmR3 protein e.g., TmR3-E130K
  • the TmR3 protein may be purified in large quantity and immobilized on a carboxy-reactive resin or amino reactive resin.
  • Carboxy-reactive resins and amino reactive resins are familiar to the skilled artisan and are commercially available.
  • the coupling procedure are also familiar to the skilled artisan. Different protein loading levels may be tested.
  • the resin may be packed into a column and equilibrated in appropriate buffer before the RNA sample (e.g., an in vitro transcription reaction mixture) is loaded to the resin.
  • RNA sample e.g., an in vitro transcription reaction mixture
  • the dsRNA contaminants will be bound by the TmR3-E130K protein, while single-stranded mRNA is flowed through and collected.
  • the quality (e.g., purity and integrity) of the mRNA collected is then analyzed by gel electrophoresis, size exclusion column, or in functional assays.
  • N-hydroxysuccinimide (NHS) activated resins e.g., from ThermoFisher Scientific
  • CarboxyLinkTM resins e.g., from ThermoFisher Scientific
  • CarboxyLinkTM resin 1.71, 3.43 and 6.85 ml of WT TmR3 or 2, 4 and 8 ml of E310K TmR3 were added to achieve 0.5 ⁇ , 1.0 ⁇ and 2.0 ⁇ protein binding to 1 ml slurry. SDA-PAGE analysis and Bradford assays showed that the crosslinking efficiency was less than that for the NHS resin at all concentrations for both WT TmR3 and E130K TmR3 ( FIGS. 9A-9B , and Tables 5-6). Without being bound by theory, it is possible that the TmR3 proteins were crosslinked in solution and only a small percentage of the protein pool was able to successfully couple to the resin.
  • RNA purification methods described herein may be used to remove double-stranded RNA contaminants from single-stranded RNA preparations (e.g., mRNA produced via in vitro transcription).
  • MRNA coding for the human erythropoietin (Epo) protein was made using standard in vitro transcription conditions and purified using polyT affinity chromatography. 100 ⁇ g of mRNA was mixed with reaction buffer containing 33 mM Tris-acetate, pH 7.5, 66 mM potassium acetate, 10 mM magnesium acetate, and 0.5 mM TCEP, to a final volume of 250 ⁇ l and added to 250 ⁇ l of “2.0 ⁇ ” N-hydroxysuccinimide (NHS) resin containing either WT or E130K mutant immobilized RNase III enzyme. The slurry was incubated at room temperature for 30 minutes and then passed through a spin filter to remove the resin.
  • NHS N-hydroxysuccinimide
  • the clarified solution containing mRNA was transfected into BJ fibroblasts using L2000 according to the manufacturer protocol. Forty-eight hours after transfection, the supernatant from the transfection was collected and analyzed by ELISA for human EPO expression ( FIG. 10A ) and INF-beta cytokine expression ( FIG. 10B ) and according to their manufacturer protocols.

Abstract

Provided herein, in some embodiments, are methods of purifying a nucleic acid preparation. The methods may comprise contacting a nucleic acid preparation comprising messenger ribonucleic acid with an RNase III enzyme that is immobilized on a solid support and binds to double-stranded RNA contaminants.

Description

    RELATED APPLICATIONS
  • This application claims the benefit under 35 U.S.C. § 119(e) of U.S. provisional application No. 62/433,352, filed Dec. 13, 2016, which is incorporated by reference herein in its entirety.
    • BACKGROUND
  • High-quality ribonucleic acid (RNA) is required for many different biomolecular and therapeutic applications; however, RNA synthesis reactions (e.g., in vitro transcription reactions) often generate contaminating double-stranded RNA (dsRNA) fragments that are difficult to separate from reaction mixtures containing a full-length, single-stranded RNA (ssRNA) product of interest.
    • SUMMARY
  • Provided herein are systems, compositions, and affinity purification methods for removing dsRNA contaminants from a nucleic acid preparation that includes a ssRNA (e.g., messenger RNA (mRNA)) product of interest. The affinity purification methods of the present disclosure are based, at least in part, on experimental results showing that immobilized ribonuclease III (RNase III) and immobilized catalytically inactive RNase III variants, as provided herein, bind specifically to dsRNA, without non-specific degradation of the ssRNA (e.g., mRNA) of interest.
  • Thus, some aspects of the present disclosure provide methods of purifying a nucleic acid (e.g., RNA) preparation that comprise contacting a nucleic acid preparation comprising messenger ribonucleic acid (mRNA) (e.g., an in vitro-transcribed mRNA) with an RNase III enzyme that is immobilized on a solid support (e.g., a resin). Typically, such a nucleic acid preparation comprises contaminating double-stranded RNA, therefore, affinity purification methods, as provided herein, may be performed under conditions that result in binding of the RNase III enzyme to double-stranded RNA.
  • In some embodiments, the RNase III enzyme is catalytically inactive. In some embodiments, the RNase III enzyme (e.g., a catalytically inactive RNase III enzymes) is a thermostable (e.g., Thermotoga maritima) RNase III enzyme.
  • In some embodiments, the RNase III enzyme comprises an amino acid sequence identified by SEQ ID NO: 3 (wild-type Thermotoga maritima RNase III (TmR3)). The RNase III enzyme may comprise, for example, an amino acid sequence having a modification at an amino acid position corresponding to E130 of the sequence identified by SEQ ID NO: 3. In some embodiments, the RNase III enzyme comprises an amino acid sequence identified by SEQ ID NO: 4 (variant Thermotoga maritima RNase III (E130K)).
  • Other aspects of the present disclosure provide methods that comprise performing an in vitro transcription reaction in the presence of a template nucleic acid (e.g., DNA) to produce an in vitro transcription product (e.g., RNA, such as mRNA), and contacting the in vitro transcription product with a RNase III enzyme (e.g., a catalytically inactive RNase III enzyme) that is immobilized on a solid support (e.g., a resin, such as a carboxy-reactive resin or an amino-reactive resin).
  • Further provided herein are compositions comprising RNA purified according to methods that comprise contacting a nucleic acid preparation comprising mRNA with an RNase III enzyme that is immobilized on a solid support. In some embodiments, the composition (e.g., comprising the purified RNA) is substantially free of double-stranded RNA.
  • Also provided herein are compositions containing RNA prepared according to a method that comprises performing an in vitro transcription reaction in the presence of a template nucleic acid (e.g., DNA) to produce an in vitro transcription product (e.g., mRNA); and contacting the in vitro transcription product with an RNase III enzyme that is immobilized on a solid support. In some embodiments, the composition is substantially free of double-stranded RNA.
  • Each of the limitations of the invention can encompass various embodiments of the invention. It is, therefore, anticipated that each of the limitations of the invention involving any one element or combinations of elements can be included in each aspect of the invention.
  • This invention is not limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings. The invention is capable of other embodiments and of being practiced or of being carried out in various ways.
    • BRIEF DESCRIPTION OF THE DRAWINGS
  • The accompanying drawings are not intended to be drawn to scale. In the drawings, each identical or nearly identical component that is illustrated in various figures is represented by a like numeral. For purposes of clarity, not every component may be labeled in every drawing. In the drawings:
  • FIG. 1 shows a Coomassie blue stained polyacrylamide gel. Thermotoga maritima RNase III (TmR3) was expressed and purified by Ni-NTA affinity column to >99% purity. Different amounts (0.5 μg or 1 μg) of the purified TmR3 were resolved on the polyacrylamide gel. The molecular weight of TmR3 is 28.5 kDa.
  • FIGS. 2A-2D show spectrums from a size-exclusion experiment used to analyze the degradation of mRNAs by TmR3 at different temperatures. A human erythropoietin (hEpo) mRNA containing a natural 5′ cap (GO) was incubated in reaction mixtures containing purified TmR3 at room temperature (FIG. 2A), 37° C. (FIG. 2C), 45° C. (FIG. 2B), or 65° C. (FIG. 2D), and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at all temperatures, with most degraded fragments of the mRNA observed at 65° C.
  • FIGS. 3A-3D show spectrums from a size-exclusion experiment designed to analyze the degradation of mRNAs by TmR3 at different temperatures. A human erythropoietin (hEPO) mRNA containing a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) was incubated in reaction mixtures containing purified TmR3 at room temperature (FIG. 3A), 37° C. (FIG. 3C), 45° C. (FIG. 3B), or 65° C. (FIG. 3D), and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at room temperature, 45° C., and 65° C., with most degraded fragments of the mRNA observed at 65° C.
  • FIGS. 4A-4D show spectrums from a size-exclusion experiment designed to analyze the degradation of mRNAs by TmR3 at different temperatures. A luciferase (Luc) mRNA containing a natural 5′ Cap (GO) was incubated with purified TmR3 at room temperature (FIG. 4A), 37° C. (FIG. 4C), 45° C. (FIG. 4B), or 65° C. (FIG. 4D) and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at all temperatures, with most degraded fragments of the mRNA observed at 65° C.
  • FIGS. 5A-5D show spectrums from a size-exclusion experiment designed to analyze the degradation of mRNAs by TmR3 at different temperatures. A luciferase (Luc) mRNA containing a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) was incubated in reaction mixtures containing purified TmR3 at room temperature (FIG. 5A), 37° C. (FIG. 5C), 45° C. (FIG. 5B), or 65° C. (FIG. 5D) and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at 37° C. and 65° C., with most degraded fragments of the mRNA observed at 65° C.
  • FIG. 6 shows a sequence alignment of the RNase III protein sequences from Aquifex aeolicus (top sequence, SEQ ID NO: 5), Thermotoga maritima (middle sequence, SEQ ID NO: 3) and Escherichia coli (bottom sequence, SEQ ID NO: 1).
  • FIG. 7 shows spectrums from a reverse-phase HPLC used to detect non-specific RNase contamination in a purified TmR3-E130K mutant. 20 μg of human erythropoietin (hEPO) mRNA containing a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) was incubated in reactions mixtures containing the designated purified enzymes at room temperature for 1 hour, and the mixtures were analyzed on a size exclusion column. No detectable non-specific RNase was present.
  • FIGS. 8A-8B are gels showing the results of coupling wild type TmRNase III (TmR3) (FIG. 8A) and E130K TmR3 variant (FIG. 8B) to N-hydroxysuccinimide (NHS) resin. The coupling efficiency was analyzed using SDS-PAGE and Bradford assays. TmR3 proteins were efficiently coupled to the NHS resin.
  • FIGS. 9A-9B are gels showing the results of coupling wild type TmR3 (FIG. 9A) and E130K TmR3 variant (FIG. 9B) to CarboxyLink™ Coupling Resin. The coupling efficiency was analyzed using SDS-PAGE and Bradford assays. The coupling efficiency for the CarboxyLink™ resin was less than that of the NHS resin.
  • FIGS. 10A-10B are graphs showing the results of an ELISA for human erythropoietin (EPO) expression (FIG. 10A) and INF-beta cytokine expression (FIG. 10B) in BJ fibroblasts 48 hours after transfected with mRNA coding for the human erythropoietin (hEpo) protein and purified using an affinity purification method of the present disclosure.
    •  DETAILED DESCRIPTION
  • The product of ribonucleic acid (RNA) synthesis reactions, such as in vitro transcription (IVT) reactions, often contains some amount of contaminating RNA, including double-stranded RNA. Such contaminants can adversely impact downstream molecular and therapeutic application, for example. Provided herein are methods of removing specifically dsRNA contaminants from a RNA preparation. More generally, the present disclosure provides methods of purifying a nucleic acid preparation. The methods may comprise, for example, contacting a nucleic acid preparation with a RNase III enzyme that is immobilized on a solid support.
    • Affinity Purification Using RNase II Enzymes
  • RNA synthesis reactions, such as in vitro transcription reactions, typically produce an end product preparation that includes a mixture of different nucleic acid species. Purification of the intended single-stranded species is typically required prior to its use in any particular application (e.g., therapeutic application). Thus, affinity purification methods as provided herein are typically used to purify a “nucleic acid preparation,” which is simply a solution comprising nucleic acid, for example, a mixture of different nucleic acid species (e.g., full-length and truncated ssRNA, dsRNA, dsDNA, etc.). In some embodiments, a nucleic acid preparation is the end product of an in vitro transcription reaction (for example, using bacteriophage T7 RNA polymerase (e.g., as described in Donzeet et al., Nucleic Acids Res 30:e46, 2002; and Yu et al., Proc Natl Acad Sci USA 99:6047-6052, 2002)). RNA (e.g., mRNA) preparations produced by IVT often contain contaminants, such as nucleic acid contaminants (e.g., DNA template) and protein contaminants (e.g., T7 RNA polymerase). Methods of removing DNA contaminants (e.g., via digestion of the DNA by DNases) or protein contaminants (e.g., via pheno-chloroform precipitation) from an RNA preparation are known. Additional contaminate include truncated fragments of the ssRNA (e.g., mRNA) of interest generated by the T7 RNA polymerase. In some instances, these truncated fragments contain complementary species and form double-stranded RNA (dsRNA) species (e.g., as described in Kariko et al., Nucleic Acids Research, 2011, Vol. 39, No. 21, e142, 2009). It is difficult to separate such dsRNA contaminants from the desired ssRNA because the dsRNA contaminants and the ssRNA have very similar biochemical and biophysical properties.
  • Provided herein are affinity purification methods that use immobilized RNase III, and in some embodiments, immobilized catalytically inactive RNase III variants, that specifically bind to (and thus capture) dsRNA species from a RNA preparation, without non-specific degradation of the intended ssRNA (e.g., mRNA) product, as discussed in greater detail herein. The affinity purification methods makes use of specific binding interactions between RNase III and double-stranded RNA. RNase III (or a catalytically inactive variant thereof) is chemically immobilized or “coupled” to a solid support so that when a nucleic acid preparation is passed over the solid support (e.g., column), dsRNA molecules become bound to the RNase III. The “flow through” fraction is essentially free of dsRNA contaminants.
  • Thus, a nucleic acid preparation may be “purified” using affinity purification methods of the present disclosure, optionally in combination with other purification methods that remove DNA and protein contaminants. “Purification,” generally, refers to a process (one or more steps) of isolating one particular species (e.g., mRNA) or a subgroup of species from a larger group of species (e.g., a combination of RNA, DNA and protein). A purification process results in enrichment of the RNA of interest.
  • In some embodiments, purification can be partial (e.g., as in fractionation). In some embodiments, purification yields RNA of interest that is substantially free of other, chemically dissimilar types of molecules. For example, nucleic acids are purified from mixtures comprising proteins, lipids, carbohydrates, etc. In some embodiments, purification results in a RNA of interest that is in pure form, i.e., free or substantially free from all other substances, whether chemically similar or not. Being “substantially free of” a substance (e.g., protein, carbohydrates, lipids, and other nucleic acids) means the RNA of interest comprises less than 20%, less than 10%, less than 18%, less than 17%, less than 16%, less than 15%, less than 14%, less than 135, less than 12%, less than 11%, less than 10%, less than 9%, less than 8%, less than 7%, less than 6%, less than 5%, less than 4%, less than 3%, less than 2%, less than 1%, less than 0.5%, less than 0.1%, or less than 0.01% of the substance by weight or by molarity. In some embodiments, to reach its pure form, a RNA of interest may be subjected to more than one purification process (in addition to the affinity purification methods of as provided herein).
  • RNase III Enzymes. Ribonuclease III (RNase III) is an endoribonuclease that binds to and cleaves double stranded RNA. The enzyme is expressed in many organisms and is highly conserved (e.g., Mian et al., Nucleic Acids Res., 1997, 25, 3187-95). RNase III species cloned to date contain an RNase III signature sequence and vary in size from 25 to 50 kDa. Multiple functions have been ascribed to RNase III. In both Escherichia coli and Saccharomyces cerevisiae, RNase III is involved in the processing of pre-ribosomal RNA (pre-rRNA) (e.g., Elela et al., Cell, 1996, 85, 115-24). RNase III is also involved in the processing of small molecular weight nuclear RNAs (snRNAs) and small molecular weight nucleolar RNAs (snoRNAs) in S. cerevisiae (e.g., Chanfreau et al., Genes Dev. 1996, 11, 2741-51; Qu et al., Mol. Cell. Biol. 1996, 19, 1144-58). In E. coli, RNase III is involved in the degradation of some mRNA species (e.g., Court et al., Control of messenger RNA stability, 1993, Academic Press, Inc, pp. 71-116).
  • There are several types of Drosophila and Caenorhabditis elegans RNase III enzymes. The canonical RNase III contains a single RNase III signature motif and a double-stranded RNA binding domain (dsRBD; e.g. RNC_CAEEL). Drosha (Filippov et al. (2000) Gene 245: 213-221) is a Drosophila enzyme that contains two RNase III motifs and a dsRBD (CeDrosha in C. elegans). Another type of RNase III enzyme contains two RNase III signatures and an amino terminal helicase domain (e.g. Drosophila CG4792, CG6493, C. elegans K12H4.8) and may be RNAi nucleases (Bass (2000) Cell 101: 235-238). Enzymes from each Drosophila and Caenorhabditis elegans type produce discrete ˜22 nucleotide (nt) RNAs from dsRNA substrates. Some RNase III enzymes specifically bind to dsRNA molecules without cleaving the dsRNA (e.g., Blaszczyk et al., Structure, vol. 12, 457-466, 2004).
  • RNase III enzymes that may be used in accordance with the present disclosure include RNase III enzymes that specifically bind to dsRNA. A RNase III enzyme may be a bacterial enzyme or a eukaryotic (e.g., mammalian) enzyme. In some embodiments, a RNase III is an E. coli RNase III (EcR3). In some embodiments, a RNase III is a T. maritima RNase III. In some embodiments, a RNase III is an Aquifex aeolicus RNase III (AaR3). In some embodiments, a RNase III is a human RNase III.
  • Immobilized RNase III. RNase III enzymes and catalytically inactive variants thereof are immobilized on a solid support and then contacted with a nucleic acid preparation containing, for example, a mixture of single-stranded and double-stranded DNA. Immobilized RNase III, when in contact with double-stranded RNA (dsRNA) binds to (captures) the dsRNA such that the dsRNA remains associated with the solid support. RNase III is considered “immobilized” on a solid support when the enzyme is covalently or non-covalently attached to the support such that the enzyme does not dissociate from the support when contacted with a pH neutral buffered solution.
  • A solid support may be a substance with a surface to which a RNase III enzyme or variant can be attached such that the polypeptide becomes immobilized with respect to the solid support. A solid support of the present disclosure may be fabricated from one or more suitable materials, for example, plastics or synthetic polymers (e.g., polyethylene, polypropylene, polystyrene, polyamide, polyurethane, phenolic polymers, and/or nitrocellulose), naturally derived polymers (e.g., latex rubber, polysaccharides, and/or polypeptides), composite materials, ceramics, silica or silica-based materials, carbon, metals or metal compounds (e.g., comprising gold, silver, steel, aluminum, or copper), inorganic glasses, silica, and a variety of other suitable materials. Non-limiting examples of potentially suitable configurations include resins (e.g., agarose resin), beads (e.g., magnetic beads), tubes (e.g., nanotubes), plates, disks, dipsticks, chips, microchips, coverslips, or the like.
  • Surface compositions that may be used to immobilize RNase III or a variant thereof (e.g., catalytically inactive RNase III) are available. For example, the surface of the support may comprise reactive functional groups that form covalent bonds with RNase III or a variant thereof. In some embodiments, the functional groups are chemical functionalities. That is, the binding surface may be derivatized such that a chemical functionality is presented at the binding surface, which can react with a chemical functionality on polypeptide to be attached, resulting in immobilization. Examples of functional groups for attachment that may be useful include, but are not limited to, amino-reactive groups, carboxyl-reactive groups, epoxide groups, maleimide groups, oxo groups, and thiol groups. Functional groups can be attached, either directly or indirectly through the use of a linker, the combination of which is sometimes referred to as a “crosslinker.” Crosslinkers for attaching proteins to a support member are known in the art; for example, homo- or hetero-bifunctional crosslinkers as are well known (e.g., see 1994 Pierce Chemical Company catalog, technical section on crosslinkers, pages 155-200, or “Bioconjugate Techniques” by Greg T. Hermanson, Academic Press, 1996). Non-limiting example of crosslinkers include alkyl groups (including substituted alkyl groups and alkyl groups containing heteroatom moieties), esters, amide, amine, epoxy groups and ethylene glycol and derivatives. A linker may also be a sulfone group, forming a sulfonamide. In some embodiments, the functional group is a light-activated functional group. That is, the functional group can be activated by light to attach the capture component to the capture object surface. One example is PhotoLink™ technology available from SurModics, Inc. in Eden Prairie, Minn. The examples provided herein on the solid support and the surface composition are not meant to be limiting. Any solid support that are known in the art to be suitable for immobilization of polypeptides may be used in accordance with the present disclosure. Immobilization of RNase III to a solid support is carried out under conditions that maintains the structure and activity of RNase III. One skilled in the art is familiar with such conditions.
  • Exemplary RNase III Enzymes. Any RNase III or variant thereof (e.g., catalytically inactive variant) that binds specifically to dsRNA may be used in accordance with the present disclosure. Non-limiting examples of RNase III enzymes and catalytically inactivate RNase III variants are listed in Table 1.
  • TABLE 1
    Examples of RNase III Enzymes
    Host Amino Add Sequence
    Escherichia coli MNPIVINRLQRKLGYTFNHQ
    (wild type) ELLQQALTHRSASSKH
    NERLEFLGDSILSYVIANAL
    YHRFPRVDEGDMSRMR
    ATLVRGNTLAELAREFELGE
    CLRLGPGELKSGGFRR
    ESILADTVEALIGGVFLDSD
    IQTVEKLILNWYQTRLD
    EISPGDKQKDPKTRLQEYLQ
    GRHLPLPTYLVVQVRG
    EAHDQEFTIHCQVSGLSEPV
    VGTGSSRRKAEQAAAE
    QALKKLELE
    (SEQ ID NO: 1)
    Escherichia coli MNPIVINRLQRKLGYTFNHQ
    (E117K) ELLQQALTHRSASSKH
    NERLEFLGDSILSYVIANAL
    YHRFPRVDEGDMSRMR
    ATLVRGNTLAELAREFELGE
    CLRLGPGELKSGGFRR
    ESILADTVKALIGGVFLDSD
    IQTVEKLILNWYQTRLD
    EISPGDKQKDPKTRLQEYLQ
    GRHLPLPTYLVVQVRG
    EAHDQEFTIHCQVSGLSEPV
    VGTGSSRRKAEQAAAE
    QALKKLELE
    (SEQ ID NO: 2)
    Thermotoga maritima MNESERKIVEEFQKETGINF
    (wild type) KNEELLFRALCHSSYANEQN
    QAGRKDVESNEKLEFLGDAV
    LELFVCEILYKKYPEAEVGD
    LARVKSAAASEEVLAMVSRK
    MNLGKFLFLGKGEEKTGGRD
    RDSILADAFEALLAAIYLDQ
    GYEKIKELFEQEFEFYIEKI
    MKGEMLFDYKTALQEIVQSE
    HKVPPEYILVRTEKNDGDRI
    FVVEVRVNGKTIATGKGRTK
    KEAEKEAARIAYEKLLKERS
    (SEQ ID NO: 3)
    Thermotoga maritima MNESERKIVEEFQKETGINF
    (E130K) KNEELLFRALCHSSYANEQN
    QAGRKDVESNEKLEFLGDAV
    LELFVCEILYKKYPEAEVGD
    LARVKSAAASEEVLAMVSRK
    MNLGKFLFLGKGEEKTGGRD
    RDSILADAFKALLAAIYLDQ
    GYEKIKELFEQEFEFYIEKI
    MKGEMLFDYKTALQEIVQSE
    HKVPPEYILVRTEKNDGDRI
    FVVEVRVNGKTIATGKGRTK
    KEAEKEAARIAYEKLLKERS
    (SEQ ID NO: 4)
    Aquifex aeolicus MKMLEQLEKKLGYTFKDKSL
    (wild type) LEKALTHVSYSKKEHYETLE
    FLGDALVNFFIVDLLVQYSP
    NKREGFLSPLKAYLISEEFF
    NLLAQKLELHKFIRIKRGKI
    NETIIGDVFEALWAAVYIDS
    GRDANFTRELFYKLFKEDIL
    SAIKEGRVKKDYKTILQEIT
    QKRWKERPEYRLISVEGPHH
    KKKFIVEAKIKEYRTLGEGK
    SKKEAEQRAAEELIKLLEES
    E (SEQ ID NO: 5)
    Aquifex aeolicus MKMLEQLEKKLGYTFKDKSL
    (E110K) LEKALTHVSYSKKEHYETLE
    FLGDALVNFFIVDLLVQYSP
    NKREGFLSPLKAYLISEEFF
    NLLAQKLELHKFIRIKRGKI
    NETIIGDVFKALWAAVYIDS
    GRDANFTRELFYKLFKEDIL
    SAIKEGRVKKDYKTILQEIT
    QKRWKERPEYRLISVEGPHH
    KKKFIVEAKIKEYRTLGEGK
    SKKEAEQRAAEELIKLLEES
    E (SEQ ID NO: 6)
  • Escherichia coli RNase III. In some embodiments, a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 1. For example, a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 1. In some embodiments, a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 1.
  • In some embodiments, a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 1 having an amino acid substitution mutation at position E117. In some embodiments, a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 1 having a lysine (K) at position 117 (E117K). For example, a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 1 having a lysine (K) at position 117 (E117K). In some embodiments, a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 1 having a lysine (K) at position 117 (E117K). In some embodiments, the RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 2.
  • Thermotoga maritima RNase III. In some embodiments, a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 3. In some embodiments, a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 3. For example, a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 3. In some embodiments, a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 3.
  • In some embodiments, a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 3 having an amino acid substitution mutation at position E130. In some embodiments, a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 3 having a lysine (K) at position 130 (E130K). For example, a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 3 having a lysine (K) at position 130 (E130K). In some embodiments, a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 3 having a lysine (K) at position 130 (E130K). In some embodiments, the RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 4.
  • Aquifex aeolicus RNase III. In some embodiments, a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 5. In some embodiments, a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 5. For example, a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 5. In some embodiments, a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 5.
  • In some embodiments, a RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 5 having an amino acid substitution mutation at position E110. In some embodiments, a RNase III comprises an amino acid sequence that is at least 80% identical to the amino acid sequence identified by SEQ ID NO: 5 having a lysine (K) at position 110 (E110K). For example, a RNase III may comprise an amino acid sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence identified by SEQ ID NO: 5 having a lysine (K) at position 110 (E110K). In some embodiments, a RNase III comprises an amino acid sequence that is 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid sequence identified by SEQ ID NO: 5 having a lysine (K) at position 110 (E110K). In some embodiments, the RNase III used in the affinity purification methods as provided herein comprises the amino acid sequence identified by SEQ ID NO: 6.
  • Thermostable RNase III
  • Affinity purification method performed at elevated temperatures (e.g., greater than 70° C.) may reduce the formation of intramolecular (secondary) structure within ssRNA (e.g., mRNA). Thus, in some embodiments, a thermostable RNase III (e.g., Thermotoga maritima RNase III) may be used to remove dsRNA from a nucleic acid (e.g., IVT RNA) preparation.
  • “Thermostability” refers to the quality of enzymes to resist denaturation at high relative temperature. For example, if an enzyme is denatured (inactivated) at a temperature of 42° C., an enzyme having similar activity (e.g., exonuclease activity) is considered “thermostable” if it does not denature at 42° C. An enzyme (e.g., RNase III) is considered thermostable if the enzyme (a) retains activity (e.g., at least 50% activity) after temporary exposure to high temperatures that denature other non-thermostable enzymes or (b) functions at a high rate (e.g., greater than 50%) after temporary exposure to a medium to high temperature where non-thermostable enzymes function at low rates.
  • In some embodiments, a thermostable RNase III (e.g., Thermotoga maritima RNase III) retains greater than 50% activity (e.g., dsRNA binding and/or cleavage activity) following temporary exposure to high relative temperature (e.g., higher than 70° C. for Thermotoga maritima RNase III) that would otherwise denature a similar non-thermostable RNase III. In some embodiments, a thermostable RNase III retains 50-100% activity following temporary exposure to high relative temperature (e.g., at least 70, 80, 90, or 95° C.) that would otherwise denature a similar non-thermostable RNase III. For example, a thermostable RNase III may retain 50-90%, 50-85%, 50-80%, 50-75%, 50-70%, 50-65%, 50-60%, or 50-55% activity following temporary exposure to high relative temperature that would otherwise denature a similar non-thermostable RNase III. In some embodiments, a thermostable RNase III retains 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% activity following temporary exposure to high relative temperature that would otherwise denature a similar non-thermostable RNase III. In some embodiments, the activity of a thermostable RNase III after temporary exposure medium to high temperature is greater than (e.g., 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% greater than) the activity of a similar non-thermostable RNase III.
  • Thermostable RNase III may remain active (able to bind and/or cleave dsRNA) at a temperatures of 40° C. to 95° C., or higher. In some embodiments, thermostable RNase III remain active at a temperature of 40-95° C., 40-90° C., 40-85° C., 40-80° C., 40-70° C., 40-60° C., 40-50° C., 40-45° C., 45-95° C., 45-90° C., 45-80° C., 45-70° C., 45-60° C., 45-50° C., 50-95° C., 50-90° C., 50-80° C., 50-70° C., 50-60° C., 60-95° C., 60-90° C., 60-80° C., 60-70° C., 70-95° C., 70-90° C., or 70-80° C. For example, thermostable RNase III may remain active at a temperature of 40° C., 41° C., 42° C., 43° C., 44° C., 45° C., 46° C., 47° C., 48° C., 49° C., 50° C., 51° C., 52° C., 53° C., 54° C., 55° C., 55° C., 56° C., 57° C., 58° C., 59° C., 60° C., 61° C., 62° C., 63° C., 64° C., 65° C., 66° C., 67° C., 68° C., 69° C., 70° C., 71° C., 72° C., 73° C., 74° C., 75° C., 76° C., 77° C., 78° C., 79° C., 80° C., 81° C., 82° C., 83° C., 84° C., 85° C., 86° C., 87° C., 88° C., 89° C., 90° C., 91° C., 92° C., 93° C., 94° C., 95° C., 96° C., 97° C., 98° C., 99° C., or 100° C. Thermostable RNase III may remain active at high relative temperatures for 15 minutes to 48 hours, or longer. For example, thermostable RNase III may remain active at high relative temperatures for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 24, 36, 42, or 48 hours.
  • Methods of measuring the activity (e.g., dsRNA binding and/or cleavage) activity of RNase III is known to those skilled in the art. For example, the dsRNA binding activity may be monitored by an electrophoretic mobility shift assay (EMSA), using radioactive isotope (e.g., 32P) or fluorescent dye labeled dsRNA substrates, and the dsRNA cleavage activity may be monitored by the emergence of RNA cleavage products.
  • Catalytically Inactive RNase III
  • Some aspects of the present disclosure provide catalytically-inactive RNase III variants that may be used for the affinity purification methods. Use of catalytically-inactive RNase III variants in the affinity purification methods prevent/reduce the occurrence of non-specific cleavage of ssRNA (e.g., mRNA) of interest. A “catalytically inactive” form of RNase III is one the specifically binds to but does not cleave double-stranded RNA. Catalytically inactive forms of RNase III, therefore, may have at least one mutation (relative to wild-type RNase III) that impairs the endonucleolytic activity of the enzyme. Non-limiting examples of catalytically inactive RNase III enzymes are listed in Table 1. Thus, in some embodiments, a RNase III used in the affinity purification methods as provided herein is an Escherichia coli RNase III variant comprising the amino acid sequence of SEQ ID NO: 1 having a lysine (K) residue at position 117 (e.g., SEQ ID NO: 2; E117K). In some embodiments, a RNase III used in the affinity purification methods as provided herein is an Thermotoga maritima RNase III variant comprising the amino acid sequence of SEQ ID NO: 3 having a lysine (K) residue at position 130 (e.g., SEQ ID NO: 4; E130K). In some embodiments, a RNase III used in the affinity purification methods as provided herein is an Aquifex aeolicus RNase III variant comprising the amino acid sequence of SEQ ID NO: 5 having a lysine (K) residue at position 130 (e.g., SEQ ID NO: 6; E110K). Other catalytically inactive RNase III variants may be used in accordance with the present disclosure, provided the variants bind specifically to double-stranded RNA.
  • RNase III Homologs and Fragments
  • RNase III homologs and fragments are also within the scope of the present disclosure. Thus, provided herein are RNase III fragments (polypeptide sequences at least one amino acid residue shorter than a reference full-length RNase III enzyme sequence but otherwise identical) having a length of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or greater than 100 amino acids. Any RNase III polypeptide that includes a stretch of 20, 30, 40, 50, 60, 70, 80, 90, or 100 amino acids that are 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 100% identical to any of the RNase III sequences described herein may be utilized in an affinity purification method of the present disclosure, provided the polypeptide binds specifically to dsRNA (without non-specific cleavage of ssRNA).
  • “Identity” herein refers to the overall relatedness among polypeptides, for example, among RNase III and variants thereof. The percent identity of two polypeptide sequences, for example, can be calculated by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In some embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two amino acid sequences can be determined using methods such as those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991; each of which is incorporated herein by reference. Techniques for determining identity are codified in publicly available computer programs. Exemplary computer software to determine homology between two sequences include, but are not limited to, GCG program package, Devereux, J., et al., Nucleic Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN, and FASTA Altschul, S. F. et al., J. Molec. Biol., 215, 403 (1990)).
  • The term “corresponding to” an amino acid position in a sequence means that when two sequences (e.g., polypeptide sequence) are aligned (e.g., using any of the known sequence alignment programs in the art such as the ones described herein), a certain amino acid residue in one sequence aligns with the an amino acid residue in the other sequence, these two amino acid residues are considered to be “corresponding to” each other. Thus, two amino acid residues that correspond to each other may not necessarily have the same numerical position. For example, catalytically essential glutamic acid (E) is located at position 117 of the amino acid identified by SEQ ID NO: 1 (E. coli), corresponding catalytically essential glutamic (E) is located at position 130 of the amino acid identified by SEQ ID NO: 3 (T. maritima), and catalytically essential glutamic acid (E) is located at position 110 of the amino acid identified by SEQ ID NO: 5 (A. aeolicus).
  • RNase III enzymes, homologs, fragments and variants may be recombinantly produced and purified. Methods of expressing and purifying RNase III are known. For example, a nucleic acid sequence encoding an RNase III enzyme may be cloned into expression vectors, for the expression of the RNase III protein in a variety of host cells, e.g., bacterial cells, insect cells, or mammalian cells.
    • Ribonucleic Acid
  • Affinity purification methods as provided herein are used, in some embodiments, to remove double-stranded RNA (dsRNA) from a preparation containing single-stranded RNA (ssRNA), such as in vitro transcribed mRNA. A “single-stranded RNA” is a polymeric strand of contiguous ribonucleotides. A “double-stranded RNA” is comprised of two polymeric strands of contiguous ribonucleotides bound to each other through complementary ribonucleotide base pairing. Single-stranded RNA includes, without limitation, mRNA, ribosomal RNA (see, e.g., Widmann et al., Nucleic Acids Res. 35 (10): 3339-54), transfer RNA (tRNA), tmRNA (see, e.g., Felden et al., RNA. 3 (1): 89-103), microRNA (miRNA), short-hairpin RNA (shRNA), and non-coding RNA (ncRNA). In some embodiments, a ssRNA is a messenger RNA (mRNA), such as a therapeutic mRNA. ssRNAs described herein may form intramolecular secondary structures and may be partially double-stranded. A RNA molecule that is partially double-stranded due to intramolecular structures may be considered a “partially double-stranded” or a “partially single-stranded” molecule.
  • Modified Ribonucleic Acid. RNA molecules of the present disclosure (e.g., therapeutic mRNA molecules), and nucleic acid (e.g., DNA) molecules encoding the RNA molecules, may include a chemical modification (are chemically modified). The terms “chemical modification” and “chemically modified” refer to modification with respect to adenosine (A), guanosine (G), uridine (U), thymidine (T) or cytidine (C) ribonucleosides or deoxyribnucleosides in at least one of their position, pattern, percent or population. Generally, these terms do not refer to the ribonucleotide modifications in naturally occurring 5′-terminal mRNA cap moieties (5′ cap). With respect to a polypeptide, the term “modification” refers to a modification relative to the canonical set 20 amino acids. Polypeptides, as provided herein, are also considered “modified” of they contain amino acid substitutions, insertions or a combination of substitutions and insertions.
  • Polynucleotides (e.g., RNA polynucleotides, such as mRNA polynucleotides), in some embodiments, comprise various (more than one) different modifications. In some embodiments, a particular region of a polynucleotide contains one, two or more (optionally different) nucleoside or nucleotide modifications. In some embodiments, a modified RNA polynucleotide (e.g., a modified mRNA polynucleotide), introduced to a cell or organism, exhibits reduced degradation in the cell or organism, respectively, relative to an unmodified polynucleotide. In some embodiments, a modified RNA polynucleotide (e.g., a modified mRNA polynucleotide), introduced into a cell or organism, may exhibit reduced immunogenicity in the cell or organism, respectively (e.g., a reduced innate response).
  • Modifications of polynucleotides (e.g., RNA polynucleotides, such as mRNA polynucleotides) include, but are not limited to the following: 2-methylthio-N6-(cis-hydroxyisopentenyl)adenosine; 2-methylthio-N6-methyladenosine; 2-methylthio-N6-threonyl carbamoyladenosine; N6-glycinylcarbamoyladenosine; N6-isopentenyladenosine; N6-methyladenosine; N6-threonylcarbamoyladenosine; 1,2′-O-dimethyladenosine; 1-methyladenosine; 2′-O-methyladenosine; 2′-O-ribosyladenosine (phosphate); 2-methyladenosine; 2-methylthio-N6 isopentenyladenosine; 2-methylthio-N6-hydroxynorvalyl carbamoyladenosine; 2′-O-methyladenosine; 2′-O-ribosyladenosine (phosphate); Isopentenyladenosine; N6-(cis-hydroxyisopentenyl)adenosine; N6,2′-O-dimethyladenosine; N6,2′-O-dimethyladenosine; N6,N6,2′-O-trimethyladenosine; N6,N6-dimethyladenosine; N6-acetyladenosine; N6-hydroxynorvalylcarbamoyladenosine; N6-methyl-N6-threonylcarbamoyladenosine; 2-methyladenosine; 2-methylthio-N6-isopentenyladenosine; 7-deaza-adenosine; N1-methyl-adenosine; N6, N6 (dimethyl)adenine; N6-cis-hydroxy-isopentenyl-adenosine; α-thio-adenosine; 2 (amino)adenine; 2 (aminopropyl)adenine; 2 (methylthio) N6 (isopentenyl)adenine; 2-(alkyl)adenine; 2-(aminoalkyl)adenine; 2-(aminopropyl)adenine; 2-(halo)adenine; 2-(halo)adenine; 2-(propyl)adenine; 2′-Amino-2′-deoxy-ATP; 2′-Azido-2′-deoxy-ATP; 2′-Deoxy-2′-a-aminoadenosine TP; 2′-Deoxy-2′-a-azidoadenosine TP; 6 (alkyl)adenine; 6 (methyl)adenine; 6-(alkyl)adenine; 6-(methyl)adenine; 7 (deaza)adenine; 8 (alkenyl)adenine; 8 (alkynyl)adenine; 8 (amino)adenine; 8 (thioalkyl)adenine; 8-(alkenyl)adenine; 8-(alkyl)adenine; 8-(alkynyl)adenine; 8-(amino)adenine; 8-(halo)adenine; 8-(hydroxyl)adenine; 8-(thioalkyl)adenine; 8-(thiol)adenine; 8-azido-adenosine; aza adenine; deaza adenine; N6 (methyl)adenine; N6-(isopentyl)adenine; 7-deaza-8-aza-adenosine; 7-methyladenine; 1-Deazaadenosine TP; 2′Fluoro-N6-Bz-deoxyadenosine TP; 2′-OMe-2-Amino-ATP; 2′O-methyl-N6-Bz-deoxyadenosine TP; 2′-a-Ethynyladenosine TP; 2-aminoadenine; 2-Aminoadenosine TP; 2-Amino-ATP; 2′-a-Trifluoromethyladenosine TP; 2-Azidoadenosine TP; 2′-b-Ethynyladenosine TP; 2-Bromoadenosine TP; 2′-b-Trifluoromethyladenosine TP; 2-Chloroadenosine TP; 2′-Deoxy-2′,2′-difluoroadenosine TP; 2′-Deoxy-2′-a-mercaptoadenosine TP; 2′-Deoxy-2′-a-thiomethoxyadenosine TP; 2′-Deoxy-2′-b-aminoadenosine TP; 2′-Deoxy-2′-b-azidoadenosine TP; 2′-Deoxy-2′-b-bromoadenosine TP; 2′-Deoxy-2′-b-chloroadenosine TP; 2′-Deoxy-2′-b-fluoroadenosine TP; 2′-Deoxy-2′-b-iodoadenosine TP; 2′-Deoxy-2′-b-mercaptoadenosine TP; 2′-Deoxy-2′-b-thiomethoxyadenosine TP; 2-Fluoroadenosine TP; 2-Iodoadenosine TP; 2-Mercaptoadenosine TP; 2-methoxy-adenine; 2-methylthio-adenine; 2-Trifluoromethyladenosine TP; 3-Deaza-3-bromoadenosine TP; 3-Deaza-3-chloroadenosine TP; 3-Deaza-3-fluoroadenosine TP; 3-Deaza-3-iodoadenosine TP; 3-Deazaadenosine TP; 4′-Azidoadenosine TP; 4′-Carbocyclic adenosine TP; 4′-Ethynyladenosine TP; 5′-Homo-adenosine TP; 8-Aza-ATP; 8-bromo-adenosine TP; 8-Trifluoromethyladenosine TP; 9-Deazaadenosine TP; 2-aminopurine; 7-deaza-2,6-diaminopurine; 7-deaza-8-aza-2,6-diaminopurine; 7-deaza-8-aza-2-aminopurine; 2,6-diaminopurine; 7-deaza-8-aza-adenine, 7-deaza-2-aminopurine; 2-thiocytidine; 3-methylcytidine; 5-formylcytidine; 5-hydroxymethylcytidine; 5-methylcytidine; N4-acetylcytidine; 2′-O-methylcytidine; 2′-O-methylcytidine; 5,2′-O-dimethylcytidine; 5-formyl-2′-O-methylcytidine; Lysidine; N4,2′-O-dimethylcytidine; N4-acetyl-2′-O-methylcytidine; N4-methylcytidine; N4,N4-Dimethyl-2′-OMe-Cytidine TP; 4-methylcytidine; 5-aza-cytidine; Pseudo-iso-cytidine; pyrrolo-cytidine; α-thio-cytidine; 2-(thio)cytosine; 2′-Amino-2′-deoxy-CTP; 2′-Azido-2′-deoxy-CTP; 2′-Deoxy-2′-a-aminocytidine TP; 2′-Deoxy-2′-a-azidocytidine TP; 3 (deaza) 5 (aza)cytosine; 3 (methyl)cytosine; 3-(alkyl)cytosine; 3-(deaza) 5 (aza)cytosine; 3-(methyl)cytidine; 4,2′-O-dimethylcytidine; 5 (halo)cytosine; 5 (methyl)cytosine; 5 (propynyl)cytosine; 5 (trifluoromethyl)cytosine; 5-(alkyl)cytosine; 5-(alkynyl)cytosine; 5-(halo)cytosine; 5-(propynyl)cytosine; 5-(trifluoromethyl)cytosine; 5-bromo-cytidine; 5-iodo-cytidine; 5-propynyl cytosine; 6-(azo)cytosine; 6-aza-cytidine; aza cytosine; deaza cytosine; N4 (acetyl)cytosine; 1-methyl-1-deaza-pseudoisocytidine; 1-methyl-pseudoisocytidine; 2-methoxy-5-methyl-cytidine; 2-methoxy-cytidine; 2-thio-5-methyl-cytidine; 4-methoxy-1-methyl-pseudoisocytidine; 4-methoxy-pseudoisocytidine; 4-thio-1-methyl-1-deaza-pseudoisocytidine; 4-thio-1-methyl-pseudoisocytidine; 4-thio-pseudoisocytidine; 5-aza-zebularine; 5-methyl-zebularine; pyrrolo-pseudoisocytidine; Zebularine; (E)-5-(2-Bromo-vinyl)cytidine TP; 2,2′-anhydro-cytidine TP hydrochloride; 2′Fluor-N4-Bz-cytidine TP; 2′Fluoro-N4-Acetyl-cytidine TP; 2′-O-Methyl-N4-Acetyl-cytidine TP; 2′O-methyl-N4-Bz-cytidine TP; 2′-a-Ethynylcytidine TP; 2′-a-Trifluoromethylcytidine TP; 2′-b-Ethynylcytidine TP; 2′-b-Trifluoromethylcytidine TP; 2′-Deoxy-2′,2′-difluorocytidine TP; 2′-Deoxy-2′-a-mercaptocytidine TP; 2′-Deoxy-2′-a-thiomethoxycytidine TP; 2′-Deoxy-2′-b-aminocytidine TP; 2′-Deoxy-2′-b-azidocytidine TP; 2′-Deoxy-2′-b-bromocytidine TP; 2′-Deoxy-2′-b-chlorocytidine TP; 2′-Deoxy-2′-b-fluorocytidine TP; 2′-Deoxy-2′-b-iodocytidine TP; 2′-Deoxy-2′-b-mercaptocytidine TP; 2′-Deoxy-2′-b-thiomethoxycytidine TP; 2′-O-Methyl-5-(1-propynyl)cytidine TP; 3′-Ethynylcytidine TP; 4′-Azidocytidine TP; 4′-Carbocyclic cytidine TP; 4′-Ethynylcytidine TP; 5-(1-Propynyl)ara-cytidine TP; 5-(2-Chloro-phenyl)-2-thiocytidine TP; 5-(4-Amino-phenyl)-2-thiocytidine TP; 5-Aminoallyl-CTP; 5-Cyanocytidine TP; 5-Ethynylara-cytidine TP; 5-Ethynylcytidine TP; 5′-Homo-cytidine TP; 5-Methoxycytidine TP; 5-Trifluoromethyl-Cytidine TP; N4-Amino-cytidine TP; N4-Benzoyl-cytidine TP; Pseudoisocytidine; 7-methylguanosine; N2,2′-O-dimethylguanosine; N2-methylguanosine; Wyosine; 1,2′-O-dimethylguanosine; 1-methylguanosine; 2′-O-methylguanosine; 2′-O-ribosylguanosine (phosphate); 2′-O-methylguanosine; 2′-O-ribosylguanosine (phosphate); 7-aminomethyl-7-deazaguanosine; 7-cyano-7-deazaguanosine; Archaeosine; Methylwyosine; N2,7-dimethylguanosine; N2,N2,2′-O-trimethylguanosine; N2,N2,7-trimethylguanosine; N2,N2-dimethylguanosine; N2,7,2′-O-trimethylguanosine; 6-thio-guanosine; 7-deaza-guanosine; 8-oxo-guanosine; N1-methyl-guanosine; α-thio-guanosine; 2 (propyl)guanine; 2-(alkyl)guanine; 2′-Amino-2′-deoxy-GTP; 2′-Azido-2′-deoxy-GTP; 2′-Deoxy-2′-a-aminoguanosine TP; 2′-Deoxy-2′-a-azidoguanosine TP; 6 (methyl)guanine; 6-(alkyl)guanine; 6-(methyl)guanine; 6-methyl-guanosine; 7 (alkyl)guanine; 7 (deaza)guanine; 7 (methyl)guanine; 7-(alkyl)guanine; 7-(deaza)guanine; 7-(methyl)guanine; 8 (alkyl)guanine; 8 (alkynyl)guanine; 8 (halo)guanine; 8 (thioalkyl)guanine; 8-(alkenyl)guanine; 8-(alkyl)guanine; 8-(alkynyl)guanine; 8-(amino)guanine; 8-(halo)guanine; 8-(hydroxyl)guanine; 8-(thioalkyl)guanine; 8-(thiol)guanine; aza guanine; deaza guanine; N (methyl)guanine; N-(methyl)guanine; 1-methyl-6-thio-guanosine; 6-methoxy-guanosine; 6-thio-7-deaza-8-aza-guanosine; 6-thio-7-deaza-guanosine; 6-thio-7-methyl-guanosine; 7-deaza-8-aza-guanosine; 7-methyl-8-oxo-guanosine; N2,N2-dimethyl-6-thio-guanosine; N2-methyl-6-thio-guanosine; 1-Me-GTP; 2′Fluoro-N2-isobutyl-guanosine TP; 2′O-methyl-N2-isobutyl-guanosine TP; 2′-a-Ethynylguanosine TP; 2′-a-Trifluoromethylguanosine TP; 2′-b-Ethynylguanosine TP; 2′-b-Trifluoromethylguanosine TP; 2′-Deoxy-2′,2′-difluoroguanosine TP; 2′-Deoxy-2′-a-mercaptoguanosine TP; 2′-Deoxy-2′-a-thiomethoxyguanosine TP; 2′-Deoxy-2′-b-aminoguanosine TP; 2′-Deoxy-2′-b-azidoguanosine TP; 2′-Deoxy-2′-b-bromoguanosine TP; 2′-Deoxy-2′-b-chloroguanosine TP; 2′-Deoxy-2′-b-fluoroguanosine TP; 2′-Deoxy-2′-b-iodoguanosine TP; 2′-Deoxy-2′-b-mercaptoguanosine TP; 2′-Deoxy-2′-b-thiomethoxyguanosine TP; 4′-Azidoguanosine TP; 4′-Carbocyclic guanosine TP; 4′-Ethynylguanosine TP; 5′-Homo-guanosine TP; 8-bromo-guanosine TP; 9-Deazaguanosine TP; N2-isobutyl-guanosine TP; 1-methylinosine; Inosine; 1,2′-O-dimethylinosine; 2′-O-methylinosine; 7-methylinosine; 2′-O-methylinosine; Epoxyqueuosine; galactosyl-queuosine; Mannosylqueuosine; Queuosine; allyamino-thymidine; aza thymidine; deaza thymidine; deoxy-thymidine; 2′-O-methyluridine; 2-thiouridine; 3-methyluridine; 5-carboxymethyluridine; 5-hydroxyuridine; 5-methyluridine; 5-taurinomethyl-2-thiouridine; 5-taurinomethyluridine; Dihydrouridine; Pseudouridine; (3-(3-amino-3-carboxypropyl)uridine; 1-methyl-3-(3-amino-5-carboxypropyl)pseudouridine; 1-methylpseduouridine; 1-methyl-pseudouridine; 2′-O-methyluridine; 2′-O-methylpseudouridine; 2′-O-methyluridine; 2-thio-2′-O-methyluridine; 3-(3-amino-3-carboxypropyl)uridine; 3,2′-O-dimethyluridine; 3-Methyl-pseudo-Uridine TP; 4-thiouridine; 5-(carboxyhydroxymethyl)uridine; 5-(carboxyhydroxymethyl)uridine methyl ester; 5,2′-O-dimethyluridine; 5,6-dihydro-uridine; 5-aminomethyl-2-thiouridine; 5-carbamoylmethyl-2′-O-methyluridine; 5-carbamoylmethyluridine; 5-carboxyhydroxymethyluridine; 5-carboxyhydroxymethyluridine methyl ester; 5-carboxymethylaminomethyl-2′-O-methyluridine; 5-carboxymethylaminomethyl-2-thiouridine; 5-carboxymethylaminomethyl-2-thiouridine; 5-carboxymethylaminomethyluridine; 5-carboxymethylaminomethyluridine; 5-Carbamoylmethyluridine TP; 5-methoxycarbonylmethyl-2′-O-methyluridine; 5-methoxycarbonylmethyl-2-thiouridine; 5-methoxycarbonylmethyluridine; 5-methoxyuridine; 5-methyl-2-thiouridine; 5-methylaminomethyl-2-selenouridine; 5-methylaminomethyl-2-thiouridine; 5-methylaminomethyluridine; 5-Methyldihydrouridine; 5-Oxyacetic acid-Uridine TP; 5-Oxyacetic acid-methyl ester-Uridine TP; N1-methyl-pseudo-uridine; uridine 5-oxyacetic acid; uridine 5-oxyacetic acid methyl ester; 3-(3-Amino-3-carboxypropyl)-Uridine TP; 5-(iso-Pentenylaminomethyl)-2-thiouridine TP; 5-(iso-Pentenylaminomethyl)-2′-O-methyluridine TP; 5-(iso-Pentenylaminomethyl)uridine TP; 5-propynyl uracil; α-thio-uridine; 1 (aminoalkylamino-carbonylethylenyl)-2(thio)-pseudouracil; 1 (aminoalkylaminocarbonylethylenyl)-2,4-(dithio)pseudouracil; 1 (aminoalkylaminocarbonylethylenyl)-4 (thio)pseudouracil; 1 (aminoalkylaminocarbonylethylenyl)-pseudouracil; 1 (aminocarbonylethylenyl)-2(thio)-pseudouracil; 1 (aminocarbonylethylenyl)-2,4-(dithio)pseudouracil; 1 (aminocarbonylethylenyl)-4 (thio)pseudouracil; 1 (aminocarbonylethylenyl)-pseudouracil; 1 substituted 2(thio)-pseudouracil; 1 substituted 2,4-(dithio)pseudouracil; 1 substituted 4 (thio)pseudouracil; 1 substituted pseudouracil; 1-(aminoalkylamino-carbonylethylenyl)-2-(thio)-pseudouracil; 1-Methyl-3-(3-amino-3-carboxypropyl) pseudouridine TP; 1-Methyl-3-(3-amino-3-carboxypropyl)pseudo-UTP; 1-Methyl-pseudo-UTP; 2 (thio)pseudouracil; 2′ deoxy uridine; 2′ fluorouridine; 2-(thio)uracil; 2,4-(dithio)psuedouracil; 2′ methyl, 2′amino, 2′azido, 2′fluro-guanosine; 2′-Amino-2′-deoxy-UTP; 2′-Azido-2′-deoxy-UTP; 2′-Azido-deoxyuridine TP; 2′-O-methylpseudouridine; 2′ deoxy uridine; 2′ fluorouridine; 2′-Deoxy-2′-a-aminouridine TP; 2′-Deoxy-2′-a-azidouridine TP; 2-methylpseudouridine; 3 (3 amino-3 carboxypropyl)uracil; 4 (thio)pseudouracil; 4-(thio)pseudouracil; 4-(thio)uracil; 4-thiouracil; 5 (1,3-diazole-1-alkyl)uracil; 5 (2-aminopropyl)uracil; 5 (aminoalkyl)uracil; 5 (dimethylaminoalkyl)uracil; 5 (guanidiniumalkyl)uracil; 5 (methoxycarbonylmethyl)-2-(thio)uracil; 5 (methoxycarbonyl-methyl)uracil; 5 (methyl) 2 (thio)uracil; 5 (methyl) 2,4 (dithio)uracil; 5 (methyl) 4 (thio)uracil; 5 (methylaminomethyl)-2 (thio)uracil; 5 (methylaminomethyl)-2,4 (dithio)uracil; 5 (methylaminomethyl)-4 (thio)uracil; 5 (propynyl)uracil; 5 (trifluoromethyl)uracil; 5-(2-aminopropyl)uracil; 5-(alkyl)-2-(thio)pseudouracil; 5-(alkyl)-2,4 (dithio)pseudouracil; 5-(alkyl)-4 (thio)pseudouracil; 5-(alkyl)pseudouracil; 5-(alkyl)uracil; 5-(alkynyl)uracil; 5-(allylamino)uracil; 5-(cyanoalkyl)uracil; 5-(dialkylaminoalkyl)uracil; 5-(dimethylaminoalkyl)uracil; 5-(guanidiniumalkyl)uracil; 5-(halo)uracil; 5-(1,3-diazole-1-alkyl)uracil; 5-(methoxy)uracil; 5-(methoxycarbonylmethyl)-2-(thio)uracil; 5-(methoxycarbonyl-methyl)uracil; 5-(methyl) 2(thio)uracil; 5-(methyl) 2,4 (dithio)uracil; 5-(methyl) 4 (thio)uracil; 5-(methyl)-2-(thio)pseudouracil; 5-(methyl)-2,4 (dithio)pseudouracil; 5-(methyl)-4 (thio)pseudouracil; 5-(methyl)pseudouracil; 5-(methylaminomethyl)-2 (thio)uracil; 5-(methylaminomethyl)-2,4(dithio)uracil; 5-(methylaminomethyl)-4-(thio)uracil; 5-(propynyl)uracil; 5-(trifluoromethyl)uracil; 5-aminoallyl-uridine; 5-bromo-uridine; 5-iodo-uridine; 5-uracil; 6 (azo)uracil; 6-(azo)uracil; 6-aza-uridine; allyamino-uracil; aza uracil; deaza uracil; N3 (methyl)uracil; Pseudo-UTP-1-2-ethanoic acid; Pseudouracil; 4-Thio-pseudo-UTP; 1-carboxymethyl-pseudouridine; 1-methyl-1-deaza-pseudouridine; 1-propynyl-uridine; 1-taurinomethyl-1-methyl-uridine; 1-taurinomethyl-4-thio-uridine; 1-taurinomethyl-pseudouridine; 2-methoxy-4-thio-pseudouridine; 2-thio-1-methyl-1-deaza-pseudouridine; 2-thio-1-methyl-pseudouridine; 2-thio-5-aza-uridine; 2-thio-dihydropseudouridine; 2-thio-dihydrouridine; 2-thio-pseudouridine; 4-methoxy-2-thio-pseudouridine; 4-methoxy-pseudouridine; 4-thio-1-methyl-pseudouridine; 4-thio-pseudouridine; 5-aza-uridine; Dihydropseudouridine; (±)1-(2-Hydroxypropyl)pseudouridine TP; (2R)-1-(2-Hydroxypropyl)pseudouridine TP; (2S)-1-(2-Hydroxypropyl)pseudouridine TP; (E)-5-(2-Bromo-vinyl)ara-uridine TP; (E)-5-(2-Bromo-vinyl)uridine TP; (Z)-5-(2-Bromo-vinyl)ara-uridine TP; (Z)-5-(2-Bromo-vinyl)uridine TP; 1-(2,2,2-Trifluoroethyl)-pseudo-UTP; 1-(2,2,3,3,3-Pentafluoropropyl)pseudouridine TP; 1-(2,2-Diethoxyethyl)pseudouridine TP; 1-(2,4,6-Trimethylbenzyl)pseudouridine TP; 1-(2,4,6-Trimethyl-benzyl)pseudo-UTP; 1-(2,4,6-Trimethyl-phenyl)pseudo-UTP; 1-(2-Amino-2-carboxyethyl)pseudo-UTP; 1-(2-Amino-ethyl)pseudo-UTP; 1-(2-Hydroxyethyl)pseudouridine TP; 1-(2-Methoxyethyl)pseudouridine TP; 1-(3,4-Bis-trifluoromethoxybenzyl)pseudouridine TP; 1-(3,4-Dimethoxybenzyl)pseudouridine TP; 1-(3-Amino-3-carboxypropyl)pseudo-UTP; 1-(3-Amino-propyl)pseudo-UTP; 1-(3-Cyclopropyl-prop-2-ynyl)pseudouridine TP; 1-(4-Amino-4-carboxybutyl)pseudo-UTP; 1-(4-Amino-benzyl)pseudo-UTP; 1-(4-Amino-butyl)pseudo-UTP; 1-(4-Amino-phenyl)pseudo-UTP; 1-(4-Azidobenzyl)pseudouridine TP; 1-(4-Bromobenzyl)pseudouridine TP; 1-(4-Chlorobenzyl)pseudouridine TP; 1-(4-Fluorobenzyl)pseudouridine TP; 1-(4-Iodobenzyl)pseudouridine TP; 1-(4-Methanesulfonylbenzyl)pseudouridine TP; 1-(4-Methoxybenzyl)pseudouridine TP; 1-(4-Methoxy-benzyl)pseudo-UTP; 1-(4-Methoxy-phenyl)pseudo-UTP; 1-(4-Methylbenzyl)pseudouridine TP; 1-(4-Methyl-benzyl)pseudo-UTP; 1-(4-Nitrobenzyl)pseudouridine TP; 1-(4-Nitro-benzyl)pseudo-UTP; 1(4-Nitro-phenyl)pseudo-UTP; 1-(4-Thiomethoxybenzyl)pseudouridine TP; 1-(4-Trifluoromethoxybenzyl)pseudouridine TP; 1-(4-Trifluoromethylbenzyl)pseudouridine TP; 1-(5-Amino-pentyl)pseudo-UTP; 1-(6-Amino-hexyl)pseudo-UTP; 1,6-Dimethyl-pseudo-UTP; 1-[3-(2-{2-[2-(2-Aminoethoxy)-ethoxy]-ethoxy}-ethoxy)-propionyl]pseudouridine TP; 1-{3-[2-(2-Aminoethoxy)-ethoxy]-propionyl} pseudouridine TP; 1-Acetyipseudouridine TP; 1-Alkyl-6-(1-propynyl)-pseudo-UTP; 1-Alkyl-6-(2-propynyl)-pseudo-UTP; 1-Alkyl-6-allyl-pseudo-UTP; 1-Alkyl-6-ethynyl-pseudo-UTP; 1-Alkyl-6-homoallyl-pseudo-UTP; 1-Alkyl-6-vinyl-pseudo-UTP; 1-Allylpseudouridine TP; 1-Aminomethyl-pseudo-UTP; 1-Benzoylpseudouridine TP; 1-Benzyloxymethylpseudouridine TP; 1-Benzyl-pseudo-UTP; 1-Biotinyl-PEG2-pseudouridine TP; 1-Biotinylpseudouridine TP; 1-Butyl-pseudo-UTP; 1-Cyanomethylpseudouridine TP; 1-Cyclobutylmethyl-pseudo-UTP; 1-Cyclobutyl-pseudo-UTP; 1-Cycloheptylmethyl-pseudo-UTP; 1-Cycloheptyl-pseudo-UTP; 1-Cyclohexylmethyl-pseudo-UTP; 1-Cyclohexyl-pseudo-UTP; 1-Cyclooctylmethyl-pseudo-UTP; 1-Cyclooctyl-pseudo-UTP; 1-Cyclopentylmethyl-pseudo-UTP; 1-Cyclopentyl-pseudo-UTP; 1-Cyclopropylmethyl-pseudo-UTP; 1-Cyclopropyl-pseudo-UTP; 1-Ethyl-pseudo-UTP; 1-Hexyl-pseudo-UTP; 1-Homoallylpseudouridine TP; 1-Hydroxymethylpseudouridine TP; 1-iso-propyl-pseudo-UTP; 1-Me-2-thio-pseudo-UTP; 1-Me-4-thio-pseudo-UTP; 1-Me-alpha-thio-pseudo-UTP; 1-Methanesulfonylmethylpseudouridine TP; 1-Methoxymethylpseudouridine TP; 1-Methyl-6-(2,2,2-Trifluoroethyl)pseudo-UTP; 1-Methyl-6-(4-morpholino)-pseudo-UTP; 1-Methyl-6-(4-thiomorpholino)-pseudo-UTP; 1-Methyl-6-(substituted phenyl)pseudo-UTP; 1-Methyl-6-amino-pseudo-UTP; 1-Methyl-6-azido-pseudo-UTP; 1-Methyl-6-bromo-pseudo-UTP; 1-Methyl-6-butyl-pseudo-UTP; 1-Methyl-6-chloro-pseudo-UTP; 1-Methyl-6-cyano-pseudo-UTP; 1-Methyl-6-dimethylamino-pseudo-UTP; 1-Methyl-6-ethoxy-pseudo-UTP; 1-Methyl-6-ethylcarboxylate-pseudo-UTP; 1-Methyl-6-ethyl-pseudo-UTP; 1-Methyl-6-fluoro-pseudo-UTP; 1-Methyl-6-formyl-pseudo-UTP; 1-Methyl-6-hydroxyamino-pseudo-UTP; 1-Methyl-6-hydroxy-pseudo-UTP; 1-Methyl-6-iodo-pseudo-UTP; 1-Methyl-6-iso-propyl-pseudo-UTP; 1-Methyl-6-methoxy-pseudo-UTP; 1-Methyl-6-methylamino-pseudo-UTP; 1-Methyl-6-phenyl-pseudo-UTP; 1-Methyl-6-propyl-pseudo-UTP; 1-Methyl-6-tert-butyl-pseudo-UTP; 1-Methyl-6-trifluoromethoxy-pseudo-UTP; 1-Methyl-6-trifluoromethyl-pseudo-UTP; 1-Morpholinomethylpseudouridine TP; 1-Pentyl-pseudo-UTP; 1-Phenyl-pseudo-UTP; 1-Pivaloylpseudouridine TP; 1-Propargylpseudouridine TP; 1-Propyl-pseudo-UTP; 1-propynyl-pseudouridine; 1-p-tolyl-pseudo-UTP; 1-tert-Butyl-pseudo-UTP; 1-Thiomethoxymethylpseudouridine TP; 1-Thiomorpholinomethylpseudouridine TP; 1-Trifluoroacetylpseudouridine TP; 1-Trifluoromethyl-pseudo-UTP; 1-Vinylpseudouridine TP; 2,2′-anhydro-uridine TP; 2′-bromo-deoxyuridine TP; 2′-F-5-Methyl-2′-deoxy-UTP; 2′-OMe-5-Me-UTP; 2′-OMe-pseudo-UTP; 2′-a-Ethynyluridine TP; 2′-a-Trifluoromethyluridine TP; 2′-b-Ethynyluridine TP; 2′-b-Trifluoromethyluridine TP; 2′-Deoxy-2′,2′-difluorouridine TP; 2′-Deoxy-2′-a-mercaptouridine TP; 2′-Deoxy-2′-a-thiomethoxyuridine TP; 2′-Deoxy-2′-b-aminouridine TP; 2′-Deoxy-2′-b-azidouridine TP; 2′-Deoxy-2′-b-bromouridine TP; 2′-Deoxy-2′-b-chlorouridine TP; 2′-Deoxy-2′-b-fluorouridine TP; 2′-Deoxy-2′-b-iodouridine TP; 2′-Deoxy-2′-b-mercaptouridine TP; 2′-Deoxy-2′-b-thiomethoxyuridine TP; 2-methoxy-4-thio-uridine; 2-methoxyuridine; 2′-O-Methyl-5-(1-propynyl)uridine TP; 3-Alkyl-pseudo-UTP; 4′-Azidouridine TP; 4′-Carbocyclic uridine TP; 4′-Ethynyluridine TP; 5-(1-Propynyl)ara-uridine TP; 5-(2-Furanyl)uridine TP; 5-Cyanouridine TP; 5-Dimethylaminouridine TP; 5′-Homo-uridine TP; 5-iodo-2′-fluoro-deoxyuridine TP; 5-Phenylethynyluridine TP; 5-Trideuteromethyl-6-deuterouridine TP; 5-Trifluoromethyl-Uridine TP; 5-Vinylarauridine TP; 6-(2,2,2-Trifluoroethyl)-pseudo-UTP; 6-(4-Morpholino)-pseudo-UTP; 6-(4-Thiomorpholino)-pseudo-UTP; 6-(Substituted-Phenyl)-pseudo-UTP; 6-Amino-pseudo-UTP; 6-Azido-pseudo-UTP; 6-Bromo-pseudo-UTP; 6-Butyl-pseudo-UTP; 6-Chloro-pseudo-UTP; 6-Cyano-pseudo-UTP; 6-Dimethylamino-pseudo-UTP; 6-Ethoxy-pseudo-UTP; 6-Ethylcarboxylate-pseudo-UTP; 6-Ethyl-pseudo-UTP; 6-Fluoro-pseudo-UTP; 6-Formyl-pseudo-UTP; 6-Hydroxyamino-pseudo-UTP; 6-Hydroxy-pseudo-UTP; 6-Iodo-pseudo-UTP; 6-iso-Propyl-pseudo-UTP; 6-Methoxy-pseudo-UTP; 6-Methylamino-pseudo-UTP; 6-Methyl-pseudo-UTP; 6-Phenyl-pseudo-UTP; 6-Phenyl-pseudo-UTP; 6-Propyl-pseudo-UTP; 6-tert-Butyl-pseudo-UTP; 6-Trifluoromethoxy-pseudo-UTP; 6-Trifluoromethyl-pseudo-UTP; Alpha-thio-pseudo-UTP; Pseudouridine 1-(4-methylbenzenesulfonic acid) TP; Pseudouridine 1-(4-methylbenzoic acid) TP; Pseudouridine TP 1-[3-(2-ethoxy)]propionic acid; Pseudouridine TP 1-[3-{2-(2-[2-(2-ethoxy)-ethoxy]-ethoxy)-ethoxy}]propionic acid; Pseudouridine TP 1-[3-{2-(2-[2-{2(2-ethoxy)-ethoxy}-ethoxy]-ethoxy)-ethoxy}]propionic acid; Pseudouridine TP 1-[3-{2-(2-[2-ethoxy]-ethoxy)-ethoxy}]propionic acid; Pseudouridine TP 1-[3-{2-(2-ethoxy)-ethoxy}] propionic acid; Pseudouridine TP 1-methylphosphonic acid; Pseudouridine TP 1-methylphosphonic acid diethyl ester; Pseudo-UTP-N1-3-propionic acid; Pseudo-UTP-N1-4-butanoic acid; Pseudo-UTP-N1-5-pentanoic acid; Pseudo-UTP-N1-6-hexanoic acid; Pseudo-UTP-N1-7-heptanoic acid; Pseudo-UTP-N1-methyl-p-benzoic acid; Pseudo-UTP-N1-p-benzoic acid; Wybutosine; Hydroxywybutosine; Isowyosine; Peroxywybutosine; undermodified hydroxywybutosine; 4-demethylwyosine; 2,6-(diamino)purine; 1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl: 1,3-(diaza)-2-(oxo)-phenthiazin-1-yl; 1,3-(diaza)-2-(oxo)-phenoxazin-1-yl; 1,3,5-(triaza)-2,6-(dioxa)-naphthalene; 2 (amino)purine; 2,4,5-(trimethyl)phenyl; 2′ methyl, 2′amino, 2′azido, 2′fluro-cytidine; 2′ methyl, 2′amino, 2′azido, 2′fluro-adenine; 2′methyl, 2′amino, 2′azido, 2′fluro-uridine; 2′-amino-2′-deoxyribose; 2-amino-6-Chloro-purine; 2-aza-inosinyl; 2′-azido-2′-deoxyribose; 2′fluoro-2′-deoxyribose; 2′-fluoro-modified bases; 2′-O-methyl-ribose; 2-oxo-7-aminopyridopyrimidin-3-yl; 2-oxo-pyridopyrimidine-3-yl; 2-pyridinone; 3 nitropyrrole; 3-(methyl)-7-(propynyl)isocarbostyrilyl; 3-(methyl)isocarbostyrilyl; 4-(fluoro)-6-(methyl)benzimidazole; 4-(methyl)benzimidazole; 4-(methyl)indolyl; 4,6-(dimethyl)indolyl; 5 nitroindole; 5 substituted pyrimidines; 5-(methyl)isocarbostyrilyl; 5-nitroindole; 6-(aza)pyrimidine; 6-(azo)thymine; 6-(methyl)-7-(aza)indolyl; 6-chloro-purine; 6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; 7-(aminoalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl; 7-(aminoalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl; 7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl; 7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenthiazin-1-yl; 7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl; 7-(aza)indolyl; 7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazinl-yl; 7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl; 7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl; 7-(guanidiniumalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl; 7-(guanidiniumalkyl-hydroxy)-1,3-(diaza)-2-(oxo)-phenthiazin-1-yl; 7-(guanidiniumalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl; 7-(propynyl)isocarbostyrilyl; 7-(propynyl)isocarbostyrilyl, propynyl-7-(aza)indolyl; 7-deaza-inosinyl; 7-substituted 1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl; 7-substituted 1,3-(diaza)-2-(oxo)-phenoxazin-1-yl; 9-(methyl)-imidizopyridinyl; Aminoindolyl; Anthracenyl; bis-ortho-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; bis-ortho-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; Difluorotolyl; Hypoxanthine; Imidizopyridinyl; Inosinyl; Isocarbostyrilyl; Isoguanisine; N2-substituted purines; N6-methyl-2-amino-purine; N6-substituted purines; N-alkylated derivative; Napthalenyl; Nitrobenzimidazolyl; Nitroimidazolyl; Nitroindazolyl; Nitropyrazolyl; Nubularine; 06-substituted purines; O-alkylated derivative; ortho-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; ortho-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; Oxoformycin TP; para-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; para-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; Pentacenyl; Phenanthracenyl; Phenyl; propynyl-7-(aza)indolyl; Pyrenyl; pyridopyrimidin-3-yl; pyridopyrimidin-3-yl, 2-oxo-7-amino-pyridopyrimidin-3-yl; pyrrolo-pyrimidin-2-on-3-yl; Pyrrolopyrimidinyl; Pyrrolopyrizinyl; Stilbenzyl; substituted 1,2,4-triazoles; Tetracenyl; Tubercidine; Xanthine; Xanthosine-5′-TP; 2-thio-zebularine; 5-aza-2-thio-zebularine; 7-deaza-2-amino-purine; pyridin-4-one ribonucleoside; 2-Amino-riboside-TP; Formycin A TP; Formycin B TP; Pyrrolosine TP; 2′-OH-ara-adenosine TP; 2′-OH-ara-cytidine TP; 2′-OH-ara-uridine TP; 2′-OH-ara-guanosine TP; 5-(2-carbomethoxyvinyl)uridine TP; and N6-(19-Amino-pentaoxanonadecyl)adenosine TP.
  • In some embodiments, polynucleotides (e.g., RNA polynucleotides, such as mRNA polynucleotides) include a combination of at least two (e.g., 2, 3, 4 or more) of the aforementioned modified nucleobases.
  • In some embodiments, modified nucleobases in polynucleotides (e.g., RNA polynucleotides, such as mRNA polynucleotides) are selected from the group consisting of pseudouridine (W), N1-methylpseudouridine (mlyf), N1-ethylpseudouridine, 2-thiouridine, 4′-thiouridine, 5-methylcytosine, 2-thio-1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine, 2-thio-dihydropseudouridine, 2-thio-dihydrouridine, 2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine, 4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine, 4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine, 5-methoxyuridine and 2′-O-methyl uridine. In some embodiments, polynucleotides (e.g., RNA polynucleotides, such as mRNA polynucleotides) include a combination of at least two (e.g., 2, 3, 4 or more) of the aforementioned modified nucleobases.
  • When the purified ssRNA RNA of the present disclosure is a purified mRNA, it may comprise any additional modifications known to one of skill in the art and as described in US Patent Publications US20120046346 and US20120251618, and PCT Publication WO 2012/019168. Other such components include, for example, a 5′ cap, a polyA tail, a Kozak sequence; a 3′ untranslated region (3′ UTR); a 5′ untranslated region (5′ UTR); one or more intronic nucleotide sequences capable of being excised from the nucleic acid, or any combination thereof.
  • In some embodiments, the purified mRNAs of the present disclosure comprises a natural 5′ cap. In some embodiments, a 5′ cap may be a 5′ cap analog, such as, e.g., a 5′ diguanosine cap, tetraphosphate cap analogs having a methylene-bis (phosphonate) moiety, cap analogs having a sulfur substitution for a non-bridging oxygen, N7-benzylated dinucleoside tetraphosphate analogs, or anti-reverse cap analogs. In some embodiments, the 5′ cap is 7mG(5′)ppp(5′)NlmpNp. In some embodiments, the 5′cap analog is a 5′diguanosine cap. In some embodiments, the synthetic, modified mRNA of the present disclosure does not comprise a 5′ triphosphate.
  • Both the 5′UTR and the 3′UTR are typically transcribed from the genomic DNA and are elements of the premature mRNA. Characteristic structural features of mature mRNA, such as the 5′-cap and the 3′-poly(A) tail are usually added to the transcribed (premature) mRNA during mRNA processing. The 3′-poly(A) tail is typically a stretch of adenine nucleotides added to the 3′-end of the transcribed mRNA. In some embodiments the length of the 3′-poly(A) tail may be an essential element with respect to the stability of the individual mRNA. A poly-A tail may be greater than 30 nucleotides in length, greater than 35 nucleotides in length, at least 40 nucleotides, at least 45 nucleotides, at least 55 nucleotides, at least 60 nucleotide, at least 70 nucleotides, at least 80 nucleotides, at least 90 nucleotides, at least 100 nucleotides, at least 200 nucleotides, at least 300 nucleotides, at least 400 nucleotides, at least 500 nucleotides, at least 600 nucleotides, at least 700 nucleotides, at least 800 nucleotides, at least 900 nucleotides, at least 1000 nucleotides, or more.
  • In some embodiments, the purified mRNA of the present disclosure encodes a protein. In some embodiments, the protein is an antigen, e.g., a viral antigen. In some embodiments, the modified mRNA purified using the methods described herein may be used as a mRNA vaccine.
    • Methods
  • Method of purifying a nucleic acid (e.g., mRNA) preparation of the present disclosure generally include contacting the nucleic acid preparation with an RNase III enzyme that is immobilized on a solid support.
  • An affinity purification method may, in some embodiments, include the following steps: (1) incubating a nucleic acid preparation (e.g., a solution containing in vitro-transcribed mRNA) with a solid support to which a RNase III enzyme (e.g., a thermostable RNase III enzyme) or variant thereof (e.g., a catalytically active RNase III) is immobilized under conditions that result in binding of double-stranded RNA (dsRNA) to the immobilized RNase III enzyme; (2) eluting unbound preparation components from the support using appropriate buffers that maintain the binding interaction between the RNase III enzyme and the dsRNA to produce a preparation enriched for single-stranded RNA (ssRNA) (a “ssRNA-enriched preparation”); and (3) optionally performing at least one additional purification process to isolate a ssRNA (e.g., mRNA) from the preparation.
  • Methods may be performed “under conditions that result in binding of the RNase III enzyme to double-stranded RNA.” These conditions are readily determined by a skilled artisan and include, for example, temperature conditions, buffer (e.g., salt and pH) conditions, and reaction/process time.
  • In some embodiments, an affinity purification method as provided herein is performed using a RNase III enzyme (e.g., identified by SEQ ID NO: 1, 2, 5 or 6) that is optimally active at a temperature of 20° C.-42° C. Thus, in some embodiments, an affinity purification method is performed at 20° C.-42° C. For example, an affinity purification method may be performed at 20° C., 21° C., 22° C., 23° C., 24° C., 25° C., 26° C., 27° C., 28° C., 29° C., 30° C., 31° C., 32° C., 33° C., 34° C., 35° C., 36° C., 37° C., 38° C., 39° C., 40° C., 41° C., 42° C., or within a range having endpoints defined by any two of the foregoing temperatures.
  • In some embodiments, an affinity purification method as provided herein is performed using a RNase III enzyme (e.g., identified by SEQ ID NO: 3 or 4) that is optimally active at a temperature of 40° C.-70° C. Thus, in some embodiments, an affinity purification method is performed at 40° C.-70° C. For example, an affinity purification method may be performed at 40° C., 41° C., 42° C., 43° C., 44° C., 45° C., 46° C., 47° C., 48° C., 49° C., 50° C., 51° C., 52° C., 53° C., 54° C., 55° C., 56° C., 57° C., 58° C., 59° C., 60° C., 61° C., 62° C., 63° C., 64° C., 65° C., 66° C., 67° C., 68° C., 69° C., 70° C., or within a range having endpoints defined by any two of the foregoing temperatures. In some embodiments, an affinity purification method is performed at a temperature greater than 70° C. For example, an affinity purification method may be performed at 75° C., 80° C., 85° C., 90° C., or 95° C.
  • Incubation (contact) times may vary. In some embodiments, a nucleic acid preparation (e.g., an IVT preparation) is contacted with RNase III enzyme immobilized on a solid support for 5 minutes to 3 hours, or longer. For example, a nucleic acid preparation may be contacted with RNase III enzyme immobilized on a solid support for 5 minutes, 10 minutes, 15 minutes, 20 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 3 hours, or longer.
  • In some embodiments, affinity purification methods further comprise separating solid phase RNase III-dsRNA complexes from the liquid phase ssRNA-enriched preparation. This separation step(s) depends on the type of solid support used in an affinity purification method. For example, for RNase III immobilized on a resin, the ssRNA-enriched preparation may be separated by centrifugation. For RNase III immobilized on magnetic beads, a magnet may be used to remove the beads from the ssRNA-enriched preparation. Separation of the solid phase from the liquid phase yields ssRNA that is substantially free of dsRNA contaminants. Following or preceding performance of an affinity purification method using a RNase III enzyme (or variant thereof), the nucleic acid preparation may be subjected to one or more additional purification methods to remove DNA and/or protein contaminants. Methods of removing DNA or protein contaminants from a preparation containing RNA are known. The order in which the different purification methods are performed may be varied.
    • Compositions
  • The present disclosure also encompasses compositions comprising ssRNA (e.g., mRNA) prepared, for example, via IVT and purified according to the affinity purification methods as provided herein. In some embodiments, the compositions are therapeutic composition. For example, the RNA (e.g., mRNA) purified using the methods of the present disclosure may be used in a vaccine composition to treat or prevent cancer or an infectious disease.
  • In some embodiments, a composition comprises a RNA (e.g., mRNA) purified by a method of the present disclosure having an open reading frame comprising at least one chemical modification or optionally no nucleotide modification, a 5′ terminal cap that is 7mG(5′)ppp(5′)NlmpNp, and a polyA tail. In some embodiments, 100% of the uracil in the open reading frame have a chemical modification. In some embodiments, a chemical modification is in the 5-position of the uracil. In some embodiments, a chemical modification is a N1-methyl pseudouridine. In some embodiments, 100% of the uracil in the open reading frame have a N1-methyl pseudouridine in the 5-position of the uracil.
  • In some embodiments, the RNA (e.g., mRNA) purified using the methods of the present disclosure may be formulated in a nanoparticle, such as a lipid particle described, for example, in any one of International Application No. PCT/US16/58327, International Application No. PCT/US16/583140, and International Application No. PCT/US16/58324, each of which was filed Oct. 21, 2016 and is herein incorporated by reference. In some embodiments, the nanoparticle has a mean diameter of 50-200 nm. In some embodiments, the nanoparticle is a lipid nanoparticle. In some embodiments, the lipid nanoparticle comprises a cationic lipid, a PEG-modified lipid, a sterol and a non-cationic lipid. In some embodiments, the lipid nanoparticle comprises a molar ratio of about 20-60% cationic lipid, 0.5-15% PEG-modified lipid, 25-55% sterol, and 25% non-cationic lipid. In some embodiments, a lipid nanoparticle comprises a cationic lipid, a PEG-modified lipid, a sterol and a non-cationic lipid. In some embodiments, a cationic lipid is an ionizable cationic lipid and the non-cationic lipid is a neutral lipid, and the sterol is a cholesterol. In some embodiments, a cationic lipid is selected from the group consisting of 2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA), dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), di((Z)-non-2-en-1-yl) 9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), (12Z,15Z)—N,N-dimethyl-2-nonylhenicosa-12,15-dien-1-amine (L608), and N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]heptadecan-8-amine (L530).
  • In some embodiments, a lipid nanoparticle comprises compounds of Formula (I) and/or Formula (II) and encapsulates a RNA (e.g., mRNA) purified using the methods of the present disclosure.
  • In some embodiments, a nanoparticle comprises compounds of Formula (I):
  • Figure US20220290125A1-20220915-C00001
  • or a salt or isomer thereof, wherein:
  • R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;
  • R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R4 is selected from the group consisting of a C3-6 carbocycle, —(CH2)nQ, —(CH2)nCHQR, —CHQR, —CQ(R)2, and unsubstituted C1-6 alkyl, where Q is selected from a carbocycle, heterocycle, —OR, —O(CH2)nN(R)2, —C(O)OR, —OC(O)R, —CX3, —CX2H, —CXH2, —CN, —N(R)2, —C(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)C(O)N(R)2, —N(R)C(S)N(R)2, —N(R)R8, —O(CH2)nOR, —N(R)C(═NR9)N(R)2, —N(R)C(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, —N(OR)C(O)R, —N(OR)S(O)2R, —N(OR)C(O)OR, —N(OR)C(O)N(R)2, —N(OR)C(S)N(R)2, —N(OR)C(═NR9)N(R)2, —N(OR)C(═CHR9)N(R)2, —C(═NR9)N(R)2, —C(═NR9)R, —C(O)N(R)OR, and —C(R)N(R)2C(O)OR, and each n is independently selected from 1, 2, 3, 4, and 5;
  • each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, —S—S—, an aryl group, and a heteroaryl group;
  • R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • R8 is selected from the group consisting of C3-6 carbocycle and heterocycle;
  • R9 is selected from the group consisting of H, CN, NO2, C1-6 alkyl, —OR, —S(O)2R, —S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle and heterocycle;
  • each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;
  • each R″ is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl;
  • each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl;
  • each Y is independently a C3-6 carbocycle;
  • each X is independently selected from the group consisting of F, Cl, Br, and I; and
  • m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13.
  • In some embodiments, a subset of compounds of Formula (I) includes those in which when R4 is —(CH2)nQ, —(CH2)nCHQR, —CHQR, or —CQ(R)2, then (i) Q is not —N(R)2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2.
  • In some embodiments, another subset of compounds of Formula (I) includes those in which
  • R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;
  • R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R4 is selected from the group consisting of a C3-6 carbocycle, —(CH2)nQ, —(CH2)nCHQR, —CHQR, —CQ(R)2, and unsubstituted C1-6 alkyl, where Q is selected from a C3-6 carbocycle, a 5- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S, —OR, —O(CH2)nN(R)2, —C(O)OR, —OC(O)R, —CX3, —CX2H, —CXH2, —CN, —C(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)C(O)N(R)2, —N(R)C(S)N(R)2, —CRN(R)2C(O)OR, —N(R)R8, —O(CH2)nOR, —N(R)C(═NR9)N(R)2, —N(R)C(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, —N(OR)C(O)R, —N(OR)S(O)2R, —N(OR)C(O)OR, —N(OR)C(O)N(R)2, —N(OR)C(S)N(R)2, —N(OR)C(═NR9)N(R)2, —N(OR)C(═CHR9)N(R)2, —C(═NR9)N(R)2, —C(═NR9)R, —C(O)N(R)OR, and a 5- to 14-membered heterocycloalkyl having one or more heteroatoms selected from N, O, and S which is substituted with one or more substituents selected from oxo (═O), OH, amino, mono- or di-alkylamino, and C1-3 alkyl, and each n is independently selected from 1, 2, 3, 4, and 5;
  • each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, —S—S—, an aryl group, and a heteroaryl group;
  • R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • R8 is selected from the group consisting of C3-6 carbocycle and heterocycle;
  • R9 is selected from the group consisting of H, CN, NO2, C1-6 alkyl, —OR, —S(O)2R, —S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle and heterocycle;
  • each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;
  • each R″ is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl;
  • each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl;
  • each Y is independently a C3-6 carbocycle;
  • each X is independently selected from the group consisting of F, Cl, Br, and I; and
  • m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • or salts or isomers thereof.
  • In some embodiments, another subset of compounds of Formula (I) includes those in which
  • R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;
  • R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R4 is selected from the group consisting of a C3-6 carbocycle, —(CH2)nQ, —(CH2)nCHQR, —CHQR, —CQ(R)2, and unsubstituted C1-6 alkyl, where Q is selected from a C3-6 carbocycle, a 5- to 14-membered heterocycle having one or more heteroatoms selected from N, O, and S, —OR, —O(CH2)nN(R)2, —C(O)OR, —OC(O)R, —CX3, —CX2H, —CXH2, —CN, —C(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)C(O)N(R)2, —N(R)C(S)N(R)2, —CRN(R)2C(O)OR, —N(R)R8, —O(CH2)nOR, —N(R)C(═NR9)N(R)2, —N(R)C(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, —N(OR)C(O)R, —N(OR)S(O)2R, —N(OR)C(O)OR, —N(OR)C(O)N(R)2, —N(OR)C(S)N(R)2, —N(OR)C(═NR9)N(R)2, —N(OR)C(═CHR9)N(R)2, —C(═NR9)R, —C(O)N(R)OR, and —C(═NR9)N(R)2, and each n is independently selected from 1, 2, 3, 4, and 5; and when Q is a 5- to 14-membered heterocycle and (i) R4 is —(CH2)nQ in which n is 1 or 2, or (ii) R4 is —(CH2)nCHQR in which n is 1, or (iii) R4 is —CHQR, and —CQ(R)2, then Q is either a 5- to 14-membered heteroaryl or 8- to 14-membered heterocycloalkyl;
  • each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, —S—S—, an aryl group, and a heteroaryl group;
  • R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • R8 is selected from the group consisting of C3-6 carbocycle and heterocycle;
  • R9 is selected from the group consisting of H, CN, NO2, C1-6 alkyl, —OR, —S(O)2R, —S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle and heterocycle;
  • each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;
  • each R″ is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl;
  • each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl;
  • each Y is independently a C3-6 carbocycle;
  • each X is independently selected from the group consisting of F, Cl, Br, and I; and
  • m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • or salts or isomers thereof.
  • In some embodiments, another subset of compounds of Formula (I) includes those in which
  • R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;
  • R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R4 is selected from the group consisting of a C3-6 carbocycle, —(CH2)nQ, —(CH2)nCHQR, —CHQR, —CQ(R)2, and unsubstituted C1-6 alkyl, where Q is selected from a C3-6 carbocycle, a 5- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S, —OR, —O(CH2)n N(R)2, —C(O)OR, —OC(O)R, —CX3, —CX2H, —CXH2, —CN, —C(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)C(O)N(R)2, —N(R)C(S)N(R)2, —CRN(R)2C(O)OR, —N(R)R8, —O(CH2)nOR, —N(R)C(═NR9)N(R)2, —N(R)C(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, —N(OR)C(O)R, —N(OR)S(O)2R, —N(OR)C(O)OR, —N(OR)C(O)N(R)2, —N(OR)C(S)N(R)2, —N(OR)C(═NR9)N(R)2, —N(OR)C(═CHR9)N(R)2, —C(═NR9)R, —C(O)N(R)OR, and —C(═NR9)N(R)2, and each n is independently selected from 1, 2, 3, 4, and 5;
  • each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, —S—S—, an aryl group, and a heteroaryl group;
  • R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • R8 is selected from the group consisting of C3-6 carbocycle and heterocycle;
  • R9 is selected from the group consisting of H, CN, NO2, C1-6 alkyl, —OR, —S(O)2R, —S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle and heterocycle;
  • each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;
  • each R″ is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl;
  • each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl;
  • each Y is independently a C3-6 carbocycle;
  • each X is independently selected from the group consisting of F, Cl, Br, and I; and
  • m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • or salts or isomers thereof.
  • In some embodiments, another subset of compounds of Formula (I) includes those in which
  • R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;
  • R2 and R3 are independently selected from the group consisting of H, C2-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R4 is —(CH2)nQ or —(CH2)nCHQR, where Q is —N(R)2, and n is selected from 3, 4, and 5;
  • each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, —S—S—, an aryl group, and a heteroaryl group;
  • R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;
  • each R″ is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl;
  • each R* is independently selected from the group consisting of C1-12 alkyl and C1-12 alkenyl;
  • each Y is independently a C3-6 carbocycle;
  • each X is independently selected from the group consisting of F, Cl, Br, and I; and
  • m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • or salts or isomers thereof.
  • In some embodiments, another subset of compounds of Formula (I) includes those in which
  • R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;
  • R2 and R3 are independently selected from the group consisting of C1-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R4 is selected from the group consisting of —(CH2)nQ, —(CH2)nCHQR, —CHQR, and —CQ(R)2, where Q is —N(R)2, and n is selected from 1, 2, 3, 4, and 5;
  • each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, —S—S—, an aryl group, and a heteroaryl group;
  • R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;
  • each R″ is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl;
  • each R* is independently selected from the group consisting of C1-12 alkyl and C1-12 alkenyl;
  • each Y is independently a C3-6 carbocycle;
  • each X is independently selected from the group consisting of F, Cl, Br, and I; and
  • m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
  • or salts or isomers thereof.
  • In some embodiments, a subset of compounds of Formula (I) includes those of Formula (IA):
  • Figure US20220290125A1-20220915-C00002
  • or a salt or isomer thereof, wherein 1 is selected from 1, 2, 3, 4, and 5; m is selected from 5, 6, 7, 8, and 9; M1 is a bond or M′; R4 is unsubstituted C1-3 alkyl, or —(CH2)nQ, in which Q is OH, —NHC(S)N(R)2, —NHC(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)R8, —NHC(═NR9)N(R)2, —NHC(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —P(O)(OR′)O—, —S—S—, an aryl group, and a heteroaryl group; and R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl.
  • In some embodiments, a subset of compounds of Formula (I) includes those of Formula (II):
  • Figure US20220290125A1-20220915-C00003
  • or a salt or isomer thereof, wherein 1 is selected from 1, 2, 3, 4, and 5; M1 is a bond or M′; R4 is unsubstituted C1-3 alkyl, or —(CH2)nQ, in which n is 2, 3, or 4, and Q is OH, —NHC(S)N(R)2, —NHC(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)R8, —NHC(═NR9)N(R)2, —NHC(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —P(O)(OR′)O—, —S—S—, an aryl group, and a heteroaryl group; and R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl.
  • In some embodiments, a subset of compounds of Formula (I) includes those of Formula (IIa), (IIb), (IIc), or (IIe):
  • Figure US20220290125A1-20220915-C00004
  • or a salt or isomer thereof, wherein R4 is as described herein.
  • In some embodiments, a subset of compounds of Formula (I) includes those of Formula (Id):
  • Figure US20220290125A1-20220915-C00005
  • or a salt or isomer thereof, wherein n is 2, 3, or 4; and m, R′, R″, and R2 through R6 are as described herein. For example, each of R2 and R3 may be independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl.
  • In some embodiments, a subset of compounds of Formula (I) includes those of Formula (IIa), (IIb), (IIc), or (IIe):
  • Figure US20220290125A1-20220915-C00006
  • or a salt or isomer thereof, wherein R4 is as described herein.
  • In some embodiments, a subset of compounds of Formula (I) includes those of Formula (IId):
  • Figure US20220290125A1-20220915-C00007
  • or a salt or isomer thereof, wherein n is 2, 3, or 4; and m, R′, R″, and R2 through R6 are as described herein. For example, each of R2 and R3 may be independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl.
  • In some embodiments, the compound of Formula (I) is selected from the group consisting of:
  • Figure US20220290125A1-20220915-C00008
    Figure US20220290125A1-20220915-C00009
    Figure US20220290125A1-20220915-C00010
    Figure US20220290125A1-20220915-C00011
    Figure US20220290125A1-20220915-C00012
    Figure US20220290125A1-20220915-C00013
  • In further embodiments, the compound of Formula (I) is selected from the group consisting of:
  • Figure US20220290125A1-20220915-C00014
  • In some embodiments, the compound of Formula (I) is selected from the group consisting of:
  • Figure US20220290125A1-20220915-C00015
    Figure US20220290125A1-20220915-C00016
    Figure US20220290125A1-20220915-C00017
    Figure US20220290125A1-20220915-C00018
    Figure US20220290125A1-20220915-C00019
    Figure US20220290125A1-20220915-C00020
    Figure US20220290125A1-20220915-C00021
    Figure US20220290125A1-20220915-C00022
    Figure US20220290125A1-20220915-C00023
    Figure US20220290125A1-20220915-C00024
    Figure US20220290125A1-20220915-C00025
  • Figure US20220290125A1-20220915-C00026
    Figure US20220290125A1-20220915-C00027
    Figure US20220290125A1-20220915-C00028
    Figure US20220290125A1-20220915-C00029
    Figure US20220290125A1-20220915-C00030
    Figure US20220290125A1-20220915-C00031
    Figure US20220290125A1-20220915-C00032
    Figure US20220290125A1-20220915-C00033
    Figure US20220290125A1-20220915-C00034
    Figure US20220290125A1-20220915-C00035
    Figure US20220290125A1-20220915-C00036
    Figure US20220290125A1-20220915-C00037
    Figure US20220290125A1-20220915-C00038
    Figure US20220290125A1-20220915-C00039
    Figure US20220290125A1-20220915-C00040
  • and salts and isomers thereof.
  • In some embodiments, a nanoparticle comprises the following compound:
  • Figure US20220290125A1-20220915-C00041
  • or salts and isomers thereof.
  • In some embodiments, a lipid nanoparticle comprises Compounds 3, 18, 20, 25, 26, 29, 30, 60, 108-112, or 122.
  • In some embodiments, the nanoparticle has a polydispersity value of less than 0.4 (e.g., less than 0.3, 0.2 or 0.1).
  • In some embodiments, the nanoparticle has a net neutral charge at a neutral pH value.
  • The following examples are intended to be illustrative of certain embodiments and are non-limiting. The entire contents of all of the references (including literature references, issued patents, published patent applications, and co pending patent applications) cited throughout this application are hereby expressly incorporated by reference.
    • EXAMPLES Example 1. Thermotoga Maritima RNase III (TmR3) Purification
  • Initial affinity purification experiments using immobilized wild-type Escherichia coli (E. coli) RNase III resulted in non-specific degradation of the RNA, which was attributed to the structure of the mRNA. To address the problem of non-specific degradation, additional affinity purification experiments were performed at elevated temperatures using a hardier, thermostable Thermotoga maritima RNase III (TmR3), which has high sequence homology to E. coli RNase III (Protein BLAST (NCBI) E value of 2−50; sequence alignment shown in FIG. 6). A catalytically-inactive form of TmR3 was also used. The mutation in the catalytically-essential glutamic acid residue in the TmR3 protein, which renders the TmR3 catalytically inactive, does not alter its binding affinity (e.g., indicated by KM) to dsRNA (e.g., Nicholson et al., Wiley Interdiscip Rev RNA. 2014 January; 5(1): 31-48).
  • The coding sequence for TmR3 was cloned into a bacterial expression vector under the control of an IPTG inducible promoter. Expression of TmR3 was induced by isopropyl β-D-1-thiogalactopyranoside (IPTG) at 37° C., resulting in soluble TmR3 expression. TmR3 protein was purified by Ni-NTA affinity purification, and TmR3 having a purity of greater than 99% was obtained. A total of 30 mg of TmR3 was purified from 4 liters of bacterial culture. The purified TmR3 was stored as a solution having a concentration of 2 mg/ml. The purified TmR3 (MW=28.5 kDA) was resolved in the polyacrylamide gel shown in FIG. 1
  • The protein sequence of the recombinant TmR3 is identified by SEQ ID NO: 7.
  • TmR3 protein sequence with 8xHis tag
    (SEQ ID NO: 7)
    MHHHHHHHHNESERKIVEEFQKETGINFKNEELLFRALCH
    SSYANEQNQAGRKDVESNEKLEFLGDAVLELFVCEILYKK
    YPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFLFLGKG
    EEKTGGRDRDSILADAFEALLAAIYLDQGYEKIKELFEQE
    FEFYIEKIMKGEMLFDYKTALQEIVQSEHKVPPEYILVRT
    EKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAY
    EKLLKERS
    (underlined sequence: 8xHis tag; bolded
    amino acid: glutamic acid residue critical
    for catalytic activity)
    • Example 2. Thermotoga Maritima RNase III (TmR3) Temperature Study
  • To assess whether use of immobilized TmR3 in an affinity purification method results in non-specific degradation of RNA (e.g., mRNA) to be purified, synthetic mRNA was incubated with the purified TmR3 described in Example 1 at different temperatures (37° C., 45° C., or 65° C.) and non-specific degradation of the mRNA was analyzed on a size-exclusion column. mRNA having different 5′cap structures were also tested.
  • A human erythropoietin (hEPO) mRNA containing a natural 5′ cap (GO) (FIGS. 2A-2D) or a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) (FIGS. 3A-3D) was incubated in reaction mixtures containing purified TmR3 at room temperature, 37° C., 45° C., or 65° C., and non-specific degradation products were observed at all temperatures, with most degraded fragments of the mRNA observed at 65° C.
  • A luciferase (Luc) mRNA containing a natural 5′ cap (GO) (FIGS. 4A-4D) or a 5′ cap analog 7mG(5′)ppp(5′)NlmpNp (G5) (FIGS. 5A-5D) was incubated in reaction mixtures containing purified TmR3 at room temperature, 37° C., 45° C., or 65° C., and the mixtures were analyzed on a size exclusion column. Non-specific degradation products were observed at almost all temperatures, with most degraded fragments of the mRNA observed at 65° C.
    • Example 3. Catalytically-Inactive TmR3
  • Results herein show that catalytically-inactive TmR3 reduces the non-specific RNA degradation observed in Example 2 (FIGS. 2A-5D). A E117K mutation abolished the catalytic activity of E. Coli RNase III. The cognate mutation in TmR3 is E130K (FIG. 6). The TmR3-E130K mutant was expressed and purified. The expression and purification conditions and the yield are shown in Table 2.
  • TABLE 2
    Expression and Purification of TmR3-E130K
    Summary Information
    Expression Scale
    2 × 1 L
    Enrichment IMAC
    Protein Conc. (mg/ml) 1.09 mg/mL
    Total Volume (ml) 63 mL
    Total Protein 68.7 mg
    Aliquot Size 63 × 1 mL
    Buffer Formulation
    30 mM Tris pH 8, 500 mM NaCl, 0.5 mM
    TCEP, 0.5 mM EDTA, 50% glycerol
    Storage Temperate (° C.) −20 C.
  • To detect whether the purified TmR3 contains any non-specific RNase contamination, 20 μg of hEPO mRNA with a G5 cap was incubated with different amounts of TmR3 or TmR3-E130K in the buffer specified in Table 1. A reaction containing no added RNase was also used as a negative control. The reaction mixtures were incubated at room temperature for 1 hour, before the mixtures were subjected to the size exclusion analysis as described in Example 2. No detectable non-specific RNA contamination was observed (FIG. 7).
  • Further, a RNaseAlert test kit (ThermoFisher) was used to detect any non-specific RNase contamination in the purified TmR3. 5 μg of enzyme (TmR3, TmR3-E130K, Viv PAP, or RNase A) were incubated at 37° C. for 1 hour with a test buffer containing a RNA substrate tagged with a fluorescent reporter molecule (fluor) on one end and a quencher on the other. Degradation of the RNA substrate separates the quencher and the fluor, producing green fluorescence when excited by light of appropriate wavelength. Green fluorescence was not observed for TmR3 or TmR3-E130K, indicating the absence of a contaminating non-specific RNase.
    • Example 4. TmR3-E130K Mutant for RNA Purification (Prophetic)
  • The TmR3-E130K mutant protein is suitable for use in RNA purification. For example, in an in vitro transcription reaction where a mRNA is being produced, there often are short, double stranded RNA contaminants. Removing the dsRNA contaminants would yield pure mRNA. To be used for RNA purification, the TmR3 protein (e.g., TmR3-E130K) may be purified in large quantity and immobilized on a carboxy-reactive resin or amino reactive resin. Carboxy-reactive resins and amino reactive resins are familiar to the skilled artisan and are commercially available. The coupling procedure are also familiar to the skilled artisan. Different protein loading levels may be tested.
  • To use the resin for RNA purification, the resin may be packed into a column and equilibrated in appropriate buffer before the RNA sample (e.g., an in vitro transcription reaction mixture) is loaded to the resin. The dsRNA contaminants will be bound by the TmR3-E130K protein, while single-stranded mRNA is flowed through and collected. The quality (e.g., purity and integrity) of the mRNA collected is then analyzed by gel electrophoresis, size exclusion column, or in functional assays.
    • Example 5. Immobilizing WT TmR3 and TmR3-E130K Proteins
  • The instant study was designed to immobilize the TmR3 (wild type and E130K variant) to different types of resins. Resins tested are N-hydroxysuccinimide (NHS) activated resins (e.g., from ThermoFisher Scientific) and CarboxyLink™ resins (e.g., from ThermoFisher Scientific).
  • For resin coupling, protein samples were dialyzed against 0.1 M sodium phosphate buffer with 150 mM NaCl and 0.1 M MES with 0.9% NaCl for NHS activated and CarboxyLink™ slurry, respectively. Binding of protein was performed by mixing top to bottom for 3 hours at room temperature. Unbound proteins were extracted by flow through, and resin were stored in sodium phosphate buffer with 0.05% azide. For coupling to CarboxyLink™ resin, 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (EDC) was added as a crosslinker to conjugate protein to the resin.
  • For NHS resin, 1.86, 3.71 and 7.43 ml of WT TmR3 or 2.21, 4.43 and 8.86 ml of E130K TmR3 after dialysis were added to achieve 0.5δ, 1.0× and 2.0× protein binding to 1 ml slurry. SDA-PAGE analysis and Bradford assays show that the both WT TmR3 and E130K TmR3 were efficiently coupled to NHS resin and the higher level of efficiency was achieved at 0.5× (FIGS. 8A-8B, and Tables 3-4).
  • For CarboxyLink™ resin 1.71, 3.43 and 6.85 ml of WT TmR3 or 2, 4 and 8 ml of E310K TmR3 were added to achieve 0.5×, 1.0× and 2.0× protein binding to 1 ml slurry. SDA-PAGE analysis and Bradford assays showed that the crosslinking efficiency was less than that for the NHS resin at all concentrations for both WT TmR3 and E130K TmR3 (FIGS. 9A-9B, and Tables 5-6). Without being bound by theory, it is possible that the TmR3 proteins were crosslinked in solution and only a small percentage of the protein pool was able to successfully couple to the resin.
  • TABLE 3
    Coupling WT TmR3 to NHS Resin
    Binding
    Volume Efficiency
    Lanes of Loaded (Bradford
    FIG. 8A Protein Resin (μl) Assay)
    1 Fermentas Marker no resin 4 NA
    2 WT TmR3 no resin 15 NA
    3 WT TmR3 0.5 X NHS 15 ~97%
    4 WT TmR3 1.0 X NHS 15 ~92%
    5 WT TmR3 2.0 X NHS 15 ~76%
  • TABLE 4
    Coupling E130K TmR3 to NHS Resin
    Binding
    Volume Efficiency
    Lanes of Loaded (Bradford
    FIG. 8B Protein Resin (μl) Assay)
    1 Fermentas Marker no resin 4 NA
    2 E130K TmR3 no resin 15 NA
    3 E130K TmR3 0.5 X NHS 15 ~98%
    4 E130K TmR3 1.0 X NHS 15 ~89%
    5 E130K TmR3 2.0 X NHS 15 ~58%
  • TABLE 5
    Coupling WT TmR3 to CarboxyLink ™ Resin
    Binding
    Volume Efficiency
    Lanes of Loaded (Bradford
    FIG. 9A Protein Resin (μl) Assay)
    1 Fermentas Marker no resin 4 NA
    2 WT TmR3 no resin 15 NA
    3 WT TmR3 0.5 X CarboxyLink ™ 15 ~3%
    4 WT TmR3 1.0 X CarboxyLink ™ 15 NA
    5 WT TmR3 2.0 X CarboxyLink ™ 15 NA
  • TABLE 6
    Coupling E130K TmR3 to CarboxyLink ™ Resin
    Binding
    Volume Efficiency
    Lanes of Loaded (Bradford
    FIG. 9B Protein Resin (μl) Assay)
    1 Fermentas Marker no resin 4 NA
    2 E130K TmR3 no resin 15 NA
    3 E130K TmR3 0.5 X CarboxyLink ™ 15  ~6%
    4 E130K TmR3 1.0 X CarboxyLink ™ 15 ~12%
    5 E130K TmR3 2.0 X CarboxyLink ™ 15 NA
    • Example 6. Purification of mRNA Encoding Human Erythropoietin (Epo) from IVT
  • The instant study was designed to demonstrate that the RNA purification methods described herein may be used to remove double-stranded RNA contaminants from single-stranded RNA preparations (e.g., mRNA produced via in vitro transcription).
  • MRNA coding for the human erythropoietin (Epo) protein was made using standard in vitro transcription conditions and purified using polyT affinity chromatography. 100 μg of mRNA was mixed with reaction buffer containing 33 mM Tris-acetate, pH 7.5, 66 mM potassium acetate, 10 mM magnesium acetate, and 0.5 mM TCEP, to a final volume of 250 μl and added to 250 μl of “2.0×” N-hydroxysuccinimide (NHS) resin containing either WT or E130K mutant immobilized RNase III enzyme. The slurry was incubated at room temperature for 30 minutes and then passed through a spin filter to remove the resin. The clarified solution containing mRNA was transfected into BJ fibroblasts using L2000 according to the manufacturer protocol. Forty-eight hours after transfection, the supernatant from the transfection was collected and analyzed by ELISA for human EPO expression (FIG. 10A) and INF-beta cytokine expression (FIG. 10B) and according to their manufacturer protocols.
    • EQUIVALENTS AND SCOPE
  • All references, patents and patent applications disclosed herein are incorporated by reference with respect to the subject matter for which each is cited, which in some cases may encompass the entirety of the document.
  • The indefinite articles “a” and “an,” as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean “at least one.”
  • It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.
  • In the claims, as well as in the specification above, all transitional phrases such as “comprising,” “including,” “carrying,” “having,” “containing,” “involving,” “holding,” “composed of,” and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases “consisting of” and “consisting essentially of” shall be closed or semi-closed transitional phrases, respectively, as set forth in the United States Patent Office Manual of Patent Examining Procedures, Section 2111.03.

Claims (35)

What is claimed is:
1. A method of purifying a nucleic acid preparation, comprising
contacting a nucleic acid preparation comprising messenger ribonucleic acid (mRNA) with an RNase III enzyme that is immobilized on a solid support, under conditions that result in binding of the RNase III enzyme to double-stranded RNA.
2. The method of claim 1, wherein the mRNA is an in vitro-transcribed mRNA.
3. The method of claim 1 or 2, wherein the preparation further comprises double-stranded RNA (dsRNA).
4. The method of any one of claims 1-3, wherein the RNase III enzyme is catalytically inactive.
5. The method of any one of claims 1-4, wherein the RNase III enzyme is a thermostable RNase III enzyme.
6. The method of claim 5, wherein the thermostable RNase III enzyme is a Thermotoga maritima RNase III enzyme.
7. The method of any one of claims 1-6, wherein the RNase III enzyme comprises an amino acid sequence identified by SEQ ID NO: 3.
8. The method of any one of claims 1-6, wherein the RNase III enzyme comprises an amino acid sequence having a modification at an amino acid position corresponding to E130 of the sequence identified by SEQ ID NO: 3.
9. The method of claim 8, wherein the RNase III enzyme comprises an amino acid sequence identified by SEQ ID NO: 4.
10. The method of any one of claims 1-9, wherein the solid support comprises a carboxy-reactive resin or an amino-reactive resin.
11. The method of any one of claims 1-10, wherein the mRNA comprises at least one chemical modification.
12. The method of claim 11, wherein the chemical modification is selected from pseudouridine, N1-methylpseudouridine, 2-thiouridine, 4′-thiouridine, 5-methylcytosine, 5-methyluridine, 2-thio-1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine, 2-thio-dihydropseudouridine, 2-thio-dihydrouridine, 2-thio15 pseudouridine, 4-methoxy-2-thio-pseudouridine, 4-methoxy-pseudouridine, 4-thio-1-methylpseudouridine, 4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine, 5-methoxyuridine and 2′-O-methyl uridine.
13. The method of any one of claims 1-12, wherein the mRNA comprises a 5′ terminal cap.
14. The method of claim 14, wherein the 5′ terminal cap is 7mG(5′)ppp(5′)NlmpNp.
15. A method, comprising:
performing an in vitro transcription reaction in the presence of a template nucleic acid to produce an in vitro transcription product; and
contacting the in vitro transcription product with an RNase III enzyme that is immobilized on a solid support.
16. The method of claim 15, wherein the in vitro transcription product comprises messenger RNA (mRNA).
17. The method of claim 15 or 16, wherein the in vitro transcription product further comprises double-stranded RNA (dsRNA).
18. The method of any one of claims 15-17, wherein the RNase III enzyme is catalytically inactive.
19. The method of any one of claims 15-18, wherein the RNase III enzyme is a thermostable RNase III enzyme.
20. The method of claim 19, wherein the thermostable RNase III enzyme is a Thermotoga maritima RNase III enzyme.
21. The method of any one of claims 15-20, wherein the RNase III enzyme comprises an amino acid sequence identified by SEQ ID NO: 3.
22. The method of any one of claims 15-20, wherein the RNase III enzyme comprises an amino acid sequence having a modification at an amino acid position corresponding to E130 of the sequence identified by SEQ ID NO: 3.
23. The method of claim 22, wherein the RNase III enzyme comprises an amino acid sequence as identified by SEQ ID NO: 4.
24. The method of any one of claims 15-23, wherein the solid support comprises a carboxy-reactive resin or an amino-reactive resin.
25. The method of any one of claims 16-24, wherein the mRNA comprises at least one chemical modification.
26. The method of claim 25, wherein the chemical modification is selected from pseudouridine, N1-methylpseudouridine, 2-thiouridine, 4′-thiouridine, 5-methylcytosine, 5-methyluridine, 2-thio-1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine, 2-thio-dihydropseudouridine, 2-thio-dihydrouridine, 2-thio15 pseudouridine, 4-methoxy-2-thio-pseudouridine, 4-methoxy-pseudouridine, 4-thio-1-methylpseudouridine, 4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine, 5-methoxyuridine and 2′-O-methyl uridine.
27. The method of any one of claims 16-26, wherein the mRNA comprises a 5′ terminal cap.
28. The method of claim 27, wherein the 5′ terminal cap is 7mG(5′)ppp(5′)NlmpNp.
29. A composition comprising RNA purified according to a method that comprises contacting a preparation comprising messenger ribonucleic acid (mRNA) with an RNase III enzyme that is immobilized on a solid support.
30. The composition of claim 29, wherein the composition is substantially free of double-stranded RNA.
31. A composition comprising RNA prepared according to a method that comprises
performing an in vitro transcription reaction in the presence of a template nucleic acid to produce an in vitro transcription product; and
contacting the in vitro transcription product with an RNase III enzyme that is immobilized on a solid support.
32. The composition of claim 31, wherein the composition is substantially free of double-stranded RNA.
33. A method of purifying a product of an in vitro transcription reaction, comprising
contacting a product of an in vitro transcription reaction comprising messenger ribonucleic acid (mRNA) with a catalytically inactive thermostable RNase III enzyme that is immobilized on a solid support, under conditions that result in binding of the RNase III enzyme to double-stranded RNA.
34. The method of claim 33, wherein the catalytically inactive thermostable RNase III enzyme has an amino acid sequence identified by SEQ ID NO: 4.
35. A catalytically inactive thermostable RNase III enzyme having an amino acid sequence identified by SEQ ID NO: 4.
US17/830,742 2016-12-13 2022-06-02 Rna affinity purification Pending US20220290125A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US17/830,742 US20220290125A1 (en) 2016-12-13 2022-06-02 Rna affinity purification

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201662433352P 2016-12-13 2016-12-13
PCT/US2017/065962 WO2018111967A1 (en) 2016-12-13 2017-12-13 Rna affinity purification
US201916468838A 2019-06-12 2019-06-12
US17/830,742 US20220290125A1 (en) 2016-12-13 2022-06-02 Rna affinity purification

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
US16/468,838 Continuation US11384352B2 (en) 2016-12-13 2017-12-13 RNA affinity purification
PCT/US2017/065962 Continuation WO2018111967A1 (en) 2016-12-13 2017-12-13 Rna affinity purification

Publications (1)

Publication Number Publication Date
US20220290125A1 true US20220290125A1 (en) 2022-09-15

Family

ID=62559322

Family Applications (2)

Application Number Title Priority Date Filing Date
US16/468,838 Active 2038-10-05 US11384352B2 (en) 2016-12-13 2017-12-13 RNA affinity purification
US17/830,742 Pending US20220290125A1 (en) 2016-12-13 2022-06-02 Rna affinity purification

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US16/468,838 Active 2038-10-05 US11384352B2 (en) 2016-12-13 2017-12-13 RNA affinity purification

Country Status (3)

Country Link
US (2) US11384352B2 (en)
EP (1) EP3555289A1 (en)
WO (1) WO2018111967A1 (en)

Families Citing this family (43)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9464124B2 (en) 2011-09-12 2016-10-11 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
CA2946751A1 (en) 2014-04-23 2015-10-29 Modernatx, Inc. Nucleic acid vaccines
US11364292B2 (en) 2015-07-21 2022-06-21 Modernatx, Inc. CHIKV RNA vaccines
ES2937963T3 (en) 2015-07-21 2023-04-03 Modernatx Inc Infectious disease vaccines
WO2017031232A1 (en) 2015-08-17 2017-02-23 Modernatx, Inc. Methods for preparing particles and related compositions
PL3718565T3 (en) 2015-10-22 2022-09-19 Modernatx, Inc. Respiratory virus vaccines
WO2017070624A1 (en) 2015-10-22 2017-04-27 Modernatx, Inc. Tropical disease vaccines
CA3002819A1 (en) 2015-10-22 2017-04-27 Modernatx, Inc. Sexually transmitted disease vaccines
EA201891001A1 (en) 2015-10-22 2018-11-30 МОДЕРНАТиЭкс, ИНК. VACCINES ON THE BASIS OF NUCLEIC ACIDS AGAINST WINDSHEAD VIRUS (VZV)
EP3364981A4 (en) 2015-10-22 2019-08-07 ModernaTX, Inc. Human cytomegalovirus vaccine
CA3007955A1 (en) 2015-12-10 2017-06-15 Modernatx, Inc. Lipid nanoparticles for delivery of therapeutic agents
US10465190B1 (en) 2015-12-23 2019-11-05 Modernatx, Inc. In vitro transcription methods and constructs
CA3024500A1 (en) 2016-05-18 2017-11-23 Modernatx, Inc. Polynucleotides encoding relaxin
CN116837052A (en) 2016-09-14 2023-10-03 摩登纳特斯有限公司 High-purity RNA composition and preparation method thereof
JP6980780B2 (en) 2016-10-21 2021-12-15 モデルナティーエックス， インコーポレイテッド Human cytomegalovirus vaccine
WO2018089851A2 (en) 2016-11-11 2018-05-17 Modernatx, Inc. Influenza vaccine
MA50335A (en) 2016-12-08 2020-08-19 Modernatx Inc NUCLEIC ACID VACCINES AGAINST RESPIRATORY VIRUSES
WO2018111967A1 (en) 2016-12-13 2018-06-21 Modernatx, Inc. Rna affinity purification
MA47515A (en) 2017-02-16 2019-12-25 Modernatx Inc VERY POWERFUL IMMUNOGENIC COMPOSITIONS
WO2018170256A1 (en) 2017-03-15 2018-09-20 Modernatx, Inc. Herpes simplex virus vaccine
WO2018170260A1 (en) 2017-03-15 2018-09-20 Modernatx, Inc. Respiratory syncytial virus vaccine
US11045540B2 (en) 2017-03-15 2021-06-29 Modernatx, Inc. Varicella zoster virus (VZV) vaccine
MA52262A (en) 2017-03-15 2020-02-19 Modernatx Inc BROAD SPECTRUM VACCINE AGAINST THE INFLUENZA VIRUS
US20200030432A1 (en) 2017-03-17 2020-01-30 Modernatx, Inc. Zoonotic disease rna vaccines
MA48047A (en) 2017-04-05 2020-02-12 Modernatx Inc REDUCTION OR ELIMINATION OF IMMUNE RESPONSES TO NON-INTRAVENOUS THERAPEUTIC PROTEINS, FOR EXAMPLE SUBCUTANEOUSLY
WO2018232357A1 (en) 2017-06-15 2018-12-20 Modernatx, Inc. Rna formulations
US11866696B2 (en) 2017-08-18 2024-01-09 Modernatx, Inc. Analytical HPLC methods
MA49922A (en) 2017-08-18 2021-06-02 Modernatx Inc PROCESSES FOR HPLC ANALYSIS
JP7408098B2 (en) 2017-08-18 2024-01-05 モデルナティエックス インコーポレイテッド RNA polymerase variants
JP7275111B2 (en) 2017-08-31 2023-05-17 モデルナティエックス インコーポレイテッド Method for producing lipid nanoparticles
US10653767B2 (en) 2017-09-14 2020-05-19 Modernatx, Inc. Zika virus MRNA vaccines
US11911453B2 (en) 2018-01-29 2024-02-27 Modernatx, Inc. RSV RNA vaccines
US11351242B1 (en) 2019-02-12 2022-06-07 Modernatx, Inc. HMPV/hPIV3 mRNA vaccine composition
CN113795579A (en) 2019-02-20 2021-12-14 摩登纳特斯有限公司 RNA polymerase variants for co-transcriptional capping
US11851694B1 (en) 2019-02-20 2023-12-26 Modernatx, Inc. High fidelity in vitro transcription
CN113521268A (en) 2020-04-22 2021-10-22 生物技术Rna制药有限公司 Coronavirus vaccine
US11406703B2 (en) 2020-08-25 2022-08-09 Modernatx, Inc. Human cytomegalovirus vaccine
US11524023B2 (en) 2021-02-19 2022-12-13 Modernatx, Inc. Lipid nanoparticle compositions and methods of formulating the same
US20220364078A1 (en) * 2021-05-14 2022-11-17 Crispr Therapeutics Ag Mrna large scale synthesis and purification
IL308469A (en) * 2021-05-26 2024-01-01 Etherna Immunotherapies Nv Method to reduce double stranded rna by-product formation
WO2023112886A1 (en) * 2021-12-16 2023-06-22 国立研究開発法人理化学研究所 Method for producing single-stranded rna
WO2023141624A1 (en) * 2022-01-24 2023-07-27 Verily Life Sciences Llc Ionizable lipids, lipid nanoparticles, and uses thereof
US11878055B1 (en) 2022-06-26 2024-01-23 BioNTech SE Coronavirus vaccine

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130189741A1 (en) * 2009-12-07 2013-07-25 Cellscript, Inc. Compositions and methods for reprogramming mammalian cells

Family Cites Families (136)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5256555A (en) 1991-12-20 1993-10-26 Ambion, Inc. Compositions and methods for increasing the yields of in vitro RNA transcription and other polynucleotide synthetic reactions
US5997861A (en) 1994-10-31 1999-12-07 Burstein Laboratories, Inc. Antiviral supramolecules containing target-binding molecules and therapeutic molecules bound to spectrin
US20050287540A1 (en) 1995-09-27 2005-12-29 Murphy Brian R Production of attenuated negative stranded RNA virus vaccines from cloned nucleotide sequences
WO2002044196A1 (en) 2000-11-28 2002-06-06 University Of Massachusetts Methods and reagents for introducing a sulfhydryl group into the 5'-terminus of rna
US20050042621A1 (en) 2002-09-27 2005-02-24 Affymetrix, Inc. Method for preparing a nucleic acid sample for hybridization to an array
US20140142290A1 (en) 2003-08-01 2014-05-22 Life Technologies Corporation Compositions and methods for preparing short rna molecules and other nucleicacids
WO2007014363A2 (en) 2005-07-27 2007-02-01 Genentech, Inc. Vectors for inducible expression of hairpin rna and use thereof
US9012219B2 (en) * 2005-08-23 2015-04-21 The Trustees Of The University Of Pennsylvania RNA preparations comprising purified modified RNA for reprogramming cells
ES2937245T3 (en) 2005-08-23 2023-03-27 Univ Pennsylvania RNA containing modified nucleosides and methods of using the same
DE102006061015A1 (en) 2006-12-22 2008-06-26 Curevac Gmbh Process for the purification of RNA on a preparative scale by HPLC
US9163246B2 (en) 2007-08-08 2015-10-20 Wayne Barnes T7 expression system
US9193959B2 (en) 2010-04-16 2015-11-24 Roche Diagnostics Operations, Inc. T7 RNA polymerase variants with enhanced thermostability
CA2801564A1 (en) 2010-06-11 2011-12-15 Syngenta Participations Ag Compositions and methods for protein production
EP3578205A1 (en) 2010-08-06 2019-12-11 ModernaTX, Inc. A pharmaceutical formulation comprising engineered nucleic acids and medical use thereof
US20120237975A1 (en) 2010-10-01 2012-09-20 Jason Schrum Engineered nucleic acids and methods of use thereof
EP2691101A2 (en) 2011-03-31 2014-02-05 Moderna Therapeutics, Inc. Delivery and formulation of engineered nucleic acids
CA2835428A1 (en) 2011-05-17 2012-11-22 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof for non-human vertebrates
WO2013003475A1 (en) * 2011-06-27 2013-01-03 Cellscript, Inc. Inhibition of innate immune response
WO2013039861A2 (en) 2011-09-12 2013-03-21 modeRNA Therapeutics Engineered nucleic acids and methods of use thereof
US9464124B2 (en) 2011-09-12 2016-10-11 Moderna Therapeutics, Inc. Engineered nucleic acids and methods of use thereof
FR2981088B1 (en) 2011-10-06 2013-11-29 Biomerieux Sa RNA POLYMERASES MUTEES
US20140378538A1 (en) 2011-12-14 2014-12-25 Moderma Therapeutics, Inc. Methods of responding to a biothreat
KR20140102759A (en) 2011-12-16 2014-08-22 모더나 세라퓨틱스, 인코포레이티드 Modified nucleoside, nucleotide, and nucleic acid compositions
AU2012358384A1 (en) 2011-12-21 2014-07-31 Moderna Therapeutics, Inc. Methods of increasing the viability or longevity of an organ or organ explant
PL3421601T3 (en) 2011-12-30 2020-06-01 Cellscript, Llc Making and using in vitro-synthesized ssrna for introducing into mammalian cells to induce a biological or biochemical effect
WO2013148867A1 (en) 2012-03-27 2013-10-03 Massachusetts Institute Of Technology Artificial sigma factors based on bisected t7 rna polymerase
CA2868398A1 (en) 2012-04-02 2013-10-10 Moderna Therapeutics, Inc. Modified polynucleotides for the production of cosmetic proteins and peptides
US9878056B2 (en) 2012-04-02 2018-01-30 Modernatx, Inc. Modified polynucleotides for the production of cosmetic proteins and peptides
US9283287B2 (en) 2012-04-02 2016-03-15 Moderna Therapeutics, Inc. Modified polynucleotides for the production of nuclear proteins
US10501513B2 (en) 2012-04-02 2019-12-10 Modernatx, Inc. Modified polynucleotides for the production of oncology-related proteins and peptides
US9512456B2 (en) 2012-08-14 2016-12-06 Modernatx, Inc. Enzymes and polymerases for the synthesis of RNA
US20150307542A1 (en) 2012-10-03 2015-10-29 Moderna Therapeutics, Inc. Modified nucleic acid molecules and uses thereof
US20150376581A1 (en) 2012-10-29 2015-12-31 Technische Universitaet Dortmund T7 rna polymerase variants and methods of using the same
JP6144355B2 (en) 2012-11-26 2017-06-07 モデルナティエックス インコーポレイテッドＭｏｄｅｒｎａＴＸ，Ｉｎｃ． Chemically modified mRNA
WO2014093574A1 (en) 2012-12-13 2014-06-19 Moderna Therapeutics, Inc. Modified polynucleotides for altering cell phenotype
EP2970955B1 (en) 2013-03-14 2018-11-14 Translate Bio, Inc. Methods for purification of messenger rna
WO2014160243A1 (en) * 2013-03-14 2014-10-02 The Trustees Of The University Of Pennsylvania Purification and purity assessment of rna molecules synthesized with modified nucleosides
US10258698B2 (en) 2013-03-14 2019-04-16 Modernatx, Inc. Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions
US10138507B2 (en) 2013-03-15 2018-11-27 Modernatx, Inc. Manufacturing methods for production of RNA transcripts
US11377470B2 (en) 2013-03-15 2022-07-05 Modernatx, Inc. Ribonucleic acid purification
ES2923018T3 (en) 2013-03-15 2022-09-22 Glaxosmithkline Biologicals Sa RNA purification methods
US20160032273A1 (en) 2013-03-15 2016-02-04 Moderna Therapeutics, Inc. Characterization of mrna molecules
EP2983804A4 (en) 2013-03-15 2017-03-01 Moderna Therapeutics, Inc. Ion exchange purification of mrna
US10385088B2 (en) 2013-10-02 2019-08-20 Modernatx, Inc. Polynucleotide molecules and uses thereof
EP3058082A4 (en) 2013-10-18 2017-04-26 ModernaTX, Inc. Compositions and methods for tolerizing cellular systems
CA2946751A1 (en) 2014-04-23 2015-10-29 Modernatx, Inc. Nucleic acid vaccines
WO2015196128A2 (en) 2014-06-19 2015-12-23 Moderna Therapeutics, Inc. Alternative nucleic acid molecules and uses thereof
EP3169693B1 (en) 2014-07-16 2022-03-09 ModernaTX, Inc. Chimeric polynucleotides
AU2015289573A1 (en) 2014-07-17 2017-02-02 Modernatx, Inc Terminal modifications of polynucleotides
US20180000953A1 (en) 2015-01-21 2018-01-04 Moderna Therapeutics, Inc. Lipid nanoparticle compositions
WO2016164762A1 (en) 2015-04-08 2016-10-13 Moderna Therapeutics, Inc. Polynucleotides encoding low density lipoprotein receptor egf-a and intracellular domain mutants and methods of using the same
SI3286203T1 (en) 2015-04-23 2020-10-30 Geron Corporation Methods of polynucleotide preparation using multivalent cation salt compositions
WO2016201377A1 (en) 2015-06-10 2016-12-15 Moderna Therapeutics, Inc. Targeted adaptive vaccines
WO2017015457A1 (en) 2015-07-21 2017-01-26 Modernatx, Inc. Ebola vaccine
ES2937963T3 (en) 2015-07-21 2023-04-03 Modernatx Inc Infectious disease vaccines
US20190008887A1 (en) 2015-07-30 2019-01-10 ModernaTX Inc. Multimeric mrna
WO2017020026A1 (en) 2015-07-30 2017-02-02 Modernatx, Inc. Concatemeric peptide epitopes rnas
WO2017031232A1 (en) 2015-08-17 2017-02-23 Modernatx, Inc. Methods for preparing particles and related compositions
US20180237849A1 (en) 2015-08-17 2018-08-23 Modernatx, Inc. Rna mapping/fingerprinting
AU2016324310B2 (en) 2015-09-17 2021-04-08 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
WO2017062513A1 (en) 2015-10-05 2017-04-13 Modernatx, Inc. Methods for therapeutic administration of messenger ribonucleic acid drugs
WO2017066789A1 (en) 2015-10-16 2017-04-20 Modernatx, Inc. Mrna cap analogs with modified sugar
WO2017070624A1 (en) 2015-10-22 2017-04-27 Modernatx, Inc. Tropical disease vaccines
CA3002819A1 (en) 2015-10-22 2017-04-27 Modernatx, Inc. Sexually transmitted disease vaccines
EP3364981A4 (en) 2015-10-22 2019-08-07 ModernaTX, Inc. Human cytomegalovirus vaccine
CN109310751A (en) 2015-10-22 2019-02-05 摩登纳特斯有限公司 Wide spectrum influenza virus vaccine
CN108472354A (en) 2015-10-22 2018-08-31 摩登纳特斯有限公司 Respiratory syncytial virus vaccines
EA201891001A1 (en) 2015-10-22 2018-11-30 МОДЕРНАТиЭкс, ИНК. VACCINES ON THE BASIS OF NUCLEIC ACIDS AGAINST WINDSHEAD VIRUS (VZV)
MA46024A (en) 2015-10-22 2019-07-03 Modernatx Inc HERPES SIMPLEX VACCINE
MA46255A (en) 2015-10-22 2019-07-31 Modernatx Inc ANTI-CANCER VACCINES
PL3718565T3 (en) 2015-10-22 2022-09-19 Modernatx, Inc. Respiratory virus vaccines
CA3007955A1 (en) 2015-12-10 2017-06-15 Modernatx, Inc. Lipid nanoparticles for delivery of therapeutic agents
AU2016369612B2 (en) 2015-12-17 2023-06-01 Modernatx, Inc. Polynucleotides encoding methylmalonyl-CoA mutase
US10465190B1 (en) 2015-12-23 2019-11-05 Modernatx, Inc. In vitro transcription methods and constructs
WO2017127750A1 (en) 2016-01-22 2017-07-27 Modernatx, Inc. Messenger ribonucleic acids for the production of intracellular binding polypeptides and methods of use thereof
EP3426775A1 (en) 2016-03-10 2019-01-16 Novartis AG Chemically modified messenger rna's
JP7210287B2 (en) 2016-05-18 2023-01-23 モダーナティエックス・インコーポレイテッド Polynucleotides encoding citrine for the treatment of type II citrullinemia
US20190382774A1 (en) 2016-05-18 2019-12-19 Modernatx, Inc. Polyribonucleotides containing reduced uracil content and uses thereof
US20190390181A1 (en) 2016-05-18 2019-12-26 Modernatx, Inc. Polynucleotides Encoding Lipoprotein Lipase for the Treatment of Hyperlipidemia
WO2017201348A1 (en) 2016-05-18 2017-11-23 Modernatx, Inc. Polynucleotides encoding galactose-1-phosphate uridylyltransferase for the treatment of galactosemia type 1
WO2017201332A1 (en) 2016-05-18 2017-11-23 Modernatx, Inc. Polynucleotides encoding acyl-coa dehydrogenase, very long-chain for the treatment of very long-chain acyl-coa dehydrogenase deficiency
US20190275170A1 (en) 2016-05-18 2019-09-12 Modernatx, Inc. Polynucleotides encoding jagged1 for the treatment of alagille syndrome
MA45053A (en) 2016-05-18 2019-03-27 Modernatx Inc POLYNUCLEOTIDES CODING FOR A CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR FOR THE TREATMENT OF CYSTIC FIBROSIS
MA45032A (en) 2016-05-18 2019-03-27 Fundacion Para La Investig Medica Aplicada POLYNUCLEOTIDES CODING FOR PORPHOBILINOGEN DESAMINASE FOR THE TREATMENT OF ACUTE INTERMITTEN PORPHYRIA
EP3458590B9 (en) 2016-05-18 2021-08-18 ModernaTX, Inc. Polynucleotides encoding -galactosidase a for the treatment of fabry disease
CA3024500A1 (en) 2016-05-18 2017-11-23 Modernatx, Inc. Polynucleotides encoding relaxin
MA45037A (en) 2016-05-18 2019-03-27 Modernatx Inc RNAM-BASED POLYTHERAPY FOR CANCER TREATMENT
AU2017286606A1 (en) 2016-06-14 2018-12-13 Modernatx, Inc. Stabilized formulations of lipid nanoparticles
CN116837052A (en) 2016-09-14 2023-10-03 摩登纳特斯有限公司 High-purity RNA composition and preparation method thereof
JP6980780B2 (en) 2016-10-21 2021-12-15 モデルナティーエックス， インコーポレイテッド Human cytomegalovirus vaccine
BR112019008369A2 (en) 2016-10-26 2019-10-01 Modernatx Inc messenger ribonucleic acids to enhance immune responses and methods for using them
WO2018081462A1 (en) 2016-10-26 2018-05-03 Modernatx, Inc. Methods and compositions for rna mapping
WO2018089540A1 (en) 2016-11-08 2018-05-17 Modernatx, Inc. Stabilized formulations of lipid nanoparticles
WO2018089851A2 (en) 2016-11-11 2018-05-17 Modernatx, Inc. Influenza vaccine
US11279923B2 (en) 2016-11-28 2022-03-22 Curevac Ag Method for purifying RNA
MA50335A (en) 2016-12-08 2020-08-19 Modernatx Inc NUCLEIC ACID VACCINES AGAINST RESPIRATORY VIRUSES
WO2018111967A1 (en) 2016-12-13 2018-06-21 Modernatx, Inc. Rna affinity purification
US20180243225A1 (en) 2017-01-25 2018-08-30 Modernatx, Inc. Ebola/marburg vaccines
MA47438A (en) 2017-02-01 2019-12-11 Modernatx Inc SECONDARY POLYNUCLEOTIDE STRUCTURE
KR20190110612A (en) 2017-02-01 2019-09-30 모더나티엑스, 인크. Immunomodulatory Therapeutic MRNA Compositions Encoding Activating Oncogene Mutant Peptides
KR20190120233A (en) 2017-02-01 2019-10-23 모더나티엑스, 인크. RNA cancer vaccine
MA47515A (en) 2017-02-16 2019-12-25 Modernatx Inc VERY POWERFUL IMMUNOGENIC COMPOSITIONS
US20200368162A1 (en) 2017-02-24 2020-11-26 Modernatx, Inc. Nucleic Acid-Based Therapy of Muscular Dystrophies
WO2018170256A1 (en) 2017-03-15 2018-09-20 Modernatx, Inc. Herpes simplex virus vaccine
WO2018170260A1 (en) 2017-03-15 2018-09-20 Modernatx, Inc. Respiratory syncytial virus vaccine
MA52262A (en) 2017-03-15 2020-02-19 Modernatx Inc BROAD SPECTRUM VACCINE AGAINST THE INFLUENZA VIRUS
HUE060693T2 (en) 2017-03-15 2023-04-28 Modernatx Inc Compound and compositions for intracellular delivery of therapeutic agents
US11045540B2 (en) 2017-03-15 2021-06-29 Modernatx, Inc. Varicella zoster virus (VZV) vaccine
US20200030432A1 (en) 2017-03-17 2020-01-30 Modernatx, Inc. Zoonotic disease rna vaccines
US20200038499A1 (en) 2017-03-22 2020-02-06 Modernatx, Inc. Rna bacterial vaccines
MA48047A (en) 2017-04-05 2020-02-12 Modernatx Inc REDUCTION OR ELIMINATION OF IMMUNE RESPONSES TO NON-INTRAVENOUS THERAPEUTIC PROTEINS, FOR EXAMPLE SUBCUTANEOUSLY
MA49463A (en) 2017-04-26 2021-05-05 Modernatx Inc HERPES SIMPLEX VACCINE
WO2018232355A1 (en) 2017-06-15 2018-12-20 Modernatx, Inc. Rna antibodies
WO2018232357A1 (en) 2017-06-15 2018-12-20 Modernatx, Inc. Rna formulations
WO2019005540A1 (en) 2017-06-30 2019-01-03 Codexis, Inc. T7 rna polymerase variants
US11866696B2 (en) 2017-08-18 2024-01-09 Modernatx, Inc. Analytical HPLC methods
JP7408098B2 (en) 2017-08-18 2024-01-05 モデルナティエックス インコーポレイテッド RNA polymerase variants
EP3668522A4 (en) 2017-08-18 2021-04-21 Modernatx, Inc. Efficacious mrna vaccines
MA49922A (en) 2017-08-18 2021-06-02 Modernatx Inc PROCESSES FOR HPLC ANALYSIS
US10653767B2 (en) 2017-09-14 2020-05-19 Modernatx, Inc. Zika virus MRNA vaccines
US20190192646A1 (en) 2017-11-03 2019-06-27 Modernatx, Inc. Salmonella vaccines
CA3083102A1 (en) 2017-11-21 2019-05-31 Modernatx, Inc. Epstein-barr virus vaccines
US11911453B2 (en) 2018-01-29 2024-02-27 Modernatx, Inc. RSV RNA vaccines
AU2019293244A1 (en) 2018-06-27 2021-02-11 Modernatx, Inc. Personalized cancer vaccine epitope selection
US20220054653A1 (en) 2018-09-13 2022-02-24 Modernatx, Inc. Modified mrna for the treatment of progressive familial intrahepatic cholestasis disorders
EP3852732A1 (en) 2018-09-19 2021-07-28 ModernaTX, Inc. Peg lipids and uses thereof
CA3113436A1 (en) 2018-09-19 2020-03-26 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
JP2022500543A (en) 2018-09-19 2022-01-04 モデルナティーエックス， インコーポレイテッド High-purity PEG lipids and their use
JP2022506839A (en) 2018-11-07 2022-01-17 モデルナティエックス インコーポレイテッド RNA cancer vaccine
CN113795579A (en) 2019-02-20 2021-12-14 摩登纳特斯有限公司 RNA polymerase variants for co-transcriptional capping
CN113874502A (en) 2019-03-11 2021-12-31 摩登纳特斯有限公司 Fed-batch in vitro transcription method
WO2020190750A1 (en) 2019-03-15 2020-09-24 Modernatx, Inc. Hiv rna vaccines
EP3976057A4 (en) 2019-05-31 2023-08-30 ModernaTX, Inc. Expanded t cell assay
US20220348900A1 (en) 2019-08-14 2022-11-03 Modernatx, Inc. Processes for purifying downstream products of in vitro transcription
US20220347292A1 (en) 2019-09-11 2022-11-03 Modernatx, Inc. Human cytomegalovirus vaccine
AU2020348860A1 (en) 2019-09-19 2022-04-07 Modernatx, Inc. Cap guides and methods of use thereof for RNA mapping

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20130189741A1 (en) * 2009-12-07 2013-07-25 Cellscript, Inc. Compositions and methods for reprogramming mammalian cells

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
Blaszczyk, J. et al. 2004. Noncatalytic assembly of ribonuclease III with double-stranded RNA. Structure 12: 457-466; specif. pp. 457, 458 (Year: 2004) *
Court, D.L. et al. 2013. RNase III: Genetics and function; structure and mechanism. Annual Review of Genetics 47: 405-431; specif. pp. 417, 421 (Year: 2013) *
Johnsson, B. et al. 1991. Immobilization of proteins to a carboxymethyldextran-modified gold surface for biospecific interaction analysis in surface plasmon resonance sensors. Analytical Biochemistry 198: 268-277; specif. pp. 268, 269, 270 (Year: 1991) *
NCBI Blast search. SEQ ID NO.: 3. Datasheet [online]. Downloaded from the internet 18 October 2023; pp. 1-4 (Year: 2023) *
Singh, R. et al. 2015. Complete genome sequence of an evolved Thermotoga maritima isolate. GenomeA.ASM 3(3): 1-3; specif. pp. 1, 3 (Year: 2015) *

Also Published As

Publication number Publication date
WO2018111967A1 (en) 2018-06-21
US11384352B2 (en) 2022-07-12
EP3555289A1 (en) 2019-10-23
US20200071689A1 (en) 2020-03-05

Similar Documents

Publication Publication Date Title
US20220290125A1 (en) Rna affinity purification
EP3289101B1 (en) Immobilized poly(n)polymerase
US11268157B2 (en) Method for producing RNA
US20220073962A1 (en) Methods for rna analysis
US11920174B2 (en) RNA analysis by total hydrolysis and quantification of released nucleosides
EP3303575B1 (en) Method for adding cap structures to rna using immobilized enzymes
US10501768B2 (en) Method of producing RNA from circular DNA and corresponding template DNA
ES2680545T3 (en) Process of isolation and / or parallel purification of RNA and DNA
US20190177714A1 (en) Immobilized inorganic pyrophosphatase (ppase)
WO2017066789A1 (en) Mrna cap analogs with modified sugar
Cook et al. Advantages of ion-exchange chromatography for oligonucleotide analysis
AU2014239250A1 (en) Quantitative assessment for cap efficiency of messenger RNA
KR20190096989A (en) How to Process Nucleic Acid Samples
JP2022543569A (en) Templateless Enzymatic Synthesis of Polynucleotides Using Poly(A) and Poly(U) Polymerases
WO2023034794A1 (en) Rna preservation and recovery from fixed cells
Kimoto et al. Evolving aptamers with unnatural base pairs
US20070275920A1 (en) Method for Chromatographic Separation of a Nucleic Acid Mixture
US20220364078A1 (en) Mrna large scale synthesis and purification
CN117677710A (en) Assays for quantitative assessment of mRNA capping efficiency
JP2004533828A (en) N4 virus single-stranded DNA-dependent RNA polymerase
CN115552029A (en) Compositions and methods for rapid RNA-adenylation and RNA sequencing
Tarn Site-specific substitution of inosine at the terminal positions of a pre-mRNA intron: implications for the configuration of the terminal base interaction
US20240043892A1 (en) Methods for in vitro transcription
Roura Frigolé Biomedical studies of human adenosine deaminase acting on transfer RNA and related therapeutic strategies
EP1482048B1 (en) Sulfotransferase, its polypeptide and dna encoding the same

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

AS Assignment

Owner name: MODERNATX, INC., MASSACHUSETTS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MIRACCO, EDWARD J.;REEL/FRAME:061514/0403

Effective date: 20171218

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED