US20220211773A1 - Compositions and methods for treating immune disorders using immune modulating lactococcus bacteria strains - Google Patents
Compositions and methods for treating immune disorders using immune modulating lactococcus bacteria strains Download PDFInfo
- Publication number
- US20220211773A1 US20220211773A1 US17/583,775 US202217583775A US2022211773A1 US 20220211773 A1 US20220211773 A1 US 20220211773A1 US 202217583775 A US202217583775 A US 202217583775A US 2022211773 A1 US2022211773 A1 US 2022211773A1
- Authority
- US
- United States
- Prior art keywords
- bacterial composition
- strain
- cluster
- bacteria
- lactococcus
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 206
- 230000002519 immonomodulatory effect Effects 0.000 title claims abstract description 160
- 241000194036 Lactococcus Species 0.000 title claims abstract description 158
- 208000026278 immune system disease Diseases 0.000 title claims abstract description 42
- 238000000034 method Methods 0.000 title abstract description 76
- 230000001580 bacterial effect Effects 0.000 claims abstract description 169
- 241000194034 Lactococcus lactis subsp. cremoris Species 0.000 claims abstract description 70
- 235000014962 Streptococcus cremoris Nutrition 0.000 claims abstract description 67
- 241000894006 Bacteria Species 0.000 claims description 188
- 230000001332 colony forming effect Effects 0.000 claims description 43
- 229920002444 Exopolysaccharide Polymers 0.000 claims description 16
- 230000028993 immune response Effects 0.000 claims description 9
- 239000002775 capsule Substances 0.000 claims description 7
- 230000002238 attenuated effect Effects 0.000 claims description 6
- 239000002702 enteric coating Substances 0.000 claims description 6
- 238000009505 enteric coating Methods 0.000 claims description 6
- 238000001990 intravenous administration Methods 0.000 claims description 6
- 230000002601 intratumoral effect Effects 0.000 claims description 5
- 239000007787 solid Substances 0.000 claims description 4
- 238000007920 subcutaneous administration Methods 0.000 claims description 4
- 238000005538 encapsulation Methods 0.000 claims description 3
- 239000003937 drug carrier Substances 0.000 claims description 2
- 239000003814 drug Substances 0.000 abstract description 12
- 229940124597 therapeutic agent Drugs 0.000 abstract description 6
- 108090000623 proteins and genes Proteins 0.000 description 198
- 235000018102 proteins Nutrition 0.000 description 152
- 102000004169 proteins and genes Human genes 0.000 description 152
- -1 molecules Chemical class 0.000 description 64
- 239000008194 pharmaceutical composition Substances 0.000 description 47
- 102000008579 Transposases Human genes 0.000 description 36
- 108010020764 Transposases Proteins 0.000 description 36
- 239000000427 antigen Substances 0.000 description 35
- 206010028980 Neoplasm Diseases 0.000 description 34
- 108091007433 antigens Proteins 0.000 description 33
- 102000036639 antigens Human genes 0.000 description 33
- 210000004027 cell Anatomy 0.000 description 33
- 230000000813 microbial effect Effects 0.000 description 31
- 238000011282 treatment Methods 0.000 description 31
- 244000005700 microbiome Species 0.000 description 30
- 239000002245 particle Substances 0.000 description 30
- 241000894007 species Species 0.000 description 27
- 230000001225 therapeutic effect Effects 0.000 description 27
- 239000000306 component Substances 0.000 description 26
- 239000003242 anti bacterial agent Substances 0.000 description 25
- 230000003211 malignant effect Effects 0.000 description 24
- 230000027455 binding Effects 0.000 description 23
- 150000001875 compounds Chemical class 0.000 description 23
- 239000006228 supernatant Substances 0.000 description 23
- 229930006000 Sucrose Natural products 0.000 description 22
- 230000015572 biosynthetic process Effects 0.000 description 22
- 201000011510 cancer Diseases 0.000 description 22
- 150000001720 carbohydrates Chemical group 0.000 description 22
- 239000005720 sucrose Substances 0.000 description 22
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 21
- 239000005557 antagonist Substances 0.000 description 21
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 21
- 150000002632 lipids Chemical class 0.000 description 21
- 125000003729 nucleotide group Chemical group 0.000 description 20
- 235000014633 carbohydrates Nutrition 0.000 description 19
- 239000000047 product Substances 0.000 description 19
- 239000000463 material Substances 0.000 description 18
- 229940088710 antibiotic agent Drugs 0.000 description 17
- 235000013305 food Nutrition 0.000 description 17
- 239000002773 nucleotide Substances 0.000 description 17
- 150000007523 nucleic acids Chemical group 0.000 description 16
- 235000013361 beverage Nutrition 0.000 description 15
- 210000001072 colon Anatomy 0.000 description 15
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 14
- 201000010099 disease Diseases 0.000 description 14
- 230000003115 biocidal effect Effects 0.000 description 13
- 150000004676 glycans Chemical class 0.000 description 13
- 239000002609 medium Substances 0.000 description 13
- 239000013612 plasmid Substances 0.000 description 13
- 229920001282 polysaccharide Polymers 0.000 description 13
- 239000005017 polysaccharide Substances 0.000 description 13
- 238000002360 preparation method Methods 0.000 description 13
- 210000001744 T-lymphocyte Anatomy 0.000 description 12
- 230000037396 body weight Effects 0.000 description 12
- 239000012141 concentrate Substances 0.000 description 12
- 230000000694 effects Effects 0.000 description 12
- 229910052500 inorganic mineral Inorganic materials 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 12
- 235000010755 mineral Nutrition 0.000 description 12
- 239000011707 mineral Substances 0.000 description 12
- 229920001542 oligosaccharide Polymers 0.000 description 12
- 150000002482 oligosaccharides Chemical class 0.000 description 12
- 239000008188 pellet Substances 0.000 description 12
- 238000005199 ultracentrifugation Methods 0.000 description 12
- 241000282414 Homo sapiens Species 0.000 description 11
- 239000003795 chemical substances by application Substances 0.000 description 11
- 238000009472 formulation Methods 0.000 description 11
- 239000012634 fragment Substances 0.000 description 11
- 208000027866 inflammatory disease Diseases 0.000 description 11
- 230000004054 inflammatory process Effects 0.000 description 11
- 208000023275 Autoimmune disease Diseases 0.000 description 10
- 206010020751 Hypersensitivity Diseases 0.000 description 10
- 206010061218 Inflammation Diseases 0.000 description 10
- 229960003957 dexamethasone Drugs 0.000 description 10
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 10
- 102000037865 fusion proteins Human genes 0.000 description 10
- 108020001507 fusion proteins Proteins 0.000 description 10
- 238000002347 injection Methods 0.000 description 10
- 239000007924 injection Substances 0.000 description 10
- 102000039446 nucleic acids Human genes 0.000 description 10
- 108020004707 nucleic acids Proteins 0.000 description 10
- 238000003786 synthesis reaction Methods 0.000 description 10
- 238000002560 therapeutic procedure Methods 0.000 description 10
- 239000003981 vehicle Substances 0.000 description 10
- 201000009030 Carcinoma Diseases 0.000 description 9
- 102100040247 Tumor necrosis factor Human genes 0.000 description 9
- 206010053613 Type IV hypersensitivity reaction Diseases 0.000 description 9
- 238000001914 filtration Methods 0.000 description 9
- 230000006870 function Effects 0.000 description 9
- 230000012010 growth Effects 0.000 description 9
- 238000009169 immunotherapy Methods 0.000 description 9
- 230000002401 inhibitory effect Effects 0.000 description 9
- 230000010076 replication Effects 0.000 description 9
- 230000005951 type IV hypersensitivity Effects 0.000 description 9
- 208000027930 type IV hypersensitivity disease Diseases 0.000 description 9
- 229940088594 vitamin Drugs 0.000 description 9
- 229930003231 vitamin Natural products 0.000 description 9
- 235000013343 vitamin Nutrition 0.000 description 9
- 239000011782 vitamin Substances 0.000 description 9
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 8
- 102000004889 Interleukin-6 Human genes 0.000 description 8
- 108090001005 Interleukin-6 Proteins 0.000 description 8
- 241001465754 Metazoa Species 0.000 description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 description 8
- 201000004681 Psoriasis Diseases 0.000 description 8
- 230000001093 anti-cancer Effects 0.000 description 8
- 230000001965 increasing effect Effects 0.000 description 8
- 201000006417 multiple sclerosis Diseases 0.000 description 8
- 239000000546 pharmaceutical excipient Substances 0.000 description 8
- 229920000642 polymer Polymers 0.000 description 8
- 235000013406 prebiotics Nutrition 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 239000002028 Biomass Substances 0.000 description 7
- 241001112696 Clostridia Species 0.000 description 7
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 7
- 102100030703 Interleukin-22 Human genes 0.000 description 7
- 102100034256 Mucin-1 Human genes 0.000 description 7
- 102000004357 Transferases Human genes 0.000 description 7
- 108090000992 Transferases Proteins 0.000 description 7
- 208000009956 adenocarcinoma Diseases 0.000 description 7
- 229940022399 cancer vaccine Drugs 0.000 description 7
- 238000009566 cancer vaccine Methods 0.000 description 7
- 230000008859 change Effects 0.000 description 7
- 239000007884 disintegrant Substances 0.000 description 7
- 210000001035 gastrointestinal tract Anatomy 0.000 description 7
- 208000015181 infectious disease Diseases 0.000 description 7
- 238000012544 monitoring process Methods 0.000 description 7
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Substances [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 7
- 108091033319 polynucleotide Proteins 0.000 description 7
- 102000040430 polynucleotide Human genes 0.000 description 7
- 239000002157 polynucleotide Substances 0.000 description 7
- 108090000765 processed proteins & peptides Proteins 0.000 description 7
- 206010039073 rheumatoid arthritis Diseases 0.000 description 7
- 229960004641 rituximab Drugs 0.000 description 7
- 239000000523 sample Substances 0.000 description 7
- 150000003722 vitamin derivatives Chemical class 0.000 description 7
- 229920001817 Agar Polymers 0.000 description 6
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 6
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 6
- 102100032368 Coiled-coil domain-containing protein 110 Human genes 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 6
- 108090000695 Cytokines Proteins 0.000 description 6
- 206010012438 Dermatitis atopic Diseases 0.000 description 6
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 6
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 6
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 6
- 102000000589 Interleukin-1 Human genes 0.000 description 6
- 108010002352 Interleukin-1 Proteins 0.000 description 6
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 6
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 6
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 6
- 229920002472 Starch Polymers 0.000 description 6
- 239000004098 Tetracycline Substances 0.000 description 6
- 239000007983 Tris buffer Substances 0.000 description 6
- 239000002671 adjuvant Substances 0.000 description 6
- 230000002411 adverse Effects 0.000 description 6
- 239000008272 agar Substances 0.000 description 6
- 208000026935 allergic disease Diseases 0.000 description 6
- 230000007815 allergy Effects 0.000 description 6
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 6
- 230000000844 anti-bacterial effect Effects 0.000 description 6
- 201000008937 atopic dermatitis Diseases 0.000 description 6
- 210000002421 cell wall Anatomy 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 206010009887 colitis Diseases 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 229960000485 methotrexate Drugs 0.000 description 6
- 238000010172 mouse model Methods 0.000 description 6
- 229960002450 ofatumumab Drugs 0.000 description 6
- 230000004260 plant-type cell wall biogenesis Effects 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 235000019698 starch Nutrition 0.000 description 6
- 235000019364 tetracycline Nutrition 0.000 description 6
- 150000003522 tetracyclines Chemical class 0.000 description 6
- 229960005267 tositumomab Drugs 0.000 description 6
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 6
- 108010077805 Bacterial Proteins Proteins 0.000 description 5
- 108091033409 CRISPR Proteins 0.000 description 5
- 238000010354 CRISPR gene editing Methods 0.000 description 5
- 229930186147 Cephalosporin Natural products 0.000 description 5
- 208000015943 Coeliac disease Diseases 0.000 description 5
- 208000011231 Crohn disease Diseases 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 206010014025 Ear swelling Diseases 0.000 description 5
- 241000192125 Firmicutes Species 0.000 description 5
- 241000233866 Fungi Species 0.000 description 5
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 5
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 5
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 5
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 5
- 102000051628 Interleukin-1 receptor antagonist Human genes 0.000 description 5
- 102000013264 Interleukin-23 Human genes 0.000 description 5
- 108010065637 Interleukin-23 Proteins 0.000 description 5
- 108091023242 Internal transcribed spacer Proteins 0.000 description 5
- 206010025323 Lymphomas Diseases 0.000 description 5
- 108010052285 Membrane Proteins Proteins 0.000 description 5
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 5
- MVTQIFVKRXBCHS-SMMNFGSLSA-N N-[(3S,6S,12R,15S,16R,19S,22S)-3-benzyl-12-ethyl-4,16-dimethyl-2,5,11,14,18,21,24-heptaoxo-19-phenyl-17-oxa-1,4,10,13,20-pentazatricyclo[20.4.0.06,10]hexacosan-15-yl]-3-hydroxypyridine-2-carboxamide (10R,11R,12E,17E,19E,21S)-21-hydroxy-11,19-dimethyl-10-propan-2-yl-9,26-dioxa-3,15,28-triazatricyclo[23.2.1.03,7]octacosa-1(27),6,12,17,19,25(28)-hexaene-2,8,14,23-tetrone Chemical compound CC(C)[C@H]1OC(=O)C2=CCCN2C(=O)c2coc(CC(=O)C[C@H](O)\C=C(/C)\C=C\CNC(=O)\C=C\[C@H]1C)n2.CC[C@H]1NC(=O)[C@@H](NC(=O)c2ncccc2O)[C@@H](C)OC(=O)[C@@H](NC(=O)[C@@H]2CC(=O)CCN2C(=O)[C@H](Cc2ccccc2)N(C)C(=O)[C@@H]2CCCN2C1=O)c1ccccc1 MVTQIFVKRXBCHS-SMMNFGSLSA-N 0.000 description 5
- 229930182555 Penicillin Natural products 0.000 description 5
- 102000035195 Peptidases Human genes 0.000 description 5
- 108091005804 Peptidases Proteins 0.000 description 5
- 108010013639 Peptidoglycan Proteins 0.000 description 5
- 241000194017 Streptococcus Species 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 239000012830 cancer therapeutic Substances 0.000 description 5
- 229940124587 cephalosporin Drugs 0.000 description 5
- 150000001780 cephalosporins Chemical class 0.000 description 5
- 230000002354 daily effect Effects 0.000 description 5
- 229940124307 fluoroquinolone Drugs 0.000 description 5
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 230000036541 health Effects 0.000 description 5
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 5
- 239000003018 immunosuppressive agent Substances 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- 210000001165 lymph node Anatomy 0.000 description 5
- 239000003120 macrolide antibiotic agent Substances 0.000 description 5
- 229940041033 macrolides Drugs 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 239000002207 metabolite Substances 0.000 description 5
- 150000002772 monosaccharides Chemical class 0.000 description 5
- 239000013642 negative control Substances 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 239000013641 positive control Substances 0.000 description 5
- 239000000843 powder Substances 0.000 description 5
- 102000004196 processed proteins & peptides Human genes 0.000 description 5
- 238000001243 protein synthesis Methods 0.000 description 5
- 150000003839 salts Chemical class 0.000 description 5
- 229940040944 tetracyclines Drugs 0.000 description 5
- 230000001988 toxicity Effects 0.000 description 5
- 231100000419 toxicity Toxicity 0.000 description 5
- 230000014616 translation Effects 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- OQANPHBRHBJGNZ-FYJGNVAPSA-N (3e)-6-oxo-3-[[4-(pyridin-2-ylsulfamoyl)phenyl]hydrazinylidene]cyclohexa-1,4-diene-1-carboxylic acid Chemical compound C1=CC(=O)C(C(=O)O)=C\C1=N\NC1=CC=C(S(=O)(=O)NC=2N=CC=CC=2)C=C1 OQANPHBRHBJGNZ-FYJGNVAPSA-N 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- RTQWWZBSTRGEAV-PKHIMPSTSA-N 2-[[(2s)-2-[bis(carboxymethyl)amino]-3-[4-(methylcarbamoylamino)phenyl]propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound CNC(=O)NC1=CC=C(C[C@@H](CN(CC(C)N(CC(O)=O)CC(O)=O)CC(O)=O)N(CC(O)=O)CC(O)=O)C=C1 RTQWWZBSTRGEAV-PKHIMPSTSA-N 0.000 description 4
- 102100026802 72 kDa type IV collagenase Human genes 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 102100036850 C-C motif chemokine 23 Human genes 0.000 description 4
- 102100039510 Cancer/testis antigen 2 Human genes 0.000 description 4
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 4
- 108010078791 Carrier Proteins Proteins 0.000 description 4
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 4
- 206010009900 Colitis ulcerative Diseases 0.000 description 4
- 102100030074 Dickkopf-related protein 1 Human genes 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 4
- 108010015899 Glycopeptides Proteins 0.000 description 4
- 102000002068 Glycopeptides Human genes 0.000 description 4
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 4
- 101000713081 Homo sapiens C-C motif chemokine 23 Proteins 0.000 description 4
- 101000889345 Homo sapiens Cancer/testis antigen 2 Proteins 0.000 description 4
- 101000868824 Homo sapiens Coiled-coil domain-containing protein 110 Proteins 0.000 description 4
- 101000620554 Homo sapiens Ras-related protein Rab-38 Proteins 0.000 description 4
- 108700021006 Interleukin-1 receptor antagonist Proteins 0.000 description 4
- 102000003814 Interleukin-10 Human genes 0.000 description 4
- 108090000174 Interleukin-10 Proteins 0.000 description 4
- 102000003816 Interleukin-13 Human genes 0.000 description 4
- 108090000176 Interleukin-13 Proteins 0.000 description 4
- 102000013691 Interleukin-17 Human genes 0.000 description 4
- 108050003558 Interleukin-17 Proteins 0.000 description 4
- 102000003810 Interleukin-18 Human genes 0.000 description 4
- 108090000171 Interleukin-18 Proteins 0.000 description 4
- 102000000588 Interleukin-2 Human genes 0.000 description 4
- 108010002350 Interleukin-2 Proteins 0.000 description 4
- 102000017761 Interleukin-33 Human genes 0.000 description 4
- 108010067003 Interleukin-33 Proteins 0.000 description 4
- 102100021533 Kita-kyushu lung cancer antigen 1 Human genes 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 108010028921 Lipopeptides Proteins 0.000 description 4
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 4
- 102000018697 Membrane Proteins Human genes 0.000 description 4
- 102000015728 Mucins Human genes 0.000 description 4
- 108010063954 Mucins Proteins 0.000 description 4
- 108060008487 Myosin Proteins 0.000 description 4
- 102000003505 Myosin Human genes 0.000 description 4
- SHGAZHPCJJPHSC-UHFFFAOYSA-N Panrexin Chemical compound OC(=O)C=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-UHFFFAOYSA-N 0.000 description 4
- 206010035664 Pneumonia Diseases 0.000 description 4
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 4
- 102100038358 Prostate-specific antigen Human genes 0.000 description 4
- 102100022305 Ras-related protein Rab-38 Human genes 0.000 description 4
- 241000831652 Salinivibrio sharmensis Species 0.000 description 4
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 4
- NAVMQTYZDKMPEU-UHFFFAOYSA-N Targretin Chemical compound CC1=CC(C(CCC2(C)C)(C)C)=C2C=C1C(=C)C1=CC=C(C(O)=O)C=C1 NAVMQTYZDKMPEU-UHFFFAOYSA-N 0.000 description 4
- 206010052779 Transplant rejections Diseases 0.000 description 4
- 102000003425 Tyrosinase Human genes 0.000 description 4
- 108060008724 Tyrosinase Proteins 0.000 description 4
- 201000006704 Ulcerative Colitis Diseases 0.000 description 4
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 4
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 4
- 230000001154 acute effect Effects 0.000 description 4
- 229940126575 aminoglycoside Drugs 0.000 description 4
- 208000006673 asthma Diseases 0.000 description 4
- 230000003385 bacteriostatic effect Effects 0.000 description 4
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 4
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 4
- 229960000455 brentuximab vedotin Drugs 0.000 description 4
- 238000002619 cancer immunotherapy Methods 0.000 description 4
- 229940041011 carbapenems Drugs 0.000 description 4
- 235000008504 concentrate Nutrition 0.000 description 4
- DDRJAANPRJIHGJ-UHFFFAOYSA-N creatinine Chemical compound CN1CC(=O)NC1=N DDRJAANPRJIHGJ-UHFFFAOYSA-N 0.000 description 4
- 108010017271 denileukin diftitox Proteins 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 230000004069 differentiation Effects 0.000 description 4
- 150000002016 disaccharides Chemical class 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 238000002296 dynamic light scattering Methods 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- 150000004665 fatty acids Chemical class 0.000 description 4
- 238000000855 fermentation Methods 0.000 description 4
- 230000004151 fermentation Effects 0.000 description 4
- 230000014509 gene expression Effects 0.000 description 4
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 4
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 4
- 229960001001 ibritumomab tiuxetan Drugs 0.000 description 4
- 210000002865 immune cell Anatomy 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- CGIGDMFJXJATDK-UHFFFAOYSA-N indomethacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CGIGDMFJXJATDK-UHFFFAOYSA-N 0.000 description 4
- 230000036512 infertility Effects 0.000 description 4
- 230000002757 inflammatory effect Effects 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 108010074108 interleukin-21 Proteins 0.000 description 4
- 108010074109 interleukin-22 Proteins 0.000 description 4
- 238000007918 intramuscular administration Methods 0.000 description 4
- 229940041028 lincosamides Drugs 0.000 description 4
- 230000007774 longterm Effects 0.000 description 4
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 208000008275 microscopic colitis Diseases 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 229940041009 monobactams Drugs 0.000 description 4
- 235000015097 nutrients Nutrition 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 239000006072 paste Substances 0.000 description 4
- 150000002960 penicillins Chemical class 0.000 description 4
- 239000003910 polypeptide antibiotic agent Chemical class 0.000 description 4
- OGSBUKJUDHAQEA-WMCAAGNKSA-N pralatrexate Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CC(CC#C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OGSBUKJUDHAQEA-WMCAAGNKSA-N 0.000 description 4
- 239000003755 preservative agent Substances 0.000 description 4
- LXNHXLLTXMVWPM-UHFFFAOYSA-N pyridoxine Chemical compound CC1=NC=C(CO)C(CO)=C1O LXNHXLLTXMVWPM-UHFFFAOYSA-N 0.000 description 4
- 150000007660 quinolones Chemical class 0.000 description 4
- 108020004418 ribosomal RNA Proteins 0.000 description 4
- 210000004708 ribosome subunit Anatomy 0.000 description 4
- 108010091666 romidepsin Proteins 0.000 description 4
- OHRURASPPZQGQM-GCCNXGTGSA-N romidepsin Chemical compound O1C(=O)[C@H](C(C)C)NC(=O)C(=C/C)/NC(=O)[C@H]2CSSCC\C=C\[C@@H]1CC(=O)N[C@H](C(C)C)C(=O)N2 OHRURASPPZQGQM-GCCNXGTGSA-N 0.000 description 4
- OHRURASPPZQGQM-UHFFFAOYSA-N romidepsin Natural products O1C(=O)C(C(C)C)NC(=O)C(=CC)NC(=O)C2CSSCCC=CC1CC(=O)NC(C(C)C)C(=O)N2 OHRURASPPZQGQM-UHFFFAOYSA-N 0.000 description 4
- 201000000306 sarcoidosis Diseases 0.000 description 4
- 229940032147 starch Drugs 0.000 description 4
- 239000008107 starch Substances 0.000 description 4
- 235000000346 sugar Nutrition 0.000 description 4
- 229940124530 sulfonamide Drugs 0.000 description 4
- 150000003456 sulfonamides Chemical class 0.000 description 4
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 4
- WAEXFXRVDQXREF-UHFFFAOYSA-N vorinostat Chemical compound ONC(=O)CCCCCCC(=O)NC1=CC=CC=C1 WAEXFXRVDQXREF-UHFFFAOYSA-N 0.000 description 4
- FFTVPQUHLQBXQZ-KVUCHLLUSA-N (4s,4as,5ar,12ar)-4,7-bis(dimethylamino)-1,10,11,12a-tetrahydroxy-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1C2=C(N(C)C)C=CC(O)=C2C(O)=C2[C@@H]1C[C@H]1[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]1(O)C2=O FFTVPQUHLQBXQZ-KVUCHLLUSA-N 0.000 description 3
- 101710151806 72 kDa type IV collagenase Proteins 0.000 description 3
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 3
- 201000004384 Alopecia Diseases 0.000 description 3
- 206010003571 Astrocytoma Diseases 0.000 description 3
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 3
- 241000282472 Canis lupus familiaris Species 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 3
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 3
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 3
- 229930105110 Cyclosporin A Natural products 0.000 description 3
- 108010036949 Cyclosporine Proteins 0.000 description 3
- 108010053770 Deoxyribonucleases Proteins 0.000 description 3
- 102000016911 Deoxyribonucleases Human genes 0.000 description 3
- 201000004624 Dermatitis Diseases 0.000 description 3
- 206010012442 Dermatitis contact Diseases 0.000 description 3
- 206010013975 Dyspnoeas Diseases 0.000 description 3
- 108091054442 EV proteins Proteins 0.000 description 3
- 108010067770 Endopeptidase K Proteins 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 108010008165 Etanercept Proteins 0.000 description 3
- HKVAMNSJSFKALM-GKUWKFKPSA-N Everolimus Chemical compound C1C[C@@H](OCCO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 HKVAMNSJSFKALM-GKUWKFKPSA-N 0.000 description 3
- 241000282326 Felis catus Species 0.000 description 3
- 208000001640 Fibromyalgia Diseases 0.000 description 3
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 3
- 235000010469 Glycine max Nutrition 0.000 description 3
- 102100021866 Hepatocyte growth factor Human genes 0.000 description 3
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 3
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 3
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 3
- 101000904724 Homo sapiens Transmembrane glycoprotein NMB Proteins 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 3
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 3
- 102000013462 Interleukin-12 Human genes 0.000 description 3
- 108010065805 Interleukin-12 Proteins 0.000 description 3
- 102100039897 Interleukin-5 Human genes 0.000 description 3
- 108010002616 Interleukin-5 Proteins 0.000 description 3
- 102000004890 Interleukin-8 Human genes 0.000 description 3
- 108090001007 Interleukin-8 Proteins 0.000 description 3
- UETNIIAIRMUTSM-UHFFFAOYSA-N Jacareubin Natural products CC1(C)OC2=CC3Oc4c(O)c(O)ccc4C(=O)C3C(=C2C=C1)O UETNIIAIRMUTSM-UHFFFAOYSA-N 0.000 description 3
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 3
- 229920000881 Modified starch Polymers 0.000 description 3
- 102100023123 Mucin-16 Human genes 0.000 description 3
- 208000000112 Myalgia Diseases 0.000 description 3
- 241001494479 Pecora Species 0.000 description 3
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 3
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 3
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 3
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 3
- 206010039710 Scleroderma Diseases 0.000 description 3
- 206010040047 Sepsis Diseases 0.000 description 3
- 102100021669 Stromal cell-derived factor 1 Human genes 0.000 description 3
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 3
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 3
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 3
- 102100036922 Tumor necrosis factor ligand superfamily member 13B Human genes 0.000 description 3
- 102100031988 Tumor necrosis factor ligand superfamily member 6 Human genes 0.000 description 3
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 3
- 108010059993 Vancomycin Proteins 0.000 description 3
- 206010047115 Vasculitis Diseases 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 239000000443 aerosol Substances 0.000 description 3
- MBMBGCFOFBJSGT-KUBAVDMBSA-N all-cis-docosa-4,7,10,13,16,19-hexaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCC(O)=O MBMBGCFOFBJSGT-KUBAVDMBSA-N 0.000 description 3
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 3
- 201000010105 allergic rhinitis Diseases 0.000 description 3
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 3
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 3
- 208000007502 anemia Diseases 0.000 description 3
- 230000003110 anti-inflammatory effect Effects 0.000 description 3
- 210000000612 antigen-presenting cell Anatomy 0.000 description 3
- 206010003246 arthritis Diseases 0.000 description 3
- 230000001363 autoimmune Effects 0.000 description 3
- 239000011230 binding agent Substances 0.000 description 3
- 239000006172 buffering agent Substances 0.000 description 3
- 108010018828 cadherin 5 Proteins 0.000 description 3
- 229930195731 calicheamicin Natural products 0.000 description 3
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 235000010980 cellulose Nutrition 0.000 description 3
- 229920002678 cellulose Polymers 0.000 description 3
- 239000001913 cellulose Substances 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 229960003115 certolizumab pegol Drugs 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 229960004630 chlorambucil Drugs 0.000 description 3
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 3
- 229960001265 ciclosporin Drugs 0.000 description 3
- 208000008609 collagenous colitis Diseases 0.000 description 3
- 208000010247 contact dermatitis Diseases 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 206010012601 diabetes mellitus Diseases 0.000 description 3
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical compound CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 3
- 238000001035 drying Methods 0.000 description 3
- 201000006549 dyspepsia Diseases 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 235000019152 folic acid Nutrition 0.000 description 3
- 239000011724 folic acid Substances 0.000 description 3
- 238000007710 freezing Methods 0.000 description 3
- 230000008014 freezing Effects 0.000 description 3
- IECPWNUMDGFDKC-MZJAQBGESA-N fusidic acid Chemical compound O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C(O)=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-N 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 229960001743 golimumab Drugs 0.000 description 3
- 210000002216 heart Anatomy 0.000 description 3
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 3
- 229940125721 immunosuppressive agent Drugs 0.000 description 3
- 208000027138 indeterminate colitis Diseases 0.000 description 3
- 230000000968 intestinal effect Effects 0.000 description 3
- 229960005386 ipilimumab Drugs 0.000 description 3
- 235000015110 jellies Nutrition 0.000 description 3
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 210000004185 liver Anatomy 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 201000001441 melanoma Diseases 0.000 description 3
- 229960001428 mercaptopurine Drugs 0.000 description 3
- 208000030159 metabolic disease Diseases 0.000 description 3
- 239000003094 microcapsule Substances 0.000 description 3
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 3
- 239000008108 microcrystalline cellulose Substances 0.000 description 3
- 229940016286 microcrystalline cellulose Drugs 0.000 description 3
- 229960004023 minocycline Drugs 0.000 description 3
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 3
- 208000033808 peripheral neuropathy Diseases 0.000 description 3
- 229910052697 platinum Inorganic materials 0.000 description 3
- 238000004321 preservation Methods 0.000 description 3
- 230000002335 preservative effect Effects 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 235000019419 proteases Nutrition 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 210000003491 skin Anatomy 0.000 description 3
- 235000014347 soups Nutrition 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 210000002784 stomach Anatomy 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 229960001940 sulfasalazine Drugs 0.000 description 3
- NCEXYHBECQHGNR-UHFFFAOYSA-N sulfasalazine Natural products C1=C(O)C(C(=O)O)=CC(N=NC=2C=CC(=CC=2)S(=O)(=O)NC=2N=CC=CC=2)=C1 NCEXYHBECQHGNR-UHFFFAOYSA-N 0.000 description 3
- 229960004659 ticarcillin Drugs 0.000 description 3
- OHKOGUYZJXTSFX-KZFFXBSXSA-N ticarcillin Chemical compound C=1([C@@H](C(O)=O)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)C=CSC=1 OHKOGUYZJXTSFX-KZFFXBSXSA-N 0.000 description 3
- IUCJMVBFZDHPDX-UHFFFAOYSA-N tretamine Chemical compound C1CN1C1=NC(N2CC2)=NC(N2CC2)=N1 IUCJMVBFZDHPDX-UHFFFAOYSA-N 0.000 description 3
- 229960001727 tretinoin Drugs 0.000 description 3
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 3
- 229960005486 vaccine Drugs 0.000 description 3
- 229960003165 vancomycin Drugs 0.000 description 3
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 3
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- GJJFMKBJSRMPLA-HIFRSBDPSA-N (1R,2S)-2-(aminomethyl)-N,N-diethyl-1-phenyl-1-cyclopropanecarboxamide Chemical compound C=1C=CC=CC=1[C@@]1(C(=O)N(CC)CC)C[C@@H]1CN GJJFMKBJSRMPLA-HIFRSBDPSA-N 0.000 description 2
- LITBAYYWXZOHAW-XDZRHBBOSA-N (2s,5r,6r)-6-[[(2r)-2-[(4-ethyl-2,3-dioxopiperazine-1-carbonyl)amino]-2-phenylacetyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid;(2s,3s,5r)-3-methyl-4,4,7-trioxo-3-(triazol-1-ylmethyl)-4$l^{6}-thia-1-azabicyclo[3.2.0]hept Chemical compound C([C@]1(C)S([C@H]2N(C(C2)=O)[C@H]1C(O)=O)(=O)=O)N1C=CN=N1.O=C1C(=O)N(CC)CCN1C(=O)N[C@H](C=1C=CC=CC=1)C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 LITBAYYWXZOHAW-XDZRHBBOSA-N 0.000 description 2
- SSOORFWOBGFTHL-OTEJMHTDSA-N (4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-[[(2S)-5-carbamimidamido-1-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-1-oxopentan-2-yl]amino]-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SSOORFWOBGFTHL-OTEJMHTDSA-N 0.000 description 2
- SGKRLCUYIXIAHR-AKNGSSGZSA-N (4s,4ar,5s,5ar,6r,12ar)-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1=CC=C2[C@H](C)[C@@H]([C@H](O)[C@@H]3[C@](C(O)=C(C(N)=O)C(=O)[C@H]3N(C)C)(O)C3=O)C3=C(O)C2=C1O SGKRLCUYIXIAHR-AKNGSSGZSA-N 0.000 description 2
- HMLGSIZOMSVISS-ONJSNURVSA-N (7r)-7-[[(2z)-2-(2-amino-1,3-thiazol-4-yl)-2-(2,2-dimethylpropanoyloxymethoxyimino)acetyl]amino]-3-ethenyl-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid Chemical compound N([C@@H]1C(N2C(=C(C=C)CSC21)C(O)=O)=O)C(=O)\C(=N/OCOC(=O)C(C)(C)C)C1=CSC(N)=N1 HMLGSIZOMSVISS-ONJSNURVSA-N 0.000 description 2
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 2
- GVJHHUAWPYXKBD-UHFFFAOYSA-N (±)-α-Tocopherol Chemical compound OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 2
- 102100039583 116 kDa U5 small nuclear ribonucleoprotein component Human genes 0.000 description 2
- 108020004465 16S ribosomal RNA Proteins 0.000 description 2
- ACTOXUHEUCPTEW-BWHGAVFKSA-N 2-[(4r,5s,6s,7r,9r,10r,11e,13e,16r)-6-[(2s,3r,4r,5s,6r)-5-[(2s,4r,5s,6s)-4,5-dihydroxy-4,6-dimethyloxan-2-yl]oxy-4-(dimethylamino)-3-hydroxy-6-methyloxan-2-yl]oxy-10-[(2s,5s,6r)-5-(dimethylamino)-6-methyloxan-2-yl]oxy-4-hydroxy-5-methoxy-9,16-dimethyl-2-o Chemical compound O([C@H]1/C=C/C=C/C[C@@H](C)OC(=O)C[C@@H](O)[C@@H]([C@H]([C@@H](CC=O)C[C@H]1C)O[C@H]1[C@@H]([C@H]([C@H](O[C@@H]2O[C@@H](C)[C@H](O)[C@](C)(O)C2)[C@@H](C)O1)N(C)C)O)OC)[C@@H]1CC[C@H](N(C)C)[C@@H](C)O1 ACTOXUHEUCPTEW-BWHGAVFKSA-N 0.000 description 2
- FUBFWTUFPGFHOJ-UHFFFAOYSA-N 2-nitrofuran Chemical class [O-][N+](=O)C1=CC=CO1 FUBFWTUFPGFHOJ-UHFFFAOYSA-N 0.000 description 2
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 2
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 2
- INZOTETZQBPBCE-NYLDSJSYSA-N 3-sialyl lewis Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@H]1O[C@H]([C@H](O)CO)[C@@H]([C@@H](NC(C)=O)C=O)O[C@H]1[C@H](O)[C@@H](O[C@]2(O[C@H]([C@H](NC(C)=O)[C@@H](O)C2)[C@H](O)[C@H](O)CO)C(O)=O)[C@@H](O)[C@@H](CO)O1 INZOTETZQBPBCE-NYLDSJSYSA-N 0.000 description 2
- WZRJTRPJURQBRM-UHFFFAOYSA-N 4-amino-n-(5-methyl-1,2-oxazol-3-yl)benzenesulfonamide;5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine Chemical compound O1C(C)=CC(NS(=O)(=O)C=2C=CC(N)=CC=2)=N1.COC1=C(OC)C(OC)=CC(CC=2C(=NC(N)=NC=2)N)=C1 WZRJTRPJURQBRM-UHFFFAOYSA-N 0.000 description 2
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 2
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- SHGAZHPCJJPHSC-ZVCIMWCZSA-N 9-cis-retinoic acid Chemical compound OC(=O)/C=C(\C)/C=C/C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-ZVCIMWCZSA-N 0.000 description 2
- 102100021222 ATP-dependent Clp protease proteolytic subunit, mitochondrial Human genes 0.000 description 2
- 102100036475 Alanine aminotransferase 1 Human genes 0.000 description 2
- 108010082126 Alanine transaminase Proteins 0.000 description 2
- 102100040069 Aldehyde dehydrogenase 1A1 Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 208000035285 Allergic Seasonal Rhinitis Diseases 0.000 description 2
- 102100032959 Alpha-actinin-4 Human genes 0.000 description 2
- 101710115256 Alpha-actinin-4 Proteins 0.000 description 2
- 229920000856 Amylose Polymers 0.000 description 2
- 102100022987 Angiogenin Human genes 0.000 description 2
- 102100025674 Angiopoietin-related protein 4 Human genes 0.000 description 2
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 2
- 102100023003 Ankyrin repeat domain-containing protein 30A Human genes 0.000 description 2
- 244000303258 Annona diversifolia Species 0.000 description 2
- 235000002198 Annona diversifolia Nutrition 0.000 description 2
- 102100024003 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 Human genes 0.000 description 2
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 2
- 208000006820 Arthralgia Diseases 0.000 description 2
- 102000030431 Asparaginyl endopeptidase Human genes 0.000 description 2
- 108010003415 Aspartate Aminotransferases Proteins 0.000 description 2
- 102000004625 Aspartate Aminotransferases Human genes 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 206010064539 Autoimmune myocarditis Diseases 0.000 description 2
- 108010028006 B-Cell Activating Factor Proteins 0.000 description 2
- 108010001478 Bacitracin Proteins 0.000 description 2
- 108020000946 Bacterial DNA Proteins 0.000 description 2
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 2
- 102100028239 Basal cell adhesion molecule Human genes 0.000 description 2
- 102100026596 Bcl-2-like protein 1 Human genes 0.000 description 2
- 208000009137 Behcet syndrome Diseases 0.000 description 2
- 102100027314 Beta-2-microglobulin Human genes 0.000 description 2
- 102000015735 Beta-catenin Human genes 0.000 description 2
- 108060000903 Beta-catenin Proteins 0.000 description 2
- 102100023995 Beta-nerve growth factor Human genes 0.000 description 2
- 101800001382 Betacellulin Proteins 0.000 description 2
- BPYKTIZUTYGOLE-IFADSCNNSA-N Bilirubin Chemical compound N1C(=O)C(C)=C(C=C)\C1=C\C1=C(C)C(CCC(O)=O)=C(CC2=C(C(C)=C(\C=C/3C(=C(C=C)C(=O)N\3)C)N2)CCC(O)=O)N1 BPYKTIZUTYGOLE-IFADSCNNSA-N 0.000 description 2
- 108010049931 Bone Morphogenetic Protein 2 Proteins 0.000 description 2
- 108010049955 Bone Morphogenetic Protein 4 Proteins 0.000 description 2
- 108010049976 Bone Morphogenetic Protein 5 Proteins 0.000 description 2
- 108010049870 Bone Morphogenetic Protein 7 Proteins 0.000 description 2
- 102100024506 Bone morphogenetic protein 2 Human genes 0.000 description 2
- 102100024505 Bone morphogenetic protein 4 Human genes 0.000 description 2
- 102100022526 Bone morphogenetic protein 5 Human genes 0.000 description 2
- 102100022544 Bone morphogenetic protein 7 Human genes 0.000 description 2
- 208000014644 Brain disease Diseases 0.000 description 2
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 2
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 2
- 102100023702 C-C motif chemokine 13 Human genes 0.000 description 2
- 101710112613 C-C motif chemokine 13 Proteins 0.000 description 2
- 102100023705 C-C motif chemokine 14 Human genes 0.000 description 2
- 102100023700 C-C motif chemokine 16 Human genes 0.000 description 2
- 102100023698 C-C motif chemokine 17 Human genes 0.000 description 2
- 102100036845 C-C motif chemokine 22 Human genes 0.000 description 2
- 102100036849 C-C motif chemokine 24 Human genes 0.000 description 2
- 102100021933 C-C motif chemokine 25 Human genes 0.000 description 2
- 102100021935 C-C motif chemokine 26 Human genes 0.000 description 2
- 102100021936 C-C motif chemokine 27 Human genes 0.000 description 2
- 102100021942 C-C motif chemokine 28 Human genes 0.000 description 2
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 2
- 102100032366 C-C motif chemokine 7 Human genes 0.000 description 2
- 102100034871 C-C motif chemokine 8 Human genes 0.000 description 2
- 102100025248 C-X-C motif chemokine 10 Human genes 0.000 description 2
- 101710098275 C-X-C motif chemokine 10 Proteins 0.000 description 2
- 102100025277 C-X-C motif chemokine 13 Human genes 0.000 description 2
- 102100025250 C-X-C motif chemokine 14 Human genes 0.000 description 2
- 102100039396 C-X-C motif chemokine 16 Human genes 0.000 description 2
- 102100036150 C-X-C motif chemokine 5 Human genes 0.000 description 2
- 102100036153 C-X-C motif chemokine 6 Human genes 0.000 description 2
- 102100036170 C-X-C motif chemokine 9 Human genes 0.000 description 2
- 108700012439 CA9 Proteins 0.000 description 2
- 108700013048 CCL2 Proteins 0.000 description 2
- 102100031170 CCN family member 3 Human genes 0.000 description 2
- 102100031173 CCN family member 4 Human genes 0.000 description 2
- 101710137353 CCN family member 4 Proteins 0.000 description 2
- 102100024210 CD166 antigen Human genes 0.000 description 2
- 101150108242 CDC27 gene Proteins 0.000 description 2
- 101150034344 CT83 gene Proteins 0.000 description 2
- 229940045513 CTLA4 antagonist Drugs 0.000 description 2
- 102100029761 Cadherin-5 Human genes 0.000 description 2
- 102100025588 Calcitonin gene-related peptide 1 Human genes 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 241000282836 Camelus dromedarius Species 0.000 description 2
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 2
- 108010051152 Carboxylesterase Proteins 0.000 description 2
- 102000013392 Carboxylesterase Human genes 0.000 description 2
- 201000000274 Carcinosarcoma Diseases 0.000 description 2
- 102100034357 Casein kinase I isoform alpha Human genes 0.000 description 2
- 102100038916 Caspase-5 Human genes 0.000 description 2
- 102100026548 Caspase-8 Human genes 0.000 description 2
- 108090000538 Caspase-8 Proteins 0.000 description 2
- 241000700199 Cavia porcellus Species 0.000 description 2
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 102000016950 Chemokine CXCL1 Human genes 0.000 description 2
- 108010014419 Chemokine CXCL1 Proteins 0.000 description 2
- 102000019034 Chemokines Human genes 0.000 description 2
- 108010012236 Chemokines Proteins 0.000 description 2
- 229920001661 Chitosan Polymers 0.000 description 2
- 108010049048 Cholera Toxin Proteins 0.000 description 2
- 102000009016 Cholera Toxin Human genes 0.000 description 2
- 208000005243 Chondrosarcoma Diseases 0.000 description 2
- 102100039361 Chondrosarcoma-associated gene 2/3 protein Human genes 0.000 description 2
- HZZVJAQRINQKSD-UHFFFAOYSA-N Clavulanic acid Natural products OC(=O)C1C(=CCO)OC2CC(=O)N21 HZZVJAQRINQKSD-UHFFFAOYSA-N 0.000 description 2
- 102000011591 Cleavage And Polyadenylation Specificity Factor Human genes 0.000 description 2
- 108010076130 Cleavage And Polyadenylation Specificity Factor Proteins 0.000 description 2
- 241000193163 Clostridioides difficile Species 0.000 description 2
- 108010078777 Colistin Proteins 0.000 description 2
- 206010009895 Colitis ischaemic Diseases 0.000 description 2
- 102100027995 Collagenase 3 Human genes 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- 206010010741 Conjunctivitis Diseases 0.000 description 2
- 102100024342 Contactin-2 Human genes 0.000 description 2
- 229920002261 Corn starch Polymers 0.000 description 2
- 108010060267 Cyclin A1 Proteins 0.000 description 2
- 102000006311 Cyclin D1 Human genes 0.000 description 2
- 108010058546 Cyclin D1 Proteins 0.000 description 2
- 102100025176 Cyclin-A1 Human genes 0.000 description 2
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 2
- 108010009392 Cyclin-Dependent Kinase Inhibitor p16 Proteins 0.000 description 2
- 102100038111 Cyclin-dependent kinase 12 Human genes 0.000 description 2
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 2
- 102100024458 Cyclin-dependent kinase inhibitor 2A Human genes 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- 206010011793 Cystitis haemorrhagic Diseases 0.000 description 2
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 108010092160 Dactinomycin Proteins 0.000 description 2
- 108010013198 Daptomycin Proteins 0.000 description 2
- ZBNZXTGUTAYRHI-UHFFFAOYSA-N Dasatinib Chemical compound C=1C(N2CCN(CCO)CC2)=NC(C)=NC=1NC(S1)=NC=C1C(=O)NC1=C(C)C=CC=C1Cl ZBNZXTGUTAYRHI-UHFFFAOYSA-N 0.000 description 2
- 102100035784 Decorin Human genes 0.000 description 2
- 102100036462 Delta-like protein 1 Human genes 0.000 description 2
- 101710099518 Dickkopf-related protein 1 Proteins 0.000 description 2
- 102100037985 Dickkopf-related protein 3 Human genes 0.000 description 2
- 101710099550 Dickkopf-related protein 3 Proteins 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 102100024361 Disintegrin and metalloproteinase domain-containing protein 9 Human genes 0.000 description 2
- 101710116121 Disintegrin and metalloproteinase domain-containing protein 9 Proteins 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 208000003556 Dry Eye Syndromes Diseases 0.000 description 2
- 206010013774 Dry eye Diseases 0.000 description 2
- 206010058314 Dysplasia Diseases 0.000 description 2
- 208000000059 Dyspnea Diseases 0.000 description 2
- 108010024212 E-Selectin Proteins 0.000 description 2
- 102100023471 E-selectin Human genes 0.000 description 2
- 108050002772 E3 ubiquitin-protein ligase Mdm2 Proteins 0.000 description 2
- 102000012199 E3 ubiquitin-protein ligase Mdm2 Human genes 0.000 description 2
- 102100026245 E3 ubiquitin-protein ligase RNF43 Human genes 0.000 description 2
- 102100037238 E3 ubiquitin-protein ligase UBR4 Human genes 0.000 description 2
- 102100031334 Elongation factor 2 Human genes 0.000 description 2
- 208000032274 Encephalopathy Diseases 0.000 description 2
- 108010044063 Endocrine-Gland-Derived Vascular Endothelial Growth Factor Proteins 0.000 description 2
- 208000004232 Enteritis Diseases 0.000 description 2
- 102100023688 Eotaxin Human genes 0.000 description 2
- 108010055191 EphA3 Receptor Proteins 0.000 description 2
- 102100030324 Ephrin type-A receptor 3 Human genes 0.000 description 2
- 241000283074 Equus asinus Species 0.000 description 2
- 101000582396 Escherichia phage D108 Repressor c protein Proteins 0.000 description 2
- 101000582397 Escherichia phage Mu Repressor protein c Proteins 0.000 description 2
- 239000001856 Ethyl cellulose Substances 0.000 description 2
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 2
- 201000006107 Familial adenomatous polyposis Diseases 0.000 description 2
- 108010039471 Fas Ligand Protein Proteins 0.000 description 2
- 102100026748 Fatty acid-binding protein, intestinal Human genes 0.000 description 2
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 2
- 102100031706 Fibroblast growth factor 1 Human genes 0.000 description 2
- 102100031734 Fibroblast growth factor 19 Human genes 0.000 description 2
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 2
- 102100028072 Fibroblast growth factor 4 Human genes 0.000 description 2
- 108090000381 Fibroblast growth factor 4 Proteins 0.000 description 2
- 102100028073 Fibroblast growth factor 5 Human genes 0.000 description 2
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 2
- 201000008808 Fibrosarcoma Diseases 0.000 description 2
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 2
- 208000004262 Food Hypersensitivity Diseases 0.000 description 2
- VWUXBMIQPBEWFH-WCCTWKNTSA-N Fulvestrant Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3[C@H](CCCCCCCCCS(=O)CCCC(F)(F)C(F)(F)F)CC2=C1 VWUXBMIQPBEWFH-WCCTWKNTSA-N 0.000 description 2
- IECPWNUMDGFDKC-UHFFFAOYSA-N Fusicsaeure Natural products C12C(O)CC3C(=C(CCC=C(C)C)C(O)=O)C(OC(C)=O)CC3(C)C1(C)CCC1C2(C)CCC(O)C1C IECPWNUMDGFDKC-UHFFFAOYSA-N 0.000 description 2
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 2
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 2
- 102100024405 GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1 Human genes 0.000 description 2
- 101710144640 GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1 Proteins 0.000 description 2
- 101710113436 GTPase KRas Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- JRZJKWGQFNTSRN-UHFFFAOYSA-N Geldanamycin Natural products C1C(C)CC(OC)C(O)C(C)C=C(C)C(OC(N)=O)C(OC)CCC=C(C)C(=O)NC2=CC(=O)C(OC)=C1C2=O JRZJKWGQFNTSRN-UHFFFAOYSA-N 0.000 description 2
- 208000007465 Giant cell arteritis Diseases 0.000 description 2
- 102000034615 Glial cell line-derived neurotrophic factor Human genes 0.000 description 2
- 108091010837 Glial cell line-derived neurotrophic factor Proteins 0.000 description 2
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 2
- 244000068988 Glycine max Species 0.000 description 2
- 102000010956 Glypican Human genes 0.000 description 2
- 108050001154 Glypican Proteins 0.000 description 2
- 108050007237 Glypican-3 Proteins 0.000 description 2
- 208000024869 Goodpasture syndrome Diseases 0.000 description 2
- 241000282575 Gorilla Species 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 206010018691 Granuloma Diseases 0.000 description 2
- 208000003807 Graves Disease Diseases 0.000 description 2
- 208000015023 Graves' disease Diseases 0.000 description 2
- 108010041834 Growth Differentiation Factor 15 Proteins 0.000 description 2
- 108010090290 Growth Differentiation Factor 2 Proteins 0.000 description 2
- 102100031493 Growth arrest-specific protein 7 Human genes 0.000 description 2
- 102100040896 Growth/differentiation factor 15 Human genes 0.000 description 2
- 102100040892 Growth/differentiation factor 2 Human genes 0.000 description 2
- 229920002907 Guar gum Polymers 0.000 description 2
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 2
- 102100039317 HAUS augmin-like complex subunit 3 Human genes 0.000 description 2
- 102100031546 HLA class II histocompatibility antigen, DO beta chain Human genes 0.000 description 2
- 108010036972 HLA-A11 Antigen Proteins 0.000 description 2
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 2
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 2
- 208000001204 Hashimoto Disease Diseases 0.000 description 2
- 101710113864 Heat shock protein 90 Proteins 0.000 description 2
- 102400001369 Heparin-binding EGF-like growth factor Human genes 0.000 description 2
- 101800001649 Heparin-binding EGF-like growth factor Proteins 0.000 description 2
- 108010007712 Hepatitis A Virus Cellular Receptor 1 Proteins 0.000 description 2
- 102100034459 Hepatitis A virus cellular receptor 1 Human genes 0.000 description 2
- 102000004989 Hepsin Human genes 0.000 description 2
- 108090001101 Hepsin Proteins 0.000 description 2
- 102100038970 Histone-lysine N-methyltransferase EZH2 Human genes 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000608799 Homo sapiens 116 kDa U5 small nuclear ribonucleoprotein component Proteins 0.000 description 2
- 101000750222 Homo sapiens ATP-dependent Clp protease proteolytic subunit, mitochondrial Proteins 0.000 description 2
- 101000890570 Homo sapiens Aldehyde dehydrogenase 1A1 Proteins 0.000 description 2
- 101000757191 Homo sapiens Ankyrin repeat domain-containing protein 30A Proteins 0.000 description 2
- 101000765923 Homo sapiens Bcl-2-like protein 1 Proteins 0.000 description 2
- 101000978381 Homo sapiens C-C motif chemokine 14 Proteins 0.000 description 2
- 101000978375 Homo sapiens C-C motif chemokine 16 Proteins 0.000 description 2
- 101000978362 Homo sapiens C-C motif chemokine 17 Proteins 0.000 description 2
- 101000978371 Homo sapiens C-C motif chemokine 18 Proteins 0.000 description 2
- 101000897477 Homo sapiens C-C motif chemokine 28 Proteins 0.000 description 2
- 101000858068 Homo sapiens C-X-C motif chemokine 14 Proteins 0.000 description 2
- 101000889133 Homo sapiens C-X-C motif chemokine 16 Proteins 0.000 description 2
- 101100059307 Homo sapiens CCDC110 gene Proteins 0.000 description 2
- 101000741445 Homo sapiens Calcitonin Proteins 0.000 description 2
- 101000932890 Homo sapiens Calcitonin gene-related peptide 1 Proteins 0.000 description 2
- 101000994700 Homo sapiens Casein kinase I isoform alpha Proteins 0.000 description 2
- 101000741072 Homo sapiens Caspase-5 Proteins 0.000 description 2
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 2
- 101000916489 Homo sapiens Chondroitin sulfate proteoglycan 4 Proteins 0.000 description 2
- 101000745414 Homo sapiens Chondrosarcoma-associated gene 2/3 protein Proteins 0.000 description 2
- 101000909516 Homo sapiens Contactin-2 Proteins 0.000 description 2
- 101000884345 Homo sapiens Cyclin-dependent kinase 12 Proteins 0.000 description 2
- 101000864646 Homo sapiens Dickkopf-related protein 1 Proteins 0.000 description 2
- 101000692702 Homo sapiens E3 ubiquitin-protein ligase RNF43 Proteins 0.000 description 2
- 101000807547 Homo sapiens E3 ubiquitin-protein ligase UBR4 Proteins 0.000 description 2
- 101001060267 Homo sapiens Fibroblast growth factor 5 Proteins 0.000 description 2
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 2
- 101000923044 Homo sapiens Growth arrest-specific protein 7 Proteins 0.000 description 2
- 101001035819 Homo sapiens HAUS augmin-like complex subunit 3 Proteins 0.000 description 2
- 101000866281 Homo sapiens HLA class II histocompatibility antigen, DO beta chain Proteins 0.000 description 2
- 101000882127 Homo sapiens Histone-lysine N-methyltransferase EZH2 Proteins 0.000 description 2
- 101001037256 Homo sapiens Indoleamine 2,3-dioxygenase 1 Proteins 0.000 description 2
- 101001002470 Homo sapiens Interferon lambda-1 Proteins 0.000 description 2
- 101000614481 Homo sapiens Kidney-associated antigen 1 Proteins 0.000 description 2
- 101001027621 Homo sapiens Kinesin-like protein KIF20A Proteins 0.000 description 2
- 101000971605 Homo sapiens Kita-kyushu lung cancer antigen 1 Proteins 0.000 description 2
- 101001014223 Homo sapiens MAPK/MAK/MRK overlapping kinase Proteins 0.000 description 2
- 101001134060 Homo sapiens Melanocyte-stimulating hormone receptor Proteins 0.000 description 2
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 2
- 101001036406 Homo sapiens Melanoma-associated antigen C1 Proteins 0.000 description 2
- 101001057156 Homo sapiens Melanoma-associated antigen C2 Proteins 0.000 description 2
- 101000628547 Homo sapiens Metalloreductase STEAP1 Proteins 0.000 description 2
- 101000978949 Homo sapiens NADP-dependent malic enzyme Proteins 0.000 description 2
- 101000588345 Homo sapiens Nuclear transcription factor Y subunit gamma Proteins 0.000 description 2
- 101000601724 Homo sapiens Paired box protein Pax-5 Proteins 0.000 description 2
- 101000619805 Homo sapiens Peroxiredoxin-5, mitochondrial Proteins 0.000 description 2
- 101000829725 Homo sapiens Phospholipid hydroperoxide glutathione peroxidase Proteins 0.000 description 2
- 101000610208 Homo sapiens Poly(A) polymerase gamma Proteins 0.000 description 2
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 2
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 description 2
- 101000877404 Homo sapiens Protein enabled homolog Proteins 0.000 description 2
- 101001067951 Homo sapiens Protein phosphatase 1 regulatory subunit 3B Proteins 0.000 description 2
- 101000842302 Homo sapiens Protein-cysteine N-palmitoyltransferase HHAT Proteins 0.000 description 2
- 101000613391 Homo sapiens Protocadherin beta-16 Proteins 0.000 description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 2
- 101000591201 Homo sapiens Receptor-type tyrosine-protein phosphatase kappa Proteins 0.000 description 2
- 101001073409 Homo sapiens Retrotransposon-derived protein PEG10 Proteins 0.000 description 2
- 101000821981 Homo sapiens Sarcoma antigen 1 Proteins 0.000 description 2
- 101000665150 Homo sapiens Small nuclear ribonucleoprotein Sm D1 Proteins 0.000 description 2
- 101000665250 Homo sapiens Small nuclear ribonucleoprotein Sm D2 Proteins 0.000 description 2
- 101001056234 Homo sapiens Sperm mitochondrial-associated cysteine-rich protein Proteins 0.000 description 2
- 101000824971 Homo sapiens Sperm surface protein Sp17 Proteins 0.000 description 2
- 101000648075 Homo sapiens Trafficking protein particle complex subunit 1 Proteins 0.000 description 2
- 101000664703 Homo sapiens Transcription factor SOX-10 Proteins 0.000 description 2
- 101000801433 Homo sapiens Trophoblast glycoprotein Proteins 0.000 description 2
- 208000037147 Hypercalcaemia Diseases 0.000 description 2
- HEFNNWSXXWATRW-UHFFFAOYSA-N Ibuprofen Chemical compound CC(C)CC1=CC=C(C(C)C(O)=O)C=C1 HEFNNWSXXWATRW-UHFFFAOYSA-N 0.000 description 2
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 2
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 2
- 102100040061 Indoleamine 2,3-dioxygenase 1 Human genes 0.000 description 2
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 2
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 2
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 2
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 2
- 102000004372 Insulin-like growth factor binding protein 2 Human genes 0.000 description 2
- 108090000964 Insulin-like growth factor binding protein 2 Proteins 0.000 description 2
- 108090000965 Insulin-like growth factor binding protein 3 Proteins 0.000 description 2
- 102000004375 Insulin-like growth factor-binding protein 1 Human genes 0.000 description 2
- 108090000957 Insulin-like growth factor-binding protein 1 Proteins 0.000 description 2
- 102000004369 Insulin-like growth factor-binding protein 4 Human genes 0.000 description 2
- 108090000969 Insulin-like growth factor-binding protein 4 Proteins 0.000 description 2
- 102000004883 Insulin-like growth factor-binding protein 6 Human genes 0.000 description 2
- 108090001014 Insulin-like growth factor-binding protein 6 Proteins 0.000 description 2
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 2
- 108010064600 Intercellular Adhesion Molecule-3 Proteins 0.000 description 2
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 2
- 102100037872 Intercellular adhesion molecule 2 Human genes 0.000 description 2
- 101710148794 Intercellular adhesion molecule 2 Proteins 0.000 description 2
- 102100037871 Intercellular adhesion molecule 3 Human genes 0.000 description 2
- 102100020990 Interferon lambda-1 Human genes 0.000 description 2
- 102100020989 Interferon lambda-2 Human genes 0.000 description 2
- 101710099622 Interferon lambda-2 Proteins 0.000 description 2
- 102000006992 Interferon-alpha Human genes 0.000 description 2
- 108010047761 Interferon-alpha Proteins 0.000 description 2
- 108090000467 Interferon-beta Proteins 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 102000003777 Interleukin-1 beta Human genes 0.000 description 2
- 108090000193 Interleukin-1 beta Proteins 0.000 description 2
- 102000003815 Interleukin-11 Human genes 0.000 description 2
- 108090000177 Interleukin-11 Proteins 0.000 description 2
- 102000007482 Interleukin-13 Receptor alpha2 Subunit Human genes 0.000 description 2
- 108010085418 Interleukin-13 Receptor alpha2 Subunit Proteins 0.000 description 2
- 102000003812 Interleukin-15 Human genes 0.000 description 2
- 108090000172 Interleukin-15 Proteins 0.000 description 2
- 102000049772 Interleukin-16 Human genes 0.000 description 2
- 101800003050 Interleukin-16 Proteins 0.000 description 2
- 102100033096 Interleukin-17D Human genes 0.000 description 2
- 108010066979 Interleukin-27 Proteins 0.000 description 2
- 102100021596 Interleukin-31 Human genes 0.000 description 2
- 101710181613 Interleukin-31 Proteins 0.000 description 2
- 102000004388 Interleukin-4 Human genes 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 102000000704 Interleukin-7 Human genes 0.000 description 2
- 108010002586 Interleukin-7 Proteins 0.000 description 2
- 102000000585 Interleukin-9 Human genes 0.000 description 2
- 108010002335 Interleukin-9 Proteins 0.000 description 2
- 208000005615 Interstitial Cystitis Diseases 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 102100034872 Kallikrein-4 Human genes 0.000 description 2
- 102100040442 Kidney-associated antigen 1 Human genes 0.000 description 2
- 102100037694 Kinesin-like protein KIF20A Human genes 0.000 description 2
- IFQSXNOEEPCSLW-DKWTVANSSA-N L-cysteine hydrochloride Chemical compound Cl.SC[C@H](N)C(O)=O IFQSXNOEEPCSLW-DKWTVANSSA-N 0.000 description 2
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 2
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 2
- 102100033467 L-selectin Human genes 0.000 description 2
- 239000005536 L01XE08 - Nilotinib Substances 0.000 description 2
- 239000002118 L01XE12 - Vandetanib Substances 0.000 description 2
- 239000002145 L01XE14 - Bosutinib Substances 0.000 description 2
- 239000002146 L01XE16 - Crizotinib Substances 0.000 description 2
- 102100024144 Lengsin Human genes 0.000 description 2
- 101710113750 Lengsin Proteins 0.000 description 2
- 108090000581 Leukemia inhibitory factor Proteins 0.000 description 2
- 102000013519 Lipocalin-2 Human genes 0.000 description 2
- 108010051335 Lipocalin-2 Proteins 0.000 description 2
- 208000016604 Lyme disease Diseases 0.000 description 2
- 102100026894 Lymphotoxin-beta Human genes 0.000 description 2
- 102100020983 Lysosome membrane protein 2 Human genes 0.000 description 2
- 102100031520 MAPK/MAK/MRK overlapping kinase Human genes 0.000 description 2
- 108010010995 MART-1 Antigen Proteins 0.000 description 2
- 102100030301 MHC class I polypeptide-related sequence A Human genes 0.000 description 2
- 102100030300 MHC class I polypeptide-related sequence B Human genes 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- 102000005727 Mammaglobin A Human genes 0.000 description 2
- 108010031030 Mammaglobin A Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 102100026553 Mannose-binding protein C Human genes 0.000 description 2
- 102100030417 Matrilysin Human genes 0.000 description 2
- 108090000855 Matrilysin Proteins 0.000 description 2
- 102000000380 Matrix Metalloproteinase 1 Human genes 0.000 description 2
- 108010016113 Matrix Metalloproteinase 1 Proteins 0.000 description 2
- 102100030412 Matrix metalloproteinase-9 Human genes 0.000 description 2
- 108010015302 Matrix metalloproteinase-9 Proteins 0.000 description 2
- 102100034216 Melanocyte-stimulating hormone receptor Human genes 0.000 description 2
- 206010027145 Melanocytic naevus Diseases 0.000 description 2
- 102100039447 Melanoma-associated antigen C1 Human genes 0.000 description 2
- 102100027252 Melanoma-associated antigen C2 Human genes 0.000 description 2
- 241001482085 Meloe Species 0.000 description 2
- MJVAVZPDRWSRRC-UHFFFAOYSA-N Menadione Chemical compound C1=CC=C2C(=O)C(C)=CC(=O)C2=C1 MJVAVZPDRWSRRC-UHFFFAOYSA-N 0.000 description 2
- 102100039364 Metalloproteinase inhibitor 1 Human genes 0.000 description 2
- 102100026262 Metalloproteinase inhibitor 2 Human genes 0.000 description 2
- 102100024289 Metalloproteinase inhibitor 4 Human genes 0.000 description 2
- 108050006579 Metalloproteinase inhibitor 4 Proteins 0.000 description 2
- 102100026712 Metalloreductase STEAP1 Human genes 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 description 2
- 241000736262 Microbiota Species 0.000 description 2
- 102100030335 Midkine Human genes 0.000 description 2
- 108010092801 Midkine Proteins 0.000 description 2
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 2
- 101710151805 Mitochondrial intermediate peptidase 1 Proteins 0.000 description 2
- 241001430197 Mollicutes Species 0.000 description 2
- 208000026072 Motor neurone disease Diseases 0.000 description 2
- 108010008707 Mucin-1 Proteins 0.000 description 2
- 201000002795 Muckle-Wells syndrome Diseases 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 208000009525 Myocarditis Diseases 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 2
- 102100022913 NAD-dependent protein deacetylase sirtuin-2 Human genes 0.000 description 2
- 102100023175 NADP-dependent malic enzyme Human genes 0.000 description 2
- 102000003729 Neprilysin Human genes 0.000 description 2
- 108090000028 Neprilysin Proteins 0.000 description 2
- 108010025020 Nerve Growth Factor Proteins 0.000 description 2
- 208000012902 Nervous system disease Diseases 0.000 description 2
- 102100023181 Neurogenic locus notch homolog protein 1 Human genes 0.000 description 2
- 108090000742 Neurotrophin 3 Proteins 0.000 description 2
- 102100029268 Neurotrophin-3 Human genes 0.000 description 2
- 102000003683 Neurotrophin-4 Human genes 0.000 description 2
- 108090000099 Neurotrophin-4 Proteins 0.000 description 2
- 102100037369 Nidogen-1 Human genes 0.000 description 2
- 102100031719 Nuclear transcription factor Y subunit gamma Human genes 0.000 description 2
- 102100022396 Nucleosome assembly protein 1-like 4 Human genes 0.000 description 2
- 201000010133 Oligodendroglioma Diseases 0.000 description 2
- 108090000630 Oncostatin M Proteins 0.000 description 2
- 208000003435 Optic Neuritis Diseases 0.000 description 2
- 206010031149 Osteitis Diseases 0.000 description 2
- 208000010191 Osteitis Deformans Diseases 0.000 description 2
- 102000004264 Osteopontin Human genes 0.000 description 2
- 108010081689 Osteopontin Proteins 0.000 description 2
- 102000008108 Osteoprotegerin Human genes 0.000 description 2
- 108010035042 Osteoprotegerin Proteins 0.000 description 2
- 102100025386 Oxidized low-density lipoprotein receptor 1 Human genes 0.000 description 2
- 108091008606 PDGF receptors Proteins 0.000 description 2
- 102000036673 PRAME Human genes 0.000 description 2
- 108060006580 PRAME Proteins 0.000 description 2
- 108050007154 PWWP domain-containing DNA repair factor 3A Proteins 0.000 description 2
- 102100034640 PWWP domain-containing DNA repair factor 3A Human genes 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 208000027868 Paget disease Diseases 0.000 description 2
- 208000002193 Pain Diseases 0.000 description 2
- 102100037504 Paired box protein Pax-5 Human genes 0.000 description 2
- 241000282577 Pan troglodytes Species 0.000 description 2
- 206010033645 Pancreatitis Diseases 0.000 description 2
- 206010061332 Paraganglion neoplasm Diseases 0.000 description 2
- 241000721454 Pemphigus Species 0.000 description 2
- 108010077519 Peptide Elongation Factor 2 Proteins 0.000 description 2
- 102000017794 Perilipin-2 Human genes 0.000 description 2
- 108010067163 Perilipin-2 Proteins 0.000 description 2
- 102100022078 Peroxiredoxin-5, mitochondrial Human genes 0.000 description 2
- 201000007100 Pharyngitis Diseases 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102100037419 Pituitary tumor-transforming gene 1 protein-interacting protein Human genes 0.000 description 2
- 101710199379 Pituitary tumor-transforming gene 1 protein-interacting protein Proteins 0.000 description 2
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 2
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 2
- 102100024616 Platelet endothelial cell adhesion molecule Human genes 0.000 description 2
- 102100030304 Platelet factor 4 Human genes 0.000 description 2
- 102000011653 Platelet-Derived Growth Factor Receptors Human genes 0.000 description 2
- 206010035742 Pneumonitis Diseases 0.000 description 2
- 102100040153 Poly(A) polymerase gamma Human genes 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 102100033237 Pro-epidermal growth factor Human genes 0.000 description 2
- 102100029837 Probetacellulin Human genes 0.000 description 2
- 102100040126 Prokineticin-1 Human genes 0.000 description 2
- 102100023832 Prolyl endopeptidase FAP Human genes 0.000 description 2
- 101710107726 Protein MobC Proteins 0.000 description 2
- 102100035093 Protein enabled homolog Human genes 0.000 description 2
- 102100034504 Protein phosphatase 1 regulatory subunit 3B Human genes 0.000 description 2
- 102000018471 Proto-Oncogene Proteins B-raf Human genes 0.000 description 2
- 108010091528 Proto-Oncogene Proteins B-raf Proteins 0.000 description 2
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 2
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 2
- 101710104378 Putative malate oxidoreductase [NAD] Proteins 0.000 description 2
- MUPFEKGTMRGPLJ-RMMQSMQOSA-N Raffinose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 MUPFEKGTMRGPLJ-RMMQSMQOSA-N 0.000 description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 2
- 102100034089 Receptor-type tyrosine-protein phosphatase kappa Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 102000018120 Recombinases Human genes 0.000 description 2
- 108010091086 Recombinases Proteins 0.000 description 2
- 102100037421 Regulator of G-protein signaling 5 Human genes 0.000 description 2
- 101710140403 Regulator of G-protein signaling 5 Proteins 0.000 description 2
- 102100038246 Retinol-binding protein 4 Human genes 0.000 description 2
- 102100035844 Retrotransposon-derived protein PEG10 Human genes 0.000 description 2
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 2
- 108020004422 Riboswitch Proteins 0.000 description 2
- 108700019345 SYT-SSX fusion Proteins 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- 102100021466 Sarcoma antigen 1 Human genes 0.000 description 2
- 102100031312 Secernin-1 Human genes 0.000 description 2
- 101710186590 Secernin-1 Proteins 0.000 description 2
- 102100030053 Secreted frizzled-related protein 3 Human genes 0.000 description 2
- 101710173693 Short transient receptor potential channel 1 Proteins 0.000 description 2
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 description 2
- 102100029965 Sialic acid-binding Ig-like lectin 9 Human genes 0.000 description 2
- 108010041216 Sirtuin 2 Proteins 0.000 description 2
- 102100038685 Small nuclear ribonucleoprotein Sm D2 Human genes 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102100026503 Sperm mitochondrial-associated cysteine-rich protein Human genes 0.000 description 2
- 102100022441 Sperm surface protein Sp17 Human genes 0.000 description 2
- 239000004187 Spiramycin Substances 0.000 description 2
- UQZIYBXSHAGNOE-USOSMYMVSA-N Stachyose Natural products O(C[C@H]1[C@@H](O)[C@H](O)[C@H](O)[C@@H](O[C@@]2(CO)[C@H](O)[C@@H](O)[C@@H](CO)O2)O1)[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@H](CO[C@@H]2[C@@H](O)[C@@H](O)[C@@H](O)[C@H](CO)O2)O1 UQZIYBXSHAGNOE-USOSMYMVSA-N 0.000 description 2
- 101710088580 Stromal cell-derived factor 1 Proteins 0.000 description 2
- 102100030416 Stromelysin-1 Human genes 0.000 description 2
- 102100028848 Stromelysin-2 Human genes 0.000 description 2
- 108010002687 Survivin Proteins 0.000 description 2
- 108700019889 TEL-AML1 fusion Proteins 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- 108010053950 Teicoplanin Proteins 0.000 description 2
- 108010017842 Telomerase Proteins 0.000 description 2
- CBPNZQVSJQDFBE-FUXHJELOSA-N Temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-FUXHJELOSA-N 0.000 description 2
- 102100031294 Thymic stromal lymphopoietin Human genes 0.000 description 2
- 102100030951 Tissue factor pathway inhibitor Human genes 0.000 description 2
- 102100024333 Toll-like receptor 2 Human genes 0.000 description 2
- 102100025256 Trafficking protein particle complex subunit 1 Human genes 0.000 description 2
- 102100038808 Transcription factor SOX-10 Human genes 0.000 description 2
- 102000046299 Transforming Growth Factor beta1 Human genes 0.000 description 2
- 101800004564 Transforming growth factor alpha Proteins 0.000 description 2
- 101800002279 Transforming growth factor beta-1 Proteins 0.000 description 2
- 102000056172 Transforming growth factor beta-3 Human genes 0.000 description 2
- 108090000097 Transforming growth factor beta-3 Proteins 0.000 description 2
- 108010066451 Triggering Receptor Expressed on Myeloid Cells-1 Proteins 0.000 description 2
- 102100029681 Triggering receptor expressed on myeloid cells 1 Human genes 0.000 description 2
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 description 2
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 2
- 102100033579 Trophoblast glycoprotein Human genes 0.000 description 2
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 102100029675 Tumor necrosis factor receptor superfamily member 13B Human genes 0.000 description 2
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 2
- 102100033726 Tumor necrosis factor receptor superfamily member 17 Human genes 0.000 description 2
- 102100022205 Tumor necrosis factor receptor superfamily member 21 Human genes 0.000 description 2
- 102100035284 Tumor necrosis factor receptor superfamily member 6B Human genes 0.000 description 2
- MUPFEKGTMRGPLJ-UHFFFAOYSA-N UNPD196149 Natural products OC1C(O)C(CO)OC1(CO)OC1C(O)C(O)C(O)C(COC2C(C(O)C(O)C(CO)O2)O)O1 MUPFEKGTMRGPLJ-UHFFFAOYSA-N 0.000 description 2
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 2
- 102000008790 VE-cadherin Human genes 0.000 description 2
- 108010073923 Vascular Endothelial Growth Factor C Proteins 0.000 description 2
- 102100023543 Vascular cell adhesion protein 1 Human genes 0.000 description 2
- 102100038232 Vascular endothelial growth factor C Human genes 0.000 description 2
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 2
- 102100033179 Vascular endothelial growth factor receptor 3 Human genes 0.000 description 2
- 108010080702 Virginiamycin Proteins 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 229960002964 adalimumab Drugs 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 108010081667 aflibercept Proteins 0.000 description 2
- 229960000548 alemtuzumab Drugs 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- 229960001445 alitretinoin Drugs 0.000 description 2
- JAZBEHYOTPTENJ-JLNKQSITSA-N all-cis-5,8,11,14,17-icosapentaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O JAZBEHYOTPTENJ-JLNKQSITSA-N 0.000 description 2
- 231100000360 alopecia Toxicity 0.000 description 2
- 230000002707 ameloblastic effect Effects 0.000 description 2
- 229940024606 amino acid Drugs 0.000 description 2
- 235000001014 amino acid Nutrition 0.000 description 2
- 150000001413 amino acids Chemical class 0.000 description 2
- 229940038195 amoxicillin / clavulanate Drugs 0.000 description 2
- 229940043312 ampicillin / sulbactam Drugs 0.000 description 2
- 229960004238 anakinra Drugs 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 2
- 108010072788 angiogenin Proteins 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000001078 anti-cholinergic effect Effects 0.000 description 2
- 239000002260 anti-inflammatory agent Substances 0.000 description 2
- 230000001355 anti-mycobacterial effect Effects 0.000 description 2
- 239000003926 antimycobacterial agent Chemical class 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 2
- 108010055066 asparaginylendopeptidase Proteins 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 2
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 2
- 229960004099 azithromycin Drugs 0.000 description 2
- MQTOSJVFKKJCRP-BICOPXKESA-N azithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)N(C)C[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 MQTOSJVFKKJCRP-BICOPXKESA-N 0.000 description 2
- 229960003071 bacitracin Drugs 0.000 description 2
- 229930184125 bacitracin Natural products 0.000 description 2
- CLKOFPXJLQSYAH-ABRJDSQDSA-N bacitracin A Chemical compound C1SC([C@@H](N)[C@@H](C)CC)=N[C@@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]1C(=O)N[C@H](CCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2N=CNC=2)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)NCCCC1 CLKOFPXJLQSYAH-ABRJDSQDSA-N 0.000 description 2
- 108010056708 bcr-abl Fusion Proteins Proteins 0.000 description 2
- 102000004441 bcr-abl Fusion Proteins Human genes 0.000 description 2
- 229960003270 belimumab Drugs 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000000440 bentonite Substances 0.000 description 2
- 229910000278 bentonite Inorganic materials 0.000 description 2
- 235000012216 bentonite Nutrition 0.000 description 2
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 2
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 2
- 229960002938 bexarotene Drugs 0.000 description 2
- 238000004820 blood count Methods 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 208000018339 bone inflammation disease Diseases 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 229960001467 bortezomib Drugs 0.000 description 2
- UBPYILGKFZZVDX-UHFFFAOYSA-N bosutinib Chemical compound C1=C(Cl)C(OC)=CC(NC=2C3=CC(OC)=C(OCCCN4CCN(C)CC4)C=C3N=CC=2C#N)=C1Cl UBPYILGKFZZVDX-UHFFFAOYSA-N 0.000 description 2
- 108091006374 cAMP receptor proteins Proteins 0.000 description 2
- 229940112129 campath Drugs 0.000 description 2
- 229940041514 candida albicans extract Drugs 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- BLMPQMFVWMYDKT-NZTKNTHTSA-N carfilzomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)[C@]1(C)OC1)NC(=O)CN1CCOCC1)CC1=CC=CC=C1 BLMPQMFVWMYDKT-NZTKNTHTSA-N 0.000 description 2
- 229960002438 carfilzomib Drugs 0.000 description 2
- 108010021331 carfilzomib Proteins 0.000 description 2
- 239000003054 catalyst Substances 0.000 description 2
- XIURVHNZVLADCM-IUODEOHRSA-N cefalotin Chemical compound N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC(=O)C)C(O)=O)C(=O)CC1=CC=CS1 XIURVHNZVLADCM-IUODEOHRSA-N 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 238000002659 cell therapy Methods 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- DDTDNCYHLGRFBM-YZEKDTGTSA-N chembl2367892 Chemical compound CC(=O)N[C@H]1[C@@H](O)[C@H](O)[C@H](CO)O[C@H]1O[C@@H]([C@H]1C(N[C@@H](C2=CC(O)=CC(O[C@@H]3[C@H]([C@H](O)[C@H](O)[C@@H](CO)O3)O)=C2C=2C(O)=CC=C(C=2)[C@@H](NC(=O)[C@@H]2NC(=O)[C@@H]3C=4C=C(O)C=C(C=4)OC=4C(O)=CC=C(C=4)[C@@H](N)C(=O)N[C@H](CC=4C=C(Cl)C(O5)=CC=4)C(=O)N3)C(=O)N1)C(O)=O)=O)C(C=C1Cl)=CC=C1OC1=C(O[C@H]3[C@H]([C@@H](O)[C@H](O)[C@H](CO)O3)NC(C)=O)C5=CC2=C1 DDTDNCYHLGRFBM-YZEKDTGTSA-N 0.000 description 2
- 201000008240 chemical colitis Diseases 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- MYSWGUAQZAJSOK-UHFFFAOYSA-N ciprofloxacin Chemical compound C12=CC(N3CCNCC3)=C(F)C=C2C(=O)C(C(=O)O)=CN1C1CC1 MYSWGUAQZAJSOK-UHFFFAOYSA-N 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 229960002626 clarithromycin Drugs 0.000 description 2
- AGOYDEPGAOXOCK-KCBOHYOISA-N clarithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@](C)([C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)OC)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 AGOYDEPGAOXOCK-KCBOHYOISA-N 0.000 description 2
- 208000029664 classic familial adenomatous polyposis Diseases 0.000 description 2
- HZZVJAQRINQKSD-PBFISZAISA-N clavulanic acid Chemical compound OC(=O)[C@H]1C(=C/CO)/O[C@@H]2CC(=O)N21 HZZVJAQRINQKSD-PBFISZAISA-N 0.000 description 2
- 208000009060 clear cell adenocarcinoma Diseases 0.000 description 2
- 229940047766 co-trimoxazole Drugs 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 235000009508 confectionery Nutrition 0.000 description 2
- 238000010411 cooking Methods 0.000 description 2
- 239000008120 corn starch Substances 0.000 description 2
- 239000003246 corticosteroid Substances 0.000 description 2
- 229960001334 corticosteroids Drugs 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- 229940109239 creatinine Drugs 0.000 description 2
- KTEIFNKAUNYNJU-GFCCVEGCSA-N crizotinib Chemical compound O([C@H](C)C=1C(=C(F)C=CC=1Cl)Cl)C(C(=NC=1)N)=CC=1C(=C1)C=NN1C1CCNCC1 KTEIFNKAUNYNJU-GFCCVEGCSA-N 0.000 description 2
- 238000005138 cryopreservation Methods 0.000 description 2
- 208000022993 cryopyrin-associated periodic syndrome Diseases 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- VFLDPWHFBUODDF-FCXRPNKRSA-N curcumin Chemical compound C1=C(O)C(OC)=CC(\C=C\C(=O)CC(=O)\C=C\C=2C=C(OC)C(O)=CC=2)=C1 VFLDPWHFBUODDF-FCXRPNKRSA-N 0.000 description 2
- 229960004397 cyclophosphamide Drugs 0.000 description 2
- 229930182912 cyclosporin Natural products 0.000 description 2
- 201000003146 cystitis Diseases 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 235000013365 dairy product Nutrition 0.000 description 2
- DOAKLVKFURWEDJ-QCMAZARJSA-N daptomycin Chemical compound C([C@H]1C(=O)O[C@H](C)[C@@H](C(NCC(=O)N[C@@H](CCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@H](CO)C(=O)N[C@H](C(=O)N1)[C@H](C)CC(O)=O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](CC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)CCCCCCCCC)C(=O)C1=CC=CC=C1N DOAKLVKFURWEDJ-QCMAZARJSA-N 0.000 description 2
- 229960005484 daptomycin Drugs 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 238000000354 decomposition reaction Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 229920006237 degradable polymer Polymers 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 229960002923 denileukin diftitox Drugs 0.000 description 2
- 235000011850 desserts Nutrition 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 235000015872 dietary supplement Nutrition 0.000 description 2
- 210000002249 digestive system Anatomy 0.000 description 2
- 208000016097 disease of metabolism Diseases 0.000 description 2
- 230000006806 disease prevention Effects 0.000 description 2
- NWOYIVRVSJDTLK-YSDBFZIDSA-L disodium;(2s,5r,6r)-6-[[(2r)-2-amino-2-phenylacetyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylate;(1r,4s)-3,3-dimethyl-2,2,6-trioxo-2$l^{6}-thiabicyclo[3.2.0]heptane-4-carboxylate Chemical compound [Na+].[Na+].O=S1(=O)C(C)(C)[C@H](C([O-])=O)C2C(=O)C[C@H]21.C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C([O-])=O)(C)C)=CC=CC=C1 NWOYIVRVSJDTLK-YSDBFZIDSA-L 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 201000008243 diversion colitis Diseases 0.000 description 2
- 235000020669 docosahexaenoic acid Nutrition 0.000 description 2
- UKMSUNONTOPOIO-UHFFFAOYSA-N docosanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCCCC(O)=O UKMSUNONTOPOIO-UHFFFAOYSA-N 0.000 description 2
- 229960003722 doxycycline Drugs 0.000 description 2
- 206010013781 dry mouth Diseases 0.000 description 2
- 230000002183 duodenal effect Effects 0.000 description 2
- 229950009791 durvalumab Drugs 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- 235000020673 eicosapentaenoic acid Nutrition 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 208000010227 enterocolitis Diseases 0.000 description 2
- GTTBEUCJPZQMDZ-UHFFFAOYSA-N erlotinib hydrochloride Chemical compound [H+].[Cl-].C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 GTTBEUCJPZQMDZ-UHFFFAOYSA-N 0.000 description 2
- 229960000403 etanercept Drugs 0.000 description 2
- AEUTYOVWOVBAKS-UWVGGRQHSA-N ethambutol Chemical compound CC[C@@H](CO)NCCN[C@@H](CC)CO AEUTYOVWOVBAKS-UWVGGRQHSA-N 0.000 description 2
- 235000019325 ethyl cellulose Nutrition 0.000 description 2
- 229920001249 ethyl cellulose Polymers 0.000 description 2
- 229960005293 etodolac Drugs 0.000 description 2
- XFBVBWWRPKNWHW-UHFFFAOYSA-N etodolac Chemical compound C1COC(CC)(CC(O)=O)C2=N[C]3C(CC)=CC=CC3=C21 XFBVBWWRPKNWHW-UHFFFAOYSA-N 0.000 description 2
- 229960005167 everolimus Drugs 0.000 description 2
- 239000003925 fat Substances 0.000 description 2
- 235000019197 fats Nutrition 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 102000006815 folate receptor Human genes 0.000 description 2
- 108020005243 folate receptor Proteins 0.000 description 2
- 229960000304 folic acid Drugs 0.000 description 2
- 229940039573 folotyn Drugs 0.000 description 2
- 235000020932 food allergy Nutrition 0.000 description 2
- 235000003599 food sweetener Nutrition 0.000 description 2
- 238000005194 fractionation Methods 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 229960001625 furazolidone Drugs 0.000 description 2
- PLHJDBGFXBMTGZ-WEVVVXLNSA-N furazolidone Chemical compound O1C([N+](=O)[O-])=CC=C1\C=N\N1C(=O)OCC1 PLHJDBGFXBMTGZ-WEVVVXLNSA-N 0.000 description 2
- 229960004675 fusidic acid Drugs 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 235000021255 galacto-oligosaccharides Nutrition 0.000 description 2
- 150000003271 galactooligosaccharides Chemical class 0.000 description 2
- CHPZKNULDCNCBW-UHFFFAOYSA-N gallium nitrate Chemical compound [Ga+3].[O-][N+]([O-])=O.[O-][N+]([O-])=O.[O-][N+]([O-])=O CHPZKNULDCNCBW-UHFFFAOYSA-N 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 208000021302 gastroesophageal reflux disease Diseases 0.000 description 2
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- QTQAWLPCGQOSGP-GBTDJJJQSA-N geldanamycin Chemical compound N1C(=O)\C(C)=C/C=C\[C@@H](OC)[C@H](OC(N)=O)\C(C)=C/[C@@H](C)[C@@H](O)[C@H](OC)C[C@@H](C)CC2=C(OC)C(=O)C=C1C2=O QTQAWLPCGQOSGP-GBTDJJJQSA-N 0.000 description 2
- 238000012239 gene modification Methods 0.000 description 2
- 230000005017 genetic modification Effects 0.000 description 2
- 235000013617 genetically modified food Nutrition 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 235000010417 guar gum Nutrition 0.000 description 2
- 239000000665 guar gum Substances 0.000 description 2
- 229960002154 guar gum Drugs 0.000 description 2
- 235000013402 health food Nutrition 0.000 description 2
- 230000002949 hemolytic effect Effects 0.000 description 2
- 201000002802 hemorrhagic cystitis Diseases 0.000 description 2
- KEMQGTRYUADPNZ-UHFFFAOYSA-N heptadecanoic acid Chemical compound CCCCCCCCCCCCCCCCC(O)=O KEMQGTRYUADPNZ-UHFFFAOYSA-N 0.000 description 2
- MCAHMSDENAOJFZ-BVXDHVRPSA-N herbimycin Chemical compound N1C(=O)\C(C)=C\C=C/[C@H](OC)[C@@H](OC(N)=O)\C(C)=C\[C@H](C)[C@@H](OC)[C@@H](OC)C[C@H](C)[C@@H](OC)C2=CC(=O)C=C1C2=O MCAHMSDENAOJFZ-BVXDHVRPSA-N 0.000 description 2
- 229930193320 herbimycin Natural products 0.000 description 2
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 2
- 208000002557 hidradenitis Diseases 0.000 description 2
- 201000007162 hidradenitis suppurativa Diseases 0.000 description 2
- 229960000890 hydrocortisone Drugs 0.000 description 2
- 239000000017 hydrogel Substances 0.000 description 2
- 230000000148 hypercalcaemia Effects 0.000 description 2
- 208000030915 hypercalcemia disease Diseases 0.000 description 2
- VKOBVWXKNCXXDE-UHFFFAOYSA-N icosanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCC(O)=O VKOBVWXKNCXXDE-UHFFFAOYSA-N 0.000 description 2
- 229960001101 ifosfamide Drugs 0.000 description 2
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- YLMAHDNUQAMNNX-UHFFFAOYSA-N imatinib methanesulfonate Chemical compound CS(O)(=O)=O.C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 YLMAHDNUQAMNNX-UHFFFAOYSA-N 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 229960000905 indomethacin Drugs 0.000 description 2
- 229960000598 infliximab Drugs 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 102000006495 integrins Human genes 0.000 description 2
- 108010044426 integrins Proteins 0.000 description 2
- 102000003898 interleukin-24 Human genes 0.000 description 2
- 108090000237 interleukin-24 Proteins 0.000 description 2
- 229940100601 interleukin-6 Drugs 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 2
- 201000004614 iritis Diseases 0.000 description 2
- 201000008222 ischemic colitis Diseases 0.000 description 2
- 229940011083 istodax Drugs 0.000 description 2
- 108010024383 kallikrein 4 Proteins 0.000 description 2
- 206010023332 keratitis Diseases 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 229940054136 kineret Drugs 0.000 description 2
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 108010013555 lipoprotein-associated coagulation inhibitor Proteins 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 206010025135 lupus erythematosus Diseases 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 208000027202 mammary Paget disease Diseases 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- KBOPZPXVLCULAV-UHFFFAOYSA-N mesalamine Chemical compound NC1=CC=C(O)C(C(O)=O)=C1 KBOPZPXVLCULAV-UHFFFAOYSA-N 0.000 description 2
- 229960004963 mesalazine Drugs 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 238000006241 metabolic reaction Methods 0.000 description 2
- 229960003085 meticillin Drugs 0.000 description 2
- VAOCPAMSLUNLGC-UHFFFAOYSA-N metronidazole Chemical compound CC1=NC=C([N+]([O-])=O)N1CCO VAOCPAMSLUNLGC-UHFFFAOYSA-N 0.000 description 2
- 229960000282 metronidazole Drugs 0.000 description 2
- 230000002906 microbiologic effect Effects 0.000 description 2
- 235000013336 milk Nutrition 0.000 description 2
- 239000008267 milk Substances 0.000 description 2
- 210000004080 milk Anatomy 0.000 description 2
- 229960000600 milnacipran Drugs 0.000 description 2
- 229960001156 mitoxantrone Drugs 0.000 description 2
- SUJOIPVTNUVDCB-UHFFFAOYSA-N mutactin Natural products CC1=CC(O)=C2C(=O)CC(O)CC2=C1C1=CC(O)=CC(=O)O1 SUJOIPVTNUVDCB-UHFFFAOYSA-N 0.000 description 2
- LBWFXVZLPYTWQI-IPOVEDGCSA-N n-[2-(diethylamino)ethyl]-5-[(z)-(5-fluoro-2-oxo-1h-indol-3-ylidene)methyl]-2,4-dimethyl-1h-pyrrole-3-carboxamide;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C LBWFXVZLPYTWQI-IPOVEDGCSA-N 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 229960005027 natalizumab Drugs 0.000 description 2
- QZGIWPZCWHMVQL-UIYAJPBUSA-N neocarzinostatin chromophore Chemical compound O1[C@H](C)[C@H](O)[C@H](O)[C@@H](NC)[C@H]1O[C@@H]1C/2=C/C#C[C@H]3O[C@@]3([C@@H]3OC(=O)OC3)C#CC\2=C[C@H]1OC(=O)C1=C(O)C=CC2=C(C)C=C(OC)C=C12 QZGIWPZCWHMVQL-UIYAJPBUSA-N 0.000 description 2
- 238000007481 next generation sequencing Methods 0.000 description 2
- 108010008217 nidogen Proteins 0.000 description 2
- HHZIURLSWUIHRB-UHFFFAOYSA-N nilotinib Chemical compound C1=NC(C)=CN1C1=CC(NC(=O)C=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)=CC(C(F)(F)F)=C1 HHZIURLSWUIHRB-UHFFFAOYSA-N 0.000 description 2
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen(.) Chemical compound [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 2
- 229960003301 nivolumab Drugs 0.000 description 2
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 description 2
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 2
- YJQPYGGHQPGBLI-KGSXXDOSSA-N novobiocin Chemical compound O1C(C)(C)[C@H](OC)[C@@H](OC(N)=O)[C@@H](O)[C@@H]1OC1=CC=C(C(O)=C(NC(=O)C=2C=C(CC=C(C)C)C(O)=CC=2)C(=O)O2)C2=C1C YJQPYGGHQPGBLI-KGSXXDOSSA-N 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 229940100027 ontak Drugs 0.000 description 2
- 229960001756 oxaliplatin Drugs 0.000 description 2
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- SECPZKHBENQXJG-FPLPWBNLSA-N palmitoleic acid Chemical compound CCCCCC\C=C/CCCCCCCC(O)=O SECPZKHBENQXJG-FPLPWBNLSA-N 0.000 description 2
- 229960001972 panitumumab Drugs 0.000 description 2
- 229940096763 panretin Drugs 0.000 description 2
- 229960005489 paracetamol Drugs 0.000 description 2
- 208000007312 paraganglioma Diseases 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- MQHIQUBXFFAOMK-UHFFFAOYSA-N pazopanib hydrochloride Chemical compound Cl.C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 MQHIQUBXFFAOMK-UHFFFAOYSA-N 0.000 description 2
- 239000001814 pectin Substances 0.000 description 2
- 235000010987 pectin Nutrition 0.000 description 2
- 229920001277 pectin Polymers 0.000 description 2
- 229960002621 pembrolizumab Drugs 0.000 description 2
- 108010071005 peptidase E Proteins 0.000 description 2
- 208000027232 peripheral nervous system disease Diseases 0.000 description 2
- 239000000825 pharmaceutical preparation Substances 0.000 description 2
- 229910052698 phosphorus Inorganic materials 0.000 description 2
- HYAFETHFCAUJAY-UHFFFAOYSA-N pioglitazone Chemical compound N1=CC(CC)=CC=C1CCOC(C=C1)=CC=C1CC1C(=O)NC(=O)S1 HYAFETHFCAUJAY-UHFFFAOYSA-N 0.000 description 2
- 229940104641 piperacillin / tazobactam Drugs 0.000 description 2
- 238000007747 plating Methods 0.000 description 2
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 108040000983 polyphosphate:AMP phosphotransferase activity proteins Proteins 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 229960000214 pralatrexate Drugs 0.000 description 2
- 229960004618 prednisone Drugs 0.000 description 2
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 2
- 238000002203 pretreatment Methods 0.000 description 2
- DAIKHDNSXMZDCU-OUDXUNEISA-N pristinamycin-IIA Natural products CC(C)[C@H]1OC(=O)C2=CCCN2C(=O)c3coc(CC(=O)C[C@H](O)C=C(C)C=CCNC(=O)C=C[C@@H]1C)n3 DAIKHDNSXMZDCU-OUDXUNEISA-N 0.000 description 2
- 239000006041 probiotic Substances 0.000 description 2
- 230000000529 probiotic effect Effects 0.000 description 2
- 235000018291 probiotics Nutrition 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- MUPFEKGTMRGPLJ-ZQSKZDJDSA-N raffinose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)O1 MUPFEKGTMRGPLJ-ZQSKZDJDSA-N 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- FNHKPVJBJVTLMP-UHFFFAOYSA-N regorafenib Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=C(F)C(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 FNHKPVJBJVTLMP-UHFFFAOYSA-N 0.000 description 2
- 210000004994 reproductive system Anatomy 0.000 description 2
- 206010039083 rhinitis Diseases 0.000 description 2
- JQXXHWHPUNPDRT-WLSIYKJHSA-N rifampicin Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C([O-])=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CC[NH+](C)CC1 JQXXHWHPUNPDRT-WLSIYKJHSA-N 0.000 description 2
- RZJQGNCSTQAWON-UHFFFAOYSA-N rofecoxib Chemical compound C1=CC(S(=O)(=O)C)=CC=C1C1=C(C=2C=CC=CC=2)C(=O)OC1 RZJQGNCSTQAWON-UHFFFAOYSA-N 0.000 description 2
- 229960003452 romidepsin Drugs 0.000 description 2
- IUPCWCLVECYZRV-JZMZINANSA-N rosaramicin Chemical compound O([C@@H]1[C@@H](C)[C@H](O)CC(=O)O[C@@H]([C@H]([C@@H]2O[C@@]2(C)/C=C/C(=O)[C@H](C)C[C@@H]1CC=O)C)CC)[C@@H]1O[C@H](C)C[C@H](N(C)C)[C@H]1O IUPCWCLVECYZRV-JZMZINANSA-N 0.000 description 2
- 235000002020 sage Nutrition 0.000 description 2
- WVYADZUPLLSGPU-UHFFFAOYSA-N salsalate Chemical compound OC(=O)C1=CC=CC=C1OC(=O)C1=CC=CC=C1O WVYADZUPLLSGPU-UHFFFAOYSA-N 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 235000017557 sodium bicarbonate Nutrition 0.000 description 2
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 2
- 229920003109 sodium starch glycolate Polymers 0.000 description 2
- 239000008109 sodium starch glycolate Substances 0.000 description 2
- 229940079832 sodium starch glycolate Drugs 0.000 description 2
- IVDHYUQIDRJSTI-UHFFFAOYSA-N sorafenib tosylate Chemical compound [H+].CC1=CC=C(S([O-])(=O)=O)C=C1.C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 IVDHYUQIDRJSTI-UHFFFAOYSA-N 0.000 description 2
- 229960000268 spectinomycin Drugs 0.000 description 2
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 2
- 229960001294 spiramycin Drugs 0.000 description 2
- 235000019372 spiramycin Nutrition 0.000 description 2
- 229930191512 spiramycin Natural products 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 238000001694 spray drying Methods 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- UQZIYBXSHAGNOE-XNSRJBNMSA-N stachyose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@@H]3[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O3)O)O2)O)O1 UQZIYBXSHAGNOE-XNSRJBNMSA-N 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- PVYJZLYGTZKPJE-UHFFFAOYSA-N streptonigrin Chemical compound C=1C=C2C(=O)C(OC)=C(N)C(=O)C2=NC=1C(C=1N)=NC(C(O)=O)=C(C)C=1C1=CC=C(OC)C(OC)=C1O PVYJZLYGTZKPJE-UHFFFAOYSA-N 0.000 description 2
- 210000002536 stromal cell Anatomy 0.000 description 2
- 238000000856 sucrose gradient centrifugation Methods 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 230000000153 supplemental effect Effects 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 239000003765 sweetening agent Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
- 229960001967 tacrolimus Drugs 0.000 description 2
- QJJXYPPXXYFBGM-SHYZHZOCSA-N tacrolimus Natural products CO[C@H]1C[C@H](CC[C@@H]1O)C=C(C)[C@H]2OC(=O)[C@H]3CCCCN3C(=O)C(=O)[C@@]4(O)O[C@@H]([C@H](C[C@H]4C)OC)[C@@H](C[C@H](C)CC(=C[C@@H](CC=C)C(=O)C[C@H](O)[C@H]2C)C)OC QJJXYPPXXYFBGM-SHYZHZOCSA-N 0.000 description 2
- 229940099419 targretin Drugs 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 229960001608 teicoplanin Drugs 0.000 description 2
- 229960003250 telithromycin Drugs 0.000 description 2
- LJVAJPDWBABPEJ-PNUFFHFMSA-N telithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)[C@@H](C)C(=O)O[C@@H]([C@]2(OC(=O)N(CCCCN3C=C(N=C3)C=3C=NC=CC=3)[C@@H]2[C@@H](C)C(=O)[C@H](C)C[C@@]1(C)OC)C)CC)[C@@H]1O[C@H](C)C[C@H](N(C)C)[C@H]1O LJVAJPDWBABPEJ-PNUFFHFMSA-N 0.000 description 2
- 206010043207 temporal arteritis Diseases 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- ZFXYFBGIUFBOJW-UHFFFAOYSA-N theophylline Chemical compound O=C1N(C)C(=O)N(C)C2=C1NC=N2 ZFXYFBGIUFBOJW-UHFFFAOYSA-N 0.000 description 2
- 206010043554 thrombocytopenia Diseases 0.000 description 2
- 206010043778 thyroiditis Diseases 0.000 description 2
- 229960003087 tioguanine Drugs 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 229960000575 trastuzumab Drugs 0.000 description 2
- 229960005041 troleandomycin Drugs 0.000 description 2
- LQCLVBQBTUVCEQ-QTFUVMRISA-N troleandomycin Chemical compound O1[C@@H](C)[C@H](OC(C)=O)[C@@H](OC)C[C@@H]1O[C@@H]1[C@@H](C)C(=O)O[C@H](C)[C@H](C)[C@H](OC(C)=O)[C@@H](C)C(=O)[C@@]2(OC2)C[C@H](C)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)OC(C)=O)[C@H]1C LQCLVBQBTUVCEQ-QTFUVMRISA-N 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 241001148471 unidentified anaerobic bacterium Species 0.000 description 2
- LNPDTQAFDNKSHK-UHFFFAOYSA-N valdecoxib Chemical compound CC=1ON=C(C=2C=CC=CC=2)C=1C1=CC=C(S(N)(=O)=O)C=C1 LNPDTQAFDNKSHK-UHFFFAOYSA-N 0.000 description 2
- 229960002004 valdecoxib Drugs 0.000 description 2
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 2
- 229940099039 velcade Drugs 0.000 description 2
- GPXBXXGIAQBQNI-UHFFFAOYSA-N vemurafenib Chemical compound CCCS(=O)(=O)NC1=CC=C(F)C(C(=O)C=2C3=CC(=CN=C3NC=2)C=2C=CC(Cl)=CC=2)=C1F GPXBXXGIAQBQNI-UHFFFAOYSA-N 0.000 description 2
- 230000035899 viability Effects 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 229940011671 vitamin b6 Drugs 0.000 description 2
- 229960000237 vorinostat Drugs 0.000 description 2
- 239000012138 yeast extract Substances 0.000 description 2
- 229940055760 yervoy Drugs 0.000 description 2
- 235000013618 yogurt Nutrition 0.000 description 2
- 229940061261 zolinza Drugs 0.000 description 2
- GVJHHUAWPYXKBD-IEOSBIPESA-N α-tocopherol Chemical compound OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- WTFXTQVDAKGDEY-UHFFFAOYSA-N (-)-chorismic acid Natural products OC1C=CC(C(O)=O)=CC1OC(=C)C(O)=O WTFXTQVDAKGDEY-UHFFFAOYSA-N 0.000 description 1
- NNJPGOLRFBJNIW-HNNXBMFYSA-N (-)-demecolcine Chemical compound C1=C(OC)C(=O)C=C2[C@@H](NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-HNNXBMFYSA-N 0.000 description 1
- BITHHVVYSMSWAG-KTKRTIGZSA-N (11Z)-icos-11-enoic acid Chemical compound CCCCCCCC\C=C/CCCCCCCCCC(O)=O BITHHVVYSMSWAG-KTKRTIGZSA-N 0.000 description 1
- XSXIVVZCUAHUJO-AVQMFFATSA-N (11e,14e)-icosa-11,14-dienoic acid Chemical compound CCCCC\C=C\C\C=C\CCCCCCCCCC(O)=O XSXIVVZCUAHUJO-AVQMFFATSA-N 0.000 description 1
- GEHPRJRWZDWFBJ-FOCLMDBBSA-N (2E)-2-heptadecenoic acid Chemical compound CCCCCCCCCCCCCC\C=C\C(O)=O GEHPRJRWZDWFBJ-FOCLMDBBSA-N 0.000 description 1
- LGHXTTIAZFVCCU-SSVNFBSYSA-N (2E,4E,6E,8E)-octadeca-2,4,6,8-tetraenoic acid Chemical compound CCCCCCCCC\C=C\C=C\C=C\C=C\C(O)=O LGHXTTIAZFVCCU-SSVNFBSYSA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- XBNDESPXQUOOBQ-LSMLZNGOSA-N (2r,3s)-4-[[(2s)-1-[[2-[[(2s)-1-[[2-[[(2r,3s)-1-[[(2s)-1-[(2s)-2-[[(1s)-1-[(3s,9ar)-1,4-dioxo-3,6,7,8,9,9a-hexahydro-2h-pyrido[1,2-a]pyrazin-3-yl]ethyl]carbamoyl]pyrrolidin-1-yl]-3-methyl-1-oxobutan-2-yl]amino]-3-amino-1-oxobutan-2-yl]amino]-2-oxoethyl]am Chemical compound CCC(C)CCCCC\C=C\CC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)C(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@H]([C@H](C)N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)[C@H]1C(=O)N2CCCC[C@@H]2C(=O)N1 XBNDESPXQUOOBQ-LSMLZNGOSA-N 0.000 description 1
- RDJGLLICXDHJDY-NSHDSACASA-N (2s)-2-(3-phenoxyphenyl)propanoic acid Chemical compound OC(=O)[C@@H](C)C1=CC=CC(OC=2C=CC=CC=2)=C1 RDJGLLICXDHJDY-NSHDSACASA-N 0.000 description 1
- AHOKKYCUWBLDST-QYULHYBRSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s,3s)-2-[[(2s)-2,6-diaminohexanoyl]amino]-3-methylpentanoyl]amino]-3-phenylpropanoyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]-4-methylpentanoyl]amino]propanoyl]amino]-3-phenylpropanoyl]amino Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)[C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=CC=C1 AHOKKYCUWBLDST-QYULHYBRSA-N 0.000 description 1
- FLWWDYNPWOSLEO-HQVZTVAUSA-N (2s)-2-[[4-[1-(2-amino-4-oxo-1h-pteridin-6-yl)ethyl-methylamino]benzoyl]amino]pentanedioic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1C(C)N(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FLWWDYNPWOSLEO-HQVZTVAUSA-N 0.000 description 1
- JPSHPWJJSVEEAX-OWPBQMJCSA-N (2s)-2-amino-4-fluoranylpentanedioic acid Chemical compound OC(=O)[C@@H](N)CC([18F])C(O)=O JPSHPWJJSVEEAX-OWPBQMJCSA-N 0.000 description 1
- OEDPHAKKZGDBEV-GFPBKZJXSA-N (2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-2-[[(2r)-3-[2,3-di(hexadecanoyloxy)propylsulfanyl]-2-(hexadecanoylamino)propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]hexanoyl]amino]hexanoyl]amino]hexanoic acid Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)CCCCCCCCCCCCCCC)CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC OEDPHAKKZGDBEV-GFPBKZJXSA-N 0.000 description 1
- FVVCFHXLWDDRHG-UPLOTWCNSA-N (2s,3r,4s,5r,6r)-2-[(2r,3s,4r,5r,6r)-6-[(2s,3s,4s,5r)-3,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-2-yl]oxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)[C@@H](CO)O1 FVVCFHXLWDDRHG-UPLOTWCNSA-N 0.000 description 1
- FYGDTMLNYKFZSV-URKRLVJHSA-N (2s,3r,4s,5s,6r)-2-[(2r,4r,5r,6s)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2r,4r,5r,6s)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1[C@@H](CO)O[C@@H](OC2[C@H](O[C@H](O)[C@H](O)[C@H]2O)CO)[C@H](O)[C@H]1O FYGDTMLNYKFZSV-URKRLVJHSA-N 0.000 description 1
- CGMTUJFWROPELF-YPAAEMCBSA-N (3E,5S)-5-[(2S)-butan-2-yl]-3-(1-hydroxyethylidene)pyrrolidine-2,4-dione Chemical compound CC[C@H](C)[C@@H]1NC(=O)\C(=C(/C)O)C1=O CGMTUJFWROPELF-YPAAEMCBSA-N 0.000 description 1
- VCOPTHOUUNAYKQ-WBTCAYNUSA-N (3s)-3,6-diamino-n-[[(2s,5s,8e,11s,15s)-15-amino-11-[(6r)-2-amino-1,4,5,6-tetrahydropyrimidin-6-yl]-8-[(carbamoylamino)methylidene]-2-(hydroxymethyl)-3,6,9,12,16-pentaoxo-1,4,7,10,13-pentazacyclohexadec-5-yl]methyl]hexanamide;(3s)-3,6-diamino-n-[[(2s,5s,8 Chemical compound N1C(=O)\C(=C/NC(N)=O)NC(=O)[C@H](CNC(=O)C[C@@H](N)CCCN)NC(=O)[C@H](C)NC(=O)[C@@H](N)CNC(=O)[C@@H]1[C@@H]1NC(N)=NCC1.N1C(=O)\C(=C/NC(N)=O)NC(=O)[C@H](CNC(=O)C[C@@H](N)CCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CNC(=O)[C@@H]1[C@@H]1NC(N)=NCC1 VCOPTHOUUNAYKQ-WBTCAYNUSA-N 0.000 description 1
- TVIRNGFXQVMMGB-OFWIHYRESA-N (3s,6r,10r,13e,16s)-16-[(2r,3r,4s)-4-chloro-3-hydroxy-4-phenylbutan-2-yl]-10-[(3-chloro-4-methoxyphenyl)methyl]-6-methyl-3-(2-methylpropyl)-1,4-dioxa-8,11-diazacyclohexadec-13-ene-2,5,9,12-tetrone Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H](O)[C@@H](Cl)C=2C=CC=CC=2)C/C=C/C(=O)N1 TVIRNGFXQVMMGB-OFWIHYRESA-N 0.000 description 1
- YQYGGOPUTPQHAY-KIQLFZLRSA-N (4S)-4-[[(2S)-2-[[(2S)-2-[2-[6-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-5-amino-1-[[(4S,7R)-7-[[(2S)-1-[(2S)-6-amino-2-[[(2R)-2-[[(2S)-5-amino-2-[[(2S,3R)-2-[[(2S)-6-amino-2-[[(2S)-4-carboxy-2-hydrazinylbutanoyl]amino]hexanoyl]amino]-3-methylpentanoyl]amino]-5-oxopentanoyl]amino]propanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-2-methyl-5,6-dioxooctan-4-yl]amino]-1,5-dioxopentan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-4-amino-2-[[(2S)-2-amino-3-hydroxypropanoyl]amino]-4-oxobutanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropanoyl]amino]-4-carboxybutanoyl]amino]-3-hydroxypropanoyl]amino]-3-phenylpropanoyl]amino]-6-oxohexyl]hydrazinyl]-3-phenylpropanoyl]amino]-3-hydroxypropanoyl]amino]-5-[[(2S)-1-[[(2S,3S)-1-[[(2S)-4-amino-1-[[(2S)-1-hydroxy-3-oxopropan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-5-oxopentanoic acid Chemical compound CC[C@@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(O)=O)NN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@H](C)C(=O)C(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1ccccc1)NC(=O)C(CCCCNN[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CO)[C@H](C)O)C(C)C)[C@H](C)O YQYGGOPUTPQHAY-KIQLFZLRSA-N 0.000 description 1
- NMWKYTGJWUAZPZ-WWHBDHEGSA-N (4S)-4-[[(4R,7S,10S,16S,19S,25S,28S,31R)-31-[[(2S)-2-[[(1R,6R,9S,12S,18S,21S,24S,27S,30S,33S,36S,39S,42R,47R,53S,56S,59S,62S,65S,68S,71S,76S,79S,85S)-47-[[(2S)-2-[[(2S)-4-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-methylbutanoyl]amino]-3-methylbutanoyl]amino]-3-hydroxypropanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-3-phenylpropanoyl]amino]-4-oxobutanoyl]amino]-3-carboxypropanoyl]amino]-18-(4-aminobutyl)-27,68-bis(3-amino-3-oxopropyl)-36,71,76-tribenzyl-39-(3-carbamimidamidopropyl)-24-(2-carboxyethyl)-21,56-bis(carboxymethyl)-65,85-bis[(1R)-1-hydroxyethyl]-59-(hydroxymethyl)-62,79-bis(1H-imidazol-4-ylmethyl)-9-methyl-33-(2-methylpropyl)-8,11,17,20,23,26,29,32,35,38,41,48,54,57,60,63,66,69,72,74,77,80,83,86-tetracosaoxo-30-propan-2-yl-3,4,44,45-tetrathia-7,10,16,19,22,25,28,31,34,37,40,49,55,58,61,64,67,70,73,75,78,81,84,87-tetracosazatetracyclo[40.31.14.012,16.049,53]heptaoctacontane-6-carbonyl]amino]-3-methylbutanoyl]amino]-7-(3-carbamimidamidopropyl)-25-(hydroxymethyl)-19-[(4-hydroxyphenyl)methyl]-28-(1H-imidazol-4-ylmethyl)-10-methyl-6,9,12,15,18,21,24,27,30-nonaoxo-16-propan-2-yl-1,2-dithia-5,8,11,14,17,20,23,26,29-nonazacyclodotriacontane-4-carbonyl]amino]-5-[[(2S)-1-[[(2S)-1-[[(2S)-3-carboxy-1-[[(2S)-1-[[(2S)-1-[[(1S)-1-carboxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-5-oxopentanoic acid Chemical compound CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](Cc4ccccc4)NC3=O)[C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc3ccccc3)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N3CCC[C@H]3C(=O)N[C@@H](C)C(=O)N2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)[C@@H](C)O)C(C)C)C(=O)N[C@@H](Cc2c[nH]cn2)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1)C(=O)N[C@@H](C)C(O)=O NMWKYTGJWUAZPZ-WWHBDHEGSA-N 0.000 description 1
- NSOITZIGPJTCMQ-KCXFZFQESA-N (4r,7s,10s,13s,16s,19s,22r)-22-[[(2s,3s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-1-[(2s)-2-[[(2s,3s)-2-[[(2s)-6-amino-2-[[(2s,3s)-2-[[(2s)-2-[[2-[[2-[[(2s)-2-[[(2s)-2-amino-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]acetyl]amino]acetyl]amino]-4-methylpentanoyl]a Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]1C(N[C@@H](C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CSSC1)C(O)=O)[C@@H](C)O)C(C)C)=O)C1=CC=CC=C1 NSOITZIGPJTCMQ-KCXFZFQESA-N 0.000 description 1
- SOVUOXKZCCAWOJ-HJYUBDRYSA-N (4s,4as,5ar,12ar)-9-[[2-(tert-butylamino)acetyl]amino]-4,7-bis(dimethylamino)-1,10,11,12a-tetrahydroxy-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1C2=C(N(C)C)C=C(NC(=O)CNC(C)(C)C)C(O)=C2C(O)=C2[C@@H]1C[C@H]1[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]1(O)C2=O SOVUOXKZCCAWOJ-HJYUBDRYSA-N 0.000 description 1
- GUXHBMASAHGULD-SEYHBJAFSA-N (4s,4as,5as,6s,12ar)-7-chloro-4-(dimethylamino)-1,6,10,11,12a-pentahydroxy-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1([C@H]2O)=C(Cl)C=CC(O)=C1C(O)=C1[C@@H]2C[C@H]2[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]2(O)C1=O GUXHBMASAHGULD-SEYHBJAFSA-N 0.000 description 1
- HBUJYEUPIIJJOS-PBHICJAKSA-N (5r)-3-[4-[1-[(2s)-2,3-dihydroxypropanoyl]-3,6-dihydro-2h-pyridin-4-yl]-3,5-difluorophenyl]-5-(1,2-oxazol-3-yloxymethyl)-1,3-oxazolidin-2-one Chemical compound C1N(C(=O)[C@@H](O)CO)CCC(C=2C(=CC(=CC=2F)N2C(O[C@@H](COC3=NOC=C3)C2)=O)F)=C1 HBUJYEUPIIJJOS-PBHICJAKSA-N 0.000 description 1
- XRBSKUSTLXISAB-XVVDYKMHSA-N (5r,6r,7r,8r)-8-hydroxy-7-(hydroxymethyl)-5-(3,4,5-trimethoxyphenyl)-5,6,7,8-tetrahydrobenzo[f][1,3]benzodioxole-6-carboxylic acid Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@H](O)[C@@H](CO)[C@@H]2C(O)=O)=C1 XRBSKUSTLXISAB-XVVDYKMHSA-N 0.000 description 1
- WDLWHQDACQUCJR-ZAMMOSSLSA-N (6r,7r)-7-[[(2r)-2-azaniumyl-2-(4-hydroxyphenyl)acetyl]amino]-8-oxo-3-[(e)-prop-1-enyl]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)/C=C/C)C(O)=O)=CC=C(O)C=C1 WDLWHQDACQUCJR-ZAMMOSSLSA-N 0.000 description 1
- XRBSKUSTLXISAB-UHFFFAOYSA-N (7R,7'R,8R,8'R)-form-Podophyllic acid Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C(CO)C2C(O)=O)=C1 XRBSKUSTLXISAB-UHFFFAOYSA-N 0.000 description 1
- AESVUZLWRXEGEX-DKCAWCKPSA-N (7S,9R)-7-[(2S,4R,5R,6R)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7H-tetracene-5,12-dione iron(3+) Chemical compound [Fe+3].COc1cccc2C(=O)c3c(O)c4C[C@@](O)(C[C@H](O[C@@H]5C[C@@H](N)[C@@H](O)[C@@H](C)O5)c4c(O)c3C(=O)c12)C(=O)CO AESVUZLWRXEGEX-DKCAWCKPSA-N 0.000 description 1
- YUFFSWGQGVEMMI-JLNKQSITSA-N (7Z,10Z,13Z,16Z,19Z)-docosapentaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCCCCC(O)=O YUFFSWGQGVEMMI-JLNKQSITSA-N 0.000 description 1
- JXVAMODRWBNUSF-KZQKBALLSA-N (7s,9r,10r)-7-[(2r,4s,5s,6s)-5-[[(2s,4as,5as,7s,9s,9ar,10ar)-2,9-dimethyl-3-oxo-4,4a,5a,6,7,9,9a,10a-octahydrodipyrano[4,2-a:4',3'-e][1,4]dioxin-7-yl]oxy]-4-(dimethylamino)-6-methyloxan-2-yl]oxy-10-[(2s,4s,5s,6s)-4-(dimethylamino)-5-hydroxy-6-methyloxan-2 Chemical compound O([C@@H]1C2=C(O)C=3C(=O)C4=CC=CC(O)=C4C(=O)C=3C(O)=C2[C@@H](O[C@@H]2O[C@@H](C)[C@@H](O[C@@H]3O[C@@H](C)[C@H]4O[C@@H]5O[C@@H](C)C(=O)C[C@@H]5O[C@H]4C3)[C@H](C2)N(C)C)C[C@]1(O)CC)[C@H]1C[C@H](N(C)C)[C@H](O)[C@H](C)O1 JXVAMODRWBNUSF-KZQKBALLSA-N 0.000 description 1
- INAUWOVKEZHHDM-PEDBPRJASA-N (7s,9s)-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-7-[(2r,4s,5s,6s)-5-hydroxy-6-methyl-4-morpholin-4-yloxan-2-yl]oxy-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1 INAUWOVKEZHHDM-PEDBPRJASA-N 0.000 description 1
- RCFNNLSZHVHCEK-IMHLAKCZSA-N (7s,9s)-7-(4-amino-6-methyloxan-2-yl)oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound [Cl-].O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)C1CC([NH3+])CC(C)O1 RCFNNLSZHVHCEK-IMHLAKCZSA-N 0.000 description 1
- NOPNWHSMQOXAEI-PUCKCBAPSA-N (7s,9s)-7-[(2r,4s,5s,6s)-4-(2,3-dihydropyrrol-1-yl)-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCC=C1 NOPNWHSMQOXAEI-PUCKCBAPSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- MINDHVHHQZYEEK-UHFFFAOYSA-N (E)-(2S,3R,4R,5S)-5-[(2S,3S,4S,5S)-2,3-epoxy-5-hydroxy-4-methylhexyl]tetrahydro-3,4-dihydroxy-(beta)-methyl-2H-pyran-2-crotonic acid ester with 9-hydroxynonanoic acid Natural products CC(O)C(C)C1OC1CC1C(O)C(O)C(CC(C)=CC(=O)OCCCCCCCCC(O)=O)OC1 MINDHVHHQZYEEK-UHFFFAOYSA-N 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- RXZBMPWDPOLZGW-XMRMVWPWSA-N (E)-roxithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=N/OCOCCOC)/[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 RXZBMPWDPOLZGW-XMRMVWPWSA-N 0.000 description 1
- UCTWMZQNUQWSLP-VIFPVBQESA-N (R)-adrenaline Chemical compound CNC[C@H](O)C1=CC=C(O)C(O)=C1 UCTWMZQNUQWSLP-VIFPVBQESA-N 0.000 description 1
- 229930182837 (R)-adrenaline Natural products 0.000 description 1
- QKDHBVNJCZBTMR-LLVKDONJSA-N (R)-temafloxacin Chemical compound C1CN[C@H](C)CN1C(C(=C1)F)=CC2=C1C(=O)C(C(O)=O)=CN2C1=CC=C(F)C=C1F QKDHBVNJCZBTMR-LLVKDONJSA-N 0.000 description 1
- TVYLLZQTGLZFBW-ZBFHGGJFSA-N (R,R)-tramadol Chemical compound COC1=CC=CC([C@]2(O)[C@H](CCCC2)CN(C)C)=C1 TVYLLZQTGLZFBW-ZBFHGGJFSA-N 0.000 description 1
- WHTVZRBIWZFKQO-AWEZNQCLSA-N (S)-chloroquine Chemical compound ClC1=CC=C2C(N[C@@H](C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-AWEZNQCLSA-N 0.000 description 1
- XUBOMFCQGDBHNK-JTQLQIEISA-N (S)-gatifloxacin Chemical compound FC1=CC(C(C(C(O)=O)=CN2C3CC3)=O)=C2C(OC)=C1N1CCN[C@@H](C)C1 XUBOMFCQGDBHNK-JTQLQIEISA-N 0.000 description 1
- AGNGYMCLFWQVGX-AGFFZDDWSA-N (e)-1-[(2s)-2-amino-2-carboxyethoxy]-2-diazonioethenolate Chemical compound OC(=O)[C@@H](N)CO\C([O-])=C\[N+]#N AGNGYMCLFWQVGX-AGFFZDDWSA-N 0.000 description 1
- ATNNLHXCRAAGJS-QZQOTICOSA-N (e)-docos-2-enoic acid Chemical compound CCCCCCCCCCCCCCCCCCC\C=C\C(O)=O ATNNLHXCRAAGJS-QZQOTICOSA-N 0.000 description 1
- NCCJWSXETVVUHK-ZYSAIPPVSA-N (z)-7-[(2r)-2-amino-2-carboxyethyl]sulfanyl-2-[[(1s)-2,2-dimethylcyclopropanecarbonyl]amino]hept-2-enoic acid;(5r,6s)-3-[2-(aminomethylideneamino)ethylsulfanyl]-6-[(1r)-1-hydroxyethyl]-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic acid Chemical compound C1C(SCC\N=C/N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21.CC1(C)C[C@@H]1C(=O)N\C(=C/CCCCSC[C@H](N)C(O)=O)C(O)=O NCCJWSXETVVUHK-ZYSAIPPVSA-N 0.000 description 1
- FONKWHRXTPJODV-DNQXCXABSA-N 1,3-bis[2-[(8s)-8-(chloromethyl)-4-hydroxy-1-methyl-7,8-dihydro-3h-pyrrolo[3,2-e]indole-6-carbonyl]-1h-indol-5-yl]urea Chemical compound C1([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C4=CC(O)=C5NC=C(C5=C4[C@H](CCl)C3)C)=C2C=C(O)C2=C1C(C)=CN2 FONKWHRXTPJODV-DNQXCXABSA-N 0.000 description 1
- VQFKFAKEUMHBLV-BYSUZVQFSA-N 1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCC(=O)N[C@H]([C@H](O)[C@H](O)CCCCCCCCCCCCCC)CO[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQFKFAKEUMHBLV-BYSUZVQFSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 1
- FPIPGXGPPPQFEQ-UHFFFAOYSA-N 13-cis retinol Natural products OCC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-UHFFFAOYSA-N 0.000 description 1
- 108020004463 18S ribosomal RNA Proteins 0.000 description 1
- BTOTXLJHDSNXMW-POYBYMJQSA-N 2,3-dideoxyuridine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(=O)NC(=O)C=C1 BTOTXLJHDSNXMW-POYBYMJQSA-N 0.000 description 1
- BOMZMNZEXMAQQW-UHFFFAOYSA-N 2,5,11-trimethyl-6h-pyrido[4,3-b]carbazol-2-ium-9-ol;acetate Chemical compound CC([O-])=O.C[N+]1=CC=C2C(C)=C(NC=3C4=CC(O)=CC=3)C4=C(C)C2=C1 BOMZMNZEXMAQQW-UHFFFAOYSA-N 0.000 description 1
- VKUYLANQOAKALN-UHFFFAOYSA-N 2-[benzyl-(4-methoxyphenyl)sulfonylamino]-n-hydroxy-4-methylpentanamide Chemical compound C1=CC(OC)=CC=C1S(=O)(=O)N(C(CC(C)C)C(=O)NO)CC1=CC=CC=C1 VKUYLANQOAKALN-UHFFFAOYSA-N 0.000 description 1
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 1
- QCXJFISCRQIYID-IAEPZHFASA-N 2-amino-1-n-[(3s,6s,7r,10s,16s)-3-[(2s)-butan-2-yl]-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-10-propan-2-yl-8-oxa-1,4,11,14-tetrazabicyclo[14.3.0]nonadecan-6-yl]-4,6-dimethyl-3-oxo-9-n-[(3s,6s,7r,10s,16s)-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-3,10-di(propa Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N=C2C(C(=O)N[C@@H]3C(=O)N[C@H](C(N4CCC[C@H]4C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]3C)=O)[C@@H](C)CC)=C(N)C(=O)C(C)=C2O2)C2=C(C)C=C1 QCXJFISCRQIYID-IAEPZHFASA-N 0.000 description 1
- FDAYLTPAFBGXAB-UHFFFAOYSA-N 2-chloro-n,n-bis(2-chloroethyl)ethanamine Chemical compound ClCCN(CCCl)CCCl FDAYLTPAFBGXAB-UHFFFAOYSA-N 0.000 description 1
- VNBAOSVONFJBKP-UHFFFAOYSA-N 2-chloro-n,n-bis(2-chloroethyl)propan-1-amine;hydrochloride Chemical compound Cl.CC(Cl)CN(CCCl)CCCl VNBAOSVONFJBKP-UHFFFAOYSA-N 0.000 description 1
- TWJNQYPJQDRXPH-UHFFFAOYSA-N 2-cyanobenzohydrazide Chemical compound NNC(=O)C1=CC=CC=C1C#N TWJNQYPJQDRXPH-UHFFFAOYSA-N 0.000 description 1
- ASJSAQIRZKANQN-CRCLSJGQSA-N 2-deoxy-D-ribose Chemical compound OC[C@@H](O)[C@@H](O)CC=O ASJSAQIRZKANQN-CRCLSJGQSA-N 0.000 description 1
- VNDWQCSOSCCWIP-UHFFFAOYSA-N 2-tert-butyl-9-fluoro-1,6-dihydrobenzo[h]imidazo[4,5-f]isoquinolin-7-one Chemical compound C1=2C=CNC(=O)C=2C2=CC(F)=CC=C2C2=C1NC(C(C)(C)C)=N2 VNDWQCSOSCCWIP-UHFFFAOYSA-N 0.000 description 1
- YIMDLWDNDGKDTJ-QLKYHASDSA-N 3'-deamino-3'-(3-cyanomorpholin-4-yl)doxorubicin Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1C#N YIMDLWDNDGKDTJ-QLKYHASDSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- PWMYMKOUNYTVQN-UHFFFAOYSA-N 3-(8,8-diethyl-2-aza-8-germaspiro[4.5]decan-2-yl)-n,n-dimethylpropan-1-amine Chemical compound C1C[Ge](CC)(CC)CCC11CN(CCCN(C)C)CC1 PWMYMKOUNYTVQN-UHFFFAOYSA-N 0.000 description 1
- AKXKFZDCRYJKTF-UHFFFAOYSA-N 3-Hydroxypropionaldehyde Chemical compound OCCC=O AKXKFZDCRYJKTF-UHFFFAOYSA-N 0.000 description 1
- NLJVXZFCYKWXLH-DXTIXLATSA-N 3-[(3r,6s,9s,12s,15s,17s,20s,22r,25s,28s)-20-(2-amino-2-oxoethyl)-9-(3-aminopropyl)-3,22,25-tribenzyl-15-[(4-hydroxyphenyl)methyl]-6-(2-methylpropyl)-2,5,8,11,14,18,21,24,27-nonaoxo-12-propan-2-yl-1,4,7,10,13,16,19,23,26-nonazabicyclo[26.3.0]hentriacontan Chemical compound C([C@H]1C(=O)N[C@H](C(=O)N[C@@H](CCCN)C(=O)N[C@H](C(N[C@H](CC=2C=CC=CC=2)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](CC=2C=CC=CC=2)C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)N1)=O)CC(C)C)C(C)C)C1=CC=C(O)C=C1 NLJVXZFCYKWXLH-DXTIXLATSA-N 0.000 description 1
- YYGZHVJDHMMABU-OGLMXYFKSA-N 3-methyl-5-[(e)-1-(4-methylsulfonylphenyl)-2-[3-[6-(2-methylsulfonylpropan-2-yl)quinolin-8-yl]phenyl]ethenyl]-1,2,4-oxadiazole Chemical compound CC1=NOC(C(=C\C=2C=C(C=CC=2)C=2C3=NC=CC=C3C=C(C=2)C(C)(C)S(C)(=O)=O)\C=2C=CC(=CC=2)S(C)(=O)=O)=N1 YYGZHVJDHMMABU-OGLMXYFKSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- 101710166488 6 kDa early secretory antigenic target Proteins 0.000 description 1
- PVXPPJIGRGXGCY-DJHAAKORSA-N 6-O-alpha-D-glucopyranosyl-alpha-D-fructofuranose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@](O)(CO)O1 PVXPPJIGRGXGCY-DJHAAKORSA-N 0.000 description 1
- KKYABQBFGDZVNQ-UHFFFAOYSA-N 6-[5-[(cyclopropylamino)-oxomethyl]-3-fluoro-2-methylphenyl]-N-(2,2-dimethylpropyl)-3-pyridinecarboxamide Chemical compound CC1=C(F)C=C(C(=O)NC2CC2)C=C1C1=CC=C(C(=O)NCC(C)(C)C)C=N1 KKYABQBFGDZVNQ-UHFFFAOYSA-N 0.000 description 1
- WYXSYVWAUAUWLD-SHUUEZRQSA-N 6-azauridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=N1 WYXSYVWAUAUWLD-SHUUEZRQSA-N 0.000 description 1
- 229960005538 6-diazo-5-oxo-L-norleucine Drugs 0.000 description 1
- YCWQAMGASJSUIP-YFKPBYRVSA-N 6-diazo-5-oxo-L-norleucine Chemical compound OC(=O)[C@@H](N)CCC(=O)C=[N+]=[N-] YCWQAMGASJSUIP-YFKPBYRVSA-N 0.000 description 1
- SDDSJMXGJNWMJY-BRHAQHMBSA-N 7-[(2r,4ar,5r,7ar)-2-[(3s)-1,1-difluoro-3-methylpentyl]-2-hydroxy-6-oxo-3,4,4a,5,7,7a-hexahydrocyclopenta[b]pyran-5-yl]heptanoic acid Chemical compound O1[C@](C(F)(F)C[C@@H](C)CC)(O)CC[C@@H]2[C@@H](CCCCCCC(O)=O)C(=O)C[C@H]21 SDDSJMXGJNWMJY-BRHAQHMBSA-N 0.000 description 1
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- GSDSWSVVBLHKDQ-UHFFFAOYSA-N 9-fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-2,3-dihydro-7H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid Chemical compound FC1=CC(C(C(C(O)=O)=C2)=O)=C3N2C(C)COC3=C1N1CCN(C)CC1 GSDSWSVVBLHKDQ-UHFFFAOYSA-N 0.000 description 1
- HDZZVAMISRMYHH-UHFFFAOYSA-N 9beta-Ribofuranosyl-7-deazaadenin Natural products C1=CC=2C(N)=NC=NC=2N1C1OC(CO)C(O)C1O HDZZVAMISRMYHH-UHFFFAOYSA-N 0.000 description 1
- 108030001751 ADAM 17 endopeptidases Proteins 0.000 description 1
- 102100033793 ALK tyrosine kinase receptor Human genes 0.000 description 1
- 101150054149 ANGPTL4 gene Proteins 0.000 description 1
- 108091006112 ATPases Proteins 0.000 description 1
- 208000004998 Abdominal Pain Diseases 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 108010042708 Acetylmuramyl-Alanyl-Isoglutamine Proteins 0.000 description 1
- 241000909284 Acidaminococcaceae Species 0.000 description 1
- 102100033408 Acidic leucine-rich nuclear phosphoprotein 32 family member B Human genes 0.000 description 1
- 101710170753 Acidic leucine-rich nuclear phosphoprotein 32 family member B Proteins 0.000 description 1
- 208000002874 Acne Vulgaris Diseases 0.000 description 1
- 229920002126 Acrylic acid copolymer Polymers 0.000 description 1
- 241000544634 Actinomyces graevenitzii Species 0.000 description 1
- 241000186066 Actinomyces odontolyticus Species 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 108010075348 Activated-Leukocyte Cell Adhesion Molecule Proteins 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 1
- 208000004804 Adenomatous Polyps Diseases 0.000 description 1
- 102000057290 Adenosine Triphosphatases Human genes 0.000 description 1
- 102100026423 Adhesion G protein-coupled receptor E5 Human genes 0.000 description 1
- 102000054930 Agouti-Related Human genes 0.000 description 1
- 101710127426 Agouti-related protein Proteins 0.000 description 1
- 201000010000 Agranulocytosis Diseases 0.000 description 1
- 241000702462 Akkermansia muciniphila Species 0.000 description 1
- 102100027211 Albumin Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- PQSUYGKTWSAVDQ-ZVIOFETBSA-N Aldosterone Chemical compound C([C@@]1([C@@H](C(=O)CO)CC[C@H]1[C@@H]1CC2)C=O)[C@H](O)[C@@H]1[C@]1(C)C2=CC(=O)CC1 PQSUYGKTWSAVDQ-ZVIOFETBSA-N 0.000 description 1
- PQSUYGKTWSAVDQ-UHFFFAOYSA-N Aldosterone Natural products C1CC2C3CCC(C(=O)CO)C3(C=O)CC(O)C2C2(C)C1=CC(=O)CC2 PQSUYGKTWSAVDQ-UHFFFAOYSA-N 0.000 description 1
- 241001135230 Alistipes putredinis Species 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 208000012791 Alpha-heavy chain disease Diseases 0.000 description 1
- CEIZFXOZIQNICU-UHFFFAOYSA-N Alternaria alternata Crofton-weed toxin Natural products CCC(C)C1NC(=O)C(C(C)=O)=C1O CEIZFXOZIQNICU-UHFFFAOYSA-N 0.000 description 1
- 239000005995 Aluminium silicate Substances 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 206010001935 American trypanosomiasis Diseases 0.000 description 1
- 208000000044 Amnesia Diseases 0.000 description 1
- 206010060937 Amniotic cavity infection Diseases 0.000 description 1
- 229920000945 Amylopectin Polymers 0.000 description 1
- 241001584951 Anaerostipes hadrus Species 0.000 description 1
- 206010002198 Anaphylactic reaction Diseases 0.000 description 1
- 102100034594 Angiopoietin-1 Human genes 0.000 description 1
- 108010048154 Angiopoietin-1 Proteins 0.000 description 1
- 102100034608 Angiopoietin-2 Human genes 0.000 description 1
- 108010048036 Angiopoietin-2 Proteins 0.000 description 1
- 102100033402 Angiopoietin-4 Human genes 0.000 description 1
- 108700042530 Angiopoietin-Like Protein 4 Proteins 0.000 description 1
- 201000003076 Angiosarcoma Diseases 0.000 description 1
- 102400000068 Angiostatin Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- WZPBZJONDBGPKJ-UHFFFAOYSA-N Antibiotic SQ 26917 Natural products O=C1N(S(O)(=O)=O)C(C)C1NC(=O)C(=NOC(C)(C)C(O)=O)C1=CSC(N)=N1 WZPBZJONDBGPKJ-UHFFFAOYSA-N 0.000 description 1
- 101710145634 Antigen 1 Proteins 0.000 description 1
- 108090000084 Antiporters Proteins 0.000 description 1
- 102000003669 Antiporters Human genes 0.000 description 1
- 208000019901 Anxiety disease Diseases 0.000 description 1
- 208000032467 Aplastic anaemia Diseases 0.000 description 1
- 102100040197 Apolipoprotein A-V Human genes 0.000 description 1
- 108010061118 Apolipoprotein A-V Proteins 0.000 description 1
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 1
- 206010003011 Appendicitis Diseases 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 206010065869 Astrocytoma, low grade Diseases 0.000 description 1
- 206010003591 Ataxia Diseases 0.000 description 1
- 108010078286 Ataxins Proteins 0.000 description 1
- 102000014461 Ataxins Human genes 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 208000023345 Autoimmune Diseases of the Nervous System Diseases 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 206010003840 Autonomic nervous system imbalance Diseases 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- 208000037157 Azotemia Diseases 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 1
- 108010074708 B7-H1 Antigen Proteins 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 241000606125 Bacteroides Species 0.000 description 1
- 241000217846 Bacteroides caccae Species 0.000 description 1
- 241000606124 Bacteroides fragilis Species 0.000 description 1
- 241000606123 Bacteroides thetaiotaomicron Species 0.000 description 1
- 101710172654 Basal cell adhesion molecule Proteins 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 108010081589 Becaplermin Proteins 0.000 description 1
- 235000021357 Behenic acid Nutrition 0.000 description 1
- 208000035821 Benign schwannoma Diseases 0.000 description 1
- VGGGPCQERPFHOB-MCIONIFRSA-N Bestatin Chemical compound CC(C)C[C@H](C(O)=O)NC(=O)[C@@H](O)[C@H](N)CC1=CC=CC=C1 VGGGPCQERPFHOB-MCIONIFRSA-N 0.000 description 1
- 229920002498 Beta-glucan Polymers 0.000 description 1
- 102100022548 Beta-hexosaminidase subunit alpha Human genes 0.000 description 1
- 241000186018 Bifidobacterium adolescentis Species 0.000 description 1
- 241000186016 Bifidobacterium bifidum Species 0.000 description 1
- 241001495172 Bilophila wadsworthia Species 0.000 description 1
- 229940122361 Bisphosphonate Drugs 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 206010005152 Blepharochalasis Diseases 0.000 description 1
- 206010065553 Bone marrow failure Diseases 0.000 description 1
- 206010006002 Bone pain Diseases 0.000 description 1
- 241000589968 Borrelia Species 0.000 description 1
- DPUOLQHDNGRHBS-UHFFFAOYSA-N Brassidinsaeure Natural products CCCCCCCCC=CCCCCCCCCCCCC(O)=O DPUOLQHDNGRHBS-UHFFFAOYSA-N 0.000 description 1
- 208000007690 Brenner tumor Diseases 0.000 description 1
- 206010073258 Brenner tumour Diseases 0.000 description 1
- 208000003170 Bronchiolo-Alveolar Adenocarcinoma Diseases 0.000 description 1
- MBABCNBNDNGODA-LTGLSHGVSA-N Bullatacin Natural products O=C1C(C[C@H](O)CCCCCCCCCC[C@@H](O)[C@@H]2O[C@@H]([C@@H]3O[C@H]([C@@H](O)CCCCCCCCCC)CC3)CC2)=C[C@H](C)O1 MBABCNBNDNGODA-LTGLSHGVSA-N 0.000 description 1
- KGGVWMAPBXIMEM-ZRTAFWODSA-N Bullatacinone Chemical compound O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@@H]1[C@@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@H]2OC(=O)[C@H](CC(C)=O)C2)CC1 KGGVWMAPBXIMEM-ZRTAFWODSA-N 0.000 description 1
- KGGVWMAPBXIMEM-JQFCFGFHSA-N Bullatacinone Natural products O=C(C[C@H]1C(=O)O[C@H](CCCCCCCCCC[C@H](O)[C@@H]2O[C@@H]([C@@H]3O[C@@H]([C@@H](O)CCCCCCCCCC)CC3)CC2)C1)C KGGVWMAPBXIMEM-JQFCFGFHSA-N 0.000 description 1
- 206010006811 Bursitis Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 241000605902 Butyrivibrio Species 0.000 description 1
- VZHHNDCSESIXJW-UHFFFAOYSA-N C(=CC(C)=C)OP(=O)(O)OP(=O)(O)O Chemical compound C(=CC(C)=C)OP(=O)(O)OP(=O)(O)O VZHHNDCSESIXJW-UHFFFAOYSA-N 0.000 description 1
- 102100023703 C-C motif chemokine 15 Human genes 0.000 description 1
- 102100023701 C-C motif chemokine 18 Human genes 0.000 description 1
- 102100036842 C-C motif chemokine 19 Human genes 0.000 description 1
- 101710112622 C-C motif chemokine 19 Proteins 0.000 description 1
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 1
- 102100036848 C-C motif chemokine 20 Human genes 0.000 description 1
- 102100036846 C-C motif chemokine 21 Human genes 0.000 description 1
- 101710112539 C-C motif chemokine 24 Proteins 0.000 description 1
- 101710112540 C-C motif chemokine 25 Proteins 0.000 description 1
- 101710112538 C-C motif chemokine 27 Proteins 0.000 description 1
- 102100031102 C-C motif chemokine 4 Human genes 0.000 description 1
- 101710155834 C-C motif chemokine 7 Proteins 0.000 description 1
- 101710155833 C-C motif chemokine 8 Proteins 0.000 description 1
- 102100025279 C-X-C motif chemokine 11 Human genes 0.000 description 1
- 101710098272 C-X-C motif chemokine 11 Proteins 0.000 description 1
- 101710098309 C-X-C motif chemokine 13 Proteins 0.000 description 1
- 101710085495 C-X-C motif chemokine 5 Proteins 0.000 description 1
- 101710085504 C-X-C motif chemokine 6 Proteins 0.000 description 1
- 101710085500 C-X-C motif chemokine 9 Proteins 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 101710137351 CCN family member 3 Proteins 0.000 description 1
- 101710164718 CD166 antigen Proteins 0.000 description 1
- 102100038078 CD276 antigen Human genes 0.000 description 1
- 101710185679 CD276 antigen Proteins 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 108091016585 CD44 antigen Proteins 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 101150004010 CXCR3 gene Proteins 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- 241000606208 Campylobacter gracilis Species 0.000 description 1
- 241000589875 Campylobacter jejuni Species 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 108010065839 Capreomycin Proteins 0.000 description 1
- 229930188120 Carbomycin Natural products 0.000 description 1
- SHHKQEUPHAENFK-UHFFFAOYSA-N Carboquone Chemical compound O=C1C(C)=C(N2CC2)C(=O)C(C(COC(N)=O)OC)=C1N1CC1 SHHKQEUPHAENFK-UHFFFAOYSA-N 0.000 description 1
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 description 1
- 206010007275 Carcinoid tumour Diseases 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 206010048610 Cardiotoxicity Diseases 0.000 description 1
- AOCCBINRVIKJHY-UHFFFAOYSA-N Carmofur Chemical compound CCCCCCNC(=O)N1C=C(F)C(=O)NC1=O AOCCBINRVIKJHY-UHFFFAOYSA-N 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 208000002177 Cataract Diseases 0.000 description 1
- 102400001321 Cathepsin L Human genes 0.000 description 1
- 108090000624 Cathepsin L Proteins 0.000 description 1
- 102100037182 Cation-independent mannose-6-phosphate receptor Human genes 0.000 description 1
- 101710145225 Cation-independent mannose-6-phosphate receptor Proteins 0.000 description 1
- 108050004290 Cecropin Proteins 0.000 description 1
- GNWUOVJNSFPWDD-XMZRARIVSA-M Cefoxitin sodium Chemical compound [Na+].N([C@]1(OC)C(N2C(=C(COC(N)=O)CS[C@@H]21)C([O-])=O)=O)C(=O)CC1=CC=CS1 GNWUOVJNSFPWDD-XMZRARIVSA-M 0.000 description 1
- 240000008886 Ceratonia siliqua Species 0.000 description 1
- 235000013912 Ceratonia siliqua Nutrition 0.000 description 1
- 206010008025 Cerebellar ataxia Diseases 0.000 description 1
- 108010075016 Ceruloplasmin Proteins 0.000 description 1
- 102100023321 Ceruloplasmin Human genes 0.000 description 1
- 229940124957 Cervarix Drugs 0.000 description 1
- 208000024699 Chagas disease Diseases 0.000 description 1
- 108010082548 Chemokine CCL11 Proteins 0.000 description 1
- 108010083702 Chemokine CCL21 Proteins 0.000 description 1
- 108010083701 Chemokine CCL22 Proteins 0.000 description 1
- 108010083647 Chemokine CCL24 Proteins 0.000 description 1
- 108010083698 Chemokine CCL26 Proteins 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 108010055124 Chemokine CCL7 Proteins 0.000 description 1
- 108010055204 Chemokine CCL8 Proteins 0.000 description 1
- 108010008951 Chemokine CXCL12 Proteins 0.000 description 1
- 108010014423 Chemokine CXCL6 Proteins 0.000 description 1
- GHOKWGTUZJEAQD-UHFFFAOYSA-N Chick antidermatitis factor Natural products OCC(C)(C)C(O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-UHFFFAOYSA-N 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- XCDXSSFOJZZGQC-UHFFFAOYSA-N Chlornaphazine Chemical compound C1=CC=CC2=CC(N(CCCl)CCCl)=CC=C21 XCDXSSFOJZZGQC-UHFFFAOYSA-N 0.000 description 1
- MKQWTWSXVILIKJ-LXGUWJNJSA-N Chlorozotocin Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](C=O)NC(=O)N(N=O)CCCl MKQWTWSXVILIKJ-LXGUWJNJSA-N 0.000 description 1
- 206010008609 Cholangitis sclerosing Diseases 0.000 description 1
- 206010008690 Chondrocalcinosis pyrophosphate Diseases 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 208000008158 Chorioamnionitis Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 108010062540 Chorionic Gonadotropin Proteins 0.000 description 1
- 102000011022 Chorionic Gonadotropin Human genes 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- 206010008874 Chronic Fatigue Syndrome Diseases 0.000 description 1
- 208000000668 Chronic Pancreatitis Diseases 0.000 description 1
- 206010009657 Clostridium difficile colitis Diseases 0.000 description 1
- 241000193464 Clostridium sp. Species 0.000 description 1
- 102000003780 Clusterin Human genes 0.000 description 1
- 108090000197 Clusterin Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 208000028698 Cognitive impairment Diseases 0.000 description 1
- 206010056979 Colitis microscopic Diseases 0.000 description 1
- 108050005238 Collagenase 3 Proteins 0.000 description 1
- 241001262170 Collinsella aerofaciens Species 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108010078546 Complement C5a Proteins 0.000 description 1
- 102000003706 Complement factor D Human genes 0.000 description 1
- 108090000059 Complement factor D Proteins 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- 206010010744 Conjunctivitis allergic Diseases 0.000 description 1
- 206010010774 Constipation Diseases 0.000 description 1
- 208000034656 Contusions Diseases 0.000 description 1
- 206010010904 Convulsion Diseases 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 241001464948 Coprococcus Species 0.000 description 1
- 102100031725 Cortactin-binding protein 2 Human genes 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 1
- 229930188224 Cryptophycin Natural products 0.000 description 1
- JPVYNHNXODAKFH-UHFFFAOYSA-N Cu2+ Chemical compound [Cu+2] JPVYNHNXODAKFH-UHFFFAOYSA-N 0.000 description 1
- 244000303965 Cyamopsis psoralioides Species 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- 102000012192 Cystatin C Human genes 0.000 description 1
- 108010061642 Cystatin C Proteins 0.000 description 1
- 102000005754 Cytokine Receptor gp130 Human genes 0.000 description 1
- 108010006197 Cytokine Receptor gp130 Proteins 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 description 1
- DYDCUQKUCUHJBH-UWTATZPHSA-N D-Cycloserine Chemical compound N[C@@H]1CONC1=O DYDCUQKUCUHJBH-UWTATZPHSA-N 0.000 description 1
- DYDCUQKUCUHJBH-UHFFFAOYSA-N D-Cycloserine Natural products NC1CONC1=O DYDCUQKUCUHJBH-UHFFFAOYSA-N 0.000 description 1
- AUNGANRZJHBGPY-UHFFFAOYSA-N D-Lyxoflavin Natural products OCC(O)C(O)C(O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-UHFFFAOYSA-N 0.000 description 1
- ZZZCUOFIHGPKAK-UHFFFAOYSA-N D-erythro-ascorbic acid Natural products OCC1OC(=O)C(O)=C1O ZZZCUOFIHGPKAK-UHFFFAOYSA-N 0.000 description 1
- VVNCNSJFMMFHPL-VKHMYHEASA-N D-penicillamine Chemical compound CC(C)(S)[C@@H](N)C(O)=O VVNCNSJFMMFHPL-VKHMYHEASA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 108010041052 DNA Topoisomerase IV Proteins 0.000 description 1
- 230000004543 DNA replication Effects 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 206010011841 Dacryoadenitis acquired Diseases 0.000 description 1
- 101100481408 Danio rerio tie2 gene Proteins 0.000 description 1
- MQJKPEGWNLWLTK-UHFFFAOYSA-N Dapsone Chemical compound C1=CC(N)=CC=C1S(=O)(=O)C1=CC=C(N)C=C1 MQJKPEGWNLWLTK-UHFFFAOYSA-N 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 206010011878 Deafness Diseases 0.000 description 1
- 108090000738 Decorin Proteins 0.000 description 1
- 206010051055 Deep vein thrombosis Diseases 0.000 description 1
- 108010002069 Defensins Proteins 0.000 description 1
- 102000000541 Defensins Human genes 0.000 description 1
- 208000005156 Dehydration Diseases 0.000 description 1
- 101710112750 Delta-like protein 1 Proteins 0.000 description 1
- NNJPGOLRFBJNIW-UHFFFAOYSA-N Demecolcine Natural products C1=C(OC)C(=O)C=C2C(NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-UHFFFAOYSA-N 0.000 description 1
- FMTDIUIBLCQGJB-UHFFFAOYSA-N Demethylchlortetracyclin Natural products C1C2C(O)C3=C(Cl)C=CC(O)=C3C(=O)C2=C(O)C2(O)C1C(N(C)C)C(O)=C(C(N)=O)C2=O FMTDIUIBLCQGJB-UHFFFAOYSA-N 0.000 description 1
- VPGRYOFKCNULNK-ACXQXYJUSA-N Deoxycorticosterone acetate Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)COC(=O)C)[C@@]1(C)CC2 VPGRYOFKCNULNK-ACXQXYJUSA-N 0.000 description 1
- 108010002156 Depsipeptides Proteins 0.000 description 1
- 206010012441 Dermatitis bullous Diseases 0.000 description 1
- 206010012455 Dermatitis exfoliative Diseases 0.000 description 1
- 241000604463 Desulfovibrio piger Species 0.000 description 1
- AUGQEEXBDZWUJY-ZLJUKNTDSA-N Diacetoxyscirpenol Chemical compound C([C@]12[C@]3(C)[C@H](OC(C)=O)[C@@H](O)[C@H]1O[C@@H]1C=C(C)CC[C@@]13COC(=O)C)O2 AUGQEEXBDZWUJY-ZLJUKNTDSA-N 0.000 description 1
- AUGQEEXBDZWUJY-UHFFFAOYSA-N Diacetoxyscirpenol Natural products CC(=O)OCC12CCC(C)=CC1OC1C(O)C(OC(C)=O)C2(C)C11CO1 AUGQEEXBDZWUJY-UHFFFAOYSA-N 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 108700016256 Dihydropteroate synthases Proteins 0.000 description 1
- 102100031111 Disintegrin and metalloproteinase domain-containing protein 17 Human genes 0.000 description 1
- 235000021294 Docosapentaenoic acid Nutrition 0.000 description 1
- 241001531200 Dorea formicigenerans Species 0.000 description 1
- 241000016537 Dorea longicatena Species 0.000 description 1
- 206010013700 Drug hypersensitivity Diseases 0.000 description 1
- 206010013786 Dry skin Diseases 0.000 description 1
- 208000037162 Ductal Breast Carcinoma Diseases 0.000 description 1
- 229930193152 Dynemicin Natural products 0.000 description 1
- 208000007033 Dysgerminoma Diseases 0.000 description 1
- 208000014094 Dystonic disease Diseases 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 108060006698 EGF receptor Proteins 0.000 description 1
- 235000021297 Eicosadienoic acid Nutrition 0.000 description 1
- 102100023795 Elafin Human genes 0.000 description 1
- 206010014418 Electrolyte imbalance Diseases 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 102100037241 Endoglin Human genes 0.000 description 1
- 108010036395 Endoglin Proteins 0.000 description 1
- 208000004145 Endometritis Diseases 0.000 description 1
- AFMYMMXSQGUCBK-UHFFFAOYSA-N Endynamicin A Natural products C1#CC=CC#CC2NC(C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C3)=C3C34OC32C(C)C(C(O)=O)=C(OC)C41 AFMYMMXSQGUCBK-UHFFFAOYSA-N 0.000 description 1
- SAMRUMKYXPVKPA-VFKOLLTISA-N Enocitabine Chemical compound O=C1N=C(NC(=O)CCCCCCCCCCCCCCCCCCCCC)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 SAMRUMKYXPVKPA-VFKOLLTISA-N 0.000 description 1
- 241000194031 Enterococcus faecium Species 0.000 description 1
- 101710139422 Eotaxin Proteins 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 201000011275 Epicondylitis Diseases 0.000 description 1
- 101800003838 Epidermal growth factor Proteins 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- OBMLHUPNRURLOK-XGRAFVIBSA-N Epitiostanol Chemical compound C1[C@@H]2S[C@@H]2C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@H]21 OBMLHUPNRURLOK-XGRAFVIBSA-N 0.000 description 1
- 206010015218 Erythema multiforme Diseases 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 241001646716 Escherichia coli K-12 Species 0.000 description 1
- 241001302654 Escherichia coli Nissle 1917 Species 0.000 description 1
- 229930189413 Esperamicin Natural products 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- JOYRKODLDBILNP-UHFFFAOYSA-N Ethyl urethane Chemical compound CCOC(N)=O JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 108050006519 Exosortases Proteins 0.000 description 1
- 108010066805 F-Box Proteins Proteins 0.000 description 1
- 102000018700 F-Box Proteins Human genes 0.000 description 1
- 108050008832 Fatty acid-binding protein, intestinal Proteins 0.000 description 1
- 208000002633 Febrile Neutropenia Diseases 0.000 description 1
- 101710153349 Fibroblast growth factor 19 Proteins 0.000 description 1
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 102000003972 Fibroblast growth factor 7 Human genes 0.000 description 1
- 102100028071 Fibroblast growth factor 7 Human genes 0.000 description 1
- 206010053717 Fibrous histiocytoma Diseases 0.000 description 1
- UIOFUWFRIANQPC-JKIFEVAISA-N Floxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=C(F)C=CC=C1Cl UIOFUWFRIANQPC-JKIFEVAISA-N 0.000 description 1
- 206010016807 Fluid retention Diseases 0.000 description 1
- 102100035139 Folate receptor alpha Human genes 0.000 description 1
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 1
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 1
- 208000004463 Follicular Adenocarcinoma Diseases 0.000 description 1
- 108010014612 Follistatin Proteins 0.000 description 1
- 102000016970 Follistatin Human genes 0.000 description 1
- 206010016946 Food allergy Diseases 0.000 description 1
- 208000000666 Fowlpox Diseases 0.000 description 1
- 241000589602 Francisella tularensis Species 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- 102100035233 Furin Human genes 0.000 description 1
- 101710142641 G-protein coupled receptor-associated sorting protein 1 Proteins 0.000 description 1
- 101710142639 G-protein coupled receptor-associated sorting protein 2 Proteins 0.000 description 1
- 208000027472 Galactosemias Diseases 0.000 description 1
- 108010001517 Galectin 3 Proteins 0.000 description 1
- 102100039558 Galectin-3 Human genes 0.000 description 1
- 102000044465 Galectin-7 Human genes 0.000 description 1
- GYHNNYVSQQEPJS-UHFFFAOYSA-N Gallium Chemical compound [Ga] GYHNNYVSQQEPJS-UHFFFAOYSA-N 0.000 description 1
- 102100028652 Gamma-enolase Human genes 0.000 description 1
- 101710115997 Gamma-tubulin complex component 2 Proteins 0.000 description 1
- 206010017708 Ganglioneuroblastoma Diseases 0.000 description 1
- 208000007882 Gastritis Diseases 0.000 description 1
- 208000005577 Gastroenteritis Diseases 0.000 description 1
- 241000193789 Gemella Species 0.000 description 1
- 206010061979 Genital pain Diseases 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 208000008999 Giant Cell Carcinoma Diseases 0.000 description 1
- 208000002966 Giant Cell Tumor of Bone Diseases 0.000 description 1
- 241000948258 Gila Species 0.000 description 1
- 208000010412 Glaucoma Diseases 0.000 description 1
- 208000010055 Globoid Cell Leukodystrophy Diseases 0.000 description 1
- 206010018364 Glomerulonephritis Diseases 0.000 description 1
- 208000005232 Glossitis Diseases 0.000 description 1
- 229920002527 Glycogen Polymers 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 201000005569 Gout Diseases 0.000 description 1
- 208000009329 Graft vs Host Disease Diseases 0.000 description 1
- 108010026389 Gramicidin Proteins 0.000 description 1
- 108010054017 Granulocyte Colony-Stimulating Factor Receptors Proteins 0.000 description 1
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 1
- 102100039622 Granulocyte colony-stimulating factor receptor Human genes 0.000 description 1
- 206010018687 Granulocytopenia Diseases 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 208000005234 Granulosa Cell Tumor Diseases 0.000 description 1
- AIJTTZAVMXIJGM-UHFFFAOYSA-N Grepafloxacin Chemical compound C1CNC(C)CN1C(C(=C1C)F)=CC2=C1C(=O)C(C(O)=O)=CN2C1CC1 AIJTTZAVMXIJGM-UHFFFAOYSA-N 0.000 description 1
- 108010051696 Growth Hormone Proteins 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 206010018852 Haematoma Diseases 0.000 description 1
- 101100406392 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) omp26 gene Proteins 0.000 description 1
- 208000002375 Hand-Foot Syndrome Diseases 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 102100034051 Heat shock protein HSP 90-alpha Human genes 0.000 description 1
- 208000002125 Hemangioendothelioma Diseases 0.000 description 1
- 208000006050 Hemangiopericytoma Diseases 0.000 description 1
- 208000001258 Hemangiosarcoma Diseases 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 201000004331 Henoch-Schoenlein purpura Diseases 0.000 description 1
- 206010019617 Henoch-Schonlein purpura Diseases 0.000 description 1
- 102000008055 Heparan Sulfate Proteoglycans Human genes 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 1
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 1
- 108090000100 Hepatocyte Growth Factor Proteins 0.000 description 1
- 206010019851 Hepatotoxicity Diseases 0.000 description 1
- 208000003809 Herpes Zoster Ophthalmicus Diseases 0.000 description 1
- 108010072039 Histidine kinase Proteins 0.000 description 1
- 208000002291 Histiocytic Sarcoma Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 101000779641 Homo sapiens ALK tyrosine kinase receptor Proteins 0.000 description 1
- 101000718243 Homo sapiens Adhesion G protein-coupled receptor E5 Proteins 0.000 description 1
- 101000693076 Homo sapiens Angiopoietin-related protein 4 Proteins 0.000 description 1
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000935638 Homo sapiens Basal cell adhesion molecule Proteins 0.000 description 1
- 101000766294 Homo sapiens Branched-chain-amino-acid aminotransferase, mitochondrial Proteins 0.000 description 1
- 101000978376 Homo sapiens C-C motif chemokine 15 Proteins 0.000 description 1
- 101000713099 Homo sapiens C-C motif chemokine 20 Proteins 0.000 description 1
- 101000897493 Homo sapiens C-C motif chemokine 26 Proteins 0.000 description 1
- 101000897494 Homo sapiens C-C motif chemokine 27 Proteins 0.000 description 1
- 101000777471 Homo sapiens C-C motif chemokine 4 Proteins 0.000 description 1
- 101000797762 Homo sapiens C-C motif chemokine 5 Proteins 0.000 description 1
- 101000947186 Homo sapiens C-X-C motif chemokine 5 Proteins 0.000 description 1
- 101000947172 Homo sapiens C-X-C motif chemokine 9 Proteins 0.000 description 1
- 101000981093 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 1 Proteins 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101000928537 Homo sapiens Delta-like protein 1 Proteins 0.000 description 1
- 101001048718 Homo sapiens Elafin Proteins 0.000 description 1
- 101000911337 Homo sapiens Fatty acid-binding protein, intestinal Proteins 0.000 description 1
- 101000846394 Homo sapiens Fibroblast growth factor 19 Proteins 0.000 description 1
- 101001023230 Homo sapiens Folate receptor alpha Proteins 0.000 description 1
- 101000608772 Homo sapiens Galectin-7 Proteins 0.000 description 1
- 101000746367 Homo sapiens Granulocyte colony-stimulating factor Proteins 0.000 description 1
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 1
- 101001076292 Homo sapiens Insulin-like growth factor II Proteins 0.000 description 1
- 101001076407 Homo sapiens Interleukin-1 receptor antagonist protein Proteins 0.000 description 1
- 101001018097 Homo sapiens L-selectin Proteins 0.000 description 1
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 1
- 101000716481 Homo sapiens Lysosome membrane protein 2 Proteins 0.000 description 1
- 101000991061 Homo sapiens MHC class I polypeptide-related sequence B Proteins 0.000 description 1
- 101000669513 Homo sapiens Metalloproteinase inhibitor 1 Proteins 0.000 description 1
- 101000645296 Homo sapiens Metalloproteinase inhibitor 2 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101000972282 Homo sapiens Mucin-5AC Proteins 0.000 description 1
- 101000978766 Homo sapiens Neurogenic locus notch homolog protein 1 Proteins 0.000 description 1
- 101000973997 Homo sapiens Nucleosome assembly protein 1-like 4 Proteins 0.000 description 1
- 101001098352 Homo sapiens OX-2 membrane glycoprotein Proteins 0.000 description 1
- 101001001487 Homo sapiens Phosphatidylinositol-glycan biosynthesis class F protein Proteins 0.000 description 1
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 description 1
- 101000947178 Homo sapiens Platelet basic protein Proteins 0.000 description 1
- 101000684208 Homo sapiens Prolyl endopeptidase FAP Proteins 0.000 description 1
- 101000668165 Homo sapiens RNA-binding motif, single-stranded-interacting protein 1 Proteins 0.000 description 1
- 101000665882 Homo sapiens Retinol-binding protein 4 Proteins 0.000 description 1
- 101000711796 Homo sapiens Sclerostin Proteins 0.000 description 1
- 101000863883 Homo sapiens Sialic acid-binding Ig-like lectin 9 Proteins 0.000 description 1
- 101000835745 Homo sapiens Teratocarcinoma-derived growth factor 1 Proteins 0.000 description 1
- 101000845170 Homo sapiens Thymic stromal lymphopoietin Proteins 0.000 description 1
- 101000831567 Homo sapiens Toll-like receptor 2 Proteins 0.000 description 1
- 101000795167 Homo sapiens Tumor necrosis factor receptor superfamily member 13B Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 101000597785 Homo sapiens Tumor necrosis factor receptor superfamily member 6B Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101000997835 Homo sapiens Tyrosine-protein kinase JAK1 Proteins 0.000 description 1
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 1
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 1
- 101000851030 Homo sapiens Vascular endothelial growth factor receptor 3 Proteins 0.000 description 1
- 208000035533 House dust allergy Diseases 0.000 description 1
- 102000002265 Human Growth Hormone Human genes 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- 206010020597 Hyperchloraemia Diseases 0.000 description 1
- 208000002682 Hyperkalemia Diseases 0.000 description 1
- 206010067725 Hyperlipasaemia Diseases 0.000 description 1
- 206010020669 Hypermagnesaemia Diseases 0.000 description 1
- 208000029422 Hypernatremia Diseases 0.000 description 1
- 201000001431 Hyperuricemia Diseases 0.000 description 1
- 208000004044 Hypesthesia Diseases 0.000 description 1
- 208000003623 Hypoalbuminemia Diseases 0.000 description 1
- 208000013038 Hypocalcemia Diseases 0.000 description 1
- 206010020955 Hypochloraemia Diseases 0.000 description 1
- 208000013016 Hypoglycemia Diseases 0.000 description 1
- 208000019025 Hypokalemia Diseases 0.000 description 1
- 206010021027 Hypomagnesaemia Diseases 0.000 description 1
- 206010021036 Hyponatraemia Diseases 0.000 description 1
- 208000029663 Hypophosphatemia Diseases 0.000 description 1
- 208000001953 Hypotension Diseases 0.000 description 1
- 229940124672 IMA901 Drugs 0.000 description 1
- MPBVHIBUJCELCL-UHFFFAOYSA-N Ibandronate Chemical compound CCCCCN(C)CCC(O)(P(O)(O)=O)P(O)(O)=O MPBVHIBUJCELCL-UHFFFAOYSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 208000018127 Idiopathic intracranial hypertension Diseases 0.000 description 1
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 description 1
- 208000031814 IgA Vasculitis Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 208000007866 Immunoproliferative Small Intestinal Disease Diseases 0.000 description 1
- 208000004575 Infectious Arthritis Diseases 0.000 description 1
- 229940122390 Inflammasome inhibitor Drugs 0.000 description 1
- 206010022095 Injection Site reaction Diseases 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 101710184277 Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 1
- 102100025947 Insulin-like growth factor II Human genes 0.000 description 1
- 102000004374 Insulin-like growth factor binding protein 3 Human genes 0.000 description 1
- 102100022708 Insulin-like growth factor-binding protein 3 Human genes 0.000 description 1
- 102000012330 Integrases Human genes 0.000 description 1
- 108010061833 Integrases Proteins 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 229940124137 Interferon gamma antagonist Drugs 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 229940119178 Interleukin 1 receptor antagonist Drugs 0.000 description 1
- 102100020881 Interleukin-1 alpha Human genes 0.000 description 1
- 102000019223 Interleukin-1 receptor Human genes 0.000 description 1
- 108050006617 Interleukin-1 receptor Proteins 0.000 description 1
- 102100035014 Interleukin-17 receptor B Human genes 0.000 description 1
- 101710186071 Interleukin-17 receptor B Proteins 0.000 description 1
- 102100033101 Interleukin-17B Human genes 0.000 description 1
- 108010082786 Interleukin-1alpha Proteins 0.000 description 1
- 102100030704 Interleukin-21 Human genes 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 229920001202 Inulin Polymers 0.000 description 1
- JUZNIMUFDBIJCM-ANEDZVCMSA-N Invanz Chemical compound O=C([C@H]1NC[C@H](C1)SC=1[C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)NC1=CC=CC(C(O)=O)=C1 JUZNIMUFDBIJCM-ANEDZVCMSA-N 0.000 description 1
- 206010022971 Iron Deficiencies Diseases 0.000 description 1
- 108010035210 Iron-Binding Proteins Proteins 0.000 description 1
- 102000008133 Iron-Binding Proteins Human genes 0.000 description 1
- 208000000209 Isaacs syndrome Diseases 0.000 description 1
- 102000015617 Janus Kinases Human genes 0.000 description 1
- 108010024121 Janus Kinases Proteins 0.000 description 1
- 229940116839 Janus kinase 1 inhibitor Drugs 0.000 description 1
- 229940121730 Janus kinase 2 inhibitor Drugs 0.000 description 1
- 229940122245 Janus kinase inhibitor Drugs 0.000 description 1
- 206010023230 Joint stiffness Diseases 0.000 description 1
- 102100023437 Junctional adhesion molecule-like Human genes 0.000 description 1
- 208000003456 Juvenile Arthritis Diseases 0.000 description 1
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 1
- 201000008869 Juxtacortical Osteosarcoma Diseases 0.000 description 1
- 101710172804 K protein Proteins 0.000 description 1
- 108010043610 KIR Receptors Proteins 0.000 description 1
- 102100038298 Kallikrein-14 Human genes 0.000 description 1
- 101710115806 Kallikrein-14 Proteins 0.000 description 1
- 102100023012 Kallistatin Human genes 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 208000011200 Kawasaki disease Diseases 0.000 description 1
- 208000009319 Keratoconjunctivitis Sicca Diseases 0.000 description 1
- 102100033627 Killer cell immunoglobulin-like receptor 3DL1 Human genes 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- 208000028226 Krabbe disease Diseases 0.000 description 1
- 102100039020 Kunitz-type protease inhibitor 2 Human genes 0.000 description 1
- 101710165138 Kunitz-type protease inhibitor 2 Proteins 0.000 description 1
- 108010062028 L-BLP25 Proteins 0.000 description 1
- 108010092694 L-Selectin Proteins 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 1
- 239000002067 L01XE06 - Dasatinib Substances 0.000 description 1
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 1
- 239000003798 L01XE11 - Pazopanib Substances 0.000 description 1
- 239000002138 L01XE21 - Regorafenib Substances 0.000 description 1
- 239000002176 L01XE26 - Cabozantinib Substances 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- 108010007622 LDL Lipoproteins Proteins 0.000 description 1
- 102000007330 LDL Lipoproteins Human genes 0.000 description 1
- 241000194035 Lactococcus lactis Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 201000008197 Laryngitis Diseases 0.000 description 1
- 101710173438 Late L2 mu core protein Proteins 0.000 description 1
- 239000005639 Lauric acid Substances 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 229920001491 Lentinan Polymers 0.000 description 1
- 108010092277 Leptin Proteins 0.000 description 1
- 102000016267 Leptin Human genes 0.000 description 1
- 102000004058 Leukemia inhibitory factor Human genes 0.000 description 1
- 102100032352 Leukemia inhibitory factor Human genes 0.000 description 1
- GSDSWSVVBLHKDQ-JTQLQIEISA-N Levofloxacin Chemical compound C([C@@H](N1C2=C(C(C(C(O)=O)=C1)=O)C=C1F)C)OC2=C1N1CCN(C)CC1 GSDSWSVVBLHKDQ-JTQLQIEISA-N 0.000 description 1
- 201000004462 Leydig Cell Tumor Diseases 0.000 description 1
- 235000021353 Lignoceric acid Nutrition 0.000 description 1
- CQXMAMUUWHYSIY-UHFFFAOYSA-N Lignoceric acid Natural products CCCCCCCCCCCCCCCCCCCCCCCC(=O)OCCC1=CC=C(O)C=C1 CQXMAMUUWHYSIY-UHFFFAOYSA-N 0.000 description 1
- OJMMVQQUTAEWLP-UHFFFAOYSA-N Lincomycin Natural products CN1CC(CCC)CC1C(=O)NC(C(C)O)C1C(O)C(O)C(O)C(SC)O1 OJMMVQQUTAEWLP-UHFFFAOYSA-N 0.000 description 1
- OYHQOLUKZRVURQ-HZJYTTRNSA-N Linoleic acid Chemical compound CCCCC\C=C/C\C=C/CCCCCCCC(O)=O OYHQOLUKZRVURQ-HZJYTTRNSA-N 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 208000000265 Lobular Carcinoma Diseases 0.000 description 1
- 208000000185 Localized scleroderma Diseases 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 208000019693 Lung disease Diseases 0.000 description 1
- 102100026849 Lymphatic vessel endothelial hyaluronic acid receptor 1 Human genes 0.000 description 1
- 101710178181 Lymphatic vessel endothelial hyaluronic acid receptor 1 Proteins 0.000 description 1
- 102100020862 Lymphocyte activation gene 3 protein Human genes 0.000 description 1
- 208000028018 Lymphocytic leukaemia Diseases 0.000 description 1
- 102100035304 Lymphotactin Human genes 0.000 description 1
- 102100026238 Lymphotoxin-alpha Human genes 0.000 description 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 1
- 108090000362 Lymphotoxin-beta Proteins 0.000 description 1
- 101710165448 Lysosome membrane protein 2 Proteins 0.000 description 1
- 101710102605 MHC class I polypeptide-related sequence A Proteins 0.000 description 1
- 101710102608 MHC class I polypeptide-related sequence B Proteins 0.000 description 1
- 102000034655 MIF Human genes 0.000 description 1
- 108010009474 Macrophage Inflammatory Proteins Proteins 0.000 description 1
- 102000009571 Macrophage Inflammatory Proteins Human genes 0.000 description 1
- 108010048043 Macrophage Migration-Inhibitory Factors Proteins 0.000 description 1
- 102100037791 Macrophage migration inhibitory factor Human genes 0.000 description 1
- TYMRLRRVMHJFTF-UHFFFAOYSA-N Mafenide Chemical compound NCC1=CC=C(S(N)(=O)=O)C=C1 TYMRLRRVMHJFTF-UHFFFAOYSA-N 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- MQHWFIOJQSCFNM-UHFFFAOYSA-L Magnesium salicylate Chemical compound [Mg+2].OC1=CC=CC=C1C([O-])=O.OC1=CC=CC=C1C([O-])=O MQHWFIOJQSCFNM-UHFFFAOYSA-L 0.000 description 1
- 101710167885 Major outer membrane protein P.IB Proteins 0.000 description 1
- 208000035771 Malignant Sertoli-Leydig cell tumor of the ovary Diseases 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 240000002129 Malva sylvestris Species 0.000 description 1
- 235000006770 Malva sylvestris Nutrition 0.000 description 1
- 108010087870 Mannose-Binding Lectin Proteins 0.000 description 1
- 108010090665 Mannosyl-Glycoprotein Endo-beta-N-Acetylglucosaminidase Proteins 0.000 description 1
- 208000030162 Maple syrup disease Diseases 0.000 description 1
- VJRAUFKOOPNFIQ-UHFFFAOYSA-N Marcellomycin Natural products C12=C(O)C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C=C2C(C(=O)OC)C(CC)(O)CC1OC(OC1C)CC(N(C)C)C1OC(OC1C)CC(O)C1OC1CC(O)C(O)C(C)O1 VJRAUFKOOPNFIQ-UHFFFAOYSA-N 0.000 description 1
- 108010076497 Matrix Metalloproteinase 10 Proteins 0.000 description 1
- 108010076503 Matrix Metalloproteinase 13 Proteins 0.000 description 1
- 108010016165 Matrix Metalloproteinase 2 Proteins 0.000 description 1
- 108010016160 Matrix Metalloproteinase 3 Proteins 0.000 description 1
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 1
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 1
- 229930126263 Maytansine Natural products 0.000 description 1
- SBDNJUWAMKYJOX-UHFFFAOYSA-N Meclofenamic Acid Chemical compound CC1=CC=C(Cl)C(NC=2C(=CC=CC=2)C(O)=O)=C1Cl SBDNJUWAMKYJOX-UHFFFAOYSA-N 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- ZRVUJXDFFKFLMG-UHFFFAOYSA-N Meloxicam Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC1=NC=C(C)S1 ZRVUJXDFFKFLMG-UHFFFAOYSA-N 0.000 description 1
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 208000026139 Memory disease Diseases 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- IVDYZAAPOLNZKG-KWHRADDSSA-N Mepitiostane Chemical compound O([C@@H]1[C@]2(CC[C@@H]3[C@@]4(C)C[C@H]5S[C@H]5C[C@@H]4CC[C@H]3[C@@H]2CC1)C)C1(OC)CCCC1 IVDYZAAPOLNZKG-KWHRADDSSA-N 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 201000009574 Mesenchymal Chondrosarcoma Diseases 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 208000001145 Metabolic Syndrome Diseases 0.000 description 1
- 206010054949 Metaplasia Diseases 0.000 description 1
- CERQOIWHTDAKMF-UHFFFAOYSA-N Methacrylic acid Chemical compound CC(=C)C(O)=O CERQOIWHTDAKMF-UHFFFAOYSA-N 0.000 description 1
- QXKHYNVANLEOEG-UHFFFAOYSA-N Methoxsalen Chemical compound C1=CC(=O)OC2=C1C=C1C=COC1=C2OC QXKHYNVANLEOEG-UHFFFAOYSA-N 0.000 description 1
- FQISKWAFAHGMGT-SGJOWKDISA-M Methylprednisolone sodium succinate Chemical compound [Na+].C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCC([O-])=O)CC[C@H]21 FQISKWAFAHGMGT-SGJOWKDISA-M 0.000 description 1
- 108010046774 Mikamycin Proteins 0.000 description 1
- 229930192051 Mikamycin Natural products 0.000 description 1
- VFKZTMPDYBFSTM-KVTDHHQDSA-N Mitobronitol Chemical compound BrC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-KVTDHHQDSA-N 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 208000003250 Mixed connective tissue disease Diseases 0.000 description 1
- ZOKXTWBITQBERF-UHFFFAOYSA-N Molybdenum Chemical compound [Mo] ZOKXTWBITQBERF-UHFFFAOYSA-N 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 206010027982 Morphoea Diseases 0.000 description 1
- 208000016285 Movement disease Diseases 0.000 description 1
- 102100022496 Mucin-5AC Human genes 0.000 description 1
- 206010057269 Mucoepidermoid carcinoma Diseases 0.000 description 1
- 206010028116 Mucosal inflammation Diseases 0.000 description 1
- 201000010927 Mucositis Diseases 0.000 description 1
- 208000010357 Mullerian Mixed Tumor Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 1
- 101100481410 Mus musculus Tek gene Proteins 0.000 description 1
- 101000904718 Mus musculus Transmembrane glycoprotein NMB Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 208000021642 Muscular disease Diseases 0.000 description 1
- 241000186366 Mycobacterium bovis Species 0.000 description 1
- 241000204031 Mycoplasma Species 0.000 description 1
- 208000003926 Myelitis Diseases 0.000 description 1
- 201000009623 Myopathy Diseases 0.000 description 1
- 201000002481 Myositis Diseases 0.000 description 1
- 235000021360 Myristic acid Nutrition 0.000 description 1
- TUNFSRHWOTWDNC-UHFFFAOYSA-N Myristic acid Natural products CCCCCCCCCCCCCC(O)=O TUNFSRHWOTWDNC-UHFFFAOYSA-N 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Chemical group CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical group CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Chemical group CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 102100030397 N-acetylmuramoyl-L-alanine amidase Human genes 0.000 description 1
- 101150031836 NRCAM gene Proteins 0.000 description 1
- BLXXJMDCKKHMKV-UHFFFAOYSA-N Nabumetone Chemical compound C1=C(CCC(C)=O)C=CC2=CC(OC)=CC=C21 BLXXJMDCKKHMKV-UHFFFAOYSA-N 0.000 description 1
- CMWTZPSULFXXJA-UHFFFAOYSA-N Naproxen Natural products C1=C(C(C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-UHFFFAOYSA-N 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 206010051606 Necrotising colitis Diseases 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 206010029155 Nephropathy toxic Diseases 0.000 description 1
- 108010032605 Nerve Growth Factor Receptors Proteins 0.000 description 1
- 108010069196 Neural Cell Adhesion Molecules Proteins 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 108050003738 Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 102100023616 Neural cell adhesion molecule L1-like protein Human genes 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 108700037638 Neurogenic locus notch homolog protein 1 Proteins 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 206010072359 Neuromyotonia Diseases 0.000 description 1
- 102100021852 Neuronal cell adhesion molecule Human genes 0.000 description 1
- 101710130688 Neuronal cell adhesion molecule Proteins 0.000 description 1
- 206010029350 Neurotoxicity Diseases 0.000 description 1
- 102100030411 Neutrophil collagenase Human genes 0.000 description 1
- 101710118230 Neutrophil collagenase Proteins 0.000 description 1
- 108030001564 Neutrophil collagenases Proteins 0.000 description 1
- 102000056189 Neutrophil collagenases Human genes 0.000 description 1
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 1
- 108010053775 Nisin Proteins 0.000 description 1
- NVNLLIYOARQCIX-MSHCCFNRSA-N Nisin Chemical compound N1C(=O)[C@@H](CC(C)C)NC(=O)C(=C)NC(=O)[C@@H]([C@H](C)CC)NC(=O)[C@@H](NC(=O)C(=C/C)/NC(=O)[C@H](N)[C@H](C)CC)CSC[C@@H]1C(=O)N[C@@H]1C(=O)N2CCC[C@@H]2C(=O)NCC(=O)N[C@@H](C(=O)N[C@H](CCCCN)C(=O)N[C@@H]2C(NCC(=O)N[C@H](C)C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCSC)C(=O)NCC(=O)N[C@H](CS[C@@H]2C)C(=O)N[C@H](CC(N)=O)C(=O)N[C@H](CCSC)C(=O)N[C@H](CCCCN)C(=O)N[C@@H]2C(N[C@H](C)C(=O)N[C@@H]3C(=O)N[C@@H](C(N[C@H](CC=4NC=NC=4)C(=O)N[C@H](CS[C@@H]3C)C(=O)N[C@H](CO)C(=O)N[C@H]([C@H](C)CC)C(=O)N[C@H](CC=3NC=NC=3)C(=O)N[C@H](C(C)C)C(=O)NC(=C)C(=O)N[C@H](CCCCN)C(O)=O)=O)CS[C@@H]2C)=O)=O)CS[C@@H]1C NVNLLIYOARQCIX-MSHCCFNRSA-N 0.000 description 1
- SYNHCENRCUAUNM-UHFFFAOYSA-N Nitrogen mustard N-oxide hydrochloride Chemical compound Cl.ClCC[N+]([O-])(C)CCCl SYNHCENRCUAUNM-UHFFFAOYSA-N 0.000 description 1
- KGTDRFCXGRULNK-UHFFFAOYSA-N Nogalamycin Natural products COC1C(OC)(C)C(OC)C(C)OC1OC1C2=C(O)C(C(=O)C3=C(O)C=C4C5(C)OC(C(C(C5O)N(C)C)O)OC4=C3C3=O)=C3C=C2C(C(=O)OC)C(C)(O)C1 KGTDRFCXGRULNK-UHFFFAOYSA-N 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- YJQPYGGHQPGBLI-UHFFFAOYSA-N Novobiocin Natural products O1C(C)(C)C(OC)C(OC(N)=O)C(O)C1OC1=CC=C(C(O)=C(NC(=O)C=2C=C(CC=C(C)C)C(O)=CC=2)C(=O)O2)C2=C1C YJQPYGGHQPGBLI-UHFFFAOYSA-N 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 108700001237 Nucleic Acid-Based Vaccines Proteins 0.000 description 1
- 101710192965 Nucleosome assembly protein 1-like 4 Proteins 0.000 description 1
- 102100037589 OX-2 membrane glycoprotein Human genes 0.000 description 1
- 208000007871 Odontogenic Tumors Diseases 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 206010030216 Oesophagitis Diseases 0.000 description 1
- 239000004104 Oleandomycin Substances 0.000 description 1
- RZPAKFUAFGMUPI-UHFFFAOYSA-N Oleandomycin Natural products O1C(C)C(O)C(OC)CC1OC1C(C)C(=O)OC(C)C(C)C(O)C(C)C(=O)C2(OC2)CC(C)C(OC2C(C(CC(C)O2)N(C)C)O)C1C RZPAKFUAFGMUPI-UHFFFAOYSA-N 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 229930187135 Olivomycin Natural products 0.000 description 1
- 102000004140 Oncostatin M Human genes 0.000 description 1
- 206010030865 Ophthalmic herpes zoster Diseases 0.000 description 1
- 208000005225 Opsoclonus-Myoclonus Syndrome Diseases 0.000 description 1
- BPQQTUXANYXVAA-UHFFFAOYSA-N Orthosilicate Chemical compound [O-][Si]([O-])([O-])[O-] BPQQTUXANYXVAA-UHFFFAOYSA-N 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 229930192776 Ostreogrycin Natural products 0.000 description 1
- 208000005141 Otitis Diseases 0.000 description 1
- 206010033109 Ototoxicity Diseases 0.000 description 1
- 206010073261 Ovarian theca cell tumour Diseases 0.000 description 1
- 101710199789 Oxidized low-density lipoprotein receptor 1 Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- 239000004100 Oxytetracycline Substances 0.000 description 1
- 239000012826 P38 inhibitor Substances 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 108091007960 PI3Ks Proteins 0.000 description 1
- 102000038030 PI3Ks Human genes 0.000 description 1
- 235000021314 Palmitic acid Nutrition 0.000 description 1
- 235000021319 Palmitoleic acid Nutrition 0.000 description 1
- 206010033557 Palpitations Diseases 0.000 description 1
- VREZDOWOLGNDPW-ALTGWBOUSA-N Pancratistatin Chemical compound C1=C2[C@H]3[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H]3NC(=O)C2=C(O)C2=C1OCO2 VREZDOWOLGNDPW-ALTGWBOUSA-N 0.000 description 1
- VREZDOWOLGNDPW-MYVCAWNPSA-N Pancratistatin Natural products O=C1N[C@H]2[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@@H]2c2c1c(O)c1OCOc1c2 VREZDOWOLGNDPW-MYVCAWNPSA-N 0.000 description 1
- 206010033647 Pancreatitis acute Diseases 0.000 description 1
- 206010033649 Pancreatitis chronic Diseases 0.000 description 1
- 206010033661 Pancytopenia Diseases 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- UOZODPSAJZTQNH-UHFFFAOYSA-N Paromomycin II Natural products NC1C(O)C(O)C(CN)OC1OC1C(O)C(OC2C(C(N)CC(N)C2O)OC2C(C(O)C(O)C(CO)O2)N)OC1CO UOZODPSAJZTQNH-UHFFFAOYSA-N 0.000 description 1
- 206010034038 Parotitis Diseases 0.000 description 1
- 208000029082 Pelvic Inflammatory Disease Diseases 0.000 description 1
- 229930195708 Penicillin V Natural products 0.000 description 1
- 101710096749 Penicillin-binding protein 2A Proteins 0.000 description 1
- 101710202686 Penicillin-sensitive transpeptidase Proteins 0.000 description 1
- 108010057150 Peplomycin Proteins 0.000 description 1
- 108010047320 Pepsinogen A Proteins 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- 241000191992 Peptostreptococcus Species 0.000 description 1
- 208000031845 Pernicious anaemia Diseases 0.000 description 1
- 244000046052 Phaseolus vulgaris Species 0.000 description 1
- 235000010627 Phaseolus vulgaris Nutrition 0.000 description 1
- 201000011252 Phenylketonuria Diseases 0.000 description 1
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 description 1
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 206010034960 Photophobia Diseases 0.000 description 1
- 206010034972 Photosensitivity reaction Diseases 0.000 description 1
- 208000009077 Pigmented Nevus Diseases 0.000 description 1
- 208000019262 Pilomatrix carcinoma Diseases 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- KMSKQZKKOZQFFG-HSUXVGOQSA-N Pirarubicin Chemical compound O([C@H]1[C@@H](N)C[C@@H](O[C@H]1C)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1CCCCO1 KMSKQZKKOZQFFG-HSUXVGOQSA-N 0.000 description 1
- 102100035194 Placenta growth factor Human genes 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 108010069381 Platelet Endothelial Cell Adhesion Molecule-1 Proteins 0.000 description 1
- 101710204736 Platelet endothelial cell adhesion molecule Proteins 0.000 description 1
- 108090000778 Platelet factor 4 Proteins 0.000 description 1
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 1
- 101710164680 Platelet-derived growth factor receptor beta Proteins 0.000 description 1
- 102100040990 Platelet-derived growth factor subunit B Human genes 0.000 description 1
- 101710103494 Platelet-derived growth factor subunit B Proteins 0.000 description 1
- 101710179684 Poly [ADP-ribose] polymerase Proteins 0.000 description 1
- 102100023712 Poly [ADP-ribose] polymerase 1 Human genes 0.000 description 1
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 1
- 108010093965 Polymyxin B Proteins 0.000 description 1
- 208000026301 Postoperative Cognitive Complications Diseases 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 208000002389 Pouchitis Diseases 0.000 description 1
- HFVNWDWLWUCIHC-GUPDPFMOSA-N Prednimustine Chemical compound O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 HFVNWDWLWUCIHC-GUPDPFMOSA-N 0.000 description 1
- 241000605861 Prevotella Species 0.000 description 1
- 241000549435 Pria Species 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 208000024777 Prion disease Diseases 0.000 description 1
- 108010079780 Pristinamycin Proteins 0.000 description 1
- RLNUPSVMIYRZSM-UHFFFAOYSA-N Pristinamycin Natural products CC1OC(=O)C(C=2C=CC=CC=2)NC(=O)C2CC(=O)CCN2C(=O)C(CC=2C=CC(=CC=2)N(C)C)CCN(C)C(=O)C2CCCN2C(=O)C(CC)NC(=O)C1NC(=O)C1=NC=CC=C1O RLNUPSVMIYRZSM-UHFFFAOYSA-N 0.000 description 1
- 101710197985 Probable protein Rev Proteins 0.000 description 1
- 108010048233 Procalcitonin Proteins 0.000 description 1
- 206010036774 Proctitis Diseases 0.000 description 1
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 1
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 1
- 102000003946 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 229940079156 Proteasome inhibitor Drugs 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 229940123573 Protein synthesis inhibitor Drugs 0.000 description 1
- 102000016971 Proto-Oncogene Proteins c-kit Human genes 0.000 description 1
- 108010014608 Proto-Oncogene Proteins c-kit Proteins 0.000 description 1
- 102000008022 Proto-Oncogene Proteins c-met Human genes 0.000 description 1
- 108010089836 Proto-Oncogene Proteins c-met Proteins 0.000 description 1
- 102100032350 Protransforming growth factor alpha Human genes 0.000 description 1
- 208000003251 Pruritus Diseases 0.000 description 1
- 208000003100 Pseudomembranous Enterocolitis Diseases 0.000 description 1
- 206010037128 Pseudomembranous colitis Diseases 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 208000001431 Psychomotor Agitation Diseases 0.000 description 1
- 208000010378 Pulmonary Embolism Diseases 0.000 description 1
- 206010061924 Pulmonary toxicity Diseases 0.000 description 1
- 206010037596 Pyelonephritis Diseases 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 1
- 102000014128 RANK Ligand Human genes 0.000 description 1
- 108010025832 RANK Ligand Proteins 0.000 description 1
- KGZHFKDNSAEOJX-WIFQYKSHSA-N Ramoplanin Chemical compound C([C@H]1C(=O)N[C@H](CCCN)C(=O)N[C@H](C(=O)N[C@@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C)C(=O)N[C@H](C(=O)O[C@@H]([C@@H](C(N[C@@H](C(=O)N[C@H](CCCN)C(=O)N[C@@H](C(=O)N[C@H](C(=O)N[C@@H](C(=O)N[C@H](C(=O)N1)[C@H](C)O)C=1C=CC(O)=CC=1)C=1C=CC(O)=CC=1)[C@@H](C)O)C=1C=CC(O)=CC=1)=O)NC(=O)[C@H](CC(N)=O)NC(=O)\C=C/C=C/CC(C)C)C(N)=O)C=1C=C(Cl)C(O)=CC=1)C=1C=CC(O)=CC=1)[C@@H](C)O)C=1C=CC(O[C@@H]2[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O[C@@H]2[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)=CC=1)C1=CC=CC=C1 KGZHFKDNSAEOJX-WIFQYKSHSA-N 0.000 description 1
- 108010038036 Receptor Activator of Nuclear Factor-kappa B Proteins 0.000 description 1
- 102000010498 Receptor Activator of Nuclear Factor-kappa B Human genes 0.000 description 1
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 1
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 1
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 1
- 206010038063 Rectal haemorrhage Diseases 0.000 description 1
- 208000033464 Reiter syndrome Diseases 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- 108010047909 Resistin Proteins 0.000 description 1
- 102100024735 Resistin Human genes 0.000 description 1
- 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 1
- 206010038743 Restlessness Diseases 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 102100033914 Retinoic acid receptor responder protein 2 Human genes 0.000 description 1
- 101710170513 Retinoic acid receptor responder protein 2 Proteins 0.000 description 1
- 101710137011 Retinol-binding protein 4 Proteins 0.000 description 1
- 206010039085 Rhinitis allergic Diseases 0.000 description 1
- 206010039094 Rhinitis perennial Diseases 0.000 description 1
- 208000036284 Rhinitis seasonal Diseases 0.000 description 1
- OWPCHSCAPHNHAV-UHFFFAOYSA-N Rhizoxin Natural products C1C(O)C2(C)OC2C=CC(C)C(OC(=O)C2)CC2CC2OC2C(=O)OC1C(C)C(OC)C(C)=CC=CC(C)=CC1=COC(C)=N1 OWPCHSCAPHNHAV-UHFFFAOYSA-N 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 229930189077 Rifamycin Natural products 0.000 description 1
- 108010081391 Ristocetin Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- NSFWWJIQIKBZMJ-YKNYLIOZSA-N Roridin A Chemical compound C([C@]12[C@]3(C)[C@H]4C[C@H]1O[C@@H]1C=C(C)CC[C@@]13COC(=O)[C@@H](O)[C@H](C)CCO[C@H](\C=C\C=C/C(=O)O4)[C@H](O)C)O2 NSFWWJIQIKBZMJ-YKNYLIOZSA-N 0.000 description 1
- ZUHRLTIPDRLJHR-UHFFFAOYSA-N Rosamicin Natural products CCC1OC(=O)CC(O)C(C)C(OC2OC(C)CC(C2O)N(C)C)C(CC=O)CC(C)C(=O)C=CC3OC3C1C ZUHRLTIPDRLJHR-UHFFFAOYSA-N 0.000 description 1
- 241000157939 Rothia mucilaginosa Species 0.000 description 1
- 241000123754 Ruminococcus callidus Species 0.000 description 1
- KJTLSVCANCCWHF-UHFFFAOYSA-N Ruthenium Chemical compound [Ru] KJTLSVCANCCWHF-UHFFFAOYSA-N 0.000 description 1
- 108010084054 SBI-087 Proteins 0.000 description 1
- 241000293871 Salmonella enterica subsp. enterica serovar Typhi Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 208000007893 Salpingitis Diseases 0.000 description 1
- 206010049677 Salpingo-oophoritis Diseases 0.000 description 1
- 206010039705 Scleritis Diseases 0.000 description 1
- 102100034201 Sclerostin Human genes 0.000 description 1
- 206010039793 Seborrhoeic dermatitis Diseases 0.000 description 1
- 102100030054 Secreted frizzled-related protein 2 Human genes 0.000 description 1
- 108050007987 Secreted frizzled-related protein 2 Proteins 0.000 description 1
- 108050007990 Secreted frizzled-related protein 3 Proteins 0.000 description 1
- BUGBHKTXTAQXES-UHFFFAOYSA-N Selenium Chemical compound [Se] BUGBHKTXTAQXES-UHFFFAOYSA-N 0.000 description 1
- 102100034801 Serine protease hepsin Human genes 0.000 description 1
- 101710111478 Serine protease hepsin Proteins 0.000 description 1
- 208000000097 Sertoli-Leydig cell tumor Diseases 0.000 description 1
- 241000607762 Shigella flexneri Species 0.000 description 1
- 102100029957 Sialic acid-binding Ig-like lectin 5 Human genes 0.000 description 1
- 101710110535 Sialic acid-binding Ig-like lectin 5 Proteins 0.000 description 1
- 101710110541 Sialic acid-binding Ig-like lectin 9 Proteins 0.000 description 1
- 208000003252 Signet Ring Cell Carcinoma Diseases 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 208000009574 Skin Appendage Carcinoma Diseases 0.000 description 1
- 208000013738 Sleep Initiation and Maintenance disease Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 102100038803 Somatotropin Human genes 0.000 description 1
- 102400000673 Sonic hedgehog protein N-product Human genes 0.000 description 1
- 101800001400 Sonic hedgehog protein N-product Proteins 0.000 description 1
- 208000009415 Spinocerebellar Ataxias Diseases 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 235000015125 Sterculia urens Nutrition 0.000 description 1
- 240000001058 Sterculia urens Species 0.000 description 1
- 235000014897 Streptococcus lactis Nutrition 0.000 description 1
- 241000194019 Streptococcus mutans Species 0.000 description 1
- 241000194023 Streptococcus sanguinis Species 0.000 description 1
- 108010015791 Streptogramin A Proteins 0.000 description 1
- 108010034396 Streptogramins Proteins 0.000 description 1
- 229930184317 Streptovaricin Natural products 0.000 description 1
- 101710108790 Stromelysin-1 Proteins 0.000 description 1
- 101710108792 Stromelysin-2 Proteins 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- NHUHCSRWZMLRLA-UHFFFAOYSA-N Sulfisoxazole Chemical compound CC1=NOC(NS(=O)(=O)C=2C=CC(N)=CC=2)=C1C NHUHCSRWZMLRLA-UHFFFAOYSA-N 0.000 description 1
- 206010042553 Superficial spreading melanoma stage unspecified Diseases 0.000 description 1
- 101100215487 Sus scrofa ADRA2A gene Proteins 0.000 description 1
- 102000003705 Syndecan-1 Human genes 0.000 description 1
- 108090000058 Syndecan-1 Proteins 0.000 description 1
- 108090000054 Syndecan-2 Proteins 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- BXFOFFBJRFZBQZ-QYWOHJEZSA-N T-2 toxin Chemical compound C([C@@]12[C@]3(C)[C@H](OC(C)=O)[C@@H](O)[C@H]1O[C@H]1[C@]3(COC(C)=O)C[C@@H](C(=C1)C)OC(=O)CC(C)C)O2 BXFOFFBJRFZBQZ-QYWOHJEZSA-N 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 1
- 108700002718 TACI receptor-IgG Fc fragment fusion Proteins 0.000 description 1
- 108010034610 TG4010 Proteins 0.000 description 1
- 108700012920 TNF Proteins 0.000 description 1
- 108010000449 TNF-Related Apoptosis-Inducing Ligand Receptors Proteins 0.000 description 1
- 102000002259 TNF-Related Apoptosis-Inducing Ligand Receptors Human genes 0.000 description 1
- 108091007178 TNFRSF10A Proteins 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- 208000022292 Tay-Sachs disease Diseases 0.000 description 1
- 208000000491 Tendinopathy Diseases 0.000 description 1
- 206010043255 Tendonitis Diseases 0.000 description 1
- 208000004760 Tenosynovitis Diseases 0.000 description 1
- CGMTUJFWROPELF-UHFFFAOYSA-N Tenuazonic acid Natural products CCC(C)C1NC(=O)C(=C(C)/O)C1=O CGMTUJFWROPELF-UHFFFAOYSA-N 0.000 description 1
- 102100026404 Teratocarcinoma-derived growth factor 1 Human genes 0.000 description 1
- 206010043276 Teratoma Diseases 0.000 description 1
- JZRWCGZRTZMZEH-UHFFFAOYSA-N Thiamine Natural products CC1=C(CCO)SC=[N+]1CC1=CN=C(C)N=C1N JZRWCGZRTZMZEH-UHFFFAOYSA-N 0.000 description 1
- WKDDRNSBRWANNC-UHFFFAOYSA-N Thienamycin Natural products C1C(SCCN)=C(C(O)=O)N2C(=O)C(C(O)C)C21 WKDDRNSBRWANNC-UHFFFAOYSA-N 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 1
- 102100026966 Thrombomodulin Human genes 0.000 description 1
- 108010079274 Thrombomodulin Proteins 0.000 description 1
- 102000036693 Thrombopoietin Human genes 0.000 description 1
- 108010041111 Thrombopoietin Proteins 0.000 description 1
- 102100034195 Thrombopoietin Human genes 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- 201000009365 Thymic carcinoma Diseases 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 108010034949 Thyroglobulin Proteins 0.000 description 1
- 102000009843 Thyroglobulin Human genes 0.000 description 1
- HJLSLZFTEKNLFI-UHFFFAOYSA-N Tinidazole Chemical compound CCS(=O)(=O)CCN1C(C)=NC=C1[N+]([O-])=O HJLSLZFTEKNLFI-UHFFFAOYSA-N 0.000 description 1
- 208000009205 Tinnitus Diseases 0.000 description 1
- 108010031374 Tissue Inhibitor of Metalloproteinase-1 Proteins 0.000 description 1
- 108010031372 Tissue Inhibitor of Metalloproteinase-2 Proteins 0.000 description 1
- RTAQQCXQSZGOHL-UHFFFAOYSA-N Titanium Chemical compound [Ti] RTAQQCXQSZGOHL-UHFFFAOYSA-N 0.000 description 1
- 102000002689 Toll-like receptor Human genes 0.000 description 1
- 108020000411 Toll-like receptor Proteins 0.000 description 1
- 108010060888 Toll-like receptor 2 Proteins 0.000 description 1
- IWEQQRMGNVVKQW-OQKDUQJOSA-N Toremifene citrate Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 IWEQQRMGNVVKQW-OQKDUQJOSA-N 0.000 description 1
- 206010044221 Toxic encephalopathy Diseases 0.000 description 1
- 241000159243 Toxicodendron radicans Species 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 102000006747 Transforming Growth Factor alpha Human genes 0.000 description 1
- 102000011117 Transforming Growth Factor beta2 Human genes 0.000 description 1
- 101800000304 Transforming growth factor beta-2 Proteins 0.000 description 1
- 108060008539 Transglutaminase Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 241000589886 Treponema Species 0.000 description 1
- 206010044604 Trichiasis Diseases 0.000 description 1
- UMILHIMHKXVDGH-UHFFFAOYSA-N Triethylene glycol diglycidyl ether Chemical compound C1OC1COCCOCCOCCOCC1CO1 UMILHIMHKXVDGH-UHFFFAOYSA-N 0.000 description 1
- 108010065729 Troponin I Proteins 0.000 description 1
- 102000013394 Troponin I Human genes 0.000 description 1
- 206010054824 Tubo-ovarian abscess Diseases 0.000 description 1
- 108010065323 Tumor Necrosis Factor Ligand Superfamily Member 13 Proteins 0.000 description 1
- 102100024585 Tumor necrosis factor ligand superfamily member 13 Human genes 0.000 description 1
- 108050002568 Tumor necrosis factor ligand superfamily member 6 Proteins 0.000 description 1
- 102100040113 Tumor necrosis factor receptor superfamily member 10A Human genes 0.000 description 1
- 102100040110 Tumor necrosis factor receptor superfamily member 10D Human genes 0.000 description 1
- 101710178277 Tumor necrosis factor receptor superfamily member 10D Proteins 0.000 description 1
- 101710178302 Tumor necrosis factor receptor superfamily member 13B Proteins 0.000 description 1
- 101710187780 Tumor necrosis factor receptor superfamily member 14 Proteins 0.000 description 1
- 102100033725 Tumor necrosis factor receptor superfamily member 16 Human genes 0.000 description 1
- 101710187885 Tumor necrosis factor receptor superfamily member 17 Proteins 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- 101710187751 Tumor necrosis factor receptor superfamily member 21 Proteins 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 101710187622 Tumor necrosis factor receptor superfamily member 6B Proteins 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 239000004182 Tylosin Substances 0.000 description 1
- 229930194936 Tylosin Natural products 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 102100033438 Tyrosine-protein kinase JAK1 Human genes 0.000 description 1
- 102100037236 Tyrosine-protein kinase receptor UFO Human genes 0.000 description 1
- 101710192735 Tyrosine-protein kinase receptor UFO Proteins 0.000 description 1
- 108010021006 Tyrothricin Proteins 0.000 description 1
- 101710159648 Uncharacterized protein Proteins 0.000 description 1
- 208000006374 Uterine Cervicitis Diseases 0.000 description 1
- 206010046788 Uterine haemorrhage Diseases 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 108010079206 V-Set Domain-Containing T-Cell Activation Inhibitor 1 Proteins 0.000 description 1
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 1
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 206010046910 Vaginal haemorrhage Diseases 0.000 description 1
- 206010046914 Vaginal infection Diseases 0.000 description 1
- 201000008100 Vaginitis Diseases 0.000 description 1
- 108010000134 Vascular Cell Adhesion Molecule-1 Proteins 0.000 description 1
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 1
- 108010073919 Vascular Endothelial Growth Factor D Proteins 0.000 description 1
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 1
- 108010053100 Vascular Endothelial Growth Factor Receptor-3 Proteins 0.000 description 1
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 1
- 101710160666 Vascular cell adhesion protein 1 Proteins 0.000 description 1
- 102100038234 Vascular endothelial growth factor D Human genes 0.000 description 1
- 208000035868 Vascular inflammations Diseases 0.000 description 1
- 241001430183 Veillonellaceae Species 0.000 description 1
- 206010047249 Venous thrombosis Diseases 0.000 description 1
- 208000012886 Vertigo Diseases 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 239000004188 Virginiamycin Substances 0.000 description 1
- FPIPGXGPPPQFEQ-BOOMUCAASA-N Vitamin A Natural products OC/C=C(/C)\C=C\C=C(\C)/C=C/C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-BOOMUCAASA-N 0.000 description 1
- 229930003779 Vitamin B12 Natural products 0.000 description 1
- 229930003268 Vitamin C Natural products 0.000 description 1
- 229930003316 Vitamin D Natural products 0.000 description 1
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 1
- 229930003427 Vitamin E Natural products 0.000 description 1
- 229930003448 Vitamin K Natural products 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 208000003728 Vulvodynia Diseases 0.000 description 1
- 206010047791 Vulvovaginal dryness Diseases 0.000 description 1
- 206010069055 Vulvovaginal pain Diseases 0.000 description 1
- 102100020722 WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 Human genes 0.000 description 1
- 101710160039 WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 Proteins 0.000 description 1
- 102100036021 WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 Human genes 0.000 description 1
- 101710160038 WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 Proteins 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- PCWZKQSKUXXDDJ-UHFFFAOYSA-N Xanthotoxin Natural products COCc1c2OC(=O)C=Cc2cc3ccoc13 PCWZKQSKUXXDDJ-UHFFFAOYSA-N 0.000 description 1
- 208000005946 Xerostomia Diseases 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- NKVLDFAVEWLOCX-GUSKIFEASA-N [(2s,3r,4s,5r,6r)-3-[(2s,3r,4s,5r,6s)-5-[(2s,3r,4s,5r)-4-[(2s,3r,4r)-3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-yl]oxy-3,5-dihydroxyoxan-2-yl]oxy-3,4-dihydroxy-6-methyloxan-2-yl]oxy-4,5-dihydroxy-6-methyloxan-2-yl] (4ar,5r,6as,6br,9s,10s,12ar)-10-[(2r,3r,4s, Chemical compound O([C@H]1[C@H](O)CO[C@H]([C@@H]1O)O[C@H]1[C@H](C)O[C@H]([C@@H]([C@@H]1O)O)O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](C)O[C@H]1OC(=O)[C@]12CCC(C)(C)CC1C1=CCC3[C@@]([C@@]1(C[C@H]2O)C)(C)CCC1[C@]3(C)CC[C@@H]([C@@]1(C)C=O)O[C@@H]1O[C@@H]([C@H]([C@H](O[C@H]2[C@@H]([C@@H](O)[C@H](O)CO2)O)[C@H]1O[C@H]1[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O1)O)O)C(=O)NCCCCCCCCCCCC)[C@@H]1OC[C@](O)(CO)[C@H]1O NKVLDFAVEWLOCX-GUSKIFEASA-N 0.000 description 1
- UZQJVUCHXGYFLQ-AYDHOLPZSA-N [(2s,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-4-[(2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-6-(hydroxymethyl)-4-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-6-(hy Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@]([C@@]3(CC[C@H]2[C@@]1(C=O)C)C)(C)CC(O)[C@]1(CCC(CC14)(C)C)C(=O)O[C@H]1[C@@H]([C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O[C@H]4[C@@H]([C@@H](O[C@H]5[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O5)O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O UZQJVUCHXGYFLQ-AYDHOLPZSA-N 0.000 description 1
- FQVHOULQCKDUCY-OGHXVOSASA-N [(2s,3s,4r,6s)-6-[(2r,3s,4r,5r,6s)-6-[[(1s,3r,7r,8s,9s,10r,12r,14e,16s)-7-acetyloxy-8-methoxy-3,12-dimethyl-5,13-dioxo-10-(2-oxoethyl)-4,17-dioxabicyclo[14.1.0]heptadec-14-en-9-yl]oxy]-4-(dimethylamino)-5-hydroxy-2-methyloxan-3-yl]oxy-4-hydroxy-2,4-dimeth Chemical compound O([C@@H]1[C@@H](C)O[C@H]([C@@H]([C@H]1N(C)C)O)O[C@H]1[C@@H](CC=O)C[C@@H](C)C(=O)/C=C/[C@@H]2O[C@H]2C[C@@H](C)OC(=O)C[C@H]([C@@H]1OC)OC(C)=O)[C@H]1C[C@@](C)(O)[C@@H](OC(=O)CC(C)C)[C@H](C)O1 FQVHOULQCKDUCY-OGHXVOSASA-N 0.000 description 1
- SPJCRMJCFSJKDE-ZWBUGVOYSA-N [(3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-yl] 2-[4-[bis(2-chloroethyl)amino]phenyl]acetate Chemical compound O([C@@H]1CC2=CC[C@H]3[C@@H]4CC[C@@H]([C@]4(CC[C@@H]3[C@@]2(C)CC1)C)[C@H](C)CCCC(C)C)C(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 SPJCRMJCFSJKDE-ZWBUGVOYSA-N 0.000 description 1
- ZWBTYMGEBZUQTK-PVLSIAFMSA-N [(7S,9E,11S,12R,13S,14R,15R,16R,17S,18S,19E,21Z)-2,15,17,32-tetrahydroxy-11-methoxy-3,7,12,14,16,18,22-heptamethyl-1'-(2-methylpropyl)-6,23-dioxospiro[8,33-dioxa-24,27,29-triazapentacyclo[23.6.1.14,7.05,31.026,30]tritriaconta-1(32),2,4,9,19,21,24,26,30-nonaene-28,4'-piperidine]-13-yl] acetate Chemical compound CO[C@H]1\C=C\O[C@@]2(C)Oc3c(C2=O)c2c4NC5(CCN(CC(C)C)CC5)N=c4c(=NC(=O)\C(C)=C/C=C/[C@H](C)[C@H](O)[C@@H](C)[C@@H](O)[C@@H](C)[C@H](OC(C)=O)[C@@H]1C)c(O)c2c(O)c3C ZWBTYMGEBZUQTK-PVLSIAFMSA-N 0.000 description 1
- IFJUINDAXYAPTO-UUBSBJJBSA-N [(8r,9s,13s,14s,17s)-17-[2-[4-[4-[bis(2-chloroethyl)amino]phenyl]butanoyloxy]acetyl]oxy-13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthren-3-yl] benzoate Chemical compound C([C@@H]1[C@@H](C2=CC=3)CC[C@]4([C@H]1CC[C@@H]4OC(=O)COC(=O)CCCC=1C=CC(=CC=1)N(CCCl)CCCl)C)CC2=CC=3OC(=O)C1=CC=CC=C1 IFJUINDAXYAPTO-UUBSBJJBSA-N 0.000 description 1
- XZSRRNFBEIOBDA-CFNBKWCHSA-N [2-[(2s,4s)-4-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-3,4-dihydro-1h-tetracen-2-yl]-2-oxoethyl] 2,2-diethoxyacetate Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)C(OCC)OCC)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 XZSRRNFBEIOBDA-CFNBKWCHSA-N 0.000 description 1
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 1
- 241001531188 [Eubacterium] rectale Species 0.000 description 1
- 241001464867 [Ruminococcus] gnavus Species 0.000 description 1
- 241001464870 [Ruminococcus] torques Species 0.000 description 1
- 229960003697 abatacept Drugs 0.000 description 1
- 206010000269 abscess Diseases 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- ZOZKYEHVNDEUCO-XUTVFYLZSA-N aceglatone Chemical compound O1C(=O)[C@H](OC(C)=O)[C@@H]2OC(=O)[C@@H](OC(=O)C)[C@@H]21 ZOZKYEHVNDEUCO-XUTVFYLZSA-N 0.000 description 1
- 229950002684 aceglatone Drugs 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 208000006336 acinar cell carcinoma Diseases 0.000 description 1
- 206010000496 acne Diseases 0.000 description 1
- 201000004208 acquired thrombocytopenia Diseases 0.000 description 1
- 229940119059 actemra Drugs 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 201000003229 acute pancreatitis Diseases 0.000 description 1
- 125000002015 acyclic group Chemical group 0.000 description 1
- 208000002517 adenoid cystic carcinoma Diseases 0.000 description 1
- 201000008395 adenosquamous carcinoma Diseases 0.000 description 1
- 229950004955 adozelesin Drugs 0.000 description 1
- BYRVKDUQDLJUBX-JJCDCTGGSA-N adozelesin Chemical compound C1=CC=C2OC(C(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C[C@H]4C[C@]44C5=C(C(C=C43)=O)NC=C5C)=CC2=C1 BYRVKDUQDLJUBX-JJCDCTGGSA-N 0.000 description 1
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 1
- 230000001919 adrenal effect Effects 0.000 description 1
- 208000007128 adrenocortical carcinoma Diseases 0.000 description 1
- 201000000028 adult respiratory distress syndrome Diseases 0.000 description 1
- 241001148470 aerobic bacillus Species 0.000 description 1
- 229940042992 afinitor Drugs 0.000 description 1
- 235000013334 alcoholic beverage Nutrition 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 229960002478 aldosterone Drugs 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- FPIPGXGPPPQFEQ-OVSJKPMPSA-N all-trans-retinol Chemical compound OC\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-OVSJKPMPSA-N 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 208000002205 allergic conjunctivitis Diseases 0.000 description 1
- 208000002029 allergic contact dermatitis Diseases 0.000 description 1
- 208000030961 allergic reaction Diseases 0.000 description 1
- 208000028004 allergic respiratory disease Diseases 0.000 description 1
- 229940087168 alpha tocopherol Drugs 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 102000012005 alpha-2-HS-Glycoprotein Human genes 0.000 description 1
- 108010075843 alpha-2-HS-Glycoprotein Proteins 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- DTOSIQBPPRVQHS-PDBXOOCHSA-N alpha-linolenic acid Chemical compound CC\C=C/C\C=C/C\C=C/CCCCCCCC(O)=O DTOSIQBPPRVQHS-PDBXOOCHSA-N 0.000 description 1
- 235000020661 alpha-linolenic acid Nutrition 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 235000012211 aluminium silicate Nutrition 0.000 description 1
- 206010065867 alveolar rhabdomyosarcoma Diseases 0.000 description 1
- 208000006431 amelanotic melanoma Diseases 0.000 description 1
- 208000010029 ameloblastoma Diseases 0.000 description 1
- 229960004821 amikacin Drugs 0.000 description 1
- LKCWBDHBTVXHDL-RMDFUYIESA-N amikacin Chemical compound O([C@@H]1[C@@H](N)C[C@H]([C@@H]([C@H]1O)O[C@@H]1[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O1)O)NC(=O)[C@@H](O)CCN)[C@H]1O[C@H](CN)[C@@H](O)[C@H](O)[C@H]1O LKCWBDHBTVXHDL-RMDFUYIESA-N 0.000 description 1
- 229960003437 aminoglutethimide Drugs 0.000 description 1
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 1
- 229960002749 aminolevulinic acid Drugs 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 229960003022 amoxicillin Drugs 0.000 description 1
- LSQZJLSUYDQPKJ-NJBDSQKTSA-N amoxicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=C(O)C=C1 LSQZJLSUYDQPKJ-NJBDSQKTSA-N 0.000 description 1
- 108010079465 amphomycin Proteins 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 230000036783 anaphylactic response Effects 0.000 description 1
- 208000003455 anaphylaxis Diseases 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- BBDAGFIXKZCXAH-CCXZUQQUSA-N ancitabine Chemical compound N=C1C=CN2[C@@H]3O[C@H](CO)[C@@H](O)[C@@H]3OC2=N1 BBDAGFIXKZCXAH-CCXZUQQUSA-N 0.000 description 1
- 229950000242 ancitabine Drugs 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 108010069801 angiopoietin 4 Proteins 0.000 description 1
- 210000003423 ankle Anatomy 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- RWZYAGGXGHYGMB-UHFFFAOYSA-N anthranilic acid Chemical compound NC1=CC=CC=C1C(O)=O RWZYAGGXGHYGMB-UHFFFAOYSA-N 0.000 description 1
- 230000005911 anti-cytotoxic effect Effects 0.000 description 1
- 230000003432 anti-folate effect Effects 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 229940124599 anti-inflammatory drug Drugs 0.000 description 1
- 230000002590 anti-leukotriene effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 229940127074 antifolate Drugs 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 229940125715 antihistaminic agent Drugs 0.000 description 1
- 239000000739 antihistaminic agent Substances 0.000 description 1
- 239000003430 antimalarial agent Substances 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 238000011203 antimicrobial therapy Methods 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 230000005975 antitumor immune response Effects 0.000 description 1
- 230000036506 anxiety Effects 0.000 description 1
- 201000007436 apocrine adenocarcinoma Diseases 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- 150000008209 arabinosides Chemical class 0.000 description 1
- 229940078010 arimidex Drugs 0.000 description 1
- 229940087620 aromasin Drugs 0.000 description 1
- 230000006793 arrhythmia Effects 0.000 description 1
- 206010003119 arrhythmia Diseases 0.000 description 1
- 229940003446 arsphenamine Drugs 0.000 description 1
- VLAXZGHHBIJLAD-UHFFFAOYSA-N arsphenamine Chemical compound [Cl-].[Cl-].C1=C(O)C([NH3+])=CC([As]=[As]C=2C=C([NH3+])C(O)=CC=2)=C1 VLAXZGHHBIJLAD-UHFFFAOYSA-N 0.000 description 1
- 229940072107 ascorbate Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- 206010003549 asthenia Diseases 0.000 description 1
- 201000005476 astroblastoma Diseases 0.000 description 1
- 229950009925 atacicept Drugs 0.000 description 1
- 208000024998 atopic conjunctivitis Diseases 0.000 description 1
- 230000003416 augmentation Effects 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- AUJRCFUBUPVWSZ-XTZHGVARSA-M auranofin Chemical compound CCP(CC)(CC)=[Au]S[C@@H]1O[C@H](COC(C)=O)[C@@H](OC(C)=O)[C@H](OC(C)=O)[C@H]1OC(C)=O AUJRCFUBUPVWSZ-XTZHGVARSA-M 0.000 description 1
- 229960005207 auranofin Drugs 0.000 description 1
- 208000035362 autoimmune disorder of the nervous system Diseases 0.000 description 1
- 208000037979 autoimmune inflammatory disease Diseases 0.000 description 1
- 208000006424 autoimmune oophoritis Diseases 0.000 description 1
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 1
- 201000004988 autoimmune vasculitis Diseases 0.000 description 1
- 201000004562 autosomal dominant cerebellar ataxia Diseases 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- KLNFSAOEKUDMFA-UHFFFAOYSA-N azanide;2-hydroxyacetic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OCC(O)=O KLNFSAOEKUDMFA-UHFFFAOYSA-N 0.000 description 1
- 229950011321 azaserine Drugs 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 229960003623 azlocillin Drugs 0.000 description 1
- JTWOMNBEOCYFNV-NFFDBFGFSA-N azlocillin Chemical compound N([C@@H](C(=O)N[C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C=1C=CC=CC=1)C(=O)N1CCNC1=O JTWOMNBEOCYFNV-NFFDBFGFSA-N 0.000 description 1
- WZPBZJONDBGPKJ-VEHQQRBSSA-N aztreonam Chemical compound O=C1N(S([O-])(=O)=O)[C@@H](C)[C@@H]1NC(=O)C(=N/OC(C)(C)C(O)=O)\C1=CSC([NH3+])=N1 WZPBZJONDBGPKJ-VEHQQRBSSA-N 0.000 description 1
- 229960003644 aztreonam Drugs 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 239000000022 bacteriostatic agent Substances 0.000 description 1
- 201000007551 basophilic adenocarcinoma Diseases 0.000 description 1
- 235000015278 beef Nutrition 0.000 description 1
- 235000013405 beer Nutrition 0.000 description 1
- 229940116226 behenic acid Drugs 0.000 description 1
- 208000001119 benign fibrous histiocytoma Diseases 0.000 description 1
- 229940022836 benlysta Drugs 0.000 description 1
- BLFLLBZGZJTVJG-UHFFFAOYSA-N benzocaine Chemical compound CCOC(=O)C1=CC=C(N)C=C1 BLFLLBZGZJTVJG-UHFFFAOYSA-N 0.000 description 1
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 229960002537 betamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-DVTGEIKXSA-N betamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-DVTGEIKXSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 229940002008 bifidobacterium bifidum Drugs 0.000 description 1
- 239000012867 bioactive agent Substances 0.000 description 1
- 239000000227 bioadhesive Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 229950008548 bisantrene Drugs 0.000 description 1
- 235000015895 biscuits Nutrition 0.000 description 1
- 150000004663 bisphosphonates Chemical class 0.000 description 1
- 229950006844 bizelesin Drugs 0.000 description 1
- 208000034158 bleeding Diseases 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical class N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 208000010217 blepharitis Diseases 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000036772 blood pressure Effects 0.000 description 1
- 208000007047 blue nevus Diseases 0.000 description 1
- 201000011143 bone giant cell tumor Diseases 0.000 description 1
- 229940083476 bosulif Drugs 0.000 description 1
- 229960003736 bosutinib Drugs 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 229940077737 brain-derived neurotrophic factor Drugs 0.000 description 1
- 235000008429 bread Nutrition 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 201000003714 breast lobular carcinoma Diseases 0.000 description 1
- 201000011054 breast malignant phyllodes tumor Diseases 0.000 description 1
- 206010006451 bronchitis Diseases 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- 108010025307 buforin II Proteins 0.000 description 1
- MBABCNBNDNGODA-LUVUIASKSA-N bullatacin Chemical compound O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@@H]1[C@@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@@H](O)CC=2C(O[C@@H](C)C=2)=O)CC1 MBABCNBNDNGODA-LUVUIASKSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- PPKJUHVNTMYXOD-PZGPJMECSA-N c49ws9n75l Chemical compound O=C([C@@H]1N(C2=O)CC[C@H]1S(=O)(=O)CCN(CC)CC)O[C@H](C(C)C)[C@H](C)\C=C\C(=O)NC\C=C\C(\C)=C\[C@@H](O)CC(=O)CC1=NC2=CO1.N([C@@H]1C(=O)N[C@@H](C(N2CCC[C@H]2C(=O)N(C)[C@@H](CC=2C=CC(=CC=2)N(C)C)C(=O)N2C[C@@H](CS[C@H]3C4CCN(CC4)C3)C(=O)C[C@H]2C(=O)N[C@H](C(=O)O[C@@H]1C)C=1C=CC=CC=1)=O)CC)C(=O)C1=NC=CC=C1O PPKJUHVNTMYXOD-PZGPJMECSA-N 0.000 description 1
- 229960001292 cabozantinib Drugs 0.000 description 1
- ONIQOQHATWINJY-UHFFFAOYSA-N cabozantinib Chemical compound C=12C=C(OC)C(OC)=CC2=NC=CC=1OC(C=C1)=CC=C1NC(=O)C1(C(=O)NC=2C=CC(F)=CC=2)CC1 ONIQOQHATWINJY-UHFFFAOYSA-N 0.000 description 1
- 108700002839 cactinomycin Proteins 0.000 description 1
- 229950009908 cactinomycin Drugs 0.000 description 1
- 229960001948 caffeine Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- NKWPZUCBCARRDP-UHFFFAOYSA-L calcium bicarbonate Chemical compound [Ca+2].OC([O-])=O.OC([O-])=O NKWPZUCBCARRDP-UHFFFAOYSA-L 0.000 description 1
- 229910000020 calcium bicarbonate Inorganic materials 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 229950009823 calusterone Drugs 0.000 description 1
- IVFYLRMMHVYGJH-PVPPCFLZSA-N calusterone Chemical compound C1C[C@]2(C)[C@](O)(C)CC[C@H]2[C@@H]2[C@@H](C)CC3=CC(=O)CC[C@]3(C)[C@H]21 IVFYLRMMHVYGJH-PVPPCFLZSA-N 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 229960001838 canakinumab Drugs 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 229940056434 caprelsa Drugs 0.000 description 1
- 229960004602 capreomycin Drugs 0.000 description 1
- 235000013736 caramel Nutrition 0.000 description 1
- 229960003669 carbenicillin Drugs 0.000 description 1
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 description 1
- 229950005779 carbomycin Drugs 0.000 description 1
- 150000001721 carbon Chemical group 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 229960002115 carboquone Drugs 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 208000002458 carcinoid tumor Diseases 0.000 description 1
- 231100000259 cardiotoxicity Toxicity 0.000 description 1
- 229960003261 carmofur Drugs 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 229950007509 carzelesin Drugs 0.000 description 1
- BBZDXMBRAFTCAA-AREMUKBSSA-N carzelesin Chemical compound C1=2NC=C(C)C=2C([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)C3=CC4=CC=C(C=C4O3)N(CC)CC)=C2C=C1OC(=O)NC1=CC=CC=C1 BBZDXMBRAFTCAA-AREMUKBSSA-N 0.000 description 1
- 108010047060 carzinophilin Proteins 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 229960005361 cefaclor Drugs 0.000 description 1
- QYIYFLOTGYLRGG-GPCCPHFNSA-N cefaclor Chemical compound C1([C@H](C(=O)N[C@@H]2C(N3C(=C(Cl)CS[C@@H]32)C(O)=O)=O)N)=CC=CC=C1 QYIYFLOTGYLRGG-GPCCPHFNSA-N 0.000 description 1
- 229960004841 cefadroxil Drugs 0.000 description 1
- NBFNMSULHIODTC-CYJZLJNKSA-N cefadroxil monohydrate Chemical compound O.C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=C(O)C=C1 NBFNMSULHIODTC-CYJZLJNKSA-N 0.000 description 1
- 229960000603 cefalotin Drugs 0.000 description 1
- 229960003012 cefamandole Drugs 0.000 description 1
- OLVCFLKTBJRLHI-AXAPSJFSSA-N cefamandole Chemical compound CN1N=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)[C@H](O)C=3C=CC=CC=3)[C@H]2SC1 OLVCFLKTBJRLHI-AXAPSJFSSA-N 0.000 description 1
- 229960001139 cefazolin Drugs 0.000 description 1
- MLYYVTUWGNIJIB-BXKDBHETSA-N cefazolin Chemical compound S1C(C)=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CN3N=NN=C3)[C@H]2SC1 MLYYVTUWGNIJIB-BXKDBHETSA-N 0.000 description 1
- 229960003719 cefdinir Drugs 0.000 description 1
- RTXOFQZKPXMALH-GHXIOONMSA-N cefdinir Chemical compound S1C(N)=NC(C(=N\O)\C(=O)N[C@@H]2C(N3C(=C(C=C)CS[C@@H]32)C(O)=O)=O)=C1 RTXOFQZKPXMALH-GHXIOONMSA-N 0.000 description 1
- 229960004069 cefditoren Drugs 0.000 description 1
- KMIPKYQIOVAHOP-YLGJWRNMSA-N cefditoren Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1\C=C/C=1SC=NC=1C KMIPKYQIOVAHOP-YLGJWRNMSA-N 0.000 description 1
- 229960002100 cefepime Drugs 0.000 description 1
- HVFLCNVBZFFHBT-ZKDACBOMSA-N cefepime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1C[N+]1(C)CCCC1 HVFLCNVBZFFHBT-ZKDACBOMSA-N 0.000 description 1
- 229960002129 cefixime Drugs 0.000 description 1
- OKBVVJOGVLARMR-QSWIMTSFSA-N cefixime Chemical compound S1C(N)=NC(C(=N\OCC(O)=O)\C(=O)N[C@@H]2C(N3C(=C(C=C)CS[C@@H]32)C(O)=O)=O)=C1 OKBVVJOGVLARMR-QSWIMTSFSA-N 0.000 description 1
- 229960004682 cefoperazone Drugs 0.000 description 1
- GCFBRXLSHGKWDP-XCGNWRKASA-N cefoperazone Chemical compound O=C1C(=O)N(CC)CCN1C(=O)N[C@H](C=1C=CC(O)=CC=1)C(=O)N[C@@H]1C(=O)N2C(C(O)=O)=C(CSC=3N(N=NN=3)C)CS[C@@H]21 GCFBRXLSHGKWDP-XCGNWRKASA-N 0.000 description 1
- 229960004261 cefotaxime Drugs 0.000 description 1
- AZZMGZXNTDTSME-JUZDKLSSSA-M cefotaxime sodium Chemical compound [Na+].N([C@@H]1C(N2C(=C(COC(C)=O)CS[C@@H]21)C([O-])=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 AZZMGZXNTDTSME-JUZDKLSSSA-M 0.000 description 1
- 229960002682 cefoxitin Drugs 0.000 description 1
- 229960005090 cefpodoxime Drugs 0.000 description 1
- WYUSVOMTXWRGEK-HBWVYFAYSA-N cefpodoxime Chemical compound N([C@H]1[C@@H]2N(C1=O)C(=C(CS2)COC)C(O)=O)C(=O)C(=N/OC)\C1=CSC(N)=N1 WYUSVOMTXWRGEK-HBWVYFAYSA-N 0.000 description 1
- 229960002580 cefprozil Drugs 0.000 description 1
- ZCCUWMICIWSJIX-NQJJCJBVSA-N ceftaroline fosamil Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OCC)C=2N=C(NP(O)(O)=O)SN=2)CC=1SC(SC=1)=NC=1C1=CC=[N+](C)C=C1 ZCCUWMICIWSJIX-NQJJCJBVSA-N 0.000 description 1
- 229960004828 ceftaroline fosamil Drugs 0.000 description 1
- 229960000484 ceftazidime Drugs 0.000 description 1
- ORFOPKXBNMVMKC-DWVKKRMSSA-N ceftazidime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC(C)(C)C(O)=O)C=2N=C(N)SC=2)CC=1C[N+]1=CC=CC=C1 ORFOPKXBNMVMKC-DWVKKRMSSA-N 0.000 description 1
- 229960004086 ceftibuten Drugs 0.000 description 1
- UNJFKXSSGBWRBZ-BJCIPQKHSA-N ceftibuten Chemical compound S1C(N)=NC(C(=C\CC(O)=O)\C(=O)N[C@@H]2C(N3C(=CCS[C@@H]32)C(O)=O)=O)=C1 UNJFKXSSGBWRBZ-BJCIPQKHSA-N 0.000 description 1
- 229960001991 ceftizoxime Drugs 0.000 description 1
- NNULBSISHYWZJU-LLKWHZGFSA-N ceftizoxime Chemical compound N([C@@H]1C(N2C(=CCS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CSC(N)=N1 NNULBSISHYWZJU-LLKWHZGFSA-N 0.000 description 1
- VOAZJEPQLGBXGO-SDAWRPRTSA-N ceftobiprole Chemical compound S1C(N)=NC(C(=N\O)\C(=O)N[C@@H]2C(N3C(=C(\C=C/4C(N([C@H]5CNCC5)CC\4)=O)CS[C@@H]32)C(O)=O)=O)=N1 VOAZJEPQLGBXGO-SDAWRPRTSA-N 0.000 description 1
- 229950004259 ceftobiprole Drugs 0.000 description 1
- 229960004755 ceftriaxone Drugs 0.000 description 1
- VAAUVRVFOQPIGI-SPQHTLEESA-N ceftriaxone Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=NC(=O)C(=O)NN1C VAAUVRVFOQPIGI-SPQHTLEESA-N 0.000 description 1
- 229960001668 cefuroxime Drugs 0.000 description 1
- JFPVXVDWJQMJEE-IZRZKJBUSA-N cefuroxime Chemical compound N([C@@H]1C(N2C(=C(COC(N)=O)CS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CC=CO1 JFPVXVDWJQMJEE-IZRZKJBUSA-N 0.000 description 1
- 229960000590 celecoxib Drugs 0.000 description 1
- RZEKVGVHFLEQIL-UHFFFAOYSA-N celecoxib Chemical compound C1=CC(C)=CC=C1C1=CC(C(F)(F)F)=NN1C1=CC=C(S(N)(=O)=O)C=C1 RZEKVGVHFLEQIL-UHFFFAOYSA-N 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 229920003174 cellulose-based polymer Polymers 0.000 description 1
- 208000015114 central nervous system disease Diseases 0.000 description 1
- 229940106164 cephalexin Drugs 0.000 description 1
- ZAIPMKNFIOOWCQ-UEKVPHQBSA-N cephalexin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=CC=C1 ZAIPMKNFIOOWCQ-UEKVPHQBSA-N 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 201000002891 ceruminous adenocarcinoma Diseases 0.000 description 1
- 208000024188 ceruminous carcinoma Diseases 0.000 description 1
- 206010008323 cervicitis Diseases 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 235000013351 cheese Nutrition 0.000 description 1
- BGTFCAQCKWKTRL-YDEUACAXSA-N chembl1095986 Chemical compound C1[C@@H](N)[C@@H](O)[C@H](C)O[C@H]1O[C@@H]([C@H]1C(N[C@H](C2=CC(O)=CC(O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O)=C2C=2C(O)=CC=C(C=2)[C@@H](NC(=O)[C@@H]2NC(=O)[C@@H]3C=4C=C(C(=C(O)C=4)C)OC=4C(O)=CC=C(C=4)[C@@H](N)C(=O)N[C@@H](C(=O)N3)[C@H](O)C=3C=CC(O4)=CC=3)C(=O)N1)C(O)=O)=O)C(C=C1)=CC=C1OC1=C(O[C@@H]3[C@H]([C@H](O)[C@@H](O)[C@H](CO[C@@H]5[C@H]([C@@H](O)[C@H](O)[C@@H](C)O5)O)O3)O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@@H]3[C@H]([C@H](O)[C@@H](CO)O3)O)C4=CC2=C1 BGTFCAQCKWKTRL-YDEUACAXSA-N 0.000 description 1
- UKVZSPHYQJNTOU-IVBHRGSNSA-N chembl1240717 Chemical compound C([C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)[C@H](C)O)CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(O)=O)C1=CC=CC=C1 UKVZSPHYQJNTOU-IVBHRGSNSA-N 0.000 description 1
- JDECNKBYILMOLE-CJQFIEQYSA-N chembl1255887 Chemical compound O1COC(=C(C)C2=O)C3=C1\C(C)=C\[C@@](C)(O)[C@H](O)[C@@H](C)[C@@H](O)[C@H](C(=O)OC)[C@H](O)[C@H](C)[C@H](O)[C@H](C)\C=C/C=C(C)/C(=O)NC1=C(C)C(OC(C)=O)=C3C2=C1O JDECNKBYILMOLE-CJQFIEQYSA-N 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 230000035605 chemotaxis Effects 0.000 description 1
- 235000015218 chewing gum Nutrition 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 229950008249 chlornaphazine Drugs 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229960003677 chloroquine Drugs 0.000 description 1
- WHTVZRBIWZFKQO-UHFFFAOYSA-N chloroquine Natural products ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-UHFFFAOYSA-N 0.000 description 1
- BFPSDSIWYFKGBC-UHFFFAOYSA-N chlorotrianisene Chemical compound C1=CC(OC)=CC=C1C(Cl)=C(C=1C=CC(OC)=CC=1)C1=CC=C(OC)C=C1 BFPSDSIWYFKGBC-UHFFFAOYSA-N 0.000 description 1
- 229960001480 chlorozotocin Drugs 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 208000003167 cholangitis Diseases 0.000 description 1
- 201000001352 cholecystitis Diseases 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 229940127243 cholinergic drug Drugs 0.000 description 1
- 201000005217 chondroblastoma Diseases 0.000 description 1
- 208000002849 chondrocalcinosis Diseases 0.000 description 1
- 201000004709 chorioretinitis Diseases 0.000 description 1
- WTFXTQVDAKGDEY-HTQZYQBOSA-L chorismate(2-) Chemical compound O[C@@H]1C=CC(C([O-])=O)=C[C@H]1OC(=C)C([O-])=O WTFXTQVDAKGDEY-HTQZYQBOSA-L 0.000 description 1
- 229910052804 chromium Inorganic materials 0.000 description 1
- 239000011651 chromium Substances 0.000 description 1
- 201000010240 chromophobe renal cell carcinoma Diseases 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 208000013507 chronic prostatitis Diseases 0.000 description 1
- 229940090100 cimzia Drugs 0.000 description 1
- 229960003405 ciprofloxacin Drugs 0.000 description 1
- SECPZKHBENQXJG-UHFFFAOYSA-N cis-palmitoleic acid Natural products CCCCCCC=CCCCCCCCC(O)=O SECPZKHBENQXJG-UHFFFAOYSA-N 0.000 description 1
- 229940090805 clavulanate Drugs 0.000 description 1
- 229960003324 clavulanic acid Drugs 0.000 description 1
- 229960002227 clindamycin Drugs 0.000 description 1
- KDLRVYVGXIQJDK-AWPVFWJPSA-N clindamycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 KDLRVYVGXIQJDK-AWPVFWJPSA-N 0.000 description 1
- ACSIXWWBWUQEHA-UHFFFAOYSA-N clodronic acid Chemical compound OP(O)(=O)C(Cl)(Cl)P(O)(O)=O ACSIXWWBWUQEHA-UHFFFAOYSA-N 0.000 description 1
- 229960002286 clodronic acid Drugs 0.000 description 1
- 229960004287 clofazimine Drugs 0.000 description 1
- WDQPAMHFFCXSNU-BGABXYSRSA-N clofazimine Chemical compound C12=CC=CC=C2N=C2C=C(NC=3C=CC(Cl)=CC=3)C(=N/C(C)C)/C=C2N1C1=CC=C(Cl)C=C1 WDQPAMHFFCXSNU-BGABXYSRSA-N 0.000 description 1
- 229960003326 cloxacillin Drugs 0.000 description 1
- LQOLIRLGBULYKD-JKIFEVAISA-N cloxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1Cl LQOLIRLGBULYKD-JKIFEVAISA-N 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 230000008045 co-localization Effects 0.000 description 1
- AGVAZMGAQJOSFJ-WZHZPDAFSA-M cobalt(2+);[(2r,3s,4r,5s)-5-(5,6-dimethylbenzimidazol-1-yl)-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] [(2r)-1-[3-[(1r,2r,3r,4z,7s,9z,12s,13s,14z,17s,18s,19r)-2,13,18-tris(2-amino-2-oxoethyl)-7,12,17-tris(3-amino-3-oxopropyl)-3,5,8,8,13,15,18,19-octamethyl-2 Chemical compound [Co+2].N#[C-].[N-]([C@@H]1[C@H](CC(N)=O)[C@@]2(C)CCC(=O)NC[C@@H](C)OP(O)(=O)O[C@H]3[C@H]([C@H](O[C@@H]3CO)N3C4=CC(C)=C(C)C=C4N=C3)O)\C2=C(C)/C([C@H](C\2(C)C)CCC(N)=O)=N/C/2=C\C([C@H]([C@@]/2(CC(N)=O)C)CCC(N)=O)=N\C\2=C(C)/C2=N[C@]1(C)[C@@](C)(CC(N)=O)[C@@H]2CCC(N)=O AGVAZMGAQJOSFJ-WZHZPDAFSA-M 0.000 description 1
- 229950005980 cobiprostone Drugs 0.000 description 1
- 208000010877 cognitive disease Diseases 0.000 description 1
- 229960003346 colistin Drugs 0.000 description 1
- 230000000112 colonic effect Effects 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 208000011588 combined hepatocellular carcinoma and cholangiocarcinoma Diseases 0.000 description 1
- 238000005056 compaction Methods 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 235000014510 cooky Nutrition 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 229910001431 copper ion Inorganic materials 0.000 description 1
- 210000004087 cornea Anatomy 0.000 description 1
- 208000029078 coronary artery disease Diseases 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- 229940111134 coxibs Drugs 0.000 description 1
- 229960005061 crizotinib Drugs 0.000 description 1
- 229960000265 cromoglicic acid Drugs 0.000 description 1
- 238000009295 crossflow filtration Methods 0.000 description 1
- 239000002577 cryoprotective agent Substances 0.000 description 1
- 108010089438 cryptophycin 1 Proteins 0.000 description 1
- PSNOPSMXOBPNNV-VVCTWANISA-N cryptophycin 1 Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H]2[C@H](O2)C=2C=CC=CC=2)C/C=C/C(=O)N1 PSNOPSMXOBPNNV-VVCTWANISA-N 0.000 description 1
- 108010090203 cryptophycin 8 Proteins 0.000 description 1
- PSNOPSMXOBPNNV-UHFFFAOYSA-N cryptophycin-327 Natural products C1=C(Cl)C(OC)=CC=C1CC1C(=O)NCC(C)C(=O)OC(CC(C)C)C(=O)OC(C(C)C2C(O2)C=2C=CC=CC=2)CC=CC(=O)N1 PSNOPSMXOBPNNV-UHFFFAOYSA-N 0.000 description 1
- 238000011498 curative surgery Methods 0.000 description 1
- 235000012754 curcumin Nutrition 0.000 description 1
- 239000004148 curcumin Substances 0.000 description 1
- 229940109262 curcumin Drugs 0.000 description 1
- 235000021438 curry Nutrition 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- 239000003255 cyclooxygenase 2 inhibitor Substances 0.000 description 1
- 229960003077 cycloserine Drugs 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 229960002433 cysteine Drugs 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 239000000430 cytokine receptor antagonist Substances 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 201000004400 dacryoadenitis Diseases 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 229960000860 dapsone Drugs 0.000 description 1
- 229960002448 dasatinib Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- ZESRJSPZRDMNHY-UHFFFAOYSA-N de-oxy corticosterone Natural products O=C1CCC2(C)C3CCC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 ZESRJSPZRDMNHY-UHFFFAOYSA-N 0.000 description 1
- 239000000850 decongestant Substances 0.000 description 1
- 229940124581 decongestants Drugs 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 229960002398 demeclocycline Drugs 0.000 description 1
- 229960005052 demecolcine Drugs 0.000 description 1
- 229960001251 denosumab Drugs 0.000 description 1
- 238000000432 density-gradient centrifugation Methods 0.000 description 1
- 229940119740 deoxycorticosterone Drugs 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- 229950003913 detorubicin Drugs 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000011026 diafiltration Methods 0.000 description 1
- WVYXNIXAMZOZFK-UHFFFAOYSA-N diaziquone Chemical compound O=C1C(NC(=O)OCC)=C(N2CC2)C(=O)C(NC(=O)OCC)=C1N1CC1 WVYXNIXAMZOZFK-UHFFFAOYSA-N 0.000 description 1
- 229950002389 diaziquone Drugs 0.000 description 1
- 229960001259 diclofenac Drugs 0.000 description 1
- DCOPUUMXTXDBNB-UHFFFAOYSA-N diclofenac Chemical compound OC(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl DCOPUUMXTXDBNB-UHFFFAOYSA-N 0.000 description 1
- YFAGHNZHGGCZAX-JKIFEVAISA-N dicloxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=C(Cl)C=CC=C1Cl YFAGHNZHGGCZAX-JKIFEVAISA-N 0.000 description 1
- 229960001585 dicloxacillin Drugs 0.000 description 1
- VFLDPWHFBUODDF-UHFFFAOYSA-N diferuloylmethane Natural products C1=C(O)C(OC)=CC(C=CC(=O)CC(=O)C=CC=2C=C(OC)C(O)=CC=2)=C1 VFLDPWHFBUODDF-UHFFFAOYSA-N 0.000 description 1
- 208000010643 digestive system disease Diseases 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- AIUDWMLXCFRVDR-UHFFFAOYSA-N dimethyl 2-(3-ethyl-3-methylpentyl)propanedioate Chemical compound CCC(C)(CC)CCC(C(=O)OC)C(=O)OC AIUDWMLXCFRVDR-UHFFFAOYSA-N 0.000 description 1
- 229960004100 dirithromycin Drugs 0.000 description 1
- WLOHNSSYAXHWNR-NXPDYKKBSA-N dirithromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H]2O[C@H](COCCOC)N[C@H]([C@@H]2C)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 WLOHNSSYAXHWNR-NXPDYKKBSA-N 0.000 description 1
- VXIHRIQNJCRFQX-UHFFFAOYSA-K disodium aurothiomalate Chemical compound [Na+].[Na+].[O-]C(=O)CC(S[Au])C([O-])=O VXIHRIQNJCRFQX-UHFFFAOYSA-K 0.000 description 1
- VLARUOGDXDTHEH-UHFFFAOYSA-L disodium cromoglycate Chemical compound [Na+].[Na+].O1C(C([O-])=O)=CC(=O)C2=C1C=CC=C2OCC(O)COC1=CC=CC2=C1C(=O)C=C(C([O-])=O)O2 VLARUOGDXDTHEH-UHFFFAOYSA-L 0.000 description 1
- HSYBQXDGYCYSGA-UHFFFAOYSA-L disodium;[6-[[5-fluoro-2-(3,4,5-trimethoxyanilino)pyrimidin-4-yl]amino]-2,2-dimethyl-3-oxopyrido[3,2-b][1,4]oxazin-4-yl]methyl phosphate Chemical compound [Na+].[Na+].COC1=C(OC)C(OC)=CC(NC=2N=C(NC=3N=C4N(COP([O-])([O-])=O)C(=O)C(C)(C)OC4=CC=3)C(F)=CN=2)=C1 HSYBQXDGYCYSGA-UHFFFAOYSA-L 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 208000002173 dizziness Diseases 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 229940090949 docosahexaenoic acid Drugs 0.000 description 1
- KFEVDPWXEVUUMW-UHFFFAOYSA-N docosanoic acid Natural products CCCCCCCCCCCCCCCCCCCCCC(=O)OCCC1=CC=C(O)C=C1 KFEVDPWXEVUUMW-UHFFFAOYSA-N 0.000 description 1
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 1
- 229930188854 dolastatin Natural products 0.000 description 1
- 229960000895 doripenem Drugs 0.000 description 1
- AVAACINZEOAHHE-VFZPANTDSA-N doripenem Chemical compound C=1([C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)S[C@@H]1CN[C@H](CNS(N)(=O)=O)C1 AVAACINZEOAHHE-VFZPANTDSA-N 0.000 description 1
- 230000005059 dormancy Effects 0.000 description 1
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- NOTIQUSPUUHHEH-UXOVVSIBSA-N dromostanolone propionate Chemical compound C([C@@H]1CC2)C(=O)[C@H](C)C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](OC(=O)CC)[C@@]2(C)CC1 NOTIQUSPUUHHEH-UXOVVSIBSA-N 0.000 description 1
- 229950004683 drostanolone propionate Drugs 0.000 description 1
- 229960001850 droxicam Drugs 0.000 description 1
- OEHFRZLKGRKFAS-UHFFFAOYSA-N droxicam Chemical compound C12=CC=CC=C2S(=O)(=O)N(C)C(C2=O)=C1OC(=O)N2C1=CC=CC=N1 OEHFRZLKGRKFAS-UHFFFAOYSA-N 0.000 description 1
- 230000037336 dry skin Effects 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- 210000001198 duodenum Anatomy 0.000 description 1
- AFMYMMXSQGUCBK-AKMKHHNQSA-N dynemicin a Chemical compound C1#C\C=C/C#C[C@@H]2NC(C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C3)=C3[C@@]34O[C@]32[C@@H](C)C(C(O)=O)=C(OC)[C@H]41 AFMYMMXSQGUCBK-AKMKHHNQSA-N 0.000 description 1
- 208000019479 dysautonomia Diseases 0.000 description 1
- 208000010118 dystonia Diseases 0.000 description 1
- 208000019258 ear infection Diseases 0.000 description 1
- FSIRXIHZBIXHKT-MHTVFEQDSA-N edatrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CC(CC)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FSIRXIHZBIXHKT-MHTVFEQDSA-N 0.000 description 1
- 229950006700 edatrexate Drugs 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 229960005135 eicosapentaenoic acid Drugs 0.000 description 1
- JAZBEHYOTPTENJ-UHFFFAOYSA-N eicosapentaenoic acid Natural products CCC=CCC=CCC=CCC=CCC=CCCCC(O)=O JAZBEHYOTPTENJ-UHFFFAOYSA-N 0.000 description 1
- IQLUYYHUNSSHIY-HZUMYPAESA-N eicosatetraenoic acid Chemical compound CCCCCCCCCCC\C=C\C=C\C=C\C=C\C(O)=O IQLUYYHUNSSHIY-HZUMYPAESA-N 0.000 description 1
- 229940108623 eicosenoic acid Drugs 0.000 description 1
- BITHHVVYSMSWAG-UHFFFAOYSA-N eicosenoic acid Natural products CCCCCCCCC=CCCCCCCCCCC(O)=O BITHHVVYSMSWAG-UHFFFAOYSA-N 0.000 description 1
- MDCUNMLZLNGCQA-HWOAGHQOSA-N elafin Chemical compound N([C@H](C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H]1C(=O)N2CCC[C@H]2C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H]2CSSC[C@H]3C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CSSC[C@H]4C(=O)N5CCC[C@H]5C(=O)NCC(=O)N[C@H](C(N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H]5N(CCC5)C(=O)[C@H]5N(CCC5)C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H](C)NC2=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N4)C(=O)N[C@@H](CSSC1)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N3)=O)[C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(N)=O)C(O)=O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)C(C)C)C(C)C)C(=O)[C@@H]1CCCN1C(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)N MDCUNMLZLNGCQA-HWOAGHQOSA-N 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- XOPYFXBZMVTEJF-PDACKIITSA-N eleutherobin Chemical compound C(/[C@H]1[C@H](C(=CC[C@@H]1C(C)C)C)C[C@@H]([C@@]1(C)O[C@@]2(C=C1)OC)OC(=O)\C=C\C=1N=CN(C)C=1)=C2\CO[C@@H]1OC[C@@H](O)[C@@H](O)[C@@H]1OC(C)=O XOPYFXBZMVTEJF-PDACKIITSA-N 0.000 description 1
- XOPYFXBZMVTEJF-UHFFFAOYSA-N eleutherobin Natural products C1=CC2(OC)OC1(C)C(OC(=O)C=CC=1N=CN(C)C=1)CC(C(=CCC1C(C)C)C)C1C=C2COC1OCC(O)C(O)C1OC(C)=O XOPYFXBZMVTEJF-UHFFFAOYSA-N 0.000 description 1
- 229950000549 elliptinium acetate Drugs 0.000 description 1
- 201000009409 embryonal rhabdomyosarcoma Diseases 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 229940073621 enbrel Drugs 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 201000002491 encephalomyelitis Diseases 0.000 description 1
- 206010014665 endocarditis Diseases 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- JOZGNYDSEBIJDH-UHFFFAOYSA-N eniluracil Chemical compound O=C1NC=C(C#C)C(=O)N1 JOZGNYDSEBIJDH-UHFFFAOYSA-N 0.000 description 1
- 229950010213 eniluracil Drugs 0.000 description 1
- 229950011487 enocitabine Drugs 0.000 description 1
- 229960002549 enoxacin Drugs 0.000 description 1
- IDYZIJYBMGIQMJ-UHFFFAOYSA-N enoxacin Chemical compound N1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNCC1 IDYZIJYBMGIQMJ-UHFFFAOYSA-N 0.000 description 1
- 230000000688 enterotoxigenic effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000002327 eosinophilic effect Effects 0.000 description 1
- 229940116977 epidermal growth factor Drugs 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 201000010063 epididymitis Diseases 0.000 description 1
- 206010015037 epilepsy Diseases 0.000 description 1
- 229960005139 epinephrine Drugs 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 208000001780 epistaxis Diseases 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 201000010877 epithelioid cell melanoma Diseases 0.000 description 1
- 229950002973 epitiostanol Drugs 0.000 description 1
- 229930013356 epothilone Natural products 0.000 description 1
- 150000003883 epothilone derivatives Chemical class 0.000 description 1
- 229940082789 erbitux Drugs 0.000 description 1
- 229960002061 ergocalciferol Drugs 0.000 description 1
- 229960005073 erlotinib hydrochloride Drugs 0.000 description 1
- 229960002770 ertapenem Drugs 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 229960003276 erythromycin Drugs 0.000 description 1
- 239000004174 erythrosine Substances 0.000 description 1
- 229960004770 esomeprazole Drugs 0.000 description 1
- SUBDBMMJDZJVOS-DEOSSOPVSA-N esomeprazole Chemical compound C([S@](=O)C1=NC2=CC=C(C=C2N1)OC)C1=NC=C(C)C(OC)=C1C SUBDBMMJDZJVOS-DEOSSOPVSA-N 0.000 description 1
- 208000006881 esophagitis Diseases 0.000 description 1
- 210000003238 esophagus Anatomy 0.000 description 1
- ITSGNOIFAJAQHJ-BMFNZSJVSA-N esorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)C[C@H](C)O1 ITSGNOIFAJAQHJ-BMFNZSJVSA-N 0.000 description 1
- 229950002017 esorubicin Drugs 0.000 description 1
- LJQQFQHBKUKHIS-WJHRIEJJSA-N esperamicin Chemical compound O1CC(NC(C)C)C(OC)CC1OC1C(O)C(NOC2OC(C)C(SC)C(O)C2)C(C)OC1OC1C(\C2=C/CSSSC)=C(NC(=O)OC)C(=O)C(OC3OC(C)C(O)C(OC(=O)C=4C(=CC(OC)=C(OC)C=4)NC(=O)C(=C)OC)C3)C2(O)C#C\C=C/C#C1 LJQQFQHBKUKHIS-WJHRIEJJSA-N 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 229960000285 ethambutol Drugs 0.000 description 1
- AEOCXXJPGCBFJA-UHFFFAOYSA-N ethionamide Chemical compound CCC1=CC(C(N)=S)=CC=N1 AEOCXXJPGCBFJA-UHFFFAOYSA-N 0.000 description 1
- 229960002001 ethionamide Drugs 0.000 description 1
- QSRLNKCNOLVZIR-KRWDZBQOSA-N ethyl (2s)-2-[[2-[4-[bis(2-chloroethyl)amino]phenyl]acetyl]amino]-4-methylsulfanylbutanoate Chemical compound CCOC(=O)[C@H](CCSC)NC(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 QSRLNKCNOLVZIR-KRWDZBQOSA-N 0.000 description 1
- 229960005237 etoglucid Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960004945 etoricoxib Drugs 0.000 description 1
- MNJVRJDLRVPLFE-UHFFFAOYSA-N etoricoxib Chemical compound C1=NC(C)=CC=C1C1=NC=C(Cl)C=C1C1=CC=C(S(C)(=O)=O)C=C1 MNJVRJDLRVPLFE-UHFFFAOYSA-N 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 229960000255 exemestane Drugs 0.000 description 1
- 208000004526 exfoliative dermatitis Diseases 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 210000000744 eyelid Anatomy 0.000 description 1
- 229940043168 fareston Drugs 0.000 description 1
- 229940087861 faslodex Drugs 0.000 description 1
- 206010016256 fatigue Diseases 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 229940087476 femara Drugs 0.000 description 1
- ZWJINEZUASEZBH-UHFFFAOYSA-N fenamic acid Chemical class OC(=O)C1=CC=CC=C1NC1=CC=CC=C1 ZWJINEZUASEZBH-UHFFFAOYSA-N 0.000 description 1
- 229960001419 fenoprofen Drugs 0.000 description 1
- 229960002428 fentanyl Drugs 0.000 description 1
- PJMPHNIQZUBGLI-UHFFFAOYSA-N fentanyl Chemical compound C=1C=CC=CC=1N(C(=O)CC)C(CC1)CCN1CCC1=CC=CC=C1 PJMPHNIQZUBGLI-UHFFFAOYSA-N 0.000 description 1
- 235000019985 fermented beverage Nutrition 0.000 description 1
- 229960004642 ferric ammonium citrate Drugs 0.000 description 1
- KTWOOEGAPBSYNW-UHFFFAOYSA-N ferrocene Chemical class [Fe+2].C=1C=C[CH-]C=1.C=1C=C[CH-]C=1 KTWOOEGAPBSYNW-UHFFFAOYSA-N 0.000 description 1
- 230000035558 fertility Effects 0.000 description 1
- 201000001169 fibrillary astrocytoma Diseases 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 201000008825 fibrosarcoma of bone Diseases 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 229960000556 fingolimod Drugs 0.000 description 1
- KKGQTZUTZRNORY-UHFFFAOYSA-N fingolimod Chemical compound CCCCCCCCC1=CC=C(CCC(N)(CO)CO)C=C1 KKGQTZUTZRNORY-UHFFFAOYSA-N 0.000 description 1
- FULAPETWGIGNMT-UHFFFAOYSA-N firocoxib Chemical compound C=1C=C(S(C)(=O)=O)C=CC=1C=1C(C)(C)OC(=O)C=1OCC1CC1 FULAPETWGIGNMT-UHFFFAOYSA-N 0.000 description 1
- 229960002524 firocoxib Drugs 0.000 description 1
- 206010016766 flatulence Diseases 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 229960004273 floxacillin Drugs 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 229960002011 fludrocortisone Drugs 0.000 description 1
- AAXVEMMRQDVLJB-BULBTXNYSA-N fludrocortisone Chemical compound O=C1CC[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 AAXVEMMRQDVLJB-BULBTXNYSA-N 0.000 description 1
- LPEPZBJOKDYZAD-UHFFFAOYSA-N flufenamic acid Chemical compound OC(=O)C1=CC=CC=C1NC1=CC=CC(C(F)(F)F)=C1 LPEPZBJOKDYZAD-UHFFFAOYSA-N 0.000 description 1
- 229960004369 flufenamic acid Drugs 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 1
- 229960002390 flurbiprofen Drugs 0.000 description 1
- SYTBZMRGLBWNTM-UHFFFAOYSA-N flurbiprofen Chemical compound FC1=CC(C(C(O)=O)C)=CC=C1C1=CC=CC=C1 SYTBZMRGLBWNTM-UHFFFAOYSA-N 0.000 description 1
- 238000011010 flushing procedure Methods 0.000 description 1
- 108010003374 fms-Like Tyrosine Kinase 3 Proteins 0.000 description 1
- 229940014144 folate Drugs 0.000 description 1
- 239000004052 folic acid antagonist Substances 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 229940028334 follicle stimulating hormone Drugs 0.000 description 1
- 230000003325 follicular Effects 0.000 description 1
- 229950004923 fontolizumab Drugs 0.000 description 1
- 235000012041 food component Nutrition 0.000 description 1
- 239000005428 food component Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 210000002683 foot Anatomy 0.000 description 1
- 229960000308 fosfomycin Drugs 0.000 description 1
- YMDXZJFXQJVXBF-STHAYSLISA-N fosfomycin Chemical compound C[C@@H]1O[C@@H]1P(O)(O)=O YMDXZJFXQJVXBF-STHAYSLISA-N 0.000 description 1
- 229950005309 fostamatinib Drugs 0.000 description 1
- GKDRMWXFWHEQQT-UHFFFAOYSA-N fostamatinib Chemical compound COC1=C(OC)C(OC)=CC(NC=2N=C(NC=3N=C4N(COP(O)(O)=O)C(=O)C(C)(C)OC4=CC=3)C(F)=CN=2)=C1 GKDRMWXFWHEQQT-UHFFFAOYSA-N 0.000 description 1
- 229960004783 fotemustine Drugs 0.000 description 1
- YAKWPXVTIGTRJH-UHFFFAOYSA-N fotemustine Chemical compound CCOP(=O)(OCC)C(C)NC(=O)N(CCCl)N=O YAKWPXVTIGTRJH-UHFFFAOYSA-N 0.000 description 1
- 229940118764 francisella tularensis Drugs 0.000 description 1
- 235000021588 free fatty acids Nutrition 0.000 description 1
- 108010018632 frizzled related protein-3 Proteins 0.000 description 1
- 235000011389 fruit/vegetable juice Nutrition 0.000 description 1
- 229960002258 fulvestrant Drugs 0.000 description 1
- 235000020510 functional beverage Nutrition 0.000 description 1
- 235000013376 functional food Nutrition 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 229940110710 fusidate Drugs 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 229910052733 gallium Inorganic materials 0.000 description 1
- 229940044658 gallium nitrate Drugs 0.000 description 1
- WIGCFUFOHFEKBI-UHFFFAOYSA-N gamma-tocopherol Natural products CC(C)CCCC(C)CCCC(C)CCCC1CCC2C(C)C(O)C(C)C(C)C2O1 WIGCFUFOHFEKBI-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 208000015419 gastrin-producing neuroendocrine tumor Diseases 0.000 description 1
- 201000000052 gastrinoma Diseases 0.000 description 1
- 229960003923 gatifloxacin Drugs 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960003170 gemifloxacin Drugs 0.000 description 1
- ZRCVYEYHRGVLOC-HYARGMPZSA-N gemifloxacin Chemical compound C1C(CN)C(=N/OC)/CN1C(C(=C1)F)=NC2=C1C(=O)C(C(O)=O)=CN2C1CC1 ZRCVYEYHRGVLOC-HYARGMPZSA-N 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 230000035784 germination Effects 0.000 description 1
- 208000007565 gingivitis Diseases 0.000 description 1
- 229940080856 gleevec Drugs 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 201000002264 glomangiosarcoma Diseases 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 229940096919 glycogen Drugs 0.000 description 1
- 150000002337 glycosamines Chemical group 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 102000035122 glycosylated proteins Human genes 0.000 description 1
- 108091005608 glycosylated proteins Proteins 0.000 description 1
- 150000002343 gold Chemical class 0.000 description 1
- 208000024908 graft versus host disease Diseases 0.000 description 1
- 229960004905 gramicidin Drugs 0.000 description 1
- ZWCXYZRRTRDGQE-SORVKSEFSA-N gramicidina Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CC=3C4=CC=CC=C4NC=3)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](C(C)C)NC(=O)[C@H](C)NC(=O)[C@H](NC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](NC=O)C(C)C)CC(C)C)C(=O)NCCO)=CNC2=C1 ZWCXYZRRTRDGQE-SORVKSEFSA-N 0.000 description 1
- 201000007574 granular cell carcinoma Diseases 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 229960000642 grepafloxacin Drugs 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 244000005709 gut microbiome Species 0.000 description 1
- 201000000079 gynecomastia Diseases 0.000 description 1
- 208000024963 hair loss Diseases 0.000 description 1
- 230000003676 hair loss Effects 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 231100000888 hearing loss Toxicity 0.000 description 1
- 230000010370 hearing loss Effects 0.000 description 1
- 208000016354 hearing loss disease Diseases 0.000 description 1
- 210000003709 heart valve Anatomy 0.000 description 1
- 208000018578 heart valve disease Diseases 0.000 description 1
- 208000024798 heartburn Diseases 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- BTIJJDXEELBZFS-UHFFFAOYSA-K hemin Chemical compound [Cl-].[Fe+3].[N-]1C(C=C2C(=C(C)C(C=C3C(=C(C)C(=C4)[N-]3)C=C)=N2)C=C)=C(C)C(CCC(O)=O)=C1C=C1C(CCC(O)=O)=C(C)C4=N1 BTIJJDXEELBZFS-UHFFFAOYSA-K 0.000 description 1
- 208000007475 hemolytic anemia Diseases 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 208000006359 hepatoblastoma Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 231100000304 hepatotoxicity Toxicity 0.000 description 1
- 230000007686 hepatotoxicity Effects 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- 150000002402 hexoses Chemical class 0.000 description 1
- 208000029824 high grade glioma Diseases 0.000 description 1
- 210000001624 hip Anatomy 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 239000003276 histone deacetylase inhibitor Substances 0.000 description 1
- 235000012907 honey Nutrition 0.000 description 1
- 229940084986 human chorionic gonadotropin Drugs 0.000 description 1
- 229940048921 humira Drugs 0.000 description 1
- 239000008172 hydrogenated vegetable oil Substances 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- XXSMGPRMXLTPCZ-UHFFFAOYSA-N hydroxychloroquine Chemical compound ClC1=CC=C2C(NC(C)CCCN(CCO)CC)=CC=NC2=C1 XXSMGPRMXLTPCZ-UHFFFAOYSA-N 0.000 description 1
- 229960004171 hydroxychloroquine Drugs 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 208000033849 hyperamylasemia Diseases 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 201000005991 hyperphosphatemia Diseases 0.000 description 1
- 208000000069 hyperpigmentation Diseases 0.000 description 1
- 230000003810 hyperpigmentation Effects 0.000 description 1
- 230000009610 hypersensitivity Effects 0.000 description 1
- 208000006575 hypertriglyceridemia Diseases 0.000 description 1
- 230000000705 hypocalcaemia Effects 0.000 description 1
- 208000034783 hypoesthesia Diseases 0.000 description 1
- 230000002218 hypoglycaemic effect Effects 0.000 description 1
- 229940015872 ibandronate Drugs 0.000 description 1
- 235000015243 ice cream Nutrition 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 229940071829 ilaris Drugs 0.000 description 1
- 208000009326 ileitis Diseases 0.000 description 1
- 210000003405 ileum Anatomy 0.000 description 1
- 229960003685 imatinib mesylate Drugs 0.000 description 1
- 229960002182 imipenem Drugs 0.000 description 1
- ZSKVGTPCRGIANV-ZXFLCMHBSA-N imipenem Chemical compound C1C(SCC\N=C\N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 ZSKVGTPCRGIANV-ZXFLCMHBSA-N 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- 230000005934 immune activation Effects 0.000 description 1
- 230000005746 immune checkpoint blockade Effects 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 208000015446 immunoglobulin a vasculitis Diseases 0.000 description 1
- 229940124589 immunosuppressive drug Drugs 0.000 description 1
- 201000001881 impotence Diseases 0.000 description 1
- DBIGHPPNXATHOF-UHFFFAOYSA-N improsulfan Chemical compound CS(=O)(=O)OCCCNCCCOS(C)(=O)=O DBIGHPPNXATHOF-UHFFFAOYSA-N 0.000 description 1
- 229950008097 improsulfan Drugs 0.000 description 1
- USSYUMHVHQSYNA-SLDJZXPVSA-N indolicidin Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)CC1=CNC2=CC=CC=C12 USSYUMHVHQSYNA-SLDJZXPVSA-N 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 230000004941 influx Effects 0.000 description 1
- 208000030603 inherited susceptibility to asthma Diseases 0.000 description 1
- 239000003999 initiator Substances 0.000 description 1
- 206010022437 insomnia Diseases 0.000 description 1
- 235000014109 instant soup Nutrition 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 229940068935 insulin-like growth factor 2 Drugs 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 229960001388 interferon-beta Drugs 0.000 description 1
- 239000003407 interleukin 1 receptor blocking agent Substances 0.000 description 1
- 108010078376 interleukin 2-diphtheria toxin Proteins 0.000 description 1
- 108090000681 interleukin 20 Proteins 0.000 description 1
- 229940076144 interleukin-10 Drugs 0.000 description 1
- 229940074383 interleukin-11 Drugs 0.000 description 1
- 229940117681 interleukin-12 Drugs 0.000 description 1
- 102000053460 interleukin-17 receptor activity proteins Human genes 0.000 description 1
- 108040001304 interleukin-17 receptor activity proteins Proteins 0.000 description 1
- 102000044166 interleukin-18 binding protein Human genes 0.000 description 1
- 108010070145 interleukin-18 binding protein Proteins 0.000 description 1
- 102000008640 interleukin-21 receptor activity proteins Human genes 0.000 description 1
- 108040002099 interleukin-21 receptor activity proteins Proteins 0.000 description 1
- 229940124829 interleukin-23 Drugs 0.000 description 1
- 229940028885 interleukin-4 Drugs 0.000 description 1
- 229940100602 interleukin-5 Drugs 0.000 description 1
- 229940100994 interleukin-7 Drugs 0.000 description 1
- 229940096397 interleukin-8 Drugs 0.000 description 1
- XKTZWUACRZHVAN-VADRZIEHSA-N interleukin-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@@H](NC(C)=O)CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N1[C@H](CCC1)C(=O)N1[C@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CCC(O)=O)C(=O)N[C@H](CC(O)=O)C(=O)N[C@H](CC=1C=CC(O)=CC=1)C(=O)N[C@H](CO)C(=O)N1[C@H](CCC1)C(N)=O)C1=CC=CC=C1 XKTZWUACRZHVAN-VADRZIEHSA-N 0.000 description 1
- 229940118526 interleukin-9 Drugs 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 229940029339 inulin Drugs 0.000 description 1
- JYJIGFIDKWBXDU-MNNPPOADSA-N inulin Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)OC[C@]1(OC[C@]2(OC[C@]3(OC[C@]4(OC[C@]5(OC[C@]6(OC[C@]7(OC[C@]8(OC[C@]9(OC[C@]%10(OC[C@]%11(OC[C@]%12(OC[C@]%13(OC[C@]%14(OC[C@]%15(OC[C@]%16(OC[C@]%17(OC[C@]%18(OC[C@]%19(OC[C@]%20(OC[C@]%21(OC[C@]%22(OC[C@]%23(OC[C@]%24(OC[C@]%25(OC[C@]%26(OC[C@]%27(OC[C@]%28(OC[C@]%29(OC[C@]%30(OC[C@]%31(OC[C@]%32(OC[C@]%33(OC[C@]%34(OC[C@]%35(OC[C@]%36(O[C@@H]%37[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O%37)O)[C@H]([C@H](O)[C@@H](CO)O%36)O)[C@H]([C@H](O)[C@@H](CO)O%35)O)[C@H]([C@H](O)[C@@H](CO)O%34)O)[C@H]([C@H](O)[C@@H](CO)O%33)O)[C@H]([C@H](O)[C@@H](CO)O%32)O)[C@H]([C@H](O)[C@@H](CO)O%31)O)[C@H]([C@H](O)[C@@H](CO)O%30)O)[C@H]([C@H](O)[C@@H](CO)O%29)O)[C@H]([C@H](O)[C@@H](CO)O%28)O)[C@H]([C@H](O)[C@@H](CO)O%27)O)[C@H]([C@H](O)[C@@H](CO)O%26)O)[C@H]([C@H](O)[C@@H](CO)O%25)O)[C@H]([C@H](O)[C@@H](CO)O%24)O)[C@H]([C@H](O)[C@@H](CO)O%23)O)[C@H]([C@H](O)[C@@H](CO)O%22)O)[C@H]([C@H](O)[C@@H](CO)O%21)O)[C@H]([C@H](O)[C@@H](CO)O%20)O)[C@H]([C@H](O)[C@@H](CO)O%19)O)[C@H]([C@H](O)[C@@H](CO)O%18)O)[C@H]([C@H](O)[C@@H](CO)O%17)O)[C@H]([C@H](O)[C@@H](CO)O%16)O)[C@H]([C@H](O)[C@@H](CO)O%15)O)[C@H]([C@H](O)[C@@H](CO)O%14)O)[C@H]([C@H](O)[C@@H](CO)O%13)O)[C@H]([C@H](O)[C@@H](CO)O%12)O)[C@H]([C@H](O)[C@@H](CO)O%11)O)[C@H]([C@H](O)[C@@H](CO)O%10)O)[C@H]([C@H](O)[C@@H](CO)O9)O)[C@H]([C@H](O)[C@@H](CO)O8)O)[C@H]([C@H](O)[C@@H](CO)O7)O)[C@H]([C@H](O)[C@@H](CO)O6)O)[C@H]([C@H](O)[C@@H](CO)O5)O)[C@H]([C@H](O)[C@@H](CO)O4)O)[C@H]([C@H](O)[C@@H](CO)O3)O)[C@H]([C@H](O)[C@@H](CO)O2)O)[C@@H](O)[C@H](O)[C@@H](CO)O1 JYJIGFIDKWBXDU-MNNPPOADSA-N 0.000 description 1
- 206010073096 invasive lobular breast carcinoma Diseases 0.000 description 1
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 1
- 229940084651 iressa Drugs 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 239000004313 iron ammonium citrate Substances 0.000 description 1
- 235000000011 iron ammonium citrate Nutrition 0.000 description 1
- 208000002551 irritable bowel syndrome Diseases 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- 229960003350 isoniazid Drugs 0.000 description 1
- QRXWMOHMRWLFEY-UHFFFAOYSA-N isoniazide Chemical compound NNC(=O)C1=CC=NC=C1 QRXWMOHMRWLFEY-UHFFFAOYSA-N 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 229950002252 isoxicam Drugs 0.000 description 1
- YYUAYBYLJSNDCX-UHFFFAOYSA-N isoxicam Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC=1C=C(C)ON=1 YYUAYBYLJSNDCX-UHFFFAOYSA-N 0.000 description 1
- 230000007803 itching Effects 0.000 description 1
- 239000008274 jelly Substances 0.000 description 1
- 229960004144 josamycin Drugs 0.000 description 1
- XJSFLOJWULLJQS-NGVXBBESSA-N josamycin Chemical compound CO[C@H]1[C@H](OC(C)=O)CC(=O)O[C@H](C)C\C=C\C=C\[C@H](O)[C@H](C)C[C@H](CC=O)[C@@H]1O[C@H]1[C@H](O)[C@@H](N(C)C)[C@H](O[C@@H]2O[C@@H](C)[C@H](OC(=O)CC(C)C)[C@](C)(O)C2)[C@@H](C)O1 XJSFLOJWULLJQS-NGVXBBESSA-N 0.000 description 1
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 1
- 108010050180 kallistatin Proteins 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 150000002576 ketones Chemical class 0.000 description 1
- DKYWVDODHFEZIM-UHFFFAOYSA-N ketoprofen Chemical compound OC(=O)C(C)C1=CC=CC(C(=O)C=2C=CC=CC=2)=C1 DKYWVDODHFEZIM-UHFFFAOYSA-N 0.000 description 1
- 229960000991 ketoprofen Drugs 0.000 description 1
- OZWKMVRBQXNZKK-UHFFFAOYSA-N ketorolac Chemical compound OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 OZWKMVRBQXNZKK-UHFFFAOYSA-N 0.000 description 1
- 229960004752 ketorolac Drugs 0.000 description 1
- 208000022013 kidney Wilms tumor Diseases 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- JCQLYHFGKNRPGE-FCVZTGTOSA-N lactulose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 JCQLYHFGKNRPGE-FCVZTGTOSA-N 0.000 description 1
- 229960000511 lactulose Drugs 0.000 description 1
- PFCRQPBOOFTZGQ-UHFFFAOYSA-N lactulose keto form Natural products OCC(=O)C(O)C(C(O)CO)OC1OC(CO)C(O)C(O)C1O PFCRQPBOOFTZGQ-UHFFFAOYSA-N 0.000 description 1
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 1
- 229960001320 lapatinib ditosylate Drugs 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 229960000681 leflunomide Drugs 0.000 description 1
- VHOGYURTWQBHIL-UHFFFAOYSA-N leflunomide Chemical compound O1N=CC(C(=O)NC=2C=CC(=CC=2)C(F)(F)F)=C1C VHOGYURTWQBHIL-UHFFFAOYSA-N 0.000 description 1
- 229940115286 lentinan Drugs 0.000 description 1
- 229940039781 leptin Drugs 0.000 description 1
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 description 1
- 229960003881 letrozole Drugs 0.000 description 1
- 201000002364 leukopenia Diseases 0.000 description 1
- 231100001022 leukopenia Toxicity 0.000 description 1
- 229960003376 levofloxacin Drugs 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 229940059904 light mineral oil Drugs 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 229960005287 lincomycin Drugs 0.000 description 1
- OJMMVQQUTAEWLP-KIDUDLJLSA-N lincomycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@@H](C)O)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 OJMMVQQUTAEWLP-KIDUDLJLSA-N 0.000 description 1
- 229960003907 linezolid Drugs 0.000 description 1
- TYZROVQLWOKYKF-ZDUSSCGKSA-N linezolid Chemical compound O=C1O[C@@H](CNC(=O)C)CN1C(C=C1F)=CC=C1N1CCOCC1 TYZROVQLWOKYKF-ZDUSSCGKSA-N 0.000 description 1
- 235000020778 linoleic acid Nutrition 0.000 description 1
- OYHQOLUKZRVURQ-IXWMQOLASA-N linoleic acid Natural products CCCCC\C=C/C\C=C\CCCCCCCC(O)=O OYHQOLUKZRVURQ-IXWMQOLASA-N 0.000 description 1
- 229960004488 linolenic acid Drugs 0.000 description 1
- KQQKGWQCNNTQJW-UHFFFAOYSA-N linolenic acid Natural products CC=CCCC=CCC=CCCCCCCCC(O)=O KQQKGWQCNNTQJW-UHFFFAOYSA-N 0.000 description 1
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical compound O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 1
- 125000003473 lipid group Chemical group 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 230000005976 liver dysfunction Effects 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 229960002422 lomefloxacin Drugs 0.000 description 1
- ZEKZLJVOYLTDKK-UHFFFAOYSA-N lomefloxacin Chemical compound FC1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNC(C)C1 ZEKZLJVOYLTDKK-UHFFFAOYSA-N 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 229960001977 loracarbef Drugs 0.000 description 1
- JAPHQRWPEGVNBT-UTUOFQBUSA-N loracarbef Chemical compound C1([C@H](C(=O)N[C@@H]2C(N3C(=C(Cl)CC[C@@H]32)C([O-])=O)=O)[NH3+])=CC=CC=C1 JAPHQRWPEGVNBT-UTUOFQBUSA-N 0.000 description 1
- OXROWJKCGCOJDO-JLHYYAGUSA-N lornoxicam Chemical compound O=C1C=2SC(Cl)=CC=2S(=O)(=O)N(C)\C1=C(\O)NC1=CC=CC=N1 OXROWJKCGCOJDO-JLHYYAGUSA-N 0.000 description 1
- 229960002202 lornoxicam Drugs 0.000 description 1
- YROQEQPFUCPDCP-UHFFFAOYSA-N losoxantrone Chemical compound OCCNCCN1N=C2C3=CC=CC(O)=C3C(=O)C3=C2C1=CC=C3NCCNCCO YROQEQPFUCPDCP-UHFFFAOYSA-N 0.000 description 1
- 229950008745 losoxantrone Drugs 0.000 description 1
- 208000018883 loss of balance Diseases 0.000 description 1
- 208000012866 low blood pressure Diseases 0.000 description 1
- 229960000994 lumiracoxib Drugs 0.000 description 1
- KHPKQFYUPIUARC-UHFFFAOYSA-N lumiracoxib Chemical compound OC(=O)CC1=CC(C)=CC=C1NC1=C(F)C=CC=C1Cl KHPKQFYUPIUARC-UHFFFAOYSA-N 0.000 description 1
- 201000000014 lung giant cell carcinoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 206010025226 lymphangitis Diseases 0.000 description 1
- 210000001077 lymphatic endothelium Anatomy 0.000 description 1
- 210000004324 lymphatic system Anatomy 0.000 description 1
- 208000004341 lymphocytic colitis Diseases 0.000 description 1
- 230000000527 lymphocytic effect Effects 0.000 description 1
- 201000010953 lymphoepithelioma-like carcinoma Diseases 0.000 description 1
- 208000003747 lymphoid leukemia Diseases 0.000 description 1
- 108010019677 lymphotactin Proteins 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 102000049853 macrophage stimulating protein Human genes 0.000 description 1
- 108010053292 macrophage stimulating protein Proteins 0.000 description 1
- 229960003640 mafenide Drugs 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- QWDJLDTYWNBUKE-UHFFFAOYSA-L magnesium bicarbonate Chemical compound [Mg+2].OC([O-])=O.OC([O-])=O QWDJLDTYWNBUKE-UHFFFAOYSA-L 0.000 description 1
- 239000002370 magnesium bicarbonate Substances 0.000 description 1
- 229910000022 magnesium bicarbonate Inorganic materials 0.000 description 1
- 235000014824 magnesium bicarbonate Nutrition 0.000 description 1
- ZLNQQNXFFQJAID-UHFFFAOYSA-L magnesium carbonate Chemical compound [Mg+2].[O-]C([O-])=O ZLNQQNXFFQJAID-UHFFFAOYSA-L 0.000 description 1
- 239000001095 magnesium carbonate Substances 0.000 description 1
- 229910000021 magnesium carbonate Inorganic materials 0.000 description 1
- 229940037627 magnesium lauryl sulfate Drugs 0.000 description 1
- 229940072082 magnesium salicylate Drugs 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 235000019341 magnesium sulphate Nutrition 0.000 description 1
- HBNDBUATLJAUQM-UHFFFAOYSA-L magnesium;dodecyl sulfate Chemical compound [Mg+2].CCCCCCCCCCCCOS([O-])(=O)=O.CCCCCCCCCCCCOS([O-])(=O)=O HBNDBUATLJAUQM-UHFFFAOYSA-L 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- 208000018013 malignant glomus tumor Diseases 0.000 description 1
- 201000004102 malignant granular cell myoblastoma Diseases 0.000 description 1
- 201000006812 malignant histiocytosis Diseases 0.000 description 1
- 206010061526 malignant mesenchymoma Diseases 0.000 description 1
- 201000009020 malignant peripheral nerve sheath tumor Diseases 0.000 description 1
- 201000002338 malignant struma ovarii Diseases 0.000 description 1
- WPBNNNQJVZRUHP-UHFFFAOYSA-L manganese(2+);methyl n-[[2-(methoxycarbonylcarbamothioylamino)phenyl]carbamothioyl]carbamate;n-[2-(sulfidocarbothioylamino)ethyl]carbamodithioate Chemical compound [Mn+2].[S-]C(=S)NCCNC([S-])=S.COC(=O)NC(=S)NC1=CC=CC=C1NC(=S)NC(=O)OC WPBNNNQJVZRUHP-UHFFFAOYSA-L 0.000 description 1
- 150000003272 mannan oligosaccharides Chemical class 0.000 description 1
- MQXVYODZCMMZEM-ZYUZMQFOSA-N mannomustine Chemical compound ClCCNC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CNCCCl MQXVYODZCMMZEM-ZYUZMQFOSA-N 0.000 description 1
- 229950008612 mannomustine Drugs 0.000 description 1
- 208000024393 maple syrup urine disease Diseases 0.000 description 1
- GSNHKUDZZFZSJB-QYOOZWMWSA-N maraviroc Chemical compound CC(C)C1=NN=C(C)N1[C@@H]1C[C@H](N2CC[C@H](NC(=O)C3CCC(F)(F)CC3)C=3C=CC=CC=3)CC[C@H]2C1 GSNHKUDZZFZSJB-QYOOZWMWSA-N 0.000 description 1
- 229960004710 maraviroc Drugs 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 201000008749 mast-cell sarcoma Diseases 0.000 description 1
- 208000004396 mastitis Diseases 0.000 description 1
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 1
- AEUKDPKXTPNBNY-XEYRWQBLSA-N mcp 2 Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)C1=CC=CC=C1 AEUKDPKXTPNBNY-XEYRWQBLSA-N 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960003803 meclofenamic acid Drugs 0.000 description 1
- 239000012533 medium component Substances 0.000 description 1
- 239000013028 medium composition Substances 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- HYYBABOKPJLUIN-UHFFFAOYSA-N mefenamic acid Chemical compound CC1=CC=CC(NC=2C(=CC=CC=2)C(O)=O)=C1C HYYBABOKPJLUIN-UHFFFAOYSA-N 0.000 description 1
- 229960001929 meloxicam Drugs 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 230000028161 membrane depolarization Effects 0.000 description 1
- 230000006984 memory degeneration Effects 0.000 description 1
- 208000023060 memory loss Diseases 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 230000009245 menopause Effects 0.000 description 1
- 229950009246 mepitiostane Drugs 0.000 description 1
- 229960002260 meropenem Drugs 0.000 description 1
- DMJNNHOOLUXYBV-PQTSNVLCSA-N meropenem Chemical compound C=1([C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)S[C@@H]1CN[C@H](C(=O)N(C)C)C1 DMJNNHOOLUXYBV-PQTSNVLCSA-N 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 230000015689 metaplastic ossification Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 229960004469 methoxsalen Drugs 0.000 description 1
- VJRAUFKOOPNFIQ-TVEKBUMESA-N methyl (1r,2r,4s)-4-[(2r,4s,5s,6s)-5-[(2s,4s,5s,6s)-5-[(2s,4s,5s,6s)-4,5-dihydroxy-6-methyloxan-2-yl]oxy-4-hydroxy-6-methyloxan-2-yl]oxy-4-(dimethylamino)-6-methyloxan-2-yl]oxy-2-ethyl-2,5,7,10-tetrahydroxy-6,11-dioxo-3,4-dihydro-1h-tetracene-1-carboxylat Chemical compound O([C@H]1[C@@H](O)C[C@@H](O[C@H]1C)O[C@H]1[C@H](C[C@@H](O[C@H]1C)O[C@H]1C[C@]([C@@H](C2=CC=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C21)C(=O)OC)(O)CC)N(C)C)[C@H]1C[C@H](O)[C@H](O)[C@H](C)O1 VJRAUFKOOPNFIQ-TVEKBUMESA-N 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 229960000198 mezlocillin Drugs 0.000 description 1
- YPBATNHYBCGSSN-VWPFQQQWSA-N mezlocillin Chemical compound N([C@@H](C(=O)N[C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C=1C=CC=CC=1)C(=O)N1CCN(S(C)(=O)=O)C1=O YPBATNHYBCGSSN-VWPFQQQWSA-N 0.000 description 1
- 239000010445 mica Substances 0.000 description 1
- 229910052618 mica group Inorganic materials 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 238000001471 micro-filtration Methods 0.000 description 1
- 206010063344 microscopic polyangiitis Diseases 0.000 description 1
- 229950007764 mikamycin Drugs 0.000 description 1
- 208000037852 mild atopic dermatitis Diseases 0.000 description 1
- 229960005485 mitobronitol Drugs 0.000 description 1
- 229960003539 mitoguazone Drugs 0.000 description 1
- MXWHMTNPTTVWDM-NXOFHUPFSA-N mitoguazone Chemical compound NC(N)=N\N=C(/C)\C=N\N=C(N)N MXWHMTNPTTVWDM-NXOFHUPFSA-N 0.000 description 1
- VFKZTMPDYBFSTM-GUCUJZIJSA-N mitolactol Chemical compound BrC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-GUCUJZIJSA-N 0.000 description 1
- 229950010913 mitolactol Drugs 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 201000010225 mixed cell type cancer Diseases 0.000 description 1
- 208000029638 mixed neoplasm Diseases 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 235000019426 modified starch Nutrition 0.000 description 1
- 229910052750 molybdenum Inorganic materials 0.000 description 1
- 239000011733 molybdenum Substances 0.000 description 1
- 230000004899 motility Effects 0.000 description 1
- 208000018962 mouth sore Diseases 0.000 description 1
- 229960003702 moxifloxacin Drugs 0.000 description 1
- FABPRXSRWADJSP-MEDUHNTESA-N moxifloxacin Chemical compound COC1=C(N2C[C@H]3NCCC[C@H]3C2)C(F)=CC(C(C(C(O)=O)=C2)=O)=C1N2C1CC1 FABPRXSRWADJSP-MEDUHNTESA-N 0.000 description 1
- 201000010879 mucinous adenocarcinoma Diseases 0.000 description 1
- 208000010492 mucinous cystadenocarcinoma Diseases 0.000 description 1
- 229940051875 mucins Drugs 0.000 description 1
- 208000001725 mucocutaneous lymph node syndrome Diseases 0.000 description 1
- 229960003128 mupirocin Drugs 0.000 description 1
- 229930187697 mupirocin Natural products 0.000 description 1
- DDHVILIIHBIMQU-YJGQQKNPSA-L mupirocin calcium hydrate Chemical compound O.O.[Ca+2].C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@@H]1[C@@H](O)[C@@H](O)[C@H](C\C(C)=C\C(=O)OCCCCCCCCC([O-])=O)OC1.C[C@H](O)[C@H](C)[C@@H]1O[C@H]1C[C@@H]1[C@@H](O)[C@@H](O)[C@H](C\C(C)=C\C(=O)OCCCCCCCCC([O-])=O)OC1 DDHVILIIHBIMQU-YJGQQKNPSA-L 0.000 description 1
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 208000013465 muscle pain Diseases 0.000 description 1
- 210000002346 musculoskeletal system Anatomy 0.000 description 1
- 108010035837 mutacin B-Ny266 Proteins 0.000 description 1
- 208000029766 myalgic encephalomeyelitis/chronic fatigue syndrome Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- 210000000066 myeloid cell Anatomy 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- AZBFJBJXUQUQLF-UHFFFAOYSA-N n-(1,5-dimethylpyrrolidin-3-yl)pyrrolidine-1-carboxamide Chemical compound C1N(C)C(C)CC1NC(=O)N1CCCC1 AZBFJBJXUQUQLF-UHFFFAOYSA-N 0.000 description 1
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 description 1
- JORAUNFTUVJTNG-BSTBCYLQSA-N n-[(2s)-4-amino-1-[[(2s,3r)-1-[[(2s)-4-amino-1-oxo-1-[[(3s,6s,9s,12s,15r,18s,21s)-6,9,18-tris(2-aminoethyl)-3-[(1r)-1-hydroxyethyl]-12,15-bis(2-methylpropyl)-2,5,8,11,14,17,20-heptaoxo-1,4,7,10,13,16,19-heptazacyclotricos-21-yl]amino]butan-2-yl]amino]-3-h Chemical compound CC(C)CCCCC(=O)N[C@@H](CCN)C(=O)N[C@H]([C@@H](C)O)CN[C@@H](CCN)C(=O)N[C@H]1CCNC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCN)NC(=O)[C@H](CCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CCN)NC1=O.CCC(C)CCCCC(=O)N[C@@H](CCN)C(=O)N[C@H]([C@@H](C)O)CN[C@@H](CCN)C(=O)N[C@H]1CCNC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCN)NC(=O)[C@H](CCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CCN)NC1=O JORAUNFTUVJTNG-BSTBCYLQSA-N 0.000 description 1
- NJSMWLQOCQIOPE-OCHFTUDZSA-N n-[(e)-[10-[(e)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine Chemical compound N1CCN=C1N\N=C\C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N\NC1=NCCN1 NJSMWLQOCQIOPE-OCHFTUDZSA-N 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- 229950006780 n-acetylglucosamine Drugs 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 229960004270 nabumetone Drugs 0.000 description 1
- GPXLMGHLHQJAGZ-JTDSTZFVSA-N nafcillin Chemical compound C1=CC=CC2=C(C(=O)N[C@@H]3C(N4[C@H](C(C)(C)S[C@@H]43)C(O)=O)=O)C(OCC)=CC=C21 GPXLMGHLHQJAGZ-JTDSTZFVSA-N 0.000 description 1
- 229960000515 nafcillin Drugs 0.000 description 1
- 229960000210 nalidixic acid Drugs 0.000 description 1
- MHWLWQUZZRMNGJ-UHFFFAOYSA-N nalidixic acid Chemical compound C1=C(C)N=C2N(CC)C=C(C(O)=O)C(=O)C2=C1 MHWLWQUZZRMNGJ-UHFFFAOYSA-N 0.000 description 1
- 229960002009 naproxen Drugs 0.000 description 1
- CMWTZPSULFXXJA-VIFPVBQESA-M naproxen(1-) Chemical compound C1=C([C@H](C)C([O-])=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-VIFPVBQESA-M 0.000 description 1
- 201000003631 narcolepsy Diseases 0.000 description 1
- 208000014761 nasopharyngeal type undifferentiated carcinoma Diseases 0.000 description 1
- 210000001989 nasopharynx Anatomy 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 229950007221 nedaplatin Drugs 0.000 description 1
- 230000031990 negative regulation of inflammatory response Effects 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 201000008383 nephritis Diseases 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- 231100000417 nephrotoxicity Toxicity 0.000 description 1
- 230000007694 nephrotoxicity Effects 0.000 description 1
- 229940053128 nerve growth factor Drugs 0.000 description 1
- 229960000808 netilmicin Drugs 0.000 description 1
- ZBGPYVZLYBDXKO-HILBYHGXSA-N netilmycin Chemical compound O([C@@H]1[C@@H](N)C[C@H]([C@@H]([C@H]1O)O[C@@H]1[C@]([C@H](NC)[C@@H](O)CO1)(C)O)NCC)[C@H]1OC(CN)=CC[C@H]1N ZBGPYVZLYBDXKO-HILBYHGXSA-N 0.000 description 1
- 208000007538 neurilemmoma Diseases 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 230000000626 neurodegenerative effect Effects 0.000 description 1
- 208000027831 neuroepithelial neoplasm Diseases 0.000 description 1
- 208000029974 neurofibrosarcoma Diseases 0.000 description 1
- 230000001272 neurogenic effect Effects 0.000 description 1
- 230000003959 neuroinflammation Effects 0.000 description 1
- 231100000228 neurotoxicity Toxicity 0.000 description 1
- 230000007135 neurotoxicity Effects 0.000 description 1
- 229940032018 neurotrophin 3 Drugs 0.000 description 1
- 229940097998 neurotrophin 4 Drugs 0.000 description 1
- 208000004235 neutropenia Diseases 0.000 description 1
- 229940080607 nexavar Drugs 0.000 description 1
- 235000001968 nicotinic acid Nutrition 0.000 description 1
- 229960003512 nicotinic acid Drugs 0.000 description 1
- 239000011664 nicotinic acid Substances 0.000 description 1
- 229960001346 nilotinib Drugs 0.000 description 1
- 229960001420 nimustine Drugs 0.000 description 1
- VFEDRRNHLBGPNN-UHFFFAOYSA-N nimustine Chemical compound CC1=NC=C(CNC(=O)N(CCCl)N=O)C(N)=N1 VFEDRRNHLBGPNN-UHFFFAOYSA-N 0.000 description 1
- 239000004309 nisin Substances 0.000 description 1
- 235000010297 nisin Nutrition 0.000 description 1
- 108010074461 nisin A Proteins 0.000 description 1
- 229960000564 nitrofurantoin Drugs 0.000 description 1
- NXFQHRVNIOXGAQ-YCRREMRBSA-N nitrofurantoin Chemical compound O1C([N+](=O)[O-])=CC=C1\C=N\N1C(=O)NC(=O)C1 NXFQHRVNIOXGAQ-YCRREMRBSA-N 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 150000004957 nitroimidazoles Chemical class 0.000 description 1
- KGTDRFCXGRULNK-JYOBTZKQSA-N nogalamycin Chemical compound CO[C@@H]1[C@@](OC)(C)[C@@H](OC)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=C(O)C=C4[C@@]5(C)O[C@H]([C@H]([C@@H]([C@H]5O)N(C)C)O)OC4=C3C3=O)=C3C=C2[C@@H](C(=O)OC)[C@@](C)(O)C1 KGTDRFCXGRULNK-JYOBTZKQSA-N 0.000 description 1
- 229950009266 nogalamycin Drugs 0.000 description 1
- 235000012149 noodles Nutrition 0.000 description 1
- 229960001180 norfloxacin Drugs 0.000 description 1
- OGJPXUAPXNRGGI-UHFFFAOYSA-N norfloxacin Chemical compound C1=C2N(CC)C=C(C(O)=O)C(=O)C2=CC(F)=C1N1CCNCC1 OGJPXUAPXNRGGI-UHFFFAOYSA-N 0.000 description 1
- 229960002950 novobiocin Drugs 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 238000001668 nucleic acid synthesis Methods 0.000 description 1
- 229940023146 nucleic acid vaccine Drugs 0.000 description 1
- 231100000862 numbness Toxicity 0.000 description 1
- 239000006916 nutrient agar Substances 0.000 description 1
- 229950005751 ocrelizumab Drugs 0.000 description 1
- XXUPLYBCNPLTIW-UHFFFAOYSA-N octadec-7-ynoic acid Chemical compound CCCCCCCCCCC#CCCCCCC(O)=O XXUPLYBCNPLTIW-UHFFFAOYSA-N 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 208000027825 odontogenic neoplasm Diseases 0.000 description 1
- 229960001699 ofloxacin Drugs 0.000 description 1
- 229960002351 oleandomycin Drugs 0.000 description 1
- 235000019367 oleandomycin Nutrition 0.000 description 1
- RZPAKFUAFGMUPI-KGIGTXTPSA-N oleandomycin Chemical compound O1[C@@H](C)[C@H](O)[C@@H](OC)C[C@@H]1O[C@@H]1[C@@H](C)C(=O)O[C@H](C)[C@H](C)[C@H](O)[C@@H](C)C(=O)[C@]2(OC2)C[C@H](C)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C RZPAKFUAFGMUPI-KGIGTXTPSA-N 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 238000006384 oligomerization reaction Methods 0.000 description 1
- CZDBNBLGZNWKMC-MWQNXGTOSA-N olivomycin Chemical class O([C@@H]1C[C@@H](O[C@H](C)[C@@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1)O[C@H]1O[C@@H](C)[C@H](O)[C@@H](OC2O[C@@H](C)[C@H](O)[C@@H](O)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@H](O)[C@H](OC)[C@H](C)O1 CZDBNBLGZNWKMC-MWQNXGTOSA-N 0.000 description 1
- 206010030306 omphalitis Diseases 0.000 description 1
- 208000005963 oophoritis Diseases 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 201000005737 orchitis Diseases 0.000 description 1
- 229940035567 orencia Drugs 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 201000008972 osteitis fibrosa Diseases 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 231100000262 ototoxicity Toxicity 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 208000012221 ovarian Sertoli-Leydig cell tumor Diseases 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- UWYHMGVUTGAWSP-JKIFEVAISA-N oxacillin Chemical compound N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C1=C(C)ON=C1C1=CC=CC=C1 UWYHMGVUTGAWSP-JKIFEVAISA-N 0.000 description 1
- 229960001019 oxacillin Drugs 0.000 description 1
- OFPXSFXSNFPTHF-UHFFFAOYSA-N oxaprozin Chemical compound O1C(CCC(=O)O)=NC(C=2C=CC=CC=2)=C1C1=CC=CC=C1 OFPXSFXSNFPTHF-UHFFFAOYSA-N 0.000 description 1
- 229960002739 oxaprozin Drugs 0.000 description 1
- 229960000625 oxytetracycline Drugs 0.000 description 1
- IWVCMVBTMGNXQD-PXOLEDIWSA-N oxytetracycline Chemical compound C1=CC=C2[C@](O)(C)[C@H]3[C@H](O)[C@H]4[C@H](N(C)C)C(O)=C(C(N)=O)C(=O)[C@@]4(O)C(O)=C3C(=O)C2=C1O IWVCMVBTMGNXQD-PXOLEDIWSA-N 0.000 description 1
- 235000019366 oxytetracycline Nutrition 0.000 description 1
- LSQZJLSUYDQPKJ-UHFFFAOYSA-N p-Hydroxyampicillin Natural products O=C1N2C(C(O)=O)C(C)(C)SC2C1NC(=O)C(N)C1=CC=C(O)C=C1 LSQZJLSUYDQPKJ-UHFFFAOYSA-N 0.000 description 1
- 101710135378 pH 6 antigen Proteins 0.000 description 1
- 230000036407 pain Effects 0.000 description 1
- 238000011499 palliative surgery Methods 0.000 description 1
- VREZDOWOLGNDPW-UHFFFAOYSA-N pancratistatine Natural products C1=C2C3C(O)C(O)C(O)C(O)C3NC(=O)C2=C(O)C2=C1OCO2 VREZDOWOLGNDPW-UHFFFAOYSA-N 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 229940055726 pantothenic acid Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 201000010210 papillary cystadenocarcinoma Diseases 0.000 description 1
- 208000024641 papillary serous cystadenocarcinoma Diseases 0.000 description 1
- 201000001494 papillary transitional carcinoma Diseases 0.000 description 1
- 208000031101 papillary transitional cell carcinoma Diseases 0.000 description 1
- TZRHLKRLEZJVIJ-UHFFFAOYSA-N parecoxib Chemical compound C1=CC(S(=O)(=O)NC(=O)CC)=CC=C1C1=C(C)ON=C1C1=CC=CC=C1 TZRHLKRLEZJVIJ-UHFFFAOYSA-N 0.000 description 1
- 229960004662 parecoxib Drugs 0.000 description 1
- 229960001914 paromomycin Drugs 0.000 description 1
- UOZODPSAJZTQNH-LSWIJEOBSA-N paromomycin Chemical compound N[C@@H]1[C@@H](O)[C@H](O)[C@H](CN)O[C@@H]1O[C@H]1[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](N)C[C@@H](N)[C@@H]2O)O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)N)O[C@@H]1CO UOZODPSAJZTQNH-LSWIJEOBSA-N 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 235000015927 pasta Nutrition 0.000 description 1
- 238000009928 pasteurization Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229960005492 pazopanib hydrochloride Drugs 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 229940056360 penicillin g Drugs 0.000 description 1
- 229940056367 penicillin v Drugs 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- QIMGFXOHTOXMQP-GFAGFCTOSA-N peplomycin Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCN[C@@H](C)C=1C=CC=CC=1)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C QIMGFXOHTOXMQP-GFAGFCTOSA-N 0.000 description 1
- 229950003180 peplomycin Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- 208000022719 perennial allergic rhinitis Diseases 0.000 description 1
- 208000008494 pericarditis Diseases 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 229960002087 pertuzumab Drugs 0.000 description 1
- BPLBGHOLXOTWMN-MBNYWOFBSA-N phenoxymethylpenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)COC1=CC=CC=C1 BPLBGHOLXOTWMN-MBNYWOFBSA-N 0.000 description 1
- VYMDGNCVAMGZFE-UHFFFAOYSA-N phenylbutazonum Chemical compound O=C1C(CCCC)C(=O)N(C=2C=CC=CC=2)N1C1=CC=CC=C1 VYMDGNCVAMGZFE-UHFFFAOYSA-N 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- 208000001297 phlebitis Diseases 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 239000011574 phosphorus Substances 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000036211 photosensitivity Effects 0.000 description 1
- SHUZOJHMOBOZST-UHFFFAOYSA-N phylloquinone Natural products CC(C)CCCCC(C)CCC(C)CCCC(=CCC1=C(C)C(=O)c2ccccc2C1=O)C SHUZOJHMOBOZST-UHFFFAOYSA-N 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 235000021110 pickles Nutrition 0.000 description 1
- 229950005566 picoplatin Drugs 0.000 description 1
- IIMIOEBMYPRQGU-UHFFFAOYSA-L picoplatin Chemical compound N.[Cl-].[Cl-].[Pt+2].CC1=CC=CC=N1 IIMIOEBMYPRQGU-UHFFFAOYSA-L 0.000 description 1
- 229950010773 pidilizumab Drugs 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 229960005095 pioglitazone Drugs 0.000 description 1
- 229960002292 piperacillin Drugs 0.000 description 1
- WCMIIGXFCMNQDS-IDYPWDAWSA-M piperacillin sodium Chemical compound [Na+].O=C1C(=O)N(CC)CCN1C(=O)N[C@H](C=1C=CC=CC=1)C(=O)N[C@@H]1C(=O)N2[C@@H](C([O-])=O)C(C)(C)S[C@@H]21 WCMIIGXFCMNQDS-IDYPWDAWSA-M 0.000 description 1
- 229960000952 pipobroman Drugs 0.000 description 1
- NJBFOOCLYDNZJN-UHFFFAOYSA-N pipobroman Chemical compound BrCCC(=O)N1CCN(C(=O)CCBr)CC1 NJBFOOCLYDNZJN-UHFFFAOYSA-N 0.000 description 1
- NUKCGLDCWQXYOQ-UHFFFAOYSA-N piposulfan Chemical compound CS(=O)(=O)OCCC(=O)N1CCN(C(=O)CCOS(C)(=O)=O)CC1 NUKCGLDCWQXYOQ-UHFFFAOYSA-N 0.000 description 1
- 229950001100 piposulfan Drugs 0.000 description 1
- 229960001221 pirarubicin Drugs 0.000 description 1
- 229960002702 piroxicam Drugs 0.000 description 1
- QYSPLQLAKJAUJT-UHFFFAOYSA-N piroxicam Chemical compound OC=1C2=CC=CC=C2S(=O)(=O)N(C)C=1C(=O)NC1=CC=CC=N1 QYSPLQLAKJAUJT-UHFFFAOYSA-N 0.000 description 1
- 208000021857 pituitary gland basophilic carcinoma Diseases 0.000 description 1
- 208000031223 plasma cell leukemia Diseases 0.000 description 1
- 108010017843 platelet-derived growth factor A Proteins 0.000 description 1
- 108010000685 platelet-derived growth factor AB Proteins 0.000 description 1
- CSOMAHTTWTVBFL-OFBLZTNGSA-N platensimycin Chemical compound C([C@]1([C@@H]2[C@@H]3C[C@@H]4C[C@@]2(C=CC1=O)C[C@@]4(O3)C)C)CC(=O)NC1=C(O)C=CC(C(O)=O)=C1O CSOMAHTTWTVBFL-OFBLZTNGSA-N 0.000 description 1
- CSOMAHTTWTVBFL-UHFFFAOYSA-N platensimycin Natural products O1C2(C)CC3(C=CC4=O)CC2CC1C3C4(C)CCC(=O)NC1=C(O)C=CC(C(O)=O)=C1O CSOMAHTTWTVBFL-UHFFFAOYSA-N 0.000 description 1
- 208000008423 pleurisy Diseases 0.000 description 1
- 231100000374 pneumotoxicity Toxicity 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 201000006292 polyarteritis nodosa Diseases 0.000 description 1
- 229920000024 polymyxin B Polymers 0.000 description 1
- XDJYMJULXQKGMM-UHFFFAOYSA-N polymyxin E1 Natural products CCC(C)CCCCC(=O)NC(CCN)C(=O)NC(C(C)O)C(=O)NC(CCN)C(=O)NC1CCNC(=O)C(C(C)O)NC(=O)C(CCN)NC(=O)C(CCN)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCN)NC1=O XDJYMJULXQKGMM-UHFFFAOYSA-N 0.000 description 1
- KNIWPHSUTGNZST-UHFFFAOYSA-N polymyxin E2 Natural products CC(C)CCCCC(=O)NC(CCN)C(=O)NC(C(C)O)C(=O)NC(CCN)C(=O)NC1CCNC(=O)C(C(C)O)NC(=O)C(CCN)NC(=O)C(CCN)NC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(CCN)NC1=O KNIWPHSUTGNZST-UHFFFAOYSA-N 0.000 description 1
- 229960005266 polymyxin b Drugs 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229950004447 posizolid Drugs 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 208000024896 potassium deficiency disease Diseases 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 229960004694 prednimustine Drugs 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 208000018290 primary dysautonomia Diseases 0.000 description 1
- 201000000742 primary sclerosing cholangitis Diseases 0.000 description 1
- 229960003961 pristinamycin Drugs 0.000 description 1
- DAIKHDNSXMZDCU-FQTGFAPKSA-N pristinamycin IIA Chemical compound C1C(=O)C[C@H](O)\C=C(/C)\C=C\CNC(=O)\C=C\[C@@H](C)[C@@H](C(C)C)OC(=O)C2=CCCN2C(=O)C2=COC1=N2 DAIKHDNSXMZDCU-FQTGFAPKSA-N 0.000 description 1
- JOOMGSFOCRDAHL-XKCHLWDXSA-N pristinamycin-IIB Natural products CC(C)[C@@H]1OC(=O)[C@H]2CCCN2C(=O)c3coc(CC(=O)C[C@@H](O)C=C(C)C=CCNC(=O)C=C[C@H]1C)n3 JOOMGSFOCRDAHL-XKCHLWDXSA-N 0.000 description 1
- CWCXERYKLSEGEZ-KDKHKZEGSA-N procalcitonin Chemical compound C([C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)NCC(O)=O)[C@@H](C)O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)[C@H]1NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@@H](N)CSSC1)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 CWCXERYKLSEGEZ-KDKHKZEGSA-N 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229940072288 prograf Drugs 0.000 description 1
- 230000007126 proinflammatory cytokine response Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 229940097325 prolactin Drugs 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- ABBQGOCHXSPKHJ-WUKNDPDISA-N prontosil Chemical compound NC1=CC(N)=CC=C1\N=N\C1=CC=C(S(N)(=O)=O)C=C1 ABBQGOCHXSPKHJ-WUKNDPDISA-N 0.000 description 1
- 150000005599 propionic acid derivatives Chemical class 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 201000007094 prostatitis Diseases 0.000 description 1
- 239000003207 proteasome inhibitor Substances 0.000 description 1
- 239000000007 protein synthesis inhibitor Substances 0.000 description 1
- 229940023143 protein vaccine Drugs 0.000 description 1
- 201000001474 proteinuria Diseases 0.000 description 1
- 201000008520 protoplasmic astrocytoma Diseases 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 208000001381 pseudotumor cerebri Diseases 0.000 description 1
- 230000001185 psoriatic effect Effects 0.000 description 1
- WOLQREOUPKZMEX-UHFFFAOYSA-N pteroyltriglutamic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(=O)NC(CCC(=O)NC(CCC(O)=O)C(O)=O)C(O)=O)C(O)=O)C=C1 WOLQREOUPKZMEX-UHFFFAOYSA-N 0.000 description 1
- 210000003689 pubic bone Anatomy 0.000 description 1
- 208000005069 pulmonary fibrosis Diseases 0.000 description 1
- 230000007047 pulmonary toxicity Effects 0.000 description 1
- 208000008128 pulmonary tuberculosis Diseases 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 229960005206 pyrazinamide Drugs 0.000 description 1
- IPEHBUMCGVEMRF-UHFFFAOYSA-N pyrazinecarboxamide Chemical compound NC(=O)C1=CN=CC=N1 IPEHBUMCGVEMRF-UHFFFAOYSA-N 0.000 description 1
- RADKZDMFGJYCBB-UHFFFAOYSA-N pyridoxal hydrochloride Natural products CC1=NC=C(CO)C(C=O)=C1O RADKZDMFGJYCBB-UHFFFAOYSA-N 0.000 description 1
- 235000008160 pyridoxine Nutrition 0.000 description 1
- 239000011677 pyridoxine Substances 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 229940052337 quinupristin/dalfopristin Drugs 0.000 description 1
- 229950009965 radezolid Drugs 0.000 description 1
- BTTNOGHPGJANSW-IBGZPJMESA-N radezolid Chemical compound O=C1O[C@@H](CNC(=O)C)CN1C1=CC=C(C=2C=CC(CNCC=3NN=NC=3)=CC=2)C(F)=C1 BTTNOGHPGJANSW-IBGZPJMESA-N 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 108010076689 ramoplanin Proteins 0.000 description 1
- 229950003551 ramoplanin Drugs 0.000 description 1
- 108010047804 ranalexin Proteins 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 229940099538 rapamune Drugs 0.000 description 1
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- BMKDZUISNHGIBY-UHFFFAOYSA-N razoxane Chemical compound C1C(=O)NC(=O)CN1C(C)CN1CC(=O)NC(=O)C1 BMKDZUISNHGIBY-UHFFFAOYSA-N 0.000 description 1
- 229960000460 razoxane Drugs 0.000 description 1
- 208000002574 reactive arthritis Diseases 0.000 description 1
- 229940044551 receptor antagonist Drugs 0.000 description 1
- 239000002464 receptor antagonist Substances 0.000 description 1
- 238000010992 reflux Methods 0.000 description 1
- 229960004836 regorafenib Drugs 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 229940116176 remicade Drugs 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 201000004335 respiratory allergy Diseases 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 102000027483 retinoid hormone receptors Human genes 0.000 description 1
- 108091008679 retinoid hormone receptors Proteins 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- OWPCHSCAPHNHAV-LMONGJCWSA-N rhizoxin Chemical compound C/C([C@H](OC)[C@@H](C)[C@@H]1C[C@H](O)[C@]2(C)O[C@@H]2/C=C/[C@@H](C)[C@]2([H])OC(=O)C[C@@](C2)(C[C@@H]2O[C@H]2C(=O)O1)[H])=C\C=C\C(\C)=C\C1=COC(C)=N1 OWPCHSCAPHNHAV-LMONGJCWSA-N 0.000 description 1
- 235000019192 riboflavin Nutrition 0.000 description 1
- 239000002151 riboflavin Substances 0.000 description 1
- 229960002477 riboflavin Drugs 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 229960000885 rifabutin Drugs 0.000 description 1
- 229960001225 rifampicin Drugs 0.000 description 1
- 229960003292 rifamycin Drugs 0.000 description 1
- HJYYPODYNSCCOU-ODRIEIDWSA-N rifamycin SV Chemical compound OC1=C(C(O)=C2C)C3=C(O)C=C1NC(=O)\C(C)=C/C=C/[C@H](C)[C@H](O)[C@@H](C)[C@@H](O)[C@@H](C)[C@H](OC(C)=O)[C@H](C)[C@@H](OC)\C=C\O[C@@]1(C)OC2=C3C1=O HJYYPODYNSCCOU-ODRIEIDWSA-N 0.000 description 1
- WDZCUPBHRAEYDL-GZAUEHORSA-N rifapentine Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C(O)=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N(CC1)CCN1C1CCCC1 WDZCUPBHRAEYDL-GZAUEHORSA-N 0.000 description 1
- 229960002599 rifapentine Drugs 0.000 description 1
- 229960003040 rifaximin Drugs 0.000 description 1
- NZCRJKRKKOLAOJ-XRCRFVBUSA-N rifaximin Chemical compound OC1=C(C(O)=C2C)C3=C4N=C5C=C(C)C=CN5C4=C1NC(=O)\C(C)=C/C=C/[C@H](C)[C@H](O)[C@@H](C)[C@@H](O)[C@@H](C)[C@H](OC(C)=O)[C@H](C)[C@@H](OC)\C=C\O[C@@]1(C)OC2=C3C1=O NZCRJKRKKOLAOJ-XRCRFVBUSA-N 0.000 description 1
- 229950004257 ristocetin Drugs 0.000 description 1
- 229950004892 rodorubicin Drugs 0.000 description 1
- 229960000371 rofecoxib Drugs 0.000 description 1
- MBABCNBNDNGODA-WPZDJQSSSA-N rolliniastatin 1 Natural products O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@H]1[C@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@@H](O)CC=2C(O[C@@H](C)C=2)=O)CC1 MBABCNBNDNGODA-WPZDJQSSSA-N 0.000 description 1
- IMUQLZLGWJSVMV-UOBFQKKOSA-N roridin A Natural products CC(O)C1OCCC(C)C(O)C(=O)OCC2CC(=CC3OC4CC(OC(=O)C=C/C=C/1)C(C)(C23)C45CO5)C IMUQLZLGWJSVMV-UOBFQKKOSA-N 0.000 description 1
- 229950001447 rosaramicin Drugs 0.000 description 1
- BPRHUIZQVSMCRT-VEUZHWNKSA-N rosuvastatin Chemical compound CC(C)C1=NC(N(C)S(C)(=O)=O)=NC(C=2C=CC(F)=CC=2)=C1\C=C\[C@@H](O)C[C@@H](O)CC(O)=O BPRHUIZQVSMCRT-VEUZHWNKSA-N 0.000 description 1
- 229960000672 rosuvastatin Drugs 0.000 description 1
- 229960005224 roxithromycin Drugs 0.000 description 1
- VHXNKPBCCMUMSW-FQEVSTJZSA-N rubitecan Chemical compound C1=CC([N+]([O-])=O)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VHXNKPBCCMUMSW-FQEVSTJZSA-N 0.000 description 1
- 229910052707 ruthenium Inorganic materials 0.000 description 1
- 201000007416 salivary gland adenoid cystic carcinoma Diseases 0.000 description 1
- 229960000953 salsalate Drugs 0.000 description 1
- 229930182947 sarcodictyin Natural products 0.000 description 1
- 208000014212 sarcomatoid carcinoma Diseases 0.000 description 1
- 229960005399 satraplatin Drugs 0.000 description 1
- 190014017285 satraplatin Chemical compound 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 235000015067 sauces Nutrition 0.000 description 1
- 235000013580 sausages Nutrition 0.000 description 1
- 210000004761 scalp Anatomy 0.000 description 1
- 108091005418 scavenger receptor class E Proteins 0.000 description 1
- 201000000980 schizophrenia Diseases 0.000 description 1
- 206010039667 schwannoma Diseases 0.000 description 1
- 208000010157 sclerosing cholangitis Diseases 0.000 description 1
- 235000014102 seafood Nutrition 0.000 description 1
- 208000017022 seasonal allergic rhinitis Diseases 0.000 description 1
- 230000001932 seasonal effect Effects 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 208000008742 seborrheic dermatitis Diseases 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 229910052711 selenium Inorganic materials 0.000 description 1
- 239000011669 selenium Substances 0.000 description 1
- 201000001223 septic arthritis Diseases 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 208000013220 shortness of breath Diseases 0.000 description 1
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 1
- 201000008123 signet ring cell adenocarcinoma Diseases 0.000 description 1
- 229960003600 silver sulfadiazine Drugs 0.000 description 1
- UEJSSZHHYBHCEL-UHFFFAOYSA-N silver(1+) sulfadiazinate Chemical compound [Ag+].C1=CC(N)=CC=C1S(=O)(=O)[N-]C1=NC=CC=N1 UEJSSZHHYBHCEL-UHFFFAOYSA-N 0.000 description 1
- 235000021309 simple sugar Nutrition 0.000 description 1
- 201000009890 sinusitis Diseases 0.000 description 1
- 229960002930 sirolimus Drugs 0.000 description 1
- 201000002078 skin pilomatrix carcinoma Diseases 0.000 description 1
- 101150038679 skp gene Proteins 0.000 description 1
- 208000000649 small cell carcinoma Diseases 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- WXMKPNITSTVMEF-UHFFFAOYSA-M sodium benzoate Chemical compound [Na+].[O-]C(=O)C1=CC=CC=C1 WXMKPNITSTVMEF-UHFFFAOYSA-M 0.000 description 1
- 239000004299 sodium benzoate Substances 0.000 description 1
- 235000010234 sodium benzoate Nutrition 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 229960004532 somatropin Drugs 0.000 description 1
- 229960000487 sorafenib tosylate Drugs 0.000 description 1
- 229960004954 sparfloxacin Drugs 0.000 description 1
- DZZWHBIBMUVIIW-DTORHVGOSA-N sparfloxacin Chemical compound C1[C@@H](C)N[C@@H](C)CN1C1=C(F)C(N)=C2C(=O)C(C(O)=O)=CN(C3CC3)C2=C1F DZZWHBIBMUVIIW-DTORHVGOSA-N 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 208000002320 spinal muscular atrophy Diseases 0.000 description 1
- 229950006315 spirogermanium Drugs 0.000 description 1
- ICXJVZHDZFXYQC-UHFFFAOYSA-N spongistatin 1 Natural products OC1C(O2)(O)CC(O)C(C)C2CCCC=CC(O2)CC(O)CC2(O2)CC(OC)CC2CC(=O)C(C)C(OC(C)=O)C(C)C(=C)CC(O2)CC(C)(O)CC2(O2)CC(OC(C)=O)CC2CC(=O)OC2C(O)C(CC(=C)CC(O)C=CC(Cl)=C)OC1C2C ICXJVZHDZFXYQC-UHFFFAOYSA-N 0.000 description 1
- 230000028070 sporulation Effects 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 229940090374 stivarga Drugs 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 208000028210 stromal sarcoma Diseases 0.000 description 1
- 238000013337 sub-cultivation Methods 0.000 description 1
- 238000000859 sublimation Methods 0.000 description 1
- 230000008022 sublimation Effects 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 229960002673 sulfacetamide Drugs 0.000 description 1
- SKIVFJLNDNKQPD-UHFFFAOYSA-N sulfacetamide Chemical compound CC(=O)NS(=O)(=O)C1=CC=C(N)C=C1 SKIVFJLNDNKQPD-UHFFFAOYSA-N 0.000 description 1
- 229960000973 sulfadimethoxine Drugs 0.000 description 1
- ZZORFUFYDOWNEF-UHFFFAOYSA-N sulfadimethoxine Chemical compound COC1=NC(OC)=CC(NS(=O)(=O)C=2C=CC(N)=CC=2)=N1 ZZORFUFYDOWNEF-UHFFFAOYSA-N 0.000 description 1
- 229960000654 sulfafurazole Drugs 0.000 description 1
- 229960005158 sulfamethizole Drugs 0.000 description 1
- VACCAVUAMIDAGB-UHFFFAOYSA-N sulfamethizole Chemical compound S1C(C)=NN=C1NS(=O)(=O)C1=CC=C(N)C=C1 VACCAVUAMIDAGB-UHFFFAOYSA-N 0.000 description 1
- 229960005404 sulfamethoxazole Drugs 0.000 description 1
- 229950008188 sulfamidochrysoidine Drugs 0.000 description 1
- 229960000894 sulindac Drugs 0.000 description 1
- MLKXDPUZXIRXEP-MFOYZWKCSA-N sulindac Chemical compound CC1=C(CC(O)=O)C2=CC(F)=CC=C2\C1=C/C1=CC=C(S(C)=O)C=C1 MLKXDPUZXIRXEP-MFOYZWKCSA-N 0.000 description 1
- JLKIGFTWXXRPMT-UHFFFAOYSA-N sulphamethoxazole Chemical compound O1C(C)=CC(NS(=O)(=O)C=2C=CC(N)=CC=2)=N1 JLKIGFTWXXRPMT-UHFFFAOYSA-N 0.000 description 1
- 229960002812 sunitinib malate Drugs 0.000 description 1
- 208000030457 superficial spreading melanoma Diseases 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 229940034785 sutent Drugs 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 201000004595 synovitis Diseases 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 229940120982 tarceva Drugs 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 229940069905 tasigna Drugs 0.000 description 1
- AJKIRUJIDFJUKJ-UHFFFAOYSA-N taurolidine Chemical compound C1NS(=O)(=O)CCN1CN1CNS(=O)(=O)CC1 AJKIRUJIDFJUKJ-UHFFFAOYSA-N 0.000 description 1
- 229960004267 taurolidine Drugs 0.000 description 1
- 235000013616 tea Nutrition 0.000 description 1
- UMHMOGFSSCTSNY-XSJWQOAGSA-N tecemotide Chemical compound CCCCCCCCCCCCCCCC(=O)NCCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1N(C(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H]2N(CCC2)C(=O)[C@H](C)NC(=O)[C@H]2N(CCC2)C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC=2NC=NC=2)NC(=O)[C@H](C)NC(=O)[C@H]2N(CCC2)C(=O)[C@H]2N(CCC2)C(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)[C@@H](C)O)C(C)C)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)CCC1 UMHMOGFSSCTSNY-XSJWQOAGSA-N 0.000 description 1
- 229950001399 tecemotide Drugs 0.000 description 1
- XFALPSLJIHVRKE-GFCCVEGCSA-N tedizolid Chemical compound CN1N=NC(C=2N=CC(=CC=2)C=2C(=CC(=CC=2)N2C(O[C@@H](CO)C2)=O)F)=N1 XFALPSLJIHVRKE-GFCCVEGCSA-N 0.000 description 1
- 229960005240 telavancin Drugs 0.000 description 1
- ONUMZHGUFYIKPM-MXNFEBESSA-N telavancin Chemical compound O1[C@@H](C)[C@@H](O)[C@](NCCNCCCCCCCCCC)(C)C[C@@H]1O[C@H]1[C@H](OC=2C3=CC=4[C@H](C(N[C@H]5C(=O)N[C@H](C(N[C@@H](C6=CC(O)=C(CNCP(O)(O)=O)C(O)=C6C=6C(O)=CC=C5C=6)C(O)=O)=O)[C@H](O)C5=CC=C(C(=C5)Cl)O3)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](NC(=O)[C@@H](CC(C)C)NC)[C@H](O)C3=CC=C(C(=C3)Cl)OC=2C=4)O[C@H](CO)[C@@H](O)[C@@H]1O ONUMZHGUFYIKPM-MXNFEBESSA-N 0.000 description 1
- 108010089019 telavancin Proteins 0.000 description 1
- 229960004576 temafloxacin Drugs 0.000 description 1
- 229960001114 temocillin Drugs 0.000 description 1
- BVCKFLJARNKCSS-DWPRYXJFSA-N temocillin Chemical compound N([C@]1(OC)C(N2[C@H](C(C)(C)S[C@@H]21)C(O)=O)=O)C(=O)C(C(O)=O)C=1C=CSC=1 BVCKFLJARNKCSS-DWPRYXJFSA-N 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 229960000235 temsirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-UHFFFAOYSA-N temsirolimus Natural products C1CC(O)C(OC)CC1CC(C)C1OC(=O)C2CCCCN2C(=O)C(=O)C(O)(O2)C(C)CCC2CC(OC)C(C)=CC=CC=CC(C)CC(C)C(=O)C(OC)C(O)C(C)=CC(C)C(=O)C1 QFJCIRLUMZQUOT-UHFFFAOYSA-N 0.000 description 1
- 201000004415 tendinitis Diseases 0.000 description 1
- 210000002435 tendon Anatomy 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 229960002871 tenoxicam Drugs 0.000 description 1
- WZWYJBNHTWCXIM-UHFFFAOYSA-N tenoxicam Chemical compound O=C1C=2SC=CC=2S(=O)(=O)N(C)C1=C(O)NC1=CC=CC=N1 WZWYJBNHTWCXIM-UHFFFAOYSA-N 0.000 description 1
- IWVCMVBTMGNXQD-UHFFFAOYSA-N terramycin dehydrate Natural products C1=CC=C2C(O)(C)C3C(O)C4C(N(C)C)C(O)=C(C(N)=O)C(=O)C4(O)C(O)=C3C(=O)C2=C1O IWVCMVBTMGNXQD-UHFFFAOYSA-N 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229960005353 testolactone Drugs 0.000 description 1
- BPEWUONYVDABNZ-DZBHQSCQSA-N testolactone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(OC(=O)CC4)[C@@H]4[C@@H]3CCC2=C1 BPEWUONYVDABNZ-DZBHQSCQSA-N 0.000 description 1
- QZZGJDVWLFXDLK-UHFFFAOYSA-N tetracosanoic acid Chemical compound CCCCCCCCCCCCCCCCCCCCCCCC(O)=O QZZGJDVWLFXDLK-UHFFFAOYSA-N 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 208000001644 thecoma Diseases 0.000 description 1
- 229960000278 theophylline Drugs 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 235000019157 thiamine Nutrition 0.000 description 1
- 229960003495 thiamine Drugs 0.000 description 1
- 239000011721 thiamine Substances 0.000 description 1
- KYMBYSLLVAOCFI-UHFFFAOYSA-N thiamine Chemical compound CC1=C(CCO)SCN1CC1=CN=C(C)N=C1N KYMBYSLLVAOCFI-UHFFFAOYSA-N 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 108010029307 thymic stromal lymphopoietin Proteins 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 208000030901 thyroid gland follicular carcinoma Diseases 0.000 description 1
- 208000015191 thyroid gland papillary and follicular carcinoma Diseases 0.000 description 1
- YFTWHEBLORWGNI-UHFFFAOYSA-N tiamiprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC(N)=NC2=C1NC=N2 YFTWHEBLORWGNI-UHFFFAOYSA-N 0.000 description 1
- 229950011457 tiamiprine Drugs 0.000 description 1
- 229960004089 tigecycline Drugs 0.000 description 1
- 229960005053 tinidazole Drugs 0.000 description 1
- 231100000886 tinnitus Toxicity 0.000 description 1
- 239000010936 titanium Substances 0.000 description 1
- 229910052719 titanium Inorganic materials 0.000 description 1
- 229960000707 tobramycin Drugs 0.000 description 1
- NLVFBUXFDBBNBW-PBSUHMDJSA-N tobramycin Chemical compound N[C@@H]1C[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N NLVFBUXFDBBNBW-PBSUHMDJSA-N 0.000 description 1
- 229960003989 tocilizumab Drugs 0.000 description 1
- 229960000984 tocofersolan Drugs 0.000 description 1
- YEZNLOUZAIOMLT-UHFFFAOYSA-N tolfenamic acid Chemical compound CC1=C(Cl)C=CC=C1NC1=CC=CC=C1C(O)=O YEZNLOUZAIOMLT-UHFFFAOYSA-N 0.000 description 1
- 229960001017 tolmetin Drugs 0.000 description 1
- UPSPUYADGBWSHF-UHFFFAOYSA-N tolmetin Chemical compound C1=CC(C)=CC=C1C(=O)C1=CC=C(CC(O)=O)N1C UPSPUYADGBWSHF-UHFFFAOYSA-N 0.000 description 1
- 210000002105 tongue Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 229960005026 toremifene Drugs 0.000 description 1
- XFCLJVABOIYOMF-QPLCGJKRSA-N toremifene Chemical compound C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 XFCLJVABOIYOMF-QPLCGJKRSA-N 0.000 description 1
- 229940100411 torisel Drugs 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 208000029335 trabecular adenocarcinoma Diseases 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 229960004380 tramadol Drugs 0.000 description 1
- TVYLLZQTGLZFBW-GOEBONIOSA-N tramadol Natural products COC1=CC=CC([C@@]2(O)[C@@H](CCCC2)CN(C)C)=C1 TVYLLZQTGLZFBW-GOEBONIOSA-N 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 229940099456 transforming growth factor beta 1 Drugs 0.000 description 1
- 229940072041 transforming growth factor beta 2 Drugs 0.000 description 1
- 102000003601 transglutaminase Human genes 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 206010044412 transitional cell carcinoma Diseases 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- XETCRXVKJHBPMK-MJSODCSWSA-N trehalose 6,6'-dimycolate Chemical compound C([C@@H]1[C@H]([C@H](O)[C@@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](COC(=O)C(CCCCCCCCCCC3C(C3)CCCCCCCCCCCCCCCCCC)C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)O2)O)O1)O)OC(=O)C(C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)CCCCCCCCCCC1CC1CCCCCCCCCCCCCCCCCC XETCRXVKJHBPMK-MJSODCSWSA-N 0.000 description 1
- 229950001353 tretamine Drugs 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- 229960005294 triamcinolone Drugs 0.000 description 1
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 1
- AUALKMYBYGCYNY-UHFFFAOYSA-E triazanium;2-hydroxypropane-1,2,3-tricarboxylate;iron(3+) Chemical compound [NH4+].[NH4+].[NH4+].[Fe+3].[Fe+3].[Fe+3].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O AUALKMYBYGCYNY-UHFFFAOYSA-E 0.000 description 1
- PXSOHRWMIRDKMP-UHFFFAOYSA-N triaziquone Chemical compound O=C1C(N2CC2)=C(N2CC2)C(=O)C=C1N1CC1 PXSOHRWMIRDKMP-UHFFFAOYSA-N 0.000 description 1
- 229960004560 triaziquone Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 229930013292 trichothecene Natural products 0.000 description 1
- 150000003327 trichothecene derivatives Chemical class 0.000 description 1
- 229960001670 trilostane Drugs 0.000 description 1
- KVJXBPDAXMEYOA-CXANFOAXSA-N trilostane Chemical compound OC1=C(C#N)C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@@]32O[C@@H]31 KVJXBPDAXMEYOA-CXANFOAXSA-N 0.000 description 1
- IEDVJHCEMCRBQM-UHFFFAOYSA-N trimethoprim Chemical compound COC1=C(OC)C(OC)=CC(CC=2C(=NC(N)=NC=2)N)=C1 IEDVJHCEMCRBQM-UHFFFAOYSA-N 0.000 description 1
- 229960001082 trimethoprim Drugs 0.000 description 1
- RYYVLZVUVIJVGH-UHFFFAOYSA-N trimethylxanthine Natural products CN1C(=O)N(C)C(=O)C2=C1N=CN2C RYYVLZVUVIJVGH-UHFFFAOYSA-N 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-N trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=NC(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-N 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- 150000004043 trisaccharides Chemical class 0.000 description 1
- 229960000875 trofosfamide Drugs 0.000 description 1
- UMKFEPPTGMDVMI-UHFFFAOYSA-N trofosfamide Chemical compound ClCCN(CCCl)P1(=O)OCCCN1CCCl UMKFEPPTGMDVMI-UHFFFAOYSA-N 0.000 description 1
- 229960000497 trovafloxacin Drugs 0.000 description 1
- WVPSKSLAZQPAKQ-CDMJZVDBSA-N trovafloxacin Chemical compound C([C@H]1[C@@H]([C@H]1C1)N)N1C(C(=CC=1C(=O)C(C(O)=O)=C2)F)=NC=1N2C1=CC=C(F)C=C1F WVPSKSLAZQPAKQ-CDMJZVDBSA-N 0.000 description 1
- HDZZVAMISRMYHH-LITAXDCLSA-N tubercidin Chemical compound C1=CC=2C(N)=NC=NC=2N1[C@@H]1O[C@@H](CO)[C@H](O)[C@H]1O HDZZVAMISRMYHH-LITAXDCLSA-N 0.000 description 1
- 239000000814 tuberculostatic agent Substances 0.000 description 1
- 229940046728 tumor necrosis factor alpha inhibitor Drugs 0.000 description 1
- 239000002451 tumor necrosis factor inhibitor Substances 0.000 description 1
- 229940094060 tykerb Drugs 0.000 description 1
- 229960004059 tylosin Drugs 0.000 description 1
- WBPYTXDJUQJLPQ-VMXQISHHSA-N tylosin Chemical compound O([C@@H]1[C@@H](C)O[C@H]([C@@H]([C@H]1N(C)C)O)O[C@@H]1[C@@H](C)[C@H](O)CC(=O)O[C@@H]([C@H](/C=C(\C)/C=C/C(=O)[C@H](C)C[C@@H]1CC=O)CO[C@H]1[C@@H]([C@H](OC)[C@H](O)[C@@H](C)O1)OC)CC)[C@H]1C[C@@](C)(O)[C@@H](O)[C@H](C)O1 WBPYTXDJUQJLPQ-VMXQISHHSA-N 0.000 description 1
- 235000019375 tylosin Nutrition 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 229960003281 tyrothricin Drugs 0.000 description 1
- 229940079023 tysabri Drugs 0.000 description 1
- 229950009811 ubenimex Drugs 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 208000000143 urethritis Diseases 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 208000019206 urinary tract infection Diseases 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 229960005356 urokinase Drugs 0.000 description 1
- 102000009816 urokinase plasminogen activator receptor activity proteins Human genes 0.000 description 1
- 108040001269 urokinase plasminogen activator receptor activity proteins Proteins 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 229960000241 vandetanib Drugs 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 229960003862 vemurafenib Drugs 0.000 description 1
- 231100000889 vertigo Toxicity 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 229920006163 vinyl copolymer Polymers 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 229960003842 virginiamycin Drugs 0.000 description 1
- 235000019373 virginiamycin Nutrition 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 235000019155 vitamin A Nutrition 0.000 description 1
- 239000011719 vitamin A Substances 0.000 description 1
- 235000019163 vitamin B12 Nutrition 0.000 description 1
- 239000011715 vitamin B12 Substances 0.000 description 1
- 235000008979 vitamin B4 Nutrition 0.000 description 1
- 239000011579 vitamin B4 Substances 0.000 description 1
- 235000019158 vitamin B6 Nutrition 0.000 description 1
- 239000011726 vitamin B6 Substances 0.000 description 1
- 235000019154 vitamin C Nutrition 0.000 description 1
- 239000011718 vitamin C Substances 0.000 description 1
- 235000019166 vitamin D Nutrition 0.000 description 1
- 239000011710 vitamin D Substances 0.000 description 1
- 150000003710 vitamin D derivatives Chemical class 0.000 description 1
- 239000011653 vitamin D2 Substances 0.000 description 1
- 235000019165 vitamin E Nutrition 0.000 description 1
- 229940046009 vitamin E Drugs 0.000 description 1
- 239000011709 vitamin E Substances 0.000 description 1
- 235000019168 vitamin K Nutrition 0.000 description 1
- 239000011712 vitamin K Substances 0.000 description 1
- 150000003721 vitamin K derivatives Chemical class 0.000 description 1
- 235000012711 vitamin K3 Nutrition 0.000 description 1
- 239000011652 vitamin K3 Substances 0.000 description 1
- 229940045997 vitamin a Drugs 0.000 description 1
- 229940046008 vitamin d Drugs 0.000 description 1
- 229940046010 vitamin k Drugs 0.000 description 1
- 229940041603 vitamin k 3 Drugs 0.000 description 1
- 229940069559 votrient Drugs 0.000 description 1
- 208000002003 vulvitis Diseases 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 229920003169 water-soluble polymer Polymers 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
- 210000000707 wrist Anatomy 0.000 description 1
- 229940049068 xalkori Drugs 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 235000010493 xanthan gum Nutrition 0.000 description 1
- 239000000230 xanthan gum Substances 0.000 description 1
- 229940082509 xanthan gum Drugs 0.000 description 1
- 229940053867 xeloda Drugs 0.000 description 1
- 229920001221 xylan Polymers 0.000 description 1
- 150000004823 xylans Chemical class 0.000 description 1
- 229940036061 zaltrap Drugs 0.000 description 1
- 229940034727 zelboraf Drugs 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- XOOUIPVCVHRTMJ-UHFFFAOYSA-L zinc stearate Chemical compound [Zn+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O XOOUIPVCVHRTMJ-UHFFFAOYSA-L 0.000 description 1
- 229950009268 zinostatin Drugs 0.000 description 1
- 229960002760 ziv-aflibercept Drugs 0.000 description 1
- 229960000641 zorubicin Drugs 0.000 description 1
- FBTUMDXHSRTGRV-ALTNURHMSA-N zorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\NC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 FBTUMDXHSRTGRV-ALTNURHMSA-N 0.000 description 1
- 239000002076 α-tocopherol Substances 0.000 description 1
- 235000004835 α-tocopherol Nutrition 0.000 description 1
- 150000003952 β-lactams Chemical class 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
- A61K35/741—Probiotics
- A61K35/744—Lactic acid bacteria, e.g. enterococci, pediococci, lactococci, streptococci or leuconostocs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/20—Bacteria; Culture media therefor
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N1/00—Microorganisms, e.g. protozoa; Compositions thereof; Processes of propagating, maintaining or preserving microorganisms or compositions thereof; Processes of preparing or isolating a composition containing a microorganism; Culture media therefor
- C12N1/20—Bacteria; Culture media therefor
- C12N1/205—Bacterial isolates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K2035/11—Medicinal preparations comprising living procariotic cells
- A61K2035/115—Probiotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/05—Immunological preparations stimulating the reticulo-endothelial system, e.g. against cancer
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/225—Lactobacillus
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- compositions e.g., bacterial compositions, pharmaceutical compositions
- disease e.g., cancer, autoimmune disease, inflammatory disease, metabolic disease
- a subject e.g., a human subject
- administering a bacterial composition comprising Lactococcus bacteria and/or a product of such bacteria (e.g., extracellular vesicles (EVs) and/or pharmaceutically active biomasses (PhABs)).
- a bacterial composition comprising Lactococcus bacteria and/or a product of such bacteria (e.g., extracellular vesicles (EVs) and/or pharmaceutically active biomasses (PhABs)).
- EVs extracellular vesicles
- PhABs pharmaceutically active biomasses
- provided herein are methods and compositions related to the treatment and/or prevention of an immune disorder in a subject (e.g., a human subject) comprising administering a bacterial (pharmaceutical) composition comprising immune modulating Lactococcus bacteria disclosed herein and/or a product of immune modulating Lactococcus bacteria disclosed herein (e.g., extracellular vesicles (EVs) and/or pharmaceutically active biomasses (PhABs)). Also provided herein are methods of making and/or identifying such a bacterium and/or bacterial product. In some embodiments, provided here are bioreactors comprising Lactococcus bacteria disclosed herein.
- the immune modulating Lactococcus bacteria is an immune modulating strain of Lactococcus lactis cremoris .
- the immune modulating Lactococcus strain is Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368).
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) comprising a protein listed in Table 1 and/or a gene encoding a protein listed in Table 1.
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) comprising a membrane associated protein listed in Table 2 and/or a gene encoding a membrane associated protein listed in Table 2.
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of a protein listed in Table 3 and/or a gene encoding a protein listed in Table 3.
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of an exopolysaccharide (EPS) synthesis protein listed in Table 4 and/or a gene encoding an EPS synthesis protein listed in Table 4.
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of an EPS synthesized in whole or in part by a protein listed in Table 4.
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of EPS.
- the bacterial compositions provided herein comprise an immune modulating Lactococcus strain provided herein.
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of a protein listed in Table 5 and/or a gene encoding a protein listed in Table 5.
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) comprising a protein listed in Table 6 and/or a gene encoding a protein listed in Table 6.
- a strain of Lactococcus bacteria e.g., a strain of Lactococcus lactis cremoris
- PhABs made from and/or comprising an immune modulating Lactococcus strain provided herein.
- the PhABs comprise whole cells, fractions of cells, supernatant from fermentation, fractions of supernatant and/or extracellular vesicles made immune modulating bacteria described herein.
- the bacterial compositions provided herein comprise an immune modulating Lactococcus strain PhAB provided herein.
- EVs produced by and/or generated from and/or isolated from an immune modulating Lactococcus strain provided herein.
- the bacterial compositions comprise both immune modulating Lactococcus strain EVs and whole immune modulating Lactococcus strain bacteria (e.g., live bacteria, killed bacteria, attenuated bacteria).
- provided herein are bacterial compositions comprising immune modulating Lactococcus strain bacteria (e.g., Lactococcus lactis cremoris Strain A) in the absence of immune modulating Lactococcus strain EVs.
- the pharmaceutical compositions comprise immune modulating Lactococcus strain EVs in the absence of immune modulating Lactococcus strain bacteria.
- the immune modulating Lactococcus strain comprises at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the nucleotide sequence (e.g., genomic sequence, 16S sequence, CRISPR sequence) of the Lactococcus lactis cremoris Strain A.
- the administration of the bacterial composition treats the immune disorder in the subject.
- the immune disorder is an autoimmune disease.
- the immune disorder is an inflammatory disease.
- the immune disorder is an allergy.
- provided herein are methods of treating a subject who has an immune disorder (e.g., an autoimmune disease, an inflammatory disease, an allergy), comprising administering to the subject a bacterial composition comprising immune modulating Lactococcus strain bacteria provided herein (e.g., a killed bacterium, a live bacterium, a pharmaceutically active biomass and/or an attenuated bacterium).
- immune modulating Lactococcus strain is Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368).
- immune modulating Lactococcus strain is a strain comprising at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity (e.g., genomic sequence identity, 16S sequence identity, CRISPR sequence identity) (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the corresponding nucleotide sequence of the Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368).
- sequence identity e.g., genomic sequence identity, 16S sequence identity, CRISPR sequence identity
- sequence identity e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity
- At least 50%, 60%, 70%, 80%, 85%, 90%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the bacteria in the bacterial composition are the immune modulating Lactococcus strain. In some embodiments, all or substantially all of the bacteria in the bacterial formulation are the immune modulating Lactococcus strain.
- the bacterial formulation comprises at least 1 ⁇ 10 5 , 5 ⁇ 10 5 , 1 ⁇ 10 6 , 2 ⁇ 10 6 , 3 ⁇ 10 6 , 4 ⁇ 10 6 , 5 ⁇ 10 6 , 6 ⁇ 10 6 , 7 ⁇ 10 6 , 8 ⁇ 10 6 , 9 ⁇ 10 6 , 1 ⁇ 10 7 , 2 ⁇ 10 7 , 3 ⁇ 10 7 , 4 ⁇ 10 7 , 5 ⁇ 10 7 , 6 ⁇ 10 7 , 7 ⁇ 10 7 , 8 ⁇ 10 7 , 9 ⁇ 10 7 , 1 ⁇ 10 8 , 2 ⁇ 10 8 , 3 ⁇ 10 8 , 4 ⁇ 10 8 , 5 ⁇ 10 8 , 6 ⁇ 10 8 , 7 ⁇ 10 8 , 8 ⁇ 10 8 , 9 ⁇ 10 8 or 1 ⁇ 10 9 colony forming units of the immune modulating Lactococcus strain.
- the bacterial composition comprises EVs and/or PhABs (e.g., whole cells, fractions of cells, supernatant from fermentation, fractions of supernatant and/or extracellular vesicles) made from the immune modulating Lactococcus strain.
- EVs and/or PhABs e.g., whole cells, fractions of cells, supernatant from fermentation, fractions of supernatant and/or extracellular vesicles
- bacterial compositions comprising an immune modulating Lactococcus strain provided herein (e.g., a killed bacterium, a live bacterium, a pharmaceutically active biomass and/or an attenuated bacterium).
- immune modulating Lactococcus strain is Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368).
- immune modulating Lactococcus strain is a strain comprising at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity (e.g., genomic sequence identity, 16S sequence identity, CRISPR sequence identity) (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the corresponding nucleotide sequence of the Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368).
- sequence identity e.g., genomic sequence identity, 16S sequence identity, CRISPR sequence identity
- sequence identity e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity
- At least 50%, 60%, 70%, 80%, 85%, 90%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the bacteria in the bacterial composition are the immune modulating Lactococcus strain. In some embodiments, all or substantially all of the bacteria in the bacterial formulation are the immune modulating Lactococcus strain.
- the bacterial formulation comprises at least 1 ⁇ 10 5 , 5 ⁇ 10 5 , 1 ⁇ 10 6 , 2 ⁇ 10 6 , 3 ⁇ 10 6 , 4 ⁇ 10 6 , 5 ⁇ 10 6 , 6 ⁇ 10 6 , 7 ⁇ 10 6 , 8 ⁇ 10 6 , 9 ⁇ 10 6 , 1 ⁇ 10 7 , 2 ⁇ 10 7 , 3 ⁇ 10 7 , 4 ⁇ 10 7 , 5 ⁇ 10 7 , 6 ⁇ 10 7 , 7 ⁇ 10 7 , 8 ⁇ 10 7 , 9 ⁇ 10 7 , 1 ⁇ 10 8 , 2 ⁇ 10 8 , 3 ⁇ 10 8 , 4 ⁇ 10 8 , 5 ⁇ 10 8 , 6 ⁇ 10 8 , 7 ⁇ 10 8 , 8 ⁇ 10 8 , 9 ⁇ 10 8 or 1 ⁇ 10 9 colony forming units of the immune modulating Lactococcus strain.
- the bacterial composition comprises EVs and/or PhABs (e.g., whole cells, fractions of cells, supernatant from fermentation, fractions of supernatant and/or extracellular vesicles) made from the immune modulating Lactococcus strain.
- EVs and/or PhABs e.g., whole cells, fractions of cells, supernatant from fermentation, fractions of supernatant and/or extracellular vesicles
- the bacterial compositions provided herein comprise a specific ratio of immune modulating Lactococcus strain bacteria to immune modulating Lactococcus strain EV particles.
- the bacterial composition comprises at least 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8.
- the bacterial composition comprises about 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7,
- the bacterial composition comprises no more than 1 Lactococcus lactis cremoris bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8.
- the bacterial composition comprises at least 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7
- the bacterial composition comprises about 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8.
- the bacterial composition comprises no more than 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.
- the bacterial composition is administered orally, intravenously, intratumorally, or subcutaneously. In some embodiments, the bacterial composition is administered in 2 or more (e.g., 3 or more, 4 or more or 5 or more doses). In some embodiments, the administration to the subject of the two or more doses are separated by at least 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days or 21 days. In some embodiments, a second bacterium is administered as part of an ecological consortium.
- the subject has mild to moderate atopic dermatitis. In some embodiments, the subject has mild atopic dermatitis. In some embodiments, the subject has moderate atopic dermatitis.
- the subject has mild to moderate psoriasis. In some embodiments, the subject has mild psoriasis. In some embodiments the subject has moderate psoriasis.
- the subject is administered a daily dose of between about 66 mg and about 3.3 g of an immune modulating Lactococcus strain provided herein (e.g., Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368) or a strain comprising at least 99% sequence identity (e.g., genomic sequence identity, 16S sequence identity, CRISPR sequence identity) (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the nucleotide sequence of the Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368)).
- sequence identity e.g., genomic sequence identity, 16S sequence identity, CRISPR sequence identity
- sequence identity e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity
- the subject is administered a daily dose of about 66 mg of an immune modulating Lactococcus strain provided herein. In some embodiments, the subject is administered a daily dose of about 660 mg of an immune modulating Lactococcus strain provided herein. In some embodiments, the subject is administered a daily dose of about 3.3 g of an immune modulating Lactococcus strain provided herein. In some embodiments, the daily dose is formulated in a capsule. In some embodiments, the subject is administered the dose of an immune modulating Lactococcus strain provided herein for at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days.
- the subject has a body mass index of 18 kg/m2 to 35 kg/m2. In some embodiments, the subject has a confirmed diagnosis of mild to moderate plaque-type psoriasis for at least 6 months involving ⁇ 5% of body surface area (BSA) (excluding the scalp). In some embodiments, the subject ha a minimum of 2 psoriatic lesions. In some embodiments, the subject has mild to moderate atopic dermatitis with a minimum of 3 to a maximum of 15% BSA involvement. In some embodiments, the subject has had a confirmed diagnosis of mild to moderate atopic dermatitis for at least 6 months with an IGA score of 2 or 3. In some embodiments, the subject has at least 2 atopic dermatitis lesions.
- BSA body surface area
- the subject is not pregnant. In some embodiments, the subject is not breastfeeding. In some embodiments, the subject is not being treated with an anti-inflammatory drug. In some embodiments, the subject does not have an active infection (e.g., sepsis, pneumonia, abscess).
- an active infection e.g., sepsis, pneumonia, abscess.
- the subject does not have renal or liver impairment (e.g., for women a serum creatinine level ⁇ 125 ⁇ mol/L, for men a serum creatinine level of ⁇ 125 ⁇ mol/L, an alanine aminotransferase (ALT) and aspartate aminotransferase (AST) ⁇ 1.5 ⁇ or 2 ⁇ the upper limit of normal (ULN), alkaline phosphatase (ALP) and/or bilirubin >1.5 ⁇ ULN.
- renal or liver impairment e.g., for women a serum creatinine level ⁇ 125 ⁇ mol/L, for men a serum creatinine level of ⁇ 125 ⁇ mol/L, an alanine aminotransferase (ALT) and aspartate aminotransferase (AST) ⁇ 1.5 ⁇ or 2 ⁇ the upper limit of normal (ULN), alkaline phosphatase (ALP) and/or bilirubin >1.5 ⁇ ULN.
- ALT alanine aminotransferase
- the bacterial composition suppresses the immune response in delayed-type hypersensitivity (DTH). In certain embodiments, the bacterial composition induces a regulatory T cell or an anti-inflammatory response. In certain embodiments, the bacterial composition inhibits antigen-specific responses. In certain embodiments, the bacterial composition treats allergic contact dermatitis. In certain embodiments, the bacterial composition treats autoimmune myocarditis. In certain embodiments, the bacterial composition treats diabetes mellitus type 1. In certain embodiments, the bacterial composition treats granulomas. In certain embodiments, the bacterial composition treats peripheral neuropathies. In certain embodiments, the bacterial composition treats Hashimoto's thyroiditis. In certain embodiments, the bacterial composition treats multiple sclerosis. In certain embodiments, the bacterial composition treats rheumatoid arthritis.
- DTH delayed-type hypersensitivity
- the bacterial composition treats inflammation of the colon. In certain embodiments, the bacterial composition treats colitis. Colitis may be acute and self-limited or long-term. In certain embodiments, the bacterial composition treats ulcerative colitis. In certain embodiments, the bacterial composition treats digestive diseases. In certain embodiments, the bacterial composition treats Crohn's disease. In certain embodiments, the bacterial composition treats inflammatory bowel disease (IBD). In certain embodiments, the bacterial composition treats microscopic colitis. In certain embodiments, the bacterial composition treats collagenous colitis. In certain embodiments, the bacterial composition treats diversion colitis. In certain embodiments, the bacterial composition treats chemical colitis. In certain embodiments, the bacterial composition treats ischemic colitis.
- Colitis may be acute and self-limited or long-term. In certain embodiments, the bacterial composition treats ulcerative colitis. In certain embodiments, the bacterial composition treats digestive diseases. In certain embodiments, the bacterial composition treats Crohn's disease. In certain embodiments, the bacterial composition treats inflammatory bowel disease (IBD
- the bacterial composition treats indeterminate colitis. In certain embodiments, the bacterial composition treats atypical colitis. In some embodiments, the method further comprises administering to the subject an additional therapeutic (e.g., an antibiotic an immune suppressant, an anti-inflammatory agent). In some embodiments, the method further comprises administering to the subject is a second therapeutic bacterium.
- an additional therapeutic e.g., an antibiotic an immune suppressant, an anti-inflammatory agent.
- the subject is a mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal (e.g., a dog, a cat, a cow, a horse, a pig, a donkey, a goat, a camel, a mouse, a rat, a guinea pig, a sheep, a llama, a monkey, a gorilla or a chimpanzee).
- a non-human mammal e.g., a dog, a cat, a cow, a horse, a pig, a donkey, a goat, a camel, a mouse, a rat, a guinea pig, a sheep, a llama, a monkey, a gorilla or a chimpanzee.
- FIG. 1 shows the efficacy of orally administered Lactococcus lactis cremoris Strain A in reducing antigen-specific ear swelling (ear thickness) compared to vehicle (negative control), anti-inflammatory Dexamethasone (positive control), and Bacteria A, B, and C in a delayed type hypersensitivity mouse model.
- FIG. 2 is a line graphing showing percent weight change in acute DSS-induced colitis model over a 12 day period for Lactococcus lactis cremoris Strain A in comparison to Bacteria A, B, and C, positive control (anti-p40), and negative control (Sucrose vehicle).
- the Lactococcus lactis cremoris Strain A group showed less weight change than the anti-p40 antibody (positive control).
- FIG. 3A and FIG. 3B are plots showing that orally administered Lactococcus lactis cremoris Strain A reduces antigen-specific ear swelling (ear thickness) compared to vehicle (negative control) and Dexamethasone ( FIG. 3A ) and Fingolimod ( FIG. 3B ).
- FIG. 4 is a plot showing the efficacy of Lactococcus lactis cremoris Strain A (with and without a 13 kb plasmid) and Lactococcus lactis cremoris Strain B (with and without a 30 kb plasmid) in reducing antigen-specific ear swelling (ear thickness) compared to vehicle and Dexamethasone in a KLH-based delayed type hypersensitivity mouse model. Lactococcus lactis cremoris Strain A without a 13 kb plasmid has reduced efficacy compared Lactococcus lactis cremoris Strain A with a 13 kb plasmid. Conversely, removal of a 30 kb plasmid from L. lactis cremoris Strain B enhances efficacy compared to L. lactis cremoris Strain B with the 30 kb plasmid.
- FIG. 5 shows the efficacy of Lactococcus lactis cremoris Strain A in reducing antigen-specific ear swelling (ear thickness) compared to vehicle (negative control), and anti-inflammatory Dexamethasone (positive control) in an OVA based adoptive transfer delayed-type hypersensitivity (AdDTH) Mouse Model.
- FIGS. 6A, 6B, and 6C show the ability of Lactococcus lactis cremoris Strain A in reducing expression of IL-12p70 ( FIG. 6A ), IL-22 ( FIG. 6B ), and KC ( FIG. 6C ) in an Adoptive Transfer Delayed-Type Hypersensitivity (AdDTH) Mouse Model. Circle represents vehicle, square represents dexamethasone, and triangle represents Lactococcus lactis cremoris Strain A.
- FIG. 7 shows the efficacy of Lactococcus lactis cremoris Strain A in improving the skin inflammation scores in an imiquimod model of psoriasis compared to control cream, vehicle, and dexamethasone.
- FIG. 8 shows the efficacy of gamma-irradiated Lactococcus lactis cremoris Strain A in reducing antigen-specific ear swelling (ear thickness) at 24 hours compared to vehicle (negative control) and anti-inflammatory Dexamethasone (positive control) in a KLH-based delayed type hypersensitivity mouse model. As shown, gamma-irradiated Lactococcus lactis cremoris Strain A retains efficacy.
- FIGS. 9A, 9B, 9C, and 9D show the ability of gamma-irradiated Lactococcus lactis cremoris Strain A to reduce expression of IL-12p′70 ( FIG. 9A ), TNF ( FIG. 9B ), IL-6 ( FIG. 9C ), and IL-13 ( FIG. 9D ) in a KLH-based delayed type hypersensitivity mouse model.
- Circle represents vehicle, square represents dexamethasone, and triangle represents gamma-irradiated Lactococcus lactis cremoris Strain A.
- Gamma-irradiated Lactococcus lactis cremoris Strain A decreases pro-inflammatory cytokine responses in leukocytes from the site-draining lymph node.
- Circle represents vehicle, square represents dexamethasone, and triangle represents Lactococcus lactis cremoris Strain A.
- FIGS. 10A and 10B show the ability of gamma-irradiated Lactococcus lactis cremoris Strain A to reduce the secretion of pro-inflammatory cytokines (IL-6 and TNFa) from gut-draining lymph nodes ( FIG. 10A ), while gamma-irradiated Lactococcus lactis cremoris Strain A induces peripheral immune cells to secrete more IL-10 ( FIG. 10B ).
- IL-6 and TNFa pro-inflammatory cytokines
- compositions e.g., bacterial compositions, pharmaceutical compositions
- disease e.g., cancer, autoimmune disease, inflammatory disease, metabolic disease
- a subject e.g., a human subject
- administering a bacterial composition comprising Lactococcus bacteria and/or a product of such bacteria (e.g., extracellular vesicles (EVs) and/or pharmaceutically active biomasses (PhABs)).
- a bacterial composition comprising Lactococcus bacteria and/or a product of such bacteria (e.g., extracellular vesicles (EVs) and/or pharmaceutically active biomasses (PhABs)).
- EVs extracellular vesicles
- PhABs pharmaceutically active biomasses
- an immune disorder e.g., an autoimmune disease, an inflammatory disease, an allergy
- a bacterial composition comprising an immune modulating Lactococcus strain provided herein, EVs generated by or isolated from an immune modulating Lactococcus strain provided herein and/or a PhAB made from or comprising an immune modulating Lactococcus strain provided herein.
- administering broadly refers to a route of administration of a composition to a subject.
- routes of administration include oral administration, rectal administration, topical administration, inhalation (nasal) or injection.
- Administration by injection includes intravenous (IV), intramuscular (IM), intratumoral (IT) and subcutaneous (SC) administration.
- compositions described herein can be administered in any form by any effective route, including but not limited to intratumoral, oral, parenteral, enteral, intravenous, intraperitoneal, topical, transdermal (e.g., using any standard patch), intradermal, ophthalmic, (intra)nasally, local, non-oral, such as aerosol, inhalation, subcutaneous, intramuscular, buccal, sublingual, (trans)rectal, vaginal, intra-arterial, and intrathecal, transmucosal (e.g., sublingual, lingual, (trans)buccal, (trans)urethral, vaginal (e.g., trans- and perivaginally), intravesical, intrapulmonary, intraduodenal, intragastrical, and intrabronchial.
- transdermal e.g., using any standard patch
- intradermal e.g., using any standard patch
- intradermal e.g., using any standard patch
- intradermal e.g
- compositions described herein are administered orally, rectally, intratumorally, topically, intravesically, by injection into or adjacent to a draining lymph node, intravenously, by inhalation or aerosol, or subcutaneously.
- antibody may refer to both an intact antibody and an antigen binding fragment thereof.
- Intact antibodies are glycoproteins that include at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
- Each heavy chain includes a heavy chain variable region (abbreviated herein as V H ) and a heavy chain constant region.
- Each light chain includes a light chain variable region (abbreviated herein as V L ) and a light chain constant region.
- the V H and V L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- Each V H and V L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the term “antibody” includes, for example, monoclonal antibodies, polyclonal antibodies, chimeric antibodies, humanized antibodies, human antibodies, multispecific antibodies (e.g., bispecific antibodies), single-chain antibodies and antigen-binding antibody fragments.
- antigen binding fragment and “antigen-binding portion” of an antibody, as used herein, refers to one or more fragments of an antibody that retain the ability to bind to an antigen.
- binding fragments encompassed within the term “antigen-binding fragment” of an antibody include Fab, Fab′, F(ab′)2, Fv, scFv, disulfide linked Fv, Fd, diabodies, single-chain antibodies, NANOBODIES®, isolated CDRH3, and other antibody fragments that retain at least a portion of the variable region of an intact antibody. These antibody fragments can be obtained using conventional recombinant and/or enzymatic techniques and can be screened for antigen binding in the same manner as intact antibodies.
- Cellular augmentation broadly refers to the influx of cells or expansion of cells in an environment that are not substantially present in the environment prior to administration of a composition and not present in the composition itself.
- Cells that augment the environment include immune cells, stromal cells, bacterial and fungal cells. Environments of particular interest are the microenvironments where cancer cells reside or locate.
- the microenvironment is a tumor microenvironment or a tumor draining lymph node.
- the microenvironment is a pre-cancerous tissue site or the site of local administration of a composition or a site where the composition will accumulate after remote administration.
- “Clade” refers to the OTUs or members of a phylogenetic tree that are downstream of a statistically valid node in a phylogenetic tree.
- the clade comprises a set of terminal leaves in the phylogenetic tree that is a distinct monophyletic evolutionary unit and that share some extent of sequence similarity.
- “Operational taxonomic units,” “OTU” (or plural, “OTUs”) refer to a terminal leaf in a phylogenetic tree and is defined by a nucleic acid sequence, e.g., the entire genome, or a specific genetic sequence, and all sequences that share sequence identity to this nucleic acid sequence at the level of species.
- the specific genetic sequence may be the 16S sequence or a portion of the 16S sequence.
- the entire genomes of two entities are sequenced and compared.
- select regions such as multilocus sequence tags (MLST), specific genes, or sets of genes may be genetically compared.
- MMT multilocus sequence tags
- OTUs that share ⁇ 97% average nucleotide identity across the entire 16S or some variable region of the 16S are considered the same OTU (see e.g. Claesson M J, Wang Q, O'Sullivan O, Greene-Diniz R, Cole J R. Ros R P, and O'Toole P W. 2010.
- OTUs are frequently defined by comparing sequences between organisms. Generally, sequences with less than 95% sequence identity are not considered to form part of the same OTU.
- OTUs may also be characterized by any combination of nucleotide markers or genes, in particular highly conserved genes (e.g., “house-keeping” genes), or a combination thereof. Such characterization employs, e.g., WGS data or a whole genome sequence.
- a “combination” of two or more microbial strains includes the physical co-existence of the two microbial strains, either in the same material or product or in physically connected products, as well as the temporal co-administration or co-localization of the monoclonal microbial strains.
- decrease or “deplete” means a change, such that the difference is, depending on circumstances, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 1/100, 1/1000, 1/10,000, 1/100,000, 1/1,000,000 or undetectable after treatment when compared to a pre-treatment state.
- ecological consortium is a group of bacteria which trades metabolites and positively co-regulates one another, in contrast to two bacteria which induce host synergy through activating complementary host pathways for improved efficacy.
- epitope means a protein determinant capable of specific binding to an antibody.
- Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains. Certain epitopes can be defined by a particular sequence of amino acids to which an antibody is capable of binding.
- engineered bacteria are any bacteria that have been genetically altered from their natural state by human intervention and the progeny of any such bacteria.
- Engineered bacteria include, for example, the products of targeted genetic modification, the products of random mutagenesis screens and the products of directed evolution.
- extracellular vesicle or “EV” or refers to a composition derived from a bacteria that comprises bacterial lipids, and bacterial proteins and/or bacterial nucleic acids and/or carbohydrate moieties contained in a nanoparticle.
- EVs may contain 1, 2, 3, 4, 5, 10, or more than 10 different lipid species.
- EVs may contain 1, 2, 3, 4, 5, 10, or more than 10 different protein species.
- EVs may contain 1, 2, 3, 4, 5, 10, or more than 10 different nucleic acid species.
- EVs may contain 1, 2, 3, 4, 5, 10, or more than 10 different carbohydrate species.
- gene is used broadly to refer to any nucleic acid associated with a biological function.
- the term “gene” applies to a specific genomic sequence, as well as to a cDNA or an mRNA encoded by that genomic sequence.
- “Identity” as between nucleic acid sequences of two nucleic acid molecules can be determined as a percentage of identity using known computer algorithms such as the “FASTA” program, using for example, the default parameters as in Pearson et al. (1988) Proc. Natl. Acad. Sci. USA 85:2444 (other programs include the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(I):387 (1984)), BLASTP, BLASTN, FASTA Atschul, S. F., et al., J Molec Biol 215:403 (1990); Guide to Huge Computers, Martin J. Bishop, ed., Academic Press, San Diego, 1994, and Carillo et al.
- Immune disorders refers to any disease, disorder or disease symptom caused by an activity of the immune system, including autoimmune diseases, inflammatory diseases and allergies.
- Immune disorders include, but are not limited to, autoimmune diseases (e.g., Lupus, Scleroderma, hemolytic anemia, vasculitis, type one diabetes, Grave's disease, rheumatoid arthritis, multiple sclerosis, Goodpasture's syndrome, pernicious anemia and/or myopathy), inflammatory diseases (e.g., acne vulgaris, asthma, celiac disease, chronic prostatitis, glomerulonephritis, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, rheumatoid arthritis, sarcoidosis, transplant rejection, vasculitis and/or interstitial cystitis), and/or an allergies (e.g., food allergies, drug allergies and/or environmental allergies).
- autoimmune diseases e.g., Lupus, Scleroderma, hemolytic anemia, vasculitis
- the term “increase” means a change, such that the difference is, depending on circumstances, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 2-fold, 4-fold, 10-fold, 100-fold, 10 ⁇ circumflex over ( ) ⁇ 3 fold, 10 ⁇ circumflex over ( ) ⁇ 4 fold, 10 ⁇ circumflex over ( ) ⁇ 5 fold, 10 ⁇ circumflex over ( ) ⁇ 6 fold, and/or 10 ⁇ circumflex over ( ) ⁇ 7 fold greater after treatment when compared to a pre-treatment state.
- Properties that may be increased include immune cells, bacterial cells, stromal cells, myeloid derived suppressor cells, fibroblasts, metabolites, and cytokines.
- ITS is a piece of non-functional RNA located between structural ribosomal RNAs (rRNA) on a common precursor transcript often used for identification of eukaryotic species in particular fungi.
- rRNA structural ribosomal RNAs
- the rRNA of fungi that forms the core of the ribosome is transcribed as a signal gene and consists of the 8S, 5.8S and 28S regions with ITS4 and 5 between the 8S and 5.8S and 5.8S and 28S regions, respectively.
- isolated or “enriched” encompasses a microbe, bacteria or other entity or substance that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature or in an experimental setting), and/or (2) produced, prepared, purified, and/or manufactured by the hand of man. Isolated microbes may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated.
- isolated microbes are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
- a substance is “pure” if it is substantially free of other components.
- the terms “purify,” “purifying” and “purified” refer to a microbe or other material that has been separated from at least some of the components with which it was associated either when initially produced or generated (e.g., whether in nature or in an experimental setting), or during any time after its initial production.
- a microbe or a microbial population may be considered purified if it is isolated at or after production, such as from a material or environment containing the microbe or microbial population, and a purified microbe or microbial population may contain other materials up to about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or above about 90% and still be considered “isolated.”
- purified microbes or microbial population are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
- the one or more microbial types present in the composition can be independently purified from one or more other microbes produced and/or present in the material or environment containing the microbial type.
- Microbial compositions and the microbial components thereof are generally purified from residual habitat products.
- Metal refers to any and all molecular compounds, compositions, molecules, ions, co-factors, catalysts or nutrients used as substrates in any cellular or microbial metabolic reaction or resulting as product compounds, compositions, molecules, ions, co-factors, catalysts or nutrients from any cellular or microbial metabolic reaction.
- Merobe refers to any natural or engineered organism characterized as a bacterium, fungus, microscopic alga, protozoan, and the stages of development or life cycle stages (e.g., vegetative, spore (including sporulation, dormancy, and germination), latent, biofilm) associated with the organism.
- gut microbes examples include: Actinomyces graevenitzii, Actinomyces odontolyticus, Akkermansia muciniphila, Bacteroides caccae, Bacteroides fragilis, Bacteroides putredinis, Bacteroides thetaiotaomicron, Bacteroides vultagus, Bifidobacterium adolescentis, Bifidobacterium bifidum, Bilophila wadsworthia, Lactococcus lactis, Butyrivibrio, Campylobacter gracilis , Clostridia cluster III, Clostridia cluster IV, Clostridia cluster IX (Acidaminococcaceae group), Clostridia cluster XI, Clostridia cluster XIII ( Peptostreptococcus group), Clostridia cluster XIV, Clostridia cluster XV, Collinsella aerofaciens, Coprococcus
- Microbiome broadly refers to the microbes residing on or in body site of a subject or patient.
- Microbes in a microbiome may include bacteria, viruses, eukaryotic microorganisms, and/or viruses.
- Individual microbes in a microbiome may be metabolically active, dormant, latent, or exist as spores, may exist planktonically or in biofilms, or may be present in the microbiome in sustainable or transient manner.
- the microbiome may be a commensal or healthy-state microbiome or a disease-state microbiome.
- the microbiome may be native to the subject or patient, or components of the microbiome may be modulated, introduced, or depleted due to changes in health state (e.g., precancerous or cancerous state) or treatment conditions (e.g., antibiotic treatment, exposure to different microbes).
- the microbiome occurs at a mucosal surface.
- the microbiome is a gut microbiome.
- the microbiome is a tumor microbiome.
- a “microbiome profile” or a “microbiome signature” of a tissue or sample refers to an at least partial characterization of the bacterial makeup of a microbiome.
- a microbiome profile indicates whether at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more bacterial strains are present or absent in a microbiome.
- Modified in reference to a bacteria broadly refers to a bacteria that has undergone a change from its wild-type form.
- bacterial modifications include genetic modification, gene expression, phenotype modification, formulation, chemical modification, and dose or concentration. Examples of improved properties are described throughout this specification and include, e.g., attenuation, auxotrophy, homing, or antigenicity.
- Phenotype modification might include, by way of example, bacteria growth in media that modify the phenotype of a bacterium that increase or decrease virulence.
- a gene is “overexpressed” in a bacteria if it is expressed at a higher level in an engineered bacteria under at least some conditions than it is expressed by a wild-type bacteria of the same species under the same conditions.
- a gene is “underexpressed” in a bacteria if it is expressed at a lower level in an engineered bacteria under at least some conditions than it is expressed by a wild-type bacteria of the same species under the same conditions.
- polynucleotide and “nucleic acid” are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure, and may perform any function.
- polynucleotides coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- nucleotide structure may be imparted before or after assembly of the polymer.
- a polynucleotide may be further modified, such as by conjugation with a labeling component.
- U nucleotides are interchangeable with T nucleotides.
- a substance is “pure” if it is substantially free of other components.
- the terms “purify,” “purifying” and “purified” refer to a EV or other material that has been separated from at least some of the components with which it was associated either when initially produced or generated (e.g., whether in nature or in an experimental setting), or during any time after its initial production.
- An EV may be considered purified if it is isolated at or after production, such as from one or more other bacterial components, and a purified microbe or microbial population may contain other materials up to about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or above about 90% and still be considered “purified.”
- purified EVs are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
- EV compositions and the microbial components thereof are, e.g., purified from residual habitat products.
- the term “purified EV composition” or “EV composition” refer to a preparation that includes EVs that have been separated from at least one associated substance found in a source material (e.g. separated from at least one other bacterial component) or any material associated with the EVs in any process used to produce the preparation. It also refers to a composition that has been significantly enriched or concentrated. In some embodiments the EVs are concentrated by 2 fold, 3-fold, 4-fold, 5-fold, 10-fold, 100-fold, 1000-fold, 10,000-fold or more than 10,000 fold.
- “Operational taxonomic units” and “OTU(s)” refer to a terminal leaf in a phylogenetic tree and is defined by a nucleic acid sequence, e.g., the entire genome, or a specific genetic sequence, and all sequences that share sequence identity to this nucleic acid sequence at the level of species.
- the specific genetic sequence may be the 16S sequence or a portion of the 16S sequence.
- the entire genomes of two entities are sequenced and compared.
- select regions such as multilocus sequence tags (MLST), specific genes, or sets of genes may be genetically compared.
- OTUs that share ⁇ 97% average nucleotide identity across the entire 16S or some variable region of the 16S are considered the same OTU. See e.g. Claesson M J, Wang Q, O'Sullivan O, Greene-Diniz R, Cole J R, Ross R P, and O'Toole P W. 2010. Comparison of two next-generation sequencing technologies for resolving highly complex microbiota composition using tandem variable 16S rRNA gene regions. Nucleic Acids Res 38: e200. Konstantinidis K T, Ramette A, and Tiedje J M. 2006. The bacterial species definition in the genomic era. Philos Trans R Soc Lond B Biol Sci 361: 1929-1940.
- MLSTs For complete genomes, MLSTs, specific genes, other than 16S, or sets of genes OTUs that share ⁇ 95% average nucleotide identity are considered the same OTU. See e.g., Achtman M, and Wagner M. 2008. Microbial diversity and the genetic nature of microbial species. Nat. Rev. Microbiol. 6: 431-440. Konstantinidis K T, Ramette A, and Tiedje J M. 2006. The bacterial species definition in the genomic era. Philos Trans R Soc Lond B Biol Sci 361: 1929-1940. OTUs are frequently defined by comparing sequences between organisms. Generally, sequences with less than 95% sequence identity are not considered to form part of the same OTU.
- OTUs may also be characterized by any combination of nucleotide markers or genes, in particular highly conserved genes (e.g., “house-keeping” genes), or a combination thereof.
- Operational Taxonomic Units (OTUs) with taxonomic assignments made to, e.g., genus, species, and phylogenetic clade are provided herein.
- specific binding refers to the ability of an antibody to bind to a predetermined antigen or the ability of a polypeptide to bind to its predetermined binding partner.
- an antibody or polypeptide specifically binds to its predetermined antigen or binding partner with an affinity corresponding to a K D of about 10 ⁇ 7 M or less, and binds to the predetermined antigen/binding partner with an affinity (as expressed by K D ) that is at least 10 fold less, at least 100 fold less or at least 1000 fold less than its affinity for binding to a non-specific and unrelated antigen/binding partner (e.g., BSA, casein).
- specific binding applies more broadly to a two component system where one component is a protein, lipid, or carbohydrate or combination thereof and engages with the second component which is a protein, lipid, carbohydrate or combination thereof in a specific way.
- subject refers to any animal.
- a subject or a patient described as “in need thereof” refers to one in need of a treatment for a disease.
- Mammals i.e., mammalian animals
- mammals include humans, laboratory animals (e.g., primates, rats, mice), livestock (e.g., cows, sheep, goats, pigs), and household pets (e.g., dogs, cats, rodents).
- the subject may be a non-human mammal including but not limited to of a dog, a cat, a cow, a horse, a pig, a donkey, a goat, a camel, a mouse, a rat, a guinea pig, a sheep, a llama, a monkey, a gorilla or a chimpanzee.
- the subject or patient may be healthy, or may be suffering from an immune disorder at any developmental stage.
- “Strain” refers to a member of a bacterial species with a genetic signature such that it may be differentiated from closely-related members of the same bacterial species.
- the genetic signature may be the absence of all or part of at least one gene, the absence of all or part of at least on regulatory region (e.g., a promoter, a terminator, a riboswitch, a ribosome binding site), the absence (“curing”) of at least one native plasmid, the presence of at least one recombinant gene, the presence of at least one mutated gene, the presence of at least one foreign gene (a gene derived from another species), the presence at least one mutated regulatory region (e.g., a promoter, a terminator, a riboswitch, a ribosome binding site), the presence of at least one non-native plasmid, the presence of at least one antibiotic resistance cassette, or a combination thereof.
- strains may be identified by PCR amplification optionally followed by DNA sequencing of the genomic region(s) of interest or of the whole genome.
- strains may be differentiated by selection or counter-selection using an antibiotic or nutrient/metabolite, respectively.
- treating refers to subjecting the subject to a pharmaceutical treatment, e.g., the administration of one or more agents, such that at least one symptom of the disease is decreased or prevented from worsening.
- a pharmaceutical treatment e.g., the administration of one or more agents, such that at least one symptom of the disease is decreased or prevented from worsening.
- “treating” refers inter alia to delaying progression, expediting remission, inducing remission, augmenting remission, speeding recovery, increasing efficacy of or decreasing resistance to alternative therapeutics, or a combination thereof.
- provided herein are methods of using a bacterial composition comprising an immune modulating Lactococcus strain provided herein, EVs generated by or isolated from an immune modulating Lactococcus strain provided herein and/or a PhAB made from or comprising an immune modulating Lactococcus strain provided herein.
- the immune modulating Lactococcus strain is a strain of Lactococcus lactis cremoris .
- the immune modulating Lactococcus strain is Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368).
- the immune modulating Lactococcus strain is a strain comprising at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the nucleotide sequence (e.g., genomic, 16S or CRISPR nucleotide sequence) of the Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368).
- sequence identity e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity
- the ATCC is a depository affording permanence of the deposit and ready accessibility thereto by the public if a patent is granted. All restrictions on the availability to the public of the material so deposited will be irrevocably removed upon the granting of a patent. The material will be available during the pendency of the patent application to one determined by the Commissioner to be entitled thereto under 37 CFR 1.14 and 35 U.S.C. 122. The deposited material will be maintained with all the care necessary to keep it viable and uncontaminated for a period of at least five years after the most recent request for the furnishing of a sample of the deposited plasmid, and in any case, for a period of at least thirty (30) years after the date of deposit or for the enforceable life of the patent, whichever period is longer. Applicant acknowledges its duty to replace the deposit should the depository be unable to furnish a sample when requested due to the condition of the deposit.
- the bacteria described herein are modified to improve colonization and/or engraftment in the mammalian gastrointestinal tract (e.g., modified metabolism, such as improved mucin degradation, enhanced competition profile, increased motility, increased adhesion to gut epithelial cells, modified chemotaxis).
- the bacteria described herein are modified to enhance their immunomodulatory and/or therapeutic effect (e.g., either alone or in combination with another therapeutic agent).
- the bacteria described herein are modified to enhance immune activation (e.g., through modified production of polysaccharides, pili, fimbriae, adhesins).
- the bacteria described herein are modified to improve bacterial manufacturing (e.g., higher oxygen tolerance, improved freeze-thaw tolerance, shorter generation times).
- Lactococcus lactis cremoris Strain A can be cultured according to methods known in the art.
- Lactococcus lactis cremoris can be grown in ATCC Medium 2722, ATCC Medium 1490, or other medium using methods disclosed, for example in Caballero et al., 2017. “Cooperating Commensals Restore Colonization Resistance to Vancomycin-Resistant Enterococcus faecium” Cell Host & Microbe 21:592-602, which is hereby incorporated by reference in its entirety.
- the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) comprising one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) proteins listed in Table 1 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) genes encoding proteins listed in Table 1.
- the immune modulating bacteria comprises all of the proteins listed in Table 1 and/or all of the genes encoding the proteins listed in Table 1.
- the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) comprising one or more (e.g., one, two or three) membrane associated proteins listed in Table 2 and/or one or more (e.g., one, two or three) genes encoding membrane associated proteins listed in Table 2.
- the immune modulating bacteria comprises all of the proteins listed in Table 2 and/or all of the genes encoding the proteins listed in Table 2.
- the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) proteins listed in Table 3 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) genes encoding proteins listed in Table 3.
- the immune modulating bacteria is free of all of the proteins listed in Table 2 and/or all of the genes encoding the proteins listed in Table 2.
- the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17) exopolysaccharide (EPS) synthesis proteins listed in Table 4 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17) genes encoding EPS synthesis proteins listed in Table 4.
- the immune modulating bacteria is free of all of the proteins listed in Table 4 and/or all of the genes encoding the proteins listed in Table 4.
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of an EPS synthesized in whole or in part by a protein listed in Table 4.
- the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of EPS.
- the immune modulating Lactococcus strain bacteria described herein are substantially free of exopolysaccharides.
- the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) comprising one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) proteins listed in Table 6 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) genes encoding proteins listed in Table 6.
- the immune modulating bacteria comprises all of the proteins listed in Table 6 and/or all of the genes encoding the proteins listed in Table 6.
- the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris ) free or substantially free of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, or more) proteins listed in Table 5 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7 or more) genes encoding proteins listed in Table 5.
- the immune modulating bacteria is free of all of the proteins listed in Table 5 and/or all of the genes encoding the proteins listed in Table 5.
- the immune modulating Lactococcus strain EVs described herein can be prepared using any method known in the art.
- the immune modulating Lactococcus strain EVs are prepared without an EV purification step.
- immune modulating Lactococcus strain bacteria comprising the EVs described herein are killed using a method that leaves the immune modulating Lactococcus strain bacterial EVs intact and the resulting bacterial components, including the EVs, are used in the methods and compositions described herein.
- the immune modulating Lactococcus strain bacteria are killed using an antibiotic (e.g., using an antibiotic described herein).
- the immune modulating Lactococcus strain bacteria are killed using UV irradiation.
- the EVs described herein are purified from one or more other bacterial components.
- Methods for purifying EVs from bacteria are known in the art.
- EVs are prepared from bacterial cultures using methods described in S. Bin Park, et al. PLoS ONE. 6(3):e17629 (2011) or G. Norheim, et al. PLoS ONE. 10(9): e0134353 (2015), each of which is hereby incorporated by reference in its entirety.
- the bacteria are cultured to high optical density and then centrifuged to pellet bacteria (e.g., at 10,000 ⁇ g for 30 min at 4° C.).
- the culture supernatants are then passed through filter to exclude intact bacterial cells (e.g., a 0.22 ⁇ m filter).
- filtered supernatants are centrifuged to pellet bacterial EVs (e.g., at 100,000-150,000 ⁇ g for 1-3 hours at 4° C.).
- the EVs are further purified by resuspending the resulting EV pellets (e.g., in PBS), and applying the resuspended EVs to sucrose gradient (e.g., a 30-60% discontinuous sucrose gradient), followed by centrifugation (e.g., at 200,000 ⁇ g for 20 hours at 4° C.).
- EV bands can be collected, washed with (e.g., with PBS), and centrifuged to pellet the EVs (e.g., at 150,000 ⁇ g for 3 hours at 4° C.).
- the purified EVs can be stored, for example, at ⁇ 80° C. until use.
- the EVs are further purified by treatment with DNase and/or proteinase K.
- cultures of immune modulating Lactococcus strain bacteria disclosed herein can be centrifuged at 11,000 ⁇ g for 20-40 min at 4° C. to pellet bacteria.
- Culture supernatants may be passed through a 0.22 ⁇ m filter to exclude intact bacterial cells.
- Filtered supernatants may then be concentrated using methods that may include, but are not limited to, ammonium sulfate precipitation, ultracentrifugation, or filtration.
- ammonium sulfate precipitation 1.5-3 M ammonium sulfate can be added to filtered supernatant slowly, while stirring at 4° C. Precipitations can be incubated at 4° C.
- filtered supernatants can be centrifuged at 100,000-200,000 ⁇ g for 1-16 hours at 4° C. The pellet of this centrifugation contains immune modulating Lactococcus strain EVs and other debris.
- a filtration technique such as through the use of an Amicon Ultra spin filter or by tangential flow filtration, supernatants can be filtered so as to retain species of molecular weight >50 or 100 kDa.
- EVs can be obtained from immune modulating Lactococcus strain bacterial cultures continuously during growth, or at selected time points during growth, by connecting a bioreactor to an alternating tangential flow (ATF) system (e.g., XCell ATF from Repligen).
- ATF alternating tangential flow
- the ATF system retains intact cells (>0.22 um) in the bioreactor, and allows smaller components (e.g., EVs, free proteins) to pass through a filter for collection.
- the system may be configured so that the ⁇ 0.22 um filtrate is then passed through a second filter of 100 kDa, allowing species such as EVs between 0.22 um and 100 kDa to be collected, and species smaller than 100 kDa to be pumped back into the bioreactor.
- the system may be configured to allow for medium in the bioreactor to be replenished and/or modified during growth of the culture.
- EVs collected by this method may be further purified and/or concentrated by ultracentrifugation or filtration as described above for filtered supernatants.
- EVs obtained by methods provided herein may be further purified by size based column chromatography, by affinity chromatography, and by gradient ultracentrifugation, using methods that may include, but are not limited to, use of a sucrose gradient or Optiprep gradient. Briefly, using a sucrose gradient method, if ammonium sulfate precipitation or ultracentrifugation were used to concentrate the filtered supernatants, pellets are resuspended in 60% sucrose, 30 mM Tris, pH 8.0. If filtration was used to concentrate the filtered supernatant, the concentrate is buffer exchanged into 60% sucrose, 30 mM Tris, pH 8.0, using an Amicon Ultra column.
- Samples are applied to a 35-60% discontinuous sucrose gradient and centrifuged at 200,000 ⁇ g for 3-24 hours at 4° C. Briefly, using an Optiprep gradient method, if ammonium sulfate precipitation or ultracentrifugation were used to concentrate the filtered supernatants, pellets are resuspended in 35% Optiprep in PBS. In some embodiments, if filtration was used to concentrate the filtered supernatant, the concentrate is diluted using 60% Optiprep to a final concentration of 35% Optiprep. Samples are applied to a 35-60% discontinuous sucrose gradient and centrifuged at 200,000 ⁇ g for 3-24 hours at 4° C.
- EVs are serially diluted onto agar medium used for routine culture of the bacteria being tested, and incubated using routine conditions. Non-sterile preparations are passed through a 0.22 um filter to exclude intact cells. To further increase purity, isolated EVs may be DNase or proteinase K treated.
- purified EVs are processed as described previously (G. Norheim, et al. PLoS ONE. 10(9): e0134353 (2015)). Briefly, after sucrose gradient centrifugation, bands containing EVs are resuspended to a final concentration of 50 ⁇ g/mL in a solution containing 3% sucrose or other solution suitable for in vivo injection known to one skilled in the art. This solution may also contain adjuvant, for example aluminum hydroxide at a concentration of 0-0.5% (w/v).
- adjuvant for example aluminum hydroxide at a concentration of 0-0.5% (w/v).
- samples are buffer exchanged into PBS or 30 mM Tris, pH 8.0 using filtration (e.g. Amicon Ultra columns), dialysis, or ultracentrifugation (200,000 ⁇ g, ⁇ 3 hours, 4° C.) and resuspension.
- filtration e.g. Amicon Ultra columns
- dialysis e.g. dialysis
- ultracentrifugation 200,000 ⁇ g, ⁇ 3 hours, 4° C.
- the sterility of the EV preparations can be confirmed by plating a portion of the EVs onto agar medium used for standard culture of the bacteria used in the generation of the EVs and incubating using standard conditions.
- select EVs are isolated and enriched by chromatography and binding surface moieties on EVs.
- select EVs are isolated and/or enriched by fluorescent cell sorting by methods using affinity reagents, chemical dyes, recombinant proteins or other methods known to one skilled in the art.
- bacterial compositions comprising an immune modulating Lactococcus strain provided herein, an immune modulating Lactococcus strain EVs provided herein, and/or an immune modulating Lactococcus strain PhAB provided herein.
- the bacterial formulation further comprises a pharmaceutically acceptable carrier.
- the bacterial composition comprises a killed bacterium, a live bacterium and/or an attenuated bacterium.
- Bacteria may be heat-killed by pasteurization, sterilization, high temperature treatment, spray cooking and/or spray drying (heat treatments can be performed at 50° C., 65° C., 85° C. or a variety of other temperatures and/or a varied amount of time).
- Bacteria may also be killed or inactivated using ⁇ -irradiation (gamma irradiation), exposure to UV light, formalin-inactivation, and/or freezing methods, or a combination thereof.
- the bacteria may be exposed to 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, or 50 kGy of radiation prior to administration.
- bacteria e.g., Lactococcus strain
- gamma irradiation In some embodiments, the bacteria are killed or inactivated using electron irradiation (e.g., beta radiation) or x-ray irradiation.
- electron irradiation e.g., beta radiation
- x-ray irradiation e.g., x-ray irradiation
- At least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the bacteria in the bacterial composition are the immune modulating Lactococcus strain. In certain embodiments, substantially all of the bacteria in the bacterial composition are the immune modulating Lactococcus strain.
- the bacterial composition comprises at least 1 ⁇ 10 3 colony forming units (CFUs), 1 ⁇ 10 4 colony forming units (CFUs), 1 ⁇ 10 5 colony forming units (CFUs), 5 ⁇ 10 5 colony forming units (CFUs), 1 ⁇ 10 6 colony forming units (CFUs), 2 ⁇ 10 6 colony forming units (CFUs), 3 ⁇ 10 6 colony forming units (CFUs), 4 ⁇ 10 6 colony forming units (CFUs), 5 ⁇ 10 6 colony forming units (CFUs), 6 ⁇ 10 6 colony forming units (CFUs), 7 ⁇ 10 6 colony forming units (CFUs), 8 ⁇ 10 6 colony forming units (CFUs), 9 ⁇ 10 6 colony forming units (CFUs), 1 ⁇ 10 7 colony forming units (CFUs), 2 ⁇ 10 7 colony forming units (CFUs), 3 ⁇ 10 7 colony forming units (CFUs), 4 ⁇ 10 7 colony forming units (CFUs), 5 ⁇ 10 7 colony forming units
- At least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% of the bacteria in the composition are of the immune modulating Lactococcus strain.
- 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% of the bacteria in the composition are of the immune modulating Lactococcus strain.
- compositions described herein may include only one strains of the immune modulating Lactococcus described herein.
- 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 of the immune modulating Lactococcus strains described herein, in any combination, can be included in the compositions provided herein.
- the pharmaceutical compositions comprise immune modulating Lactococcus strain EVs substantially or entirely free of bacteria. In some embodiments, the pharmaceutical compositions comprise both immune modulating Lactococcus strain EVs and whole immune modulating Lactococcus strain bacteria (e.g., live bacteria, killed bacteria, attenuated bacteria). In certain embodiments, the pharmaceutical compositions comprise immune modulating Lactococcus strain bacteria that is substantially or entirely free of EVs.
- the pharmaceutical composition comprises at least 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8.
- the pharmaceutical composition comprises about 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8.
- the pharmaceutical composition comprises a certain ratio of immune modulating Lactococcus strain bacteria particles to immune modulating Lactococcus strain EV particles.
- the number of immune modulating Lactococcus strain bacteria particles can be based on actual particle number or (if the bacteria is live) the number of CFUs.
- the particle number can be established by combining a set number of purified immune modulating Lactococcus strain EVs with a set number of purified immune modulating Lactococcus strain bacterium, by modifying the growth conditions under which the immune modulating Lactococcus strain bacteria are cultured, or by modifying the immune modulating Lactococcus strain bacteria itself to produce more or fewer immune modulating Lactococcus strain EVs.
- NTA nanoparticle tracking analysis
- DLS dynamic light scattering
- Coulter counting reveals the numbers of particles with diameters of 0.7-10 um.
- NTA reveals the numbers of particles with diameters of 50-1400 nm.
- the Coulter counter alone can reveal the number of bacteria in a sample.
- EVs are 20-250 nm in diameter. NTA will allow us to count the numbers of particles that are 50-250 nm in diameter.
- DLS reveals the distribution of particles of different diameters within an approximate range of 1 nm-3 um.
- the pharmaceutical composition comprises no more than 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8.
- the pharmaceutical composition comprises at least 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8.
- the pharmaceutical composition comprises about 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8.
- the pharmaceutical composition comprises no more than 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8.
- the immune modulating Lactococcus strain EVs in the pharmaceutical composition are purified from one or more other bacterial components.
- the pharmaceutical composition further comprises other bacterial components.
- the pharmaceutical composition comprise bacteria cells.
- compositions disclosed herein may be specially formulated for administration in solid or liquid form, including those adapted for oral or rectal administration.
- the composition described herein may be a pharmaceutical composition, a dietary supplement, or a food product (e.g., a food or beverage).
- a food product e.g., a food or beverage.
- the food product is an animal feed.
- the pharmaceutical composition for oral administration described herein comprises an additional component that enables efficient delivery of the bacteria to the colon.
- pharmaceutical preparation that enables the delivery of the bacteria to the colon can be used.
- examples of such formulations include pH sensitive compositions, such as buffered sachet formulations or enteric polymers that release their contents when the pH becomes alkaline after the enteric polymers pass through the stomach.
- the pH sensitive composition can be a polymer whose pH threshold of the decomposition of the composition is between about 6.8 and about 7.5.
- a pharmaceutical composition useful for delivery of the bacteria to the colon is one that ensures the delivery to the colon by delaying the release of the bacteria by approximately 3 to 5 hours, which corresponds to the small intestinal transit time.
- the pharmaceutical composition for delayed release includes a hydrogel shell. The hydrogel is hydrated and swells upon contact with gastrointestinal fluid, with the result that the contents are effectively released (released predominantly in the colon).
- Delayed release dosage units include bacteria-containing compositions having a material which coats or selectively coats the bacteria. Examples of such a selective coating material include in vivo degradable polymers, gradually hydrolyzable polymers, gradually water-soluble polymers, and/or enzyme degradable polymers.
- a wide variety of coating materials for efficiently delaying the release includes, for example, cellulose-based polymers such as hydroxypropyl cellulose, acrylic acid polymers and copolymers such as methacrylic acid polymers and copolymers, and vinyl polymers and copolymers such as polyvinylpyrrolidone.
- composition enabling the delivery to the colon further include bioadhesive compositions which specifically adhere to the colonic mucosal membrane (for example, a polymer described in the specification of U.S. Pat. No. 6,368,586, hereby incorporated by reference) and compositions into which a protease inhibitor is incorporated for protecting particularly a biopharmaceutical preparation in the gastrointestinal tracts from decomposition due to an activity of a protease.
- bioadhesive compositions which specifically adhere to the colonic mucosal membrane
- compositions into which a protease inhibitor is incorporated for protecting particularly a biopharmaceutical preparation in the gastrointestinal tracts from decomposition due to an activity of a protease for protecting particularly a biopharmaceutical preparation in the gastrointestinal tracts from decomposition due to an activity of a protease.
- An example of a system enabling the delivery to the colon is a system of delivering a composition to the colon by pressure change in such a way that the contents are released by utilizing pressure change caused by generation of gas in bacterial fermentation at a distal portion of the stomach.
- a system is not particularly limited, and a more specific example thereof is a capsule which has contents dispersed in a suppository base and which is coated with a hydrophobic polymer (for example, ethyl cellulose).
- Another example of the system enabling the delivery to the colon is a system of delivering a composition to the colon, the system being specifically decomposed by an enzyme (for example, a carbohydrate hydrolase or a carbohydrate reductase) present in the colon.
- an enzyme for example, a carbohydrate hydrolase or a carbohydrate reductase
- Such a system is not particularly limited, and more specific examples thereof include systems which use food components such as non-starch polysaccharides, amylose, xanthan gum, and azopolymers.
- Probiotic formulations are provided as encapsulated, enteric coated, or powder forms, with doses ranging up to 10 11 cfu (e.g., up to 10 10 cfu).
- the composition comprises 5 ⁇ 10 11 cfu of immune modulating Lactococcus strain and 10% (w/w) corn starch in a capsule.
- the capsule is enteric coated for duodenal release at pH 5.5
- the capsule is enteric coated for duodenal release at pH 5.5.
- the composition comprises a powder of freeze-dried immune modulating Lactococcus strain which is deemed “Qualified Presumption of Safety” (QPS) status.
- the composition is stable at frozen or refrigerated temperature.
- Methods for producing microbial compositions may include three main processing steps. The steps are: organism banking, organism production, and preservation.
- a sample that contains an abundance of immune modulating Lactococcus strain may be cultured by avoiding an isolation step.
- the strains included in the microbial composition may be (1) isolated directly from a specimen or taken from a banked stock, (2) optionally cultured on a nutrient agar or broth that supports growth to generate viable biomass, and (3) the biomass optionally preserved in multiple aliquots in long-term storage.
- the agar or broth may contain nutrients that provide essential elements and specific factors that enable growth.
- An example would be a medium composed of 20 g/L glucose, 10 g/L yeast extract, 10 g/L soy peptone, 2 g/L citric acid, 1.5 g/L sodium phosphate monobasic, 100 mg/L ferric ammonium citrate, 80 mg/L magnesium sulfate, 10 mg/L hemin chloride, 2 mg/L calcium chloride, 1 mg/L menadione.
- Another example would be a medium composed of 10 g/L beef extract, 10 g/L peptone, 5 g/L sodium chloride, 5 g/L dextrose, 3 g/L yeast extract, 3 g/L sodium acetate, 1 g/L soluble starch, and 0.5 g/L L-cysteine HCl, at pH 6.8.
- a variety of microbiological media and variations are well known in the art (e.g., R. M. Atlas, Handbook of Microbiological Media (2010) CRC Press). Culture media can be added to the culture at the start, may be added during the culture, or may be intermittently/continuously flowed through the culture.
- the strains in the bacterial composition may be cultivated alone, as a subset of the microbial composition, or as an entire collection comprising the microbial composition.
- a first strain may be cultivated together with a second strain in a mixed continuous culture, at a dilution rate lower than the maximum growth rate of either cell to prevent the culture from washing out of the cultivation.
- the inoculated culture is incubated under favorable conditions for a time sufficient to build biomass.
- microbial compositions for human use this is often at 37° C. temperature, pH, and other parameter with values similar to the normal human niche.
- the environment may be actively controlled, passively controlled (e.g., via buffers), or allowed to drift.
- an anoxic/reducing environment may be employed. This can be accomplished by addition of reducing agents such as cysteine to the broth, and/or stripping it of oxygen.
- a culture of a bacterial composition may be grown at 37° C., pH 7, in the medium above, pre-reduced with 1 g/L cysteine-HCl.
- the organisms may be placed into a chemical milieu that protects from freezing (adding ‘cryoprotectants’), drying (‘lyoprotectants’), and/or osmotic shock (‘osmoprotectants’), dispensing into multiple (optionally identical) containers to create a uniform bank, and then treating the culture for preservation.
- Containers are generally impermeable and have closures that assure isolation from the environment. Cryopreservation treatment is accomplished by freezing a liquid at ultra-low temperatures (e.g., at or below ⁇ 80° C.).
- a microbial composition culture may be harvested by centrifugation to pellet the cells from the culture medium, the supernatant decanted and replaced with fresh culture broth containing 15% glycerol. The culture can then be aliquoted into 1 mL cryotubes, sealed, and placed at ⁇ 80° C. for long-term viability retention. This procedure achieves acceptable viability upon recovery from frozen storage.
- Microbial production may be conducted using similar culture steps to banking, including medium composition and culture conditions described above. It may be conducted at larger scales of operation, especially for clinical development or commercial production. At larger scales, there may be several subcultivations of the microbial composition prior to the final cultivation. At the end of cultivation, the culture is harvested to enable further formulation into a dosage form for administration. This can involve concentration, removal of undesirable medium components, and/or introduction into a chemical milieu that preserves the microbial composition and renders it acceptable for administration via the chosen route.
- a microbial composition may be cultivated to a concentration of 10 10 CFU/mL, then concentrated 20-fold by tangential flow microfiltration; the spent medium may be exchanged by diafiltering with a preservative medium consisting of 2% gelatin, 100 mM trehalose, and 10 mM sodium phosphate buffer. The suspension can then be freeze-dried to a powder and titrated.
- the powder may be blended to an appropriate potency, and mixed with other cultures and/or a filler such as microcrystalline cellulose for consistency and ease of handling, and the bacterial composition formulated as provided herein.
- a filler such as microcrystalline cellulose for consistency and ease of handling, and the bacterial composition formulated as provided herein.
- bacterial compositions for administration subjects are provided.
- the bacterial compositions are combined with additional active and/or inactive materials in order to produce a final product, which may be in single dosage unit or in a multi-dose format.
- the composition comprises at least one carbohydrate.
- a “carbohydrate” refers to a sugar or polymer of sugars.
- saccharide polysaccharide
- carbohydrate oligosaccharide
- Most carbohydrates are aldehydes or ketones with many hydroxyl groups, usually one on each carbon atom of the molecule.
- Carbohydrates generally have the molecular formula C n H 2n O n .
- a carbohydrate may be a monosaccharide, a disaccharide, trisaccharide, oligosaccharide, or polysaccharide.
- the most basic carbohydrate is a monosaccharide, such as glucose, sucrose, galactose, mannose, ribose, arabinose, xylose, and fructose.
- Disaccharides are two joined monosaccharides. Exemplary disaccharides include sucrose, maltose, cellobiose, and lactose.
- an oligosaccharide includes between three and six monosaccharide units (e.g., raffinose, stachyose), and polysaccharides include six or more monosaccharide units.
- Exemplary polysaccharides include starch, glycogen, and cellulose.
- Carbohydrates may contain modified saccharide units such as 2′-deoxyribose wherein a hydroxyl group is removed, 2′-fluororibose wherein a hydroxyl group is replaced with a fluorine, or N-acetylglucosamine, a nitrogen-containing form of glucose (e.g., 2′-fluororibose, deoxyribose, and hexose).
- Carbohydrates may exist in many different forms, for example, conformers, cyclic forms, acyclic forms, stereoisomers, tautomers, anomers, and isomers.
- the composition comprises at least one lipid.
- a “lipid” includes fats, oils, triglycerides, cholesterol, phospholipids, fatty acids in any form including free fatty acids. Fats, oils and fatty acids can be saturated, unsaturated (cis or trans) or partially unsaturated (cis or trans).
- the lipid comprises at least one fatty acid selected from lauric acid (12:0), myristic acid (14:0), palmitic acid (16:0), palmitoleic acid (16:1), margaric acid (17:0), heptadecenoic acid (17:1), stearic acid (18:0), oleic acid (18:1), linoleic acid (18:2), linolenic acid (18:3), octadecatetraenoic acid (18:4), arachidic acid (20:0), eicosenoic acid (20:1), eicosadienoic acid (20:2), eicosatetraenoic acid (20:4), eicosapentaenoic acid (20:5) (EPA), docosanoic acid (22:0), docosenoic acid (22:1), docosapentaenoic acid (22:5), docosahexaenoic acid (22:6) (DHA), and t
- the composition comprises at least one supplemental mineral or mineral source.
- supplemental mineral or mineral source examples include, without limitation: chloride, sodium, calcium, iron, chromium, copper, iodine, zinc, magnesium, manganese, molybdenum, phosphorus, potassium, and selenium.
- Suitable forms of any of the foregoing minerals include soluble mineral salts, slightly soluble mineral salts, insoluble mineral salts, chelated minerals, mineral complexes, non-reactive minerals such as carbonyl minerals, and reduced minerals, and combinations thereof.
- the composition comprises at least one supplemental vitamin.
- the at least one vitamin can be fat-soluble or water soluble vitamins.
- Suitable vitamins include but are not limited to vitamin C, vitamin A, vitamin E, vitamin B12, vitamin K, riboflavin, niacin, vitamin D, vitamin B6, folic acid, pyridoxine, thiamine, pantothenic acid, and biotin.
- Suitable forms of any of the foregoing are salts of the vitamin, derivatives of the vitamin, compounds having the same or similar activity of the vitamin, and metabolites of the vitamin.
- the composition comprises an excipient.
- suitable excipients include a buffering agent, a preservative, a stabilizer, a binder, a compaction agent, a lubricant, a dispersion enhancer, a disintegration agent, a flavoring agent, a sweetener, and a coloring agent.
- the excipient is a buffering agent.
- suitable buffering agents include sodium citrate, magnesium carbonate, magnesium bicarbonate, calcium carbonate, and calcium bicarbonate.
- the excipient comprises a preservative.
- suitable preservatives include antioxidants, such as alpha-tocopherol and ascorbate, and antimicrobials, such as parabens, chlorobutanol, and phenol.
- the composition comprises a binder as an excipient.
- suitable binders include starches, pregelatinized starches, gelatin, polyvinylpyrolidone, cellulose, methylcellulose, sodium carboxymethylcellulose, ethylcellulose, polyacrylamides, polyvinyloxoazolidone, polyvinylalcohols, C 12 -C 18 fatty acid alcohol, polyethylene glycol, polyols, saccharides, oligosaccharides, and combinations thereof.
- the composition comprises a lubricant as an excipient.
- suitable lubricants include magnesium stearate, calcium stearate, zinc stearate, hydrogenated vegetable oils, sterotex, polyoxyethylene monostearate, talc, polyethyleneglycol, sodium benzoate, sodium lauryl sulfate, magnesium lauryl sulfate, and light mineral oil.
- the composition comprises a dispersion enhancer as an excipient.
- suitable dispersants include starch, alginic acid, polyvinylpyrrolidones, guar gum, kaolin, bentonite, purified wood cellulose, sodium starch glycolate, isoamorphous silicate, and microcrystalline cellulose as high HLB emulsifier surfactants.
- the composition comprises a disintegrant as an excipient.
- the disintegrant is a non-effervescent disintegrant.
- suitable non-effervescent disintegrants include starches such as corn starch, potato starch, pregelatinized and modified starches thereof, sweeteners, clays, such as bentonite, microcrystalline cellulose, alginates, sodium starch glycolate, gums such as agar, guar, locust bean, karaya, pectin, and tragacanth.
- the disintegrant is an effervescent disintegrant.
- suitable effervescent disintegrants include sodium bicarbonate in combination with citric acid, and sodium bicarbonate in combination with tartaric acid.
- the bacterial formulation comprises an enteric coating or micro encapsulation.
- the enteric coating or micro encapsulation improves targeting to a desired region of the gastrointestinal tract.
- the bacterial composition comprises an enteric coating and/or microcapsules that dissolves at a pH associated with a particular region of the gastrointestinal tract.
- the enteric coating and/or microcapsules dissolve at a pH of about 5.5-6.2 to release in the duodenum, at a pH value of about 7.2-7.5 to release in the ileum, and/or at a pH value of about 5.6-6.2 to release in the colon.
- Exemplary enteric coatings and microcapsules are described, for example, in U.S. Pat. Pub. No. 2016/0022592, which is hereby incorporated by reference in its entirety.
- the composition is a food product (e.g., a food or beverage) such as a health food or beverage, a food or beverage for infants, a food or beverage for pregnant women, athletes, senior citizens or other specified group, a functional food, a beverage, a food or beverage for specified health use, a dietary supplement, a food or beverage for patients, or an animal feed.
- a food product e.g., a food or beverage
- a food or beverage such as a health food or beverage, a food or beverage for infants, a food or beverage for pregnant women, athletes, senior citizens or other specified group, a functional food, a beverage, a food or beverage for specified health use, a dietary supplement, a food or beverage for patients, or an animal feed.
- the foods and beverages include various beverages such as juices, refreshing beverages, tea beverages, drink preparations, jelly beverages, and functional beverages; alcoholic beverages such as beers; carbohydrate-containing foods such as rice food products, noodles, breads, and pastas; paste products such as fish hams, sausages, paste products of seafood; retort pouch products such as curries, food dressed with a thick starchy sauces, and Chinese soups; soups; dairy products such as milk, dairy beverages, ice creams, cheeses, and yogurts; fermented products such as fermented soybean pastes, yogurts, fermented beverages, and pickles; bean products; various confectionery products, including biscuits, cookies, and the like, candies, chewing gums, gummies, cold desserts including jellies, cream caramels, and frozen desserts; instant foods such as instant soups and instant soy-bean soups; microwavable foods; and the like. Further, the examples also include health foods and beverages prepared in the forms of powders, granules, tablets, carb
- the bacteria disclosed herein are administered in conjunction with a prebiotic to the subject.
- Prebiotics are carbohydrates which are generally indigestible by a host animal and are selectively fermented or metabolized by bacteria.
- Prebiotics may be short-chain carbohydrates (e.g., oligosaccharides) and/or simple sugars (e.g., mono- and di-saccharides) and/or mucins (heavily glycosylated proteins) that alter the composition or metabolism of a microbiome in the host.
- the short chain carbohydrates are also referred to as oligosaccharides, and usually contain from 2 or 3 and up to 8, 9, 10, 15 or more sugar moieties.
- a prebiotic composition can selectively stimulate the growth and/or activity of one of a limited number of bacteria in a host.
- Prebiotics include oligosaccharides such as fructooligosaccharides (FOS) (including inulin), galactooligosaccharides (GOS), trans-galactooligosaccharides, xylooligosaccharides (XOS), chitooligosaccharides (COS), soy oligosaccharides (e.g., stachyose and raffinose) gentiooligosaccharides, isomaltooligosaccharides, mannooligosaccharides, maltooligosaccharides and mannanoligosaccharides.
- FOS fructooligosaccharides
- XOS galactooligosaccharides
- COS chitooligosaccharides
- soy oligosaccharides e.g., stachyos
- Oligosaccharides are not necessarily single components, and can be mixtures containing oligosaccharides with different degrees of oligomerization, sometimes including the parent disaccharide and the monomeric sugars.
- Various types of oligosaccharides are found as natural components in many common foods, including fruits, vegetables, milk, and honey.
- Specific examples of oligosaccharides are lactulose, lactosucrose, palatinose, glycosyl sucrose, guar gum, gum Arabic, tagalose, amylose, amylopectin, pectin, xylan, and cyclodextrins.
- Prebiotics may also be purified or chemically or enzymatically synthesized.
- PhABs described herein can be prepared using any method known in the art.
- the PhABs described herein are prepared by fractionation.
- Bacterial cells and/or supernatants from cultured bacteria cells are fractionated into various pharmacologically active biomass (PhABs) and/or products derived therefrom.
- Bacterial cells and/or supernatants are fractionated using materials and methods known in the art (see e.g. Sandrini et al. Fractionation by ultracentrifugation of gram negative cytoplasmic and membrane proteins. 2014. Bio-Protocol. 4(21); Scholler et al. Protoplast and cytoplasmic membrane preparations from Streptococcus sanguis and Streptococcus mutans. 1983. J Gen Micro.
- PhABs obtained by methods provided herein may be further purified by size based column chromatography, by affinity chromatography, and by gradient ultracentrifugation, using methods that may include, but are not limited to, use of a sucrose gradient or Optiprep gradient. Briefly, using a sucrose gradient method, if ammonium sulfate precipitation or ultracentrifugation were used to concentrate the filtered supernatants, pellets are resuspended in 60% sucrose, 30 mM Tris, pH 8.0. If filtration was used to concentrate the filtered supernatant, the concentrate is buffer exchanged into 60% sucrose, 30 mM Tris, pH 8.0, using an Amicon Ultra column.
- Samples are applied to a 35-60% discontinuous sucrose gradient and centrifuged at 200,000 ⁇ g for 3-24 hours at 4° C. Briefly, using an Optiprep gradient method, if ammonium sulfate precipitation or ultracentrifugation were used to concentrate the filtered supernatants, pellets are resuspended in 35% Optiprep in PBS. In some embodiments, if filtration was used to concentrate the filtered supernatant, the concentrate is diluted using 60% Optiprep to a final concentration of 35% Optiprep. Samples are applied to a 35-60% discontinuous sucrose gradient and centrifuged at 200,000 ⁇ g for 3-24 hours at 4° C.
- PhABs are serially diluted onto agar medium used for routine culture of the bacteria being tested, and incubated using routine conditions. Non-sterile preparations are passed through a 0.22 um filter to exclude intact cells. To further increase purity, isolated PhABs may be DNase or proteinase K treated.
- PhABs used for in vivo injections purified PhABs are processed as described previously (G. Norheim, et al. PLoS ONE. 10(9): e0134353 (2015)). Briefly, after sucrose gradient centrifugation, bands containing PhABs are resuspended to a final concentration of 50 ⁇ g/mL in a solution containing 3% sucrose or other solution suitable for in vivo injection known to one skilled in the art. This solution may also contain adjuvant, for example aluminum hydroxide at a concentration of 0-0.5% (w/v).
- adjuvant for example aluminum hydroxide at a concentration of 0-0.5% (w/v).
- samples are buffer exchanged into PBS or 30 mM Tris, pH 8.0 using filtration (e.g. Amicon Ultra columns), dialysis, or ultracentrifugation (200,000 ⁇ g, ⁇ 3 hours, 4° C.) and resuspension.
- filtration e.g. Amicon Ultra columns
- dialysis e.g. dialysis
- ultracentrifugation 200,000 ⁇ g, ⁇ 3 hours, 4° C.
- the sterility of the PhAB preparations can be confirmed by plating a portion of the PhABs onto agar medium used for standard culture of the bacteria used in the generation of the PhABs and incubating using standard conditions.
- select PhABs are isolated and enriched by chromatography and binding surface moieties on PhABs.
- select PhABs are isolated and/or enriched by fluorescent cell sorting by methods using affinity reagents, chemical dyes, recombinant proteins or other methods known to one skilled in the art.
- provided herein is a method of delivering a bacterium and/or a bacterial composition described herein to a subject.
- the bacteria are administered in conjunction with the administration of an additional therapeutic.
- the bacteria is co-formulated in a pharmaceutical composition with the additional therapeutic.
- the bacteria is co-administered with the additional therapeutic.
- the additional therapeutic is administered to the subject before administration of the bacteria (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 or 55 minutes before, about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22 or 23 hours before, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days before).
- the bacteria e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 or 55 minutes before, about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22 or 23 hours before, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days before.
- the additional therapeutic is administered to the subject after administration of the bacteria (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 or 55 minutes after, about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22 or 23 hours after, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days after).
- the same mode of delivery is used to deliver both the bacteria and the additional therapeutic.
- different modes of delivery are used to administer the bacteria and the additional therapeutic.
- the bacteria is administered orally while the additional therapeutic is administered via injection (e.g., an intravenous, intramuscular and/or intratumoral injection).
- the pharmaceutical compositions, dosage forms, and kits described herein can be administered in conjunction with any other conventional anti-immune disorder treatment. These treatments may be applied as necessary and/or as indicated and may occur before, concurrent with or after administration of the pharmaceutical compositions, dosage forms, and kits described herein.
- the dosage regimen can be any of a variety of methods and amounts, and can be determined by one skilled in the art according to known clinical factors. As is known in the medical arts, dosages for any one patient can depend on many factors, including the subject's species, size, body surface area, age, sex, immunocompetence, and general health, the particular microorganism to be administered, duration and route of administration, the kind and stage of the disease, for example, tumor size, and other compounds such as drugs being administered concurrently. In addition to the above factors, such levels can be affected by the infectivity of the microorganism, and the nature of the microorganism, as can be determined by one skilled in the art.
- appropriate minimum dosage levels of microorganisms can be levels sufficient for the microorganism to survive, grow and replicate.
- the methods of treatment described herein may be suitable for the treatment of an immune disorder (e.g., an autoimmune disease, an inflammatory disease, an allergy).
- the dose of the pharmaceutical compositions described herein may be appropriately set or adjusted in accordance with the dosage form, the route of administration, the degree or stage of a target disease, and the like.
- the general effective dose of the agents may range between 0.01 mg/kg body weight/day and 1000 mg/kg body weight/day, between 0.1 mg/kg body weight/day and 1000 mg/kg body weight/day, 0.5 mg/kg body weight/day and 500 mg/kg body weight/day, 1 mg/kg body weight/day and 100 mg/kg body weight/day, or between 5 mg/kg body weight/day and 50 mg/kg body weight/day.
- the effective dose may be 0.01, 0.05, 0.1, 0.5, 1, 2, 3, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 500, or 1000 mg/kg body weight/day or more, but the dose is not limited thereto.
- the dose administered to a subject is sufficient to prevent the immune disorder, delay its onset, or slow or stop its progression or prevent a relapse of the immune disorder.
- dosage will depend upon a variety of factors including the strength of the particular compound employed, as well as the age, species, condition, and body weight of the subject.
- the size of the dose will also be determined by the route, timing, and frequency of administration as well as the existence, nature, and extent of any adverse side-effects that might accompany the administration of a particular compound and the desired physiological effect.
- Suitable doses and dosage regimens can be determined by conventional range-finding techniques known to those of ordinary skill in the art. Generally, treatment is initiated with smaller dosages, which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under the circumstances is reached.
- An effective dosage and treatment protocol can be determined by routine and conventional means, starting e.g., with a low dose in laboratory animals and then increasing the dosage while monitoring the effects, and systematically varying the dosage regimen as well. Animal studies are commonly used to determine the maximal tolerable dose (“MTD”) of bioactive agent per kilogram weight. Those skilled in the art regularly extrapolate doses for efficacy, while avoiding toxicity, in other species, including humans.
- MTD maximal tolerable dose
- the dosages of the active agents used in accordance with the invention vary depending on the active agent, the age, weight, and clinical condition of the recipient patient, and the experience and judgment of the clinician or practitioner administering the therapy, among other factors affecting the selected dosage.
- the dose should be sufficient to result in slowing, and preferably regressing, the advancement of an immune disorder.
- Separate administrations can include any number of two or more administrations (e.g., doses), including two, three, four, five or six administrations.
- doses e.g., doses
- One skilled in the art can readily determine the number of administrations to perform, or the desirability of performing one or more additional administrations, according to methods known in the art for monitoring therapeutic methods and other monitoring methods provided herein.
- the doses may be separated by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days or 1, 2, 3, or 4 weeks.
- the methods provided herein include methods of providing to the subject one or more administrations of a bacterium, where the number of administrations can be determined by monitoring the subject, and, based on the results of the monitoring, determining whether or not to provide one or more additional administrations. Deciding on whether or not to provide one or more additional administrations can be based on a variety of monitoring results, including, but not limited to, indication of tumor growth or inhibition of tumor growth, appearance of new metastases or inhibition of metastasis, the subject's anti-bacterium antibody titer, the subject's anti-tumor antibody titer, the overall health of the subject and/or the weight of the subject.
- the time period between administrations can be any of a variety of time periods.
- the time period between administrations can be a function of any of a variety of factors, including monitoring steps, as described in relation to the number of administrations, the time period for a subject to mount an immune response and/or the time period for a subject to clear the bacteria from normal tissue.
- the time period can be a function of the time period for a subject to mount an immune response; for example, the time period can be more than the time period for a subject to mount an immune response, such as more than about one week, more than about ten days, more than about two weeks, or more than about a month; in another example, the time period can be less than the time period for a subject to mount an immune response, such as less than about one week, less than about ten days, less than about two weeks, or less than about a month.
- the time period can be a function of the time period for a subject to clear the bacteria from normal tissue; for example, the time period can be more than the time period for a subject to clear the bacteria from normal tissue, such as more than about a day, more than about two days, more than about three days, more than about five days, or more than about a week.
- the delivery of an immune disorder therapeutic in combination with the bacteria described herein reduces the adverse effects and/or improves the efficacy of the immune disorder therapeutic.
- the effective dose of an immune disorder therapeutic described herein is the amount of the therapeutic agent that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, with the least toxicity to the patient.
- the effective dosage level can be identified using the methods described herein and will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions administered, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- an effective dose of an immune disorder therapy will be the amount of the therapeutic agent, which is the lowest dose effective to produce a therapeutic effect. Such an effective dose will generally depend upon the factors described above.
- the toxicity of an immune disorder therapy is the level of adverse effects experienced by the subject during and following treatment.
- Adverse events associated with immune disorder therapy toxicity include, but are not limited to, abdominal pain, acid indigestion, acid reflux, allergic reactions, alopecia, anaphylaxis, anemia, anxiety, lack of appetite, arthralgias, asthenia, ataxia, azotemia, loss of balance, bone pain, bleeding, blood clots, low blood pressure, elevated blood pressure, difficulty breathing, bronchitis, bruising, low white blood cell count, low red blood cell count, low platelet count, cardiotoxicity, cystitis, hemorrhagic cystitis, arrhythmias, heart valve disease, cardiomyopathy, coronary artery disease, cataracts, central neurotoxicity, cognitive impairment, confusion, conjunctivitis, constipation, coughing, cramping, cystitis, deep vein thrombosis, dehydration, depression, diarrhea, dizziness, dry mouth, dry skin, dyspepsia
- the administration of the bacterial composition treats the immune disorder.
- the methods provided herein include the administration to a subject of a bacterium and/or a bacterial composition described herein (e.g., an immune modulating Lactococcus strain-containing bacterial composition) either alone or in combination with another therapeutic.
- a bacterial composition described herein e.g., an immune modulating Lactococcus strain-containing bacterial composition
- the bacterial composition and the other therapy can be administered to the subject in any order.
- the bacterial composition and the other therapy are administered conjointly.
- the bacterium is administered to the subject before the additional therapeutic is administered (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 hours before or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days before).
- the bacterium is administered to the subject after the additional therapeutic is administered (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 hours after or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days after).
- the bacterium and the additional therapeutic are administered to the subject simultaneously or nearly simultaneously (e.g., administrations occur within an hour of each other).
- the subject is administered an antibiotic before the bacterium is administered to the subject (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 hours before or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days before).
- the subject is administered an antibiotic after the bacterium is administered to the subject (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 hours before or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days after).
- the bacterium and the antibiotic are administered to the subject simultaneously or nearly simultaneously (e.g., administrations occur within an hour of each other).
- the subject may undergo surgery.
- Types of surgery include but are not limited to preventative, diagnostic or staging, curative and palliative surgery.
- the additional therapeutic is an antibiotic.
- antibiotics broadly refers to compounds capable of inhibiting or preventing a bacterial infection. Antibiotics can be classified in a number of ways, including their use for specific infections, their mechanism of action, their bioavailability, or their spectrum of target microbe (e.g., Gram-negative vs. Gram-positive bacteria, aerobic vs.
- antibiotics can be used to selectively target bacteria of a specific niche.
- antibiotics known to treat a particular infection that includes an immune disorder niche may be used to target immune-disorder-associated microbes, including immune-disorder-associated bacteria in that niche.
- antibiotics are administered after the bacterial treatment.
- antibiotics are administered after the bacterial treatment to remove the engraftment.
- antibiotics can be selected based on their bactericidal or bacteriostatic properties.
- Bactericidal antibiotics include mechanisms of action that disrupt the cell wall (e.g., ⁇ -lactams), the cell membrane (e.g., daptomycin), or bacterial DNA (e.g., fluoroquinolones).
- Bacteriostatic agents inhibit bacterial replication and include sulfonamides, tetracyclines, and macrolides, and act by inhibiting protein synthesis.
- some drugs can be bactericidal in certain organisms and bacteriostatic in others, knowing the target organism allows one skilled in the art to select an antibiotic with the appropriate properties.
- bacteriostatic antibiotics inhibit the activity of bactericidal antibiotics.
- bactericidal and bacteriostatic antibiotics are not combined.
- Antibiotics include, but are not limited to aminoglycosides, ansamycins, carbacephems, carbapenems, cephalosporins, glycopeptides, lincosamides, lipopeptides, macrolides, monobactams, nitrofurans, oxazolidonones, penicillins, polypeptide antibiotics, quinolones, fluoroquinolone, sulfonamides, tetracyclines, and anti-mycobacterial compounds, and combinations thereof.
- Aminoglycosides include, but are not limited to Amikacin, Gentamicin, Kanamycin, Neomycin, Netilmicin, Tobramycin, Paromomycin, and Spectinomycin.
- Aminoglycosides are effective, e.g., against Gram-negative bacteria, such as Escherichia coli, Klebsiella, Pseudomonas aeruginosa , and Francisella tularensis , and against certain aerobic bacteria but less effective against obligate/facultative anaerobes. Aminoglycosides are believed to bind to the bacterial 30S or 50S ribosomal subunit thereby inhibiting bacterial protein synthesis.
- Ansamycins include, but are not limited to, Geldanamycin, Herbimycin, Rifamycin, and Streptovaricin.
- Geldanamycin and Herbimycin are believed to inhibit or alter the function of Heat Shock Protein 90.
- Carbacephems include, but are not limited to, Loracarbef. Carbacephems are believed to inhibit bacterial cell wall synthesis.
- Carbapenems include, but are not limited to, Ertapenem, Doripenem, Imipenem/Cilastatin, and Meropenem. Carbapenems are bactericidal for both Gram-positive and Gram-negative bacteria as broad-spectrum antibiotics. Carbapenems are believed to inhibit bacterial cell wall synthesis.
- Cephalosporins include, but are not limited to, Cefadroxil, Cefazolin, Cefalotin, Cefalothin, Cefalexin, Cefaclor, Cefamandole, Cefoxitin, Cefprozil, Cefuroxime, Cefixime, Cefdinir, Cefditoren, Cefoperazone, Cefotaxime, Cefpodoxime, Ceftazidime, Ceftibuten, Ceftizoxime, Ceftriaxone, Cefepime, Ceftaroline fosamil, and Ceftobiprole.
- Cephalosporins are effective, e.g., against Gram-negative bacteria and against Gram-positive bacteria, including Pseudomonas , certain Cephalosporins are effective against methicillin-resistant Staphylococcus aureus (MRSA). Cephalosporins are believed to inhibit bacterial cell wall synthesis by disrupting synthesis of the peptidoglycan layer of bacterial cell walls.
- MRSA methicillin-resistant Staphylococcus aureus
- Glycopeptides include, but are not limited to, Teicoplanin, Vancomycin, and Telavancin. Glycopeptides are effective, e.g., against aerobic and anaerobic Gram-positive bacteria including MRSA and Clostridium difficile . Glycopeptides are believed to inhibit bacterial cell wall synthesis by disrupting synthesis of the peptidoglycan layer of bacterial cell walls.
- Lincosamides include, but are not limited to, Clindamycin and Lincomycin. Lincosamides are effective, e.g., against anaerobic bacteria, as well as Staphylococcus , and Streptococcus . Lincosamides are believed to bind to the bacterial 50S ribosomal subunit thereby inhibiting bacterial protein synthesis.
- Lipopeptides include, but are not limited to, Daptomycin. Lipopeptides are effective, e.g., against Gram-positive bacteria. Lipopeptides are believed to bind to the bacterial membrane and cause rapid depolarization.
- Macrolides include, but are not limited to, Azithromycin, Clarithromycin, Dirithromycin, Erythromycin, Roxithromycin, Troleandomycin, Telithromycin, and Spiramycin. Macrolides are effective, e.g., against Streptococcus and Mycoplasma . Macrolides are believed to bind to the bacterial or 50S ribosomal subunit, thereby inhibiting bacterial protein synthesis.
- Monobactams include, but are not limited to, Aztreonam. Monobactams are effective, e.g., against Gram-negative bacteria. Monobactams are believed to inhibit bacterial cell wall synthesis by disrupting synthesis of the peptidoglycan layer of bacterial cell walls.
- Nitrofurans include, but are not limited to, Furazolidone and Nitrofurantoin.
- Oxazolidonones include, but are not limited to, Linezolid, Posizolid, Radezolid, and Torezolid. Oxazolidonones are believed to be protein synthesis inhibitors.
- Penicillins include, but are not limited to, Amoxicillin, Ampicillin, Azlocillin, Carbenicillin, Cloxacillin, Dicloxacillin, Flucloxacillin, Mezlocillin, Methicillin, Nafcillin, Oxacillin, Penicillin G, Penicillin V, Piperacillin, Temocillin and Ticarcillin.
- Penicillins are effective, e.g., against Gram-positive bacteria, facultative anaerobes, e.g., Streptococcus, Borrelia , and Treponema . Penicillins are believed to inhibit bacterial cell wall synthesis by disrupting synthesis of the peptidoglycan layer of bacterial cell walls.
- Penicillin combinations include, but are not limited to, Amoxicillin/clavulanate, Ampicillin/sulbactam, Piperacillin/tazobactam, and Ticarcillin/clavulanate.
- Polypeptide antibiotics include, but are not limited to, Bacitracin, Colistin, and Polymyxin B and E.
- Polypeptide Antibiotics are effective, e.g., against Gram-negative bacteria. Certain polypeptide antibiotics are believed to inhibit isoprenyl pyrophosphate involved in synthesis of the peptidoglycan layer of bacterial cell walls, while others destabilize the bacterial outer membrane by displacing bacterial counter-ions.
- Quinolones and Fluoroquinolone include, but are not limited to, Ciprofloxacin, Enoxacin, Gatifloxacin, Gemifloxacin, Levofloxacin, Lomefloxacin, Moxifloxacin, Nalidixic acid, Norfloxacin, Ofloxacin, Trovafloxacin, Grepafloxacin, Sparfloxacin, and Temafloxacin.
- Quinolones/Fluoroquinolone are effective, e.g., against Streptococcus and Neisseria .
- Quinolones/Fluoroquinolone are believed to inhibit the bacterial DNA gyrase or topoisomerase IV, thereby inhibiting DNA replication and transcription.
- Sulfonamides include, but are not limited to, Mafenide, Sulfacetamide, Sulfadiazine, Silver sulfadiazine, Sulfadimethoxine, Sulfamethizole, Sulfamethoxazole, Sulfanilimide, Sulfasalazine, Sulfisoxazole, Trimethoprim-Sulfamethoxazole (Co-trimoxazole), and Sulfonamidochrysoidine.
- Sulfonamides are believed to inhibit folate synthesis by competitive inhibition of dihydropteroate synthetase, thereby inhibiting nucleic acid synthesis.
- Tetracyclines include, but are not limited to, Demeclocycline, Doxycycline, Minocycline, Oxytetracycline, and Tetracycline. Tetracyclines are effective, e.g., against Gram-negative bacteria. Tetracyclines are believed to bind to the bacterial 30S ribosomal subunit thereby inhibiting bacterial protein synthesis.
- Anti-mycobacterial compounds include, but are not limited to, Clofazimine, Dapsone, Capreomycin, Cycloserine, Ethambutol, Ethionamide, Isoniazid, Pyrazinamide, Rifampicin, Rifabutin, Rifapentine, and Streptomycin.
- Suitable antibiotics also include arsphenamine, chloramphenicol, fosfomycin, fusidic acid, metronidazole, mupirocin, platensimycin, quinupristin/dalfopristin, tigecycline, tinidazole, trimethoprim amoxicillin/clavulanate, ampicillin/sulbactam, amphomycin ristocetin, azithromycin, bacitracin, buforin II, carbomycin, cecropin Pl, clarithromycin, erythromycins, furazolidone, fusidic acid, Na fusidate, gramicidin, imipenem, indolicidin, josamycin, magainan II, metronidazole, nitroimidazoles, mikamycin, mutacin B-Ny266, mutacin B-JH1 140, mutacin J-T8, nisin, nisin A, novobiocin, oleandomycin,
- the additional therapeutic is an immunosuppressive agent, a DMARD, a pain-control drug, a steroid, a non-steroidal antiinflammatory drug (NSAID), or a cytokine antagonist, and combinations thereof.
- Representative agents include, but are not limited to, cyclosporin, retinoids, corticosteroids, propionic acid derivative, acetic acid derivative, enolic acid derivatives, fenamic acid derivatives, Cox-2 inhibitors, lumiracoxib, ibuprophen, cholin magnesium salicylate, fenoprofen, salsalate, difunisal, tolmetin, ketoprofen, flurbiprofen, oxaprozin, indomethacin, sulindac, etodolac, ketorolac, nabumetone, naproxen, valdecoxib, etoricoxib, MK0966; rofecoxib, acetominophen, Cele
- the agent is an immunosuppressive agent.
- immunosuppressive agents include, but are not limited to, corticosteroids, mesalazine, mesalamine, sulfasalazine, sulfasalazine derivatives, immunosuppressive drugs, cyclosporin A, mercaptopurine, azathiopurine, prednisone, methotrexate, antihistamines, glucocorticoids, epinephrine, theophylline, cromolyn sodium, anti-leukotrienes, anti-cholinergic drugs for rhinitis, TLR antagonists, inflammasome inhibitors, anti-cholinergic decongestants, mast-cell stabilizers, monoclonal anti-IgE antibodies, vaccines (e.g., vaccines used for vaccination where the amount of an allergen is gradually increased), cytokine inhibitors, such as anti-IL-6 antibodies, TNF inhibitors such as inf
- the immune disorder therapy comprises administering a therapeutic bacteria and/or a therapeutic combination of bacteria to the subject so a healthy microbiome can be reconstituted in the subject.
- the therapeutic bacteria is a non-immune-disorder-associated bacteria.
- the therapeutic bacteria is a probiotic bacteria.
- the additional therapeutic is a cancer therapeutic.
- the cancer therapeutic is a chemotherapeutic agent.
- chemotherapeutic agents include, but are not limited to, alkylating agents such as cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogue
- the cancer therapeutic is a cancer immunotherapy agent.
- Immunotherapy refers to a treatment that uses a subject's immune system to treat cancer, e.g., checkpoint inhibitors, cancer vaccines, cytokines, cell therapy, CAR-T cells, and dendritic cell therapy.
- checkpoint inhibitors include Nivolumab (BMS, anti-PD-1), Pembrolizumab (Merck, anti-PD-1), Ipilimumab (BMS, anti-CTLA-4), MEDI4736 (AstraZeneca, anti-PD-L1), and MPDL3280A (Roche, anti-PD-L1).
- Other immunotherapies may be tumor vaccines, such as Gardail, Cervarix, BCG, sipulencel-T, Gp100:209-217, AGS-003, DCVax-L, Algenpantucel-L, Tergenpantucel-L, TG4010, ProstAtak, Prostvac-V/R-TRICOM, Rindopepimul, E75 peptide acetate, IMA901, POL-103A, Belagenpumatucel-L, GSK1572932A, MDX-1279, GV1001, and Tecemotide.
- tumor vaccines such as Gardail, Cervarix, BCG, sipulencel-T, Gp100:209-217, AGS-003, DCVax-L, Algenpantucel-L, Tergenpantucel-L, TG4010, ProstAtak, Prostvac-V/R-TRICOM, Rindopepimul, E75 peptide
- Immunotherapy may be administered via injection (e.g., intravenously, intratumorally, subcutaneously, or into lymph nodes), but may also be administered orally, topically, or via aerosol.
- Immunotherapies may comprise adjuvants such as cytokines.
- the immunotherapy agent is an immune checkpoint inhibitor.
- Immune checkpoint inhibition broadly refers to inhibiting the checkpoints that cancer cells can produce to prevent or downregulate an immune response.
- immune checkpoint proteins include, but are not limited to, CTLA4, PD-1, PD-L1, PD-L2, A2AR, B7-H3, B7-H4, BTLA, KIR, LAGS, TIM-3 or VISTA.
- Immune checkpoint inhibitors can be antibodies or antigen binding fragments thereof that bind to and inhibit an immune checkpoint protein.
- immune checkpoint inhibitors include, but are not limited to, nivolumab, pembrolizumab, pidilizumab, AMP-224, AMP-514, STI-A1110, TSR-042, RG-7446, BMS-936559, MEDI-4736, MSB-0020718C, AUR-012 and STI-A1010.
- the immunotherapy agent is an antibody or antigen binding fragment thereof that, for example, binds to a cancer-associated antigen.
- cancer-associated antigens include, but are not limited to, adipophilin, AIM-2, ALDH1A1, alpha-actinin-4, alpha-fetoprotein (“AFP”), ARTC1, B-RAF, BAGE-1, BCLX (L), BCR-ABL fusion protein b3a2, beta-catenin, BING-4, CA-125, CALCA, carcinoembryonic antigen (“CEA”), CASP-5, CASP-8, CD274, CD45, Cdc27, CDK12, CDK4, CDKN2A, CEA, CLPP, COA-1, CPSF, CSNK1A1, CTAG1, CTAG2, cyclin D1, Cyclin-A1, dek-can fusion protein, DKK1, EFTUD2, Elongation factor 2, ENAH (hMena), Ep-CAM, EpCAM, EphA3, epi
- the immunotherapy agent is a cancer vaccine and/or a component of a cancer vaccine (e.g., an antigenic peptide and/or protein).
- the cancer vaccine can be a protein vaccine, a nucleic acid vaccine or a combination thereof.
- the cancer vaccine comprises a polypeptide comprising an epitope of a cancer-associated antigen.
- the cancer vaccine comprises a nucleic acid (e.g., DNA or RNA, such as mRNA) that encodes an epitope of a cancer-associated antigen.
- the nucleic acid is a vector (e.g., a bacterial vector, viral vector).
- bacterial vectors include, but are not limited to, Mycobacterium bovis (BCG), Salmonella Typhimurium ssp., Salmonella Typhi ssp., Clostridium sp. spores, Escherichia coli Nissle 1917, Escherichia coli K-12/LLO, Listeria monocytogenes , and Shigella flexneri .
- viral vectors include, but are not limited to, vaccinia, adenovirus, RNA viruses, and replication defective avipox, replication-defective fowlpox, replication-defective canarypox, replication defective MVA and replication-defective adenovirus.
- the cancer immunotherapy comprises administration of an antigen presenting cell (APC) primed with a cancer-specific antigen.
- APC antigen presenting cell
- the APC is a dendritic cell, a macrophage or a B cell.
- cancer-associated antigens include, but are not limited to, adipophilin, AIM-2, ALDH1A1, alpha-actinin-4, alpha-fetoprotein (“AFP”), ARTC1, B-RAF, BAGE-1, BCLX (L), BCR-ABL fusion protein b3a2, beta-catenin, BING-4, CA-125, CALCA, carcinoembryonic antigen (“CEA”), CASP-5, CASP-8, CD274, CD45, Cdc27, CDK12, CDK4, CDKN2A, CEA, CLPP, COA-1, CPSF, CSNK1A1, CTAG1, CTAG2, cyclin D1, Cyclin-A1, dek-can fusion protein, DKK1, EFTUD2, Elongation factor 2, ENAH (hMena), Ep-CAM, EpCAM, EphA3, epithelial tumor antigen (“ETA”), ETV6-AML1 fusion protein, EZH2, FGF5, FLT3-ITD,
- the cancer immunotherapy comprises administration of a cancer-specific chimeric antigen receptor (CAR).
- CAR cancer-specific chimeric antigen receptor
- the CAR is administered on the surface of a T cell.
- the CAR binds specifically to a cancer-associated antigen.
- the cancer immunotherapy comprises administration of a cancer-specific T cell to the subject.
- the T cell is a CD4+ T cell.
- the CD4+ T cell is a TH1 T cell, a TH2 T cell or a TH17 T cell.
- the T cell expresses a T cell receptor specific for a cancer-associated antigen.
- the cancer vaccine is administered with an adjuvant.
- adjuvants include, but are not limited to, an immune modulatory protein, Adjuvant 65, ⁇ -GalCer, aluminum phosphate, aluminum hydroxide, calcium phosphate, ⁇ -Glucan Peptide, CpG ODN DNA, GPI-0100, lipid A, lipopolysaccharide, Lipovant, Montanide, N-acetyl-muramyl-L-alanyl-D-isoglutamine, Pam3CSK4, quil A, cholera toxin (CT) and heat-labile toxin from enterotoxigenic Escherichia coli (LT) including derivatives of these (CTB, mmCT, CTA1-DD, LTB, LTK63, LTR72, dmLT) and trehalose dimycolate.
- CTB cholera toxin
- LT heat-labile toxin from enterotoxigenic Escherichia coli
- the immunotherapy agent is an immune modulating protein to the subject.
- the immune modulatory protein is a cytokine or chemokine.
- immune modulating proteins include, but are not limited to, B lymphocyte chemoattractant (“BLC”), C—C motif chemokine 11 (“Eotaxin-1”), Eosinophil chemotactic protein 2 (“Eotaxin-2”), Granulocyte colony-stimulating factor (“G-CSF”), Granulocyte macrophage colony-stimulating factor (“GM-CSF”), 1-309, Intercellular Adhesion Molecule 1 (“ICAM-1”), Interferon alpha (“IFN-alpha”), Interferon beta (“IFN-beta”) Interferon gamma (“IFN-gamma”), Interlukin-1 alpha (“IL-1 alpha”), Interlukin-1 beta (“IL-1 beta”), Interleukin 1 receptor antagonist (“IL-1 ra”), Interleukin-2 (“IL-2”)
- BLC B lymphocyte
- the cancer therapeutic agent is an anti-cancer compound.
- anti-cancer compounds include, but are not limited to, Alemtuzumab (Campath®), Alitretinoin (Panretin®), Anastrozole (Arimidex®), Bevacizumab (Avastin®), Bexarotene (Targretin®), Bortezomib (Velcade®), Bosutinib (Bosulif®), Brentuximab vedotin (Adcetris®), Cabozantinib (CometriqTM), Carfilzomib (KyprolisTM), Cetuximab (Erbitux®), Crizotinib (Xalkori®), Dasatinib (Sprycel®), Denileukin diftitox (Ontak®), Erlotinib hydrochloride (Tarceva®), Everolimus (Afinitor®), Exemestane (A
- anti-cancer compounds that modify the function of proteins that regulate gene expression and other cellular functions (e.g., HDAC inhibitors, retinoid receptor ligants) are Vorinostat (Zolinza®), Bexarotene (Targretin®) and Romidepsin (Istodax®), Alitretinoin (Panretin®), and Tretinoin (Vesanoid®).
- anti-cancer compounds that induce apoptosis are Bortezomib (Velcade®), Carfilzomib (KyprolisTM), and Pralatrexate (Folotyn®).
- anti-cancer compounds that deliver toxic agents to cancer cells are Tositumomab and 131I-tositumomab (Bexxar®) and Ibritumomab tiuxetan (Zevalin®), Denileukin diftitox (Ontak®), and Brentuximab vedotin (Adcetris®).
- exemplary anti-cancer compounds are small molecule inhibitors and conjugates thereof of, e.g., Janus kinase, ALK, Bcl-2, PARP, PI3K, VEGF receptor, Braf, MEK, CDK, and HSP90.
- platinum-based anti-cancer compounds include, for example, cisplatin, carboplatin, oxaliplatin, satraplatin, picoplatin, Nedaplatin, Triplatin, and Lipoplatin.
- Other metal-based drugs suitable for treatment include, but are not limited to ruthenium-based compounds, ferrocene derivatives, titanium-based compounds, and gallium-based compounds.
- the cancer therapeutic is a radioactive moiety that comprises a radionuclide.
- radionuclides include, but are not limited to Cr-51, Cs-131, Ce-134, Se-75, Ru-97, 1-125, Eu-149, Os-189m, Sb-119, 1-123, Ho-161, Sb-117, Ce-139, In-111, Rh-103m, Ga-67, T1-201, Pd-103, Au-195, Hg-197, Sr-87m, Pt-191, P-33, Er-169, Ru-103, Yb-169, Au-199, Sn-121, Tm-167, Yb-175, In-113m, Sn-113, Lu-177, Rh-105, Sn-117m, Cu-67, Sc-47, Pt-195m, Ce-141, 1-131, Tb-161, As-77, Pt-197, Sm-153, Gd-159, Tm-173, Pr-143, Au-198, Tm-170
- the methods and compositions described herein relate to the treatment or prevention of a disease or disorder associated with a pathological immune response, such as an autoimmune disease, an allergic reaction and/or an inflammatory disease.
- the disease or disorder is an inflammatory bowel disease (e.g., Crohn's disease or ulcerative colitis).
- the methods and compositions described herein relate to the treatment or prevention of delayed-type hypersensitivity, autoimmune myocarditis, granulomas, peripheral neuropathies, Hashimoto's thyroiditis, inflammation of the colon, colitis, microscopic colitis, collagenous colitis, diversion colitis, chemical colitis, ischemic colitis, indeterminate colitis, atypical colitis.
- a “subject in need thereof” includes any subject that has a disease or disorder associated with a pathological immune response (e.g., an inflammatory bowel disease), as well as any subject with an increased likelihood of acquiring a such a disease or disorder.
- a pathological immune response e.g., an inflammatory bowel disease
- compositions described herein can be used, for example, as a pharmaceutical composition for preventing or treating (reducing, partially or completely, the adverse effects of) an autoimmune disease, such as chronic inflammatory bowel disease, systemic lupus erythematosus, psoriasis, muckle-wells syndrome, rheumatoid arthritis, multiple sclerosis, or Hashimoto's disease; an allergic disease, such as a food allergy, pollenosis, or asthma; an infectious disease, such as an infection with Clostridium difficile ; an inflammatory disease such as a TNF-mediated inflammatory disease (e.g., an inflammatory disease of the gastrointestinal tract, such as pouchitis, a cardiovascular inflammatory condition, such as atherosclerosis, or an inflammatory lung disease, such as chronic obstructive pulmonary disease); a pharmaceutical composition for suppressing rejection in organ transplantation or other situations in which tissue rejection might occur; a supplement, food, or beverage for improving immune functions; or a reagent for suppressing the proliferation or function of
- the methods provided herein are useful for the treatment of inflammation.
- the inflammation of any tissue and organs of the body including musculoskeletal inflammation, vascular inflammation, neural inflammation, digestive system inflammation, ocular inflammation, inflammation of the reproductive system, and other inflammation, as discussed below.
- Immune disorders of the musculoskeletal system include, but are not limited, to those conditions affecting skeletal joints, including joints of the hand, wrist, elbow, shoulder, jaw, spine, neck, hip, knew, ankle, and foot, and conditions affecting tissues connecting muscles to bones such as tendons.
- immune disorders which may be treated with the methods and compositions described herein include, but are not limited to, arthritis (including, for example, osteoarthritis, rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, acute and chronic infectious arthritis, arthritis associated with gout and pseudogout, and juvenile idiopathic arthritis), tendonitis, synovitis, tenosynovitis, bursitis, fibrositis (fibromyalgia), epicondylitis, myositis, and osteitis (including, for example, Paget's disease, osteitis pubis, and osteitis fibrosa cystic).
- arthritis including, for example, osteoarthritis, rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, acute and chronic infectious arthritis, arthritis associated with gout and pseudogout, and juvenile idiopathic arthritis
- tendonitis synovitis, ten
- Ocular immune disorders refers to an immune disorder that affects any structure of the eye, including the eye lids.
- ocular immune disorders which may be treated with the methods and compositions described herein include, but are not limited to, blepharitis, blepharochalasis, conjunctivitis, dacryoadenitis, keratitis, keratoconjunctivitis sicca (dry eye), scleritis, trichiasis, and uveitis
- Examples of nervous system immune disorders which may be treated with the methods and compositions described herein include, but are not limited to, encephalitis, Guillain-Barre syndrome, meningitis, neuromyotonia, narcolepsy, multiple sclerosis, myelitis and schizophrenia.
- Examples of inflammation of the vasculature or lymphatic system which may be treated with the methods and compositions described herein include, but are not limited to, arthrosclerosis, arthritis, phlebitis, vasculitis, and lymphangitis.
- Examples of digestive system immune disorders which may be treated with the methods and compositions described herein include, but are not limited to, cholangitis, cholecystitis, enteritis, enterocolitis, gastritis, gastroenteritis, inflammatory bowel disease, ileitis, and proctitis.
- Inflammatory bowel diseases include, for example, certain art-recognized forms of a group of related conditions.
- Crohn's disease regional bowel disease, e.g., inactive and active forms
- ulcerative colitis e.g., inactive and active forms
- the inflammatory bowel disease encompasses irritable bowel syndrome, microscopic colitis, lymphocytic-plasmocytic enteritis, coeliac disease, collagenous colitis, lymphocytic colitis and eosinophilic enterocolitis.
- Other less common forms of IBD include indeterminate colitis, pseudomembranous colitis (necrotizing colitis), ischemic inflammatory bowel disease, Behcet's disease, sarcoidosis, scleroderma, IBD-associated dysplasia, dysplasia associated masses or lesions, and primary sclerosing cholangitis.
- reproductive system immune disorders which may be treated with the methods and compositions described herein include, but are not limited to, cervicitis, chorioamnionitis, endometritis, epididymitis, omphalitis, oophoritis, orchitis, salpingitis, tubo-ovarian abscess, urethritis, vaginitis, vulvitis, and vulvodynia.
- autoimmune conditions having an inflammatory component.
- Such conditions include, but are not limited to, acute disseminated alopecia universalise, Behcet's disease, Chagas' disease, chronic fatigue syndrome, dysautonomia, encephalomyelitis, ankylosing spondylitis, aplastic anemia, hidradenitis suppurativa, autoimmune hepatitis, autoimmune oophoritis, celiac disease, Crohn's disease, diabetes mellitus type 1, giant cell arteritis, goodpasture's syndrome, Grave's disease, Guillain-Barre syndrome, Hashimoto's disease, Henoch-Schonlein purpura, Kawasaki's disease, lupus erythematosus, microscopic colitis, microscopic polyarteritis, mixed connective tissue disease, Muckle-Wells syndrome, multiple sclerosis, myasthenia gravis, opsoclonus myo
- T-cell mediated hypersensitivity diseases having an inflammatory component.
- Such conditions include, but are not limited to, contact hypersensitivity, contact dermatitis (including that due to poison ivy), uticaria, skin allergies, respiratory allergies (hay fever, allergic rhinitis, house dustmite allergy) and gluten-sensitive enteropathy (Celiac disease).
- immune disorders which may be treated with the methods and compositions include, for example, appendicitis, dermatitis, dermatomyositis, endocarditis, fibrositis, gingivitis, glossitis, hepatitis, hidradenitis suppurativa, ulceris, laryngitis, mastitis, myocarditis, nephritis, otitis, pancreatitis, parotitis, percarditis, peritonoitis, pharyngitis, pleuritis, pneumonitis, prostatistis, pyelonephritis, and stomatisi, transplant rejection (involving organs such as kidney, liver, heart, lung, pancreas (e.g., islet cells), bone marrow, cornea, small bowel, skin allografts, skin homografts, and heart valve xengrafts, sewrum sickness, and graft vs host disease),
- Preferred treatments include treatment of transplant rejection, rheumatoid arthritis, psoriatic arthritis, multiple sclerosis, Type 1 diabetes, asthma, inflammatory bowel disease, systemic lupus erythematosus, psoriasis, chronic obstructive pulmonary disease, and inflammation accompanying infectious conditions (e.g., sepsis).
- the methods and compositions described herein may be used to treat metabolic disorders and metabolic syndromes. Such conditions include, but are not limited to, Type II Diabetes, Encephalopathy, Tay-Sachs disease, Krabbe disease, Galactosemia, Phenylketonuria (PKU), and Maple syrup urine disease.
- the methods and compositions described herein may be used to treat neurodegenerative and neurological diseases.
- Such conditions include, but are not limited to, Parkinson's disease, Alzheimer's disease, prion disease, Huntington's disease, motor neurone diseases (MND), spinocerebellar ataxia, spinal muscular atrophy, dystonia, idiopathic intracranial hypertension, epilepsy, nervous system disease, central nervous system disease, movement disorders, multiple sclerosis, encephalopathy, and, post-operative cognitive dysfunction.
- the methods and compositions described herein relate to the treatment of cancer.
- any cancer can be treated using the methods described herein.
- cancers that may treated by methods and compositions described herein include, but are not limited to, cancer cells from the bladder, blood, bone, bone marrow, brain, breast, colon, esophagus, gastrointestine, gum, head, kidney, liver, lung, nasopharynx, neck, ovary, prostate, skin, stomach, testis, tongue, or uterus.
- the cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma; chromophobe carcinoma; acid
- the methods and compositions provided herein relate to the treatment of a leukemia.
- leukemia is meant broadly progressive, malignant diseases of the hematopoietic organs/systems and is generally characterized by a distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow.
- Non-limiting examples of leukemia diseases include, acute nonlymphocytic leukemia, chronic lymphocytic leukemia, acute granulocytic leukemia, chronic granulocytic leukemia, acute promyelocytic leukemia, adult T-cell leukemia, aleukemic leukemia, a leukocythemic leukemia, basophilic leukemia, blast cell leukemia, bovine leukemia, chronic myelocytic leukemia, leukemia cutis, embryonal leukemia, eosinophilic leukemia, Gross' leukemia, Rieder cell leukemia, Schilling's leukemia, stem cell leukemia, subleukemic leukemia, undifferentiated cell leukemia, hairy-cell leukemia, hemoblastic leukemia, hemocytoblastic leukemia, histiocytic leukemia, stem cell leukemia, acute monocytic leukemia, leukopenic leukemia, lymphatic leuk
- the methods and compositions provided herein relate to the treatment of a carcinoma.
- carcinoma refers to a malignant growth made up of epithelial cells tending to infiltrate the surrounding tissues, and/or resist physiological and non-physiological cell death signals and gives rise to metastases.
- Non-limiting exemplary types of carcinomas include, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, basosquamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epiennoid carcinoma, carcinoma epitheliale adenoides, exophytic carcinoma, carcinoma ex ulcere, carcinoma fibrosum, gelatiniform carcinoma, gelatinous carcinoma, giant cell carcinoma, signet-ring cell carcinoma, carcinoma simplex, small-cell carcinoma, solanoid carcinoma,
- the methods and compositions provided herein relate to the treatment of a sarcoma.
- sarcoma generally refers to a tumor which is made up of a substance like the embryonic connective tissue and is generally composed of closely packed cells embedded in a fibrillar, heterogeneous, or homogeneous substance.
- Sarcomas include, but are not limited to, chondrosarcoma, fibrosarcoma, lymphosarcoma, melanosarcoma, myxosarcoma, osteosarcoma, endometrial sarcoma, stromal sarcoma, Ewing's sarcoma, fascial sarcoma, fibroblastic sarcoma, giant cell sarcoma, Abemethy's sarcoma, adipose sarcoma, liposarcoma, alveolar soft part sarcoma, ameloblastic sarcoma, botryoid sarcoma, chloroma sarcoma, chorio carcinoma, embryonal sarcoma, Wilms' tumor sarcoma, granulocytic sarcoma, Hodgkin's sarcoma, idiopathic multiple pigmented hemorrhagic sar
- Additional exemplary neoplasias that can be treated using the methods and compositions described herein include Hodgkin's Disease, Non-Hodgkin's Lymphoma, multiple myeloma, neuroblastoma, breast cancer, ovarian cancer, lung cancer, rhabdomyosarcoma, primary thrombocytosis, primary macroglobulinemia, small-cell lung tumors, primary brain tumors, stomach cancer, colon cancer, malignant pancreatic insulanoma, malignant carcinoid, premalignant skin lesions, testicular cancer, lymphomas, thyroid cancer, neuroblastoma, esophageal cancer, genitourinary tract cancer, malignant hypercalcemia, cervical cancer, endometrial cancer, and adrenal cortical cancer.
- the cancer treated is a melanoma.
- melanoma is taken to mean a tumor arising from the melanocytic system of the skin and other organs.
- melanomas are Harding-Passey melanoma, juvenile melanoma, lentigo maligna melanoma, malignant melanoma, acral-lentiginous melanoma, amelanotic melanoma, benign juvenile melanoma, Cloudman's melanoma, S91 melanoma, nodular melanoma subungal melanoma, and superficial spreading melanoma.
- tumors that can be treated using methods and compositions described herein include lymphoproliferative disorders, breast cancer, ovarian cancer, prostate cancer, cervical cancer, endometrial cancer, bone cancer, liver cancer, stomach cancer, colon cancer, pancreatic cancer, cancer of the thyroid, head and neck cancer, cancer of the central nervous system, cancer of the peripheral nervous system, skin cancer, kidney cancer, as well as metastases of all the above.
- tumors include hepatocellular carcinoma, hepatoma, hepatoblastoma, rhabdomyosarcoma, esophageal carcinoma, thyroid carcinoma, ganglioblastoma, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, Ewing's tumor, leimyosarcoma, rhabdotheliosarcoma, invasive ductal carcinoma, papillary adenocarcinoma, melanoma, pulmonary squamous cell carcinoma, basal cell carcinoma, adenocarcinoma (well differentiated, moderately differentiated, poorly differentiated or undifferentiated), bronchioloalveolar carcinoma, renal cell carcinoma, hypernephroma, hypernephroid adenocarcinoma, bile duct carcinoma,
- Cancers treated in certain embodiments also include precancerous lesions, e.g., actinic keratosis (solar keratosis), moles (dysplastic nevi), acitinic chelitis (farmer's lip), cutaneous horns, Barrett's esophagus, atrophic gastritis, dyskeratosis congenita, sideropenic dysphagia, lichen planus, oral submucous fibrosis, actinic (solar) elastosis and cervical dysplasia.
- precancerous lesions e.g., actinic keratosis (solar keratosis), moles (dysplastic nevi), acitinic chelitis (farmer's lip), cutaneous horns, Barrett's esophagus, atrophic gastritis, dyskeratosis congenita, sideropenic dysphagia, lichen
- Cancers treated in some embodiments include non-cancerous or benign tumors, e.g., of endodermal, ectodermal or mesenchymal origin, including, but not limited to cholangioma, colonic polyp, adenoma, papilloma, cystadenoma, liver cell adenoma, hydatidiform mole, renal tubular adenoma, squamous cell papilloma, gastric polyp, hemangioma, osteoma, chondroma, lipoma, fibroma, lymphangioma, leiomyoma, rhabdomyoma, astrocytoma, nevus, meningioma, and ganglioneuroma.
- non-cancerous or benign tumors e.g., of endodermal, ectodermal or mesenchymal origin, including, but not limited to cholangioma, colonic
- Example 1 Immune Modulation of Human Commensal Bacteria in a KLH-Based Delayed Type Hypersensitivity Model
- Delayed-type hypersensitivity is an animal model of atopic dermatitis (or allergic contact dermatitis), as reviewed by Petersen et al. (In vivo pharmacological disease models for psoriasis and atopic dermatitis in drug discovery. Basic & Clinical Pharm & Toxicology. 2006. 99(2): 104-115; see also Irving C. Allen (ed.) Mouse Models of Innate Immunity: Methods and Protocols, Methods in Molecular Biology, 2013. vol. 1031, DOI 10.1007/978-1-62703-481-4_13).
- DTH can be induced in a variety of mouse and rat strains using various haptens or antigens, for example an antigen emulsified with an adjuvant.
- DTH is characterized by sensitization as well as an antigen-specific T cell-mediated reaction that results in erythema, edema, and cellular infiltration—especially infiltration of antigen presenting cells (APCs), eosinophils, activated CD4+ T cells, and cytokine-expressing Th2 cells.
- APCs antigen presenting cells
- eosinophils activated CD4+ T cells
- cytokine-expressing Th2 cells cytokine-expressing Th2 cells.
- the test formulations were prepared for KLH-based delayed type hypersensitivity model.
- the delayed-type hypersensitivity (DTH) model provides an in vivo mechanism to study the cell-mediated immune response, and resulting inflammation, following exposure to a specific antigen to which the mice have been sensitized.
- DTH delayed-type hypersensitivity
- Several variations of the DTH model have been used and are well known in the art (Irving C. Allen (ed.). Mouse Models of Innate Immunity: Methods and Protocols , Methods in Molecular Biology. Vol. 1031, DOI 10.1007/978-1-62703-481-4_13, Springer Science+Business Media, LLC 2013).
- KLH Keyhole Limpet Hemocyanin
- CFA Complete Freund's Adjuvant
- mice On day 0, C57Bl/6J female mice, approximately 7 weeks old, were primed with KLH antigen in CFA by subcutaneous immunization (4 sites, 50 ⁇ L per site).
- Dexamethasone a corticosteroid
- Dexamethasone a corticosteroid
- Dexamethasone a corticosteroid
- a positive control for suppressing inflammation in this model Taube and Carlsten, Action of dexamethasone in the suppression of delayed-type hypersensitivity in reconstituted SCID mice. Inflamm Res. 2000. 49(10): 548-512.
- a stock solution of 17 mg/mL of Dexamethasone was prepared on by diluting 6.8 mg Dexamethasone in 400 ⁇ L 96% ethanol.
- a working solution is prepared by diluting the stock solution 100 ⁇ in sterile PBS to obtain a final concentration of 0.17 mg/mL in a septum vial for intraperitoneal dosing.
- Dexamethasone-treated mice received 100 ⁇ L Dexamethasone i.p. (5 mL/kg of a 0.17 mg/mL solution). Frozen sucrose served as the negative control (vehicle). Lactococcus lactis cremoris Strain A was dosed at 100 ul of bacterial cells at 1 ⁇ 10 ⁇ circumflex over ( ) ⁇ 10 CFU/ml p.o. daily.
- Dexamethasone (positive control), vehicle (negative control), and Lactococcus lactis cremoris Strain A were dosed daily.
- mice were challenged intradermally (i.d.) with 10 ⁇ g KLH in saline (in a volume of 10 ⁇ L) in the right ear and a control in the left ear Inflammatory response were measured using methods known in the art. Ear pinna thickness was measured at 48 hours following antigen challenge ( FIGS. 1 and 3 ). As determined by ear thickness, Lactococcus lactis cremoris Strain A was as efficacious as Dexamethasone at suppressing inflammation compared to mice that received vehicle alone.
- Lactococcus lactis cremoris Strain A may be studied further using varied timing and varied doses. For instance, treatment with Lactococcus lactis cremoris Strain A-containing bacterial composition may be initiated at some point, either around the time of priming or around the time of DTH challenge. For example, Lactococcus lactis cremoris strain A (1 ⁇ 10 9 CFU per mouse per day) may be administered at the same time as the subcutaneous injections (day 0), or they may be administered prior to, or upon, intradermal injection. Lactococcus lactis cremoris strain A is administered at varied doses and at defined intervals.
- mice are intravenously injected with Lactococcus lactis cremoris strain A at a range of between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells per mouse. While some mice will receive Lactococcus lactis cremoris strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, topical administration, intradermal (i.d.) injection, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A every day (e.g.
- mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A.
- the bacterial cells may be live, dead, or weakened.
- the bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A administration.
- bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, i.d. injection, topical administration, or nasal route administration.
- mice may be treated with anti-inflammatory agent(s) (e.g. anti-CD154, blockade of members of the TNF family, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- anti-inflammatory agent(s) e.g. anti-CD154, blockade of members of the TNF family, or other treatment
- an appropriate control e.g. vehicle or control antibody
- mice are treated with antibiotics prior to treatment.
- antibiotics for example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment.
- Some immunized mice are treated without receiving antibiotics.
- Study animals may be sacrificed by exsanguination from the orbital plexus under CO 2 /O 2 anesthesia, followed by cervical dislocation on day 10.
- the blood samples are allowed to clot before centrifuging.
- the sera are transferred into clean tubes, each animal in a separate tube.
- both ears each ear in a separate vial
- the spleen the mesenteric lymph nodes (MLN)
- the entire small intestine and the colon are collected in cryovials, snap frozen and stored at ⁇ 70° C.
- Tissues may be dissociated using dissociation enzymes according to the manufacturer's instructions.
- Cells are stained for analysis by flow cytometry using techniques known in the art.
- Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103.
- markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80).
- serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1.
- Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ infiltrated immune cells obtained ex vivo.
- immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- Example 2 An Evaluation of Test Articles in the Modulation of DSS-Induced Colitis in C57BL/6 Mice
- Dextran sulfate sodium (DSS)-induced colitis is a well-studied animal model of colitis, as reviewed by Randhawa et al. (A review on chemical-induced inflammatory bowel disease models in rodents. Korean J Physiol Pharmacol. 2014. 18(4): 279-288; see also Chassaing et al. Dextran sulfate sodium (DSS)-induced colitis in mice. Curr Protoc Immunol. 2014 Feb. 4; 104: Unit 15.25). In this model, mice are treated with DSS in drinking water, resulting in diarrhea and weight loss.
- mice were treated with DSS to induce colitis as known in the art (Randhawa et al. 2014; Chassaing et al. 2014; see also Kim et al. Investigating intestinal inflammation in DSS-induced model of IBD. J Vis Exp. 2012. 60: 3678).
- colitis was induced in mice by exposure to 3% DSS-treated drinking water from Day 0 to Day 5.
- One group did not receive DSS and served as naive controls.
- Lactococcus lactis cremoris Strain A-containing bacterial composition may be initiated at some point, either on day 1 of DSS administration, or sometime thereafter.
- Lactococcus lactis cremoris strain A may be administered at the same time as DSS initiation (day 1), or they may be administered upon the first signs of disease (e.g. weight loss or diarrhea), or during the stages of severe colitis. Mice may be observed daily for weight, morbidity, survival, presence of diarrhea and/or bloody stool.
- Lactococcus lactis cremoris strain A is administered at varied doses, varied intervals, and/or varied routes of administration. For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at a dose of between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells per mouse. While some mice will receive Lactococcus lactis cremoris strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A every day (e.g.
- mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A.
- the bacterial cells may be live, dead, or weakened.
- the bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- Lactococcus lactis cremoris Strain A-containing bacterial compositions may be tested for their efficacy in a mouse model of DSS-induced colitis, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory agents.
- mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A administration.
- bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration.
- mice may be treated with additional anti-inflammatory agent(s) (e.g. anti-CD154, blockade of members of the TNF family, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- additional anti-inflammatory agent(s) e.g. anti-CD154, blockade of members of the TNF family, or other treatment
- an appropriate control e.g. vehicle or control antibody
- mice are treated with antibiotics prior to treatment.
- antibiotics for example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment.
- Some mice receive DSS without receiving antibiotics beforehand.
- mice undergo video endoscopy using a small animal endoscope (Karl Storz Endoskipe, Germany) under isoflurane anesthesia. Still images and video will be recorded to evaluate the extent of colitis and the response to treatment. Colitis will be scored using criteria known in the art. Fecal material will be collected for study.
- GI gastrointestinal
- lymph nodes and/or other tissues may be removed for ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art.
- tissues are harvested and may be dissociated using dissociation enzymes according to the manufacturer's instructions.
- Cells are stained for analysis by flow cytometry using techniques known in the art.
- Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103.
- markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80).
- serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1.
- Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ GI tract-infiltrated immune cells obtained ex vivo.
- immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- mice In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be rechallenged with a disease trigger. Mice will be analyzed for susceptibility to colitis severity following rechallenge.
- the colon, small intestine, spleen, and mesenteric lymph nodes may be collected from all animals, and blood collected for analysis.
- Example 3 Lactococcus lactis Cremoris Strain A and/or EVs Derived from Lactococcus lactis Cremoris Strain A in a Mouse Model of Experimental Autoimmune Encephalomyelitis (EAE)
- EAE is a well-studied animal model of multiple sclerosis, as reviewed by Constantinescu et al. (Experimental autoimmune encephalomyelitis (EAE) as a model for multiple sclerosis (MS). Br J Pharmacol. 2011 October; 164(4): 1079-1106). It can be induced in a variety of mouse and rat strains using different myelin-associated peptides, by the adoptive transfer of activated encephalitogenic T cells, or the use of TCR transgenic mice susceptible to EAE, as discussed in Mangalam et al. (Two discreet subsets of CD8+ T cells modulate PLP 91-110 induced experimental autoimmune encephalomyelitis in HLA-DR3 transgenic mice. J Autoimmun. 2012 June; 38(4): 344-353).
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in the rodent model of EAE, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory treatments.
- female 6-8 week old C57Bl/6 mice are obtained from Taconic (Germantown, N.Y.).
- mice will be administered two subcutaneous (s.c.) injections at two sites on the back (upper and lower) of 0.1 ml myelin oligodentrocyte glycoprotein 35-55 (MOG35-55; 100 ug per injection; 200 ug per mouse (total 0.2 ml per mouse)), emulsified in Complete Freund's Adjuvant (CFA; 2-5 mg killed Mycobacterium tuberculosis H37Ra/ml emulsion). Approximately 1-2 hours after the above, mice are intraperitoneally (i.p.) injected with 200 ng Pertussis toxin (PTx) in 0.1 ml PBS (2 ug/ml).
- PTx Pertussis toxin
- An additional IP injection of PTx is administered on day 2.
- an appropriate amount of an alternative myelin peptide e.g. proteolipid protein (PLP)
- PGP proteolipid protein
- Some animals will serve as na ⁇ ve controls. EAE severity will be assessed and a disability score will be assigned daily beginning on day 4 according to methods known in the art (Mangalam et al. 2012).
- Lactococcus lactis cremoris Strain A-containing bacterial composition and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of immunization or following EAE immunization.
- Lactococcus lactis cremoris Strain A-containing bacterial and/or EVs derived from Lactococcus lactis cremoris Strain A composition may be administered at the same time as immunization (day 1), or they may be administered upon the first signs of disability (e.g. limp tail), or during severe EAE.
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are administered at varied doses and at defined intervals. For example, some mice are intravenously injected with effective doses of Lactococcus lactis cremoris Strain A. For example, mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells per mouse. While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v.
- mice may receive Lactococcus lactis cremoris and/or EVs derived from Lactococcus lactis cremoris Strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration.
- Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days).
- mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A.
- the bacterial cells may be live, dead, or weakened.
- the bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration.
- bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, subcutaneous (s.c.) injection, or nasal route administration.
- mice may be treated with additional anti-inflammatory agent(s) or EAE therapeutic(s) (e.g. anti-CD154, blockade of members of the TNF family, Vitamin D, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- additional anti-inflammatory agent(s) or EAE therapeutic(s) e.g. anti-CD154, blockade of members of the TNF family, Vitamin D, or other treatment
- an appropriate control e.g. vehicle or control antibody
- mice are treated with antibiotics prior to treatment.
- antibiotics for example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment.
- Some immunized mice are treated without receiving antibiotics.
- mice are sacrificed and sites of inflammation (e.g. brain and spinal cord), lymph nodes, or other tissues may be removed for ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art.
- tissues are dissociated using dissociation enzymes according to the manufacturer's instructions.
- Cells are stained for analysis by flow cytometry using techniques known in the art.
- Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103.
- markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80).
- serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1.
- Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ central nervous system (CNS)-infiltrated immune cells obtained ex vivo.
- CNS central nervous system
- immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- mice may be rechallenged with a disease trigger (e.g. activated encephalitogenic T cells or re-injection of EAE-inducing peptides). Mice will be analyzed for susceptibility to disease and EAE severity following rechallenge.
- a disease trigger e.g. activated encephalitogenic T cells or re-injection of EAE-inducing peptides.
- Example 4 Lactococcus lactis Cremoris Strain A and/or EVs Derived from Lactococcus lactis Cremoris Strain A in a Mouse Model of Collagen-Induced Arthritis (CIA)
- Collagen-induced arthritis is an animal model commonly used to study rheumatoid arthritis (RA), as described by Caplazi et al. (Mouse models of rheumatoid arthritis. Veterinary Pathology. Sep. 1, 2015. 52(5): 819-826) (see also Brand et al. Collagen-induced arthritis. Nature Protocols. 2007. 2: 1269-1275; Pietrosimone et al. Collagen-induced arthritis: a model for murine autoimmune arthritis. Bio Protoc. 2015 Oct. 20; 5(20): e1626).
- one model involves immunizing HLA-DQ8 Tg mice with chick type II collagen as described by Taneja et al. (J. Immunology. 2007. 56: 69-78; see also Taneja et al. J. Immunology 2008. 181: 2869-2877; and Taneja et al. Arthritis Rheum., 2007. 56: 69-78). Purification of chick CII has been described by Taneja et al. (Arthritis Rheum., 2007. 56: 69-78). Mice are monitored for CIA disease onset and progression following immunization, and severity of disease is evaluated and “graded” as described by Wooley, J. Exp. Med. 1981. 154: 688-700.
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in CIA, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory treatments.
- Lactococcus lactis cremoris Strain A-containing bacterial composition and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated either around the time of immunization with collagen or post-immunization.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered at the same time as immunization (day 1), or Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered upon first signs of disease, or upon the onset of severe symptoms.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals.
- mice are intravenously injected with Lactococcus lactis cremoris strain A at a dose of between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells per mouse. While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other groups of mice may receive Lactococcus lactis cremoris strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration.
- i.p. intraperitoneal
- s.c. subcutaneous
- mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A.
- the bacterial cells may be live, dead, or weakened.
- the bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration.
- bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, subcutaneous (s.c.) injection, intradermal (i.d.) injection, or nasal route administration.
- mice may be treated with additional anti-inflammatory agent(s) or CIA therapeutic(s) (e.g. anti-CD154, blockade of members of the TNF family, Vitamin D, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- additional anti-inflammatory agent(s) or CIA therapeutic(s) e.g. anti-CD154, blockade of members of the TNF family, Vitamin D, or other treatment
- an appropriate control e.g. vehicle or control antibody
- mice are treated with antibiotics prior to treatment.
- antibiotics for example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment.
- Some immunized mice are treated without receiving antibiotics.
- mice are sacrificed and sites of inflammation (e.g. synovium), lymph nodes, or other tissues may be removed for ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art.
- the synovium and synovial fluid will be analyzed for plasma cell infiltration and the presence of antibodies using techniques known in the art.
- tissues are dissociated using dissociation enzymes according to the manufacturer's instructions to examine the profiles of the cellular infiltrates.
- Cells are stained for analysis by flow cytometry using techniques known in the art.
- Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103.
- markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80).
- serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1.
- Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ synovium-infiltrated immune cells obtained ex vivo.
- immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- mice may be rechallenged with a disease trigger (e.g. activated re-injection with CIA-inducing peptides). Mice will be analyzed for susceptibility to disease and CIA severity following rechallenge.
- a disease trigger e.g. activated re-injection with CIA-inducing peptides.
- Example 5 Lactococcus lactis Cremoris Strain a and/or EVs Derived from Lactococcus lactis Cremoris Strain a in a Mouse Model of Type 1 Diabetes (T1D)
- Type 1 diabetes is an autoimmune disease in which the immune system targets the islets of Langerhans of the pancreas, thereby destroying the body's ability to produce insulin.
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in a mouse model of T1D, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory treatments.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of induction or following induction, or prior to the onset (or upon the onset) of spontaneously-occurring T1D.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals.
- mice are intravenously injected with Lactococcus lactis cremoris strain A at a dose of between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells per mouse.
- Other mice may receive 25, 50, or 100 mg of Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A per mouse.
- While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v.
- mice may receive Lactococcus lactis cremoris strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration.
- Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day, while others may receive Lactococcus lactis cremoris strain A at alternative intervals (e.g. every other day, or once every three days).
- Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A.
- the bacterial cells may be live, dead, or weakened.
- the bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration.
- bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration.
- mice may be treated with additional treatments and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- an appropriate control e.g. vehicle or control antibody
- mice are treated with antibiotics prior to treatment.
- antibiotics for example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment.
- Some immunized mice are treated without receiving antibiotics.
- Blood glucose is monitored biweekly prior to the start of the experiment. At various time points thereafter, nonfasting blood glucose is measured. At various time points, mice are sacrificed and site the pancreas, lymph nodes, or other tissues may be removed for ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art. For example, tissues are dissociated using dissociation enzymes according to the manufacturer's instructions. Cells are stained for analysis by flow cytometry using techniques known in the art. Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103.
- markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80).
- serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1.
- Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified tissue-infiltrating immune cells obtained ex vivo.
- immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression. Antibody production may also be assessed by ELISA.
- mice may be rechallenged with a disease trigger, or assessed for susceptibility to relapse. Mice will be analyzed for susceptibility to diabetes onset and severity following rechallenge (or spontaneously-occurring relapse).
- Example 6 Lactococcus lactis Cremoris Strain A and/or EVs Derived from Lactococcus lactis Cremoris Strain A in a Mouse Model of Primary Sclerosing Cholangitis (PSC)
- PSC Primary Sclerosing Cholangitis
- PSC Primary Sclerosing Cholangitis
- IBD inflammatory bowel disease
- PSC primary sclerosing cholangitis
- DDC 3,5-diethoxycarbonyl-1,4-dihydrocollidine
- bile duct ligation is performed as described by Georgiev et al. (Characterization of time-related changes after experimental bile duct ligation. Br J Surg. 2008. 95(5): 646-56), or disease is induced by DCC exposure as described by Fickert et al. (A new xenobiotic-induced mouse model of sclerosing cholangitis and biliary fibrosis. Am J Path. Vol 171(2): 525-536.
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in a mouse model of PSC, either alone or in combination with whole bacterial cells, with or without the addition of some other therapeutic agent.
- mice 6-8 week old C57bl/6 mice are obtained from Taconic or other vendor. Mice are fed a 0.1% DCC-supplemented diet for various durations. Some groups will receive DCC-supplement food for 1 week, others for 4 weeks, others for 8 weeks. Some groups of mice may receive a DCC-supplemented diet for a length of time and then be allowed to recover, thereafter receiving a normal diet. These mice may be studied for their ability to recover from disease and/or their susceptibility to relapse upon subsequent exposure to DCC.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A Treatment with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of DCC-feeding or subsequent to initial exposure to DCC.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered on day 1, or they may be administered sometime thereafter.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals.
- mice are intravenously injected with Lactococcus lactis cremoris strain A at a range between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells per mouse.
- Other mice may receive 25, 50, 100 mg of Lactococcus lactis cremoris strain A per mouse.
- While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A through i.p. injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration.
- mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A. The bacterial cells may be live, dead, or weakened.
- the bacterial cells may be harvested fresh (or frozen), and administered, or they may be irradiated or heat-killed prior to administration.
- some groups of mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration.
- bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration.
- Some groups of mice may be treated with additional agents and/or an appropriate control (e.g. vehicle or antibody) at various time points and at effective doses.
- mice are treated with antibiotics prior to treatment.
- antibiotics for example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment.
- Some immunized mice are treated without receiving antibiotics.
- serum samples are analyzed for ALT, AP, bilirubin, and serum bile acid (BA) levels.
- mice are sacrificed, body and liver weight are recorded, and sites of inflammation (e.g. liver, small and large intestine, spleen), lymph nodes, or other tissues may be removed for ex vivo histolomorphological characterization, cytokine and/or flow cytometric analysis using methods known in the art (see Fickert et al. Characterization of animal models for primary sclerosing cholangitis (PSC)). J Hepatol. 2014. 60(6): 1290-1303). For example, bile ducts are stained for expression of ICAM-1, VCAM-1, MadCAM-1. Some tissues are stained for histological examination, while others are dissociated using dissociation enzymes according to the manufacturer's instructions.
- sites of inflammation e.g. liver, small and large intestine, spleen
- lymph nodes e.g. liver, small and large intestine, spleen
- Other tissues may be removed for ex vivo histolomorphological characterization, cytokine and/or
- Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103.
- markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80), as well as adhesion molecule expression (ICAM-1, VCAM-1, MadCAM-1).
- T cell markers CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4
- macrophage/myeloid markers CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80
- IAM-1 adhesion molecule expression
- VCAM-1 MadCAM-1
- serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1.
- Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ bile duct-infiltrated immune cells obtained ex vivo.
- Liver tissue is prepared for histological analysis, for example, using Sirius-red staining followed by quantification of the fibrotic area.
- blood is collected for plasma analysis of liver enzymes, for example, AST or ALT, and to determine Bilirubin levels.
- the hepatic content of Hydroxyproline can be measured using established protocols.
- Hepatic gene expression analysis of inflammation and fibrosis markers may be performed by qRT-PCR using validated primers. These markers may include, but are not limited to, MCP-1, alpha-SMA, Coll1a1, and TIMP. Metabolite measurements may be performed in plasma, tissue and fecal samples using established metabolomics methods.
- immunohistochemistry is carried out on liver sections to measure neutrophils, T cells, macrophages, dendritic cells, or other immune cell infiltrates.
- mice In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be rechallenged with DCC at a later time. Mice will be analyzed for susceptibility to cholangitis and cholangitis severity following rechallenge.
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in BDL-induced cholangitis.
- 6-8 week old C57Bl/6J mice are obtained from Taconic or other vendor. After an acclimation period the mice are subjected to a surgical procedure to perform a bile duct ligation (BDL). Some control animals receive a sham surgery. The BDL procedure leads to liver injury, inflammation and fibrosis within 7-21 days.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A Treatment with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of surgery or some time following the surgery. Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals. For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at a range between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells per mouse. Other mice may receive 25, 50, or 100 mg of Lactococcus lactis cremoris strain A per mouse.
- mice While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.p. injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration. Some mice receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g.
- mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A.
- the bacterial cells may be live, dead, or weakened. They bacterial cells may be harvested fresh (or frozen), and administered, or they may be irradiated or heat-killed prior to administration.
- some groups of mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration.
- bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration.
- Some groups of mice may be treated with additional agents and/or an appropriate control (e.g. vehicle or antibody) at various time points and at effective doses.
- mice are treated with antibiotics prior to treatment.
- antibiotics for example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment.
- Some immunized mice are treated without receiving antibiotics.
- serum samples are analyzed for ALT, AP, bilirubin, and serum bile acid (BA) levels.
- mice are sacrificed, body and liver weight are recorded, and sites of inflammation (e.g. liver, small and large intestine, spleen), lymph nodes, or other tissues may be removed for ex vivo histolomorphological characterization, cytokine and/or flow cytometric analysis using methods known in the art (see Fickert et al. Characterization of animal models for primary sclerosing cholangitis (PSC)). J Hepatol. 2014. 60(6): 1290-1303). For example, bile ducts are stained for expression of ICAM-1, VCAM-1, MadCAM-1. Some tissues are stained for histological examination, while others are dissociated using dissociation enzymes according to the manufacturer's instructions.
- sites of inflammation e.g. liver, small and large intestine, spleen
- lymph nodes e.g. liver, small and large intestine, spleen
- Other tissues may be removed for ex vivo histolomorphological characterization, cytokine and/or
- Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103.
- markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80), as well as adhesion molecule expression (ICAM-1, VCAM-1, MadCAM-1).
- T cell markers CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4
- macrophage/myeloid markers CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80
- IAM-1 adhesion molecule expression
- VCAM-1 MadCAM-1
- serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1.
- Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ bile duct-infiltrated immune cells obtained ex vivo.
- Liver tissue is prepared for histological analysis, for example, using Sirius-red staining followed by quantification of the fibrotic area.
- blood is collected for plasma analysis of liver enzymes, for example, AST or ALT, and to determine Bilirubin levels.
- the hepatic content of Hydroxyproline can be measured using established protocols.
- Hepatic gene expression analysis of inflammation and fibrosis markers may be performed by qRT-PCR using validated primers. These markers may include, but are not limited to, MCP-1, alpha-SMA, Coll1a1, and TIMP. Metabolite measurements may be performed in plasma, tissue and fecal samples using established metabolomics methods.
- immunohistochemistry is carried out on liver sections to measure neutrophils, T cells, macrophages, dendritic cells, or other immune cell infiltrates.
- mice In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be analyzed for recovery.
- Example 7 Lactococcus lactis Cremoris Strain A and/or EVs Derived from Lactococcus lactis Cremoris Strain A in a Mouse Model of Nonalcoholic Steatohepatitis (NASH)
- NASH Nonalcoholic Steatohepatitis
- Nonalcoholic Steatohepattiis is a severe form of Nonalcoholic Fatty Liver Disease (NAFLD), where buildup of hepatic fat (steatosis) and inflammation lead to liver injury and hepatocyte cell death (ballooning).
- NASH Nonalcoholic Steatohepattiis
- Lactococcus lactis cremoris Strain A-containing bacterial compositions are tested for their efficacy in a mouse model of NASH, either alone or in combination with whole bacterial cells, with or without the addition of another therapeutic agent.
- a mouse model of NASH either alone or in combination with whole bacterial cells, with or without the addition of another therapeutic agent.
- 8-10 week old C57Bl/6J mice, obtained from Taconic (Germantown, N.Y.), or other vendor are placed on a methionine choline deficient (MCD) diet for a period of 4-8 weeks during which NASH features will develop, including steatosis, inflammation, ballooning and fibrosis.
- MCD methionine choline deficient
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A Treatment with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either at the beginning of the diet, or at some point following diet initiation (for example, one week after).
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered starting in the same day as the initiation of the MCD diet.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals.
- mice are intravenously injected with Lactococcus lactis cremoris strain A at doses between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells per mouse.
- Other mice may receive 25, 50, or 100 mg of Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A per mouse.
- While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v.
- mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration.
- Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days).
- mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A.
- the bacterial cells may be live, dead, or weakened.
- the bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration.
- bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration.
- Some groups of mice may be treated with additional NASH therapeutic(s) (e.g., FXR agonists, PPAR agonists, CCR2/5 antagonists or other treatment) and/or appropriate control at various time points and effective doses.
- mice are sacrificed and liver, intestine, blood, feces, or other tissues may be removed for ex vivo histological, biochemical, molecular or cytokine and/or flow cytometry analysis using methods known in the art.
- liver tissues are weighed and prepared for histological analysis, which may comprise staining with H&E, Sirius Red, and determination of NASH activity score (NAS).
- NAS NASH activity score
- blood is collected for plasma analysis of liver enzymes, for example, AST or ALT, using standards assays.
- the hepatic content of cholesterol, triglycerides, or fatty acid acids can be measured using established protocols.
- Hepatic gene expression analysis of inflammation, fibrosis, steatosis, ER stress, or oxidative stress markers may be performed by qRT-PCR using validated primers. These markers may include, but are not limited to, IL-6, MCP-1, alpha-SMA, Coll1a1, CHOP, and NRF2. Metabolite measurements may be performed in plasma, tissue and fecal samples using established biochemical and mass-spectrometry-based metabolomics methods.
- Serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1.
- Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ bile duct-infiltrated immune cells obtained ex vivo.
- immunohistochemistry is carried out on liver or intestine sections to measure neutrophils, T cells, macrophages, dendritic cells, or other immune cell infiltrates.
- mice In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be analyzed for recovery.
- Example 8 Lactococcus lactis Cremoris Strain A and/or EVs Derived from Lactococcus lactis Cremoris Strain A in a Mouse Model of Psoriasis
- Psoriasis is a T-cell-mediated chronic inflammatory skin disease.
- plat-type psoriasis is the most common form of psoriasis and is typified by dry scales, red plaques, and thickening of the skin due to infiltration of immune cells into the dermis and epidermis.
- Several animal models have contributed to the understanding of this disease, as reviewed by Gudjonsson et al. (Mouse models of psoriasis. J Invest Derm. 2007. 127: 1292-1308; see also van der Fits et al. Imiquimod-induced psoriasis-like skin inflammation in mice is mediated via the IL-23/IL-17 axis. J. Immunol. 2009 May 1. 182(9): 5836-45).
- Psoriasis can be induced in a variety of mouse models, including those that use transgenic, knockout, or xenograft models, as well as topical application of imiquimod (IMQ), a TLR7/8 ligand.
- IMQ imiquimod
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in the mouse model of psoriasis, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory treatments.
- 6-8 week old C57Bl/6 or Balb/c mice are obtained from Taconic (Germantown, N.Y.), or other vendor. Mice are shaved on the back and the right ear. Groups of mice receive a daily topical dose of 62.5 mg of commercially available IMQ cream (5%) (Aldara; 3M Pharmaceuticals).
- mice are scored for erythema, scaling, and thickening on a scale from 0 to 4, as described by van der Fits et al. (2009). Mice are monitored for ear thickness using a Mitutoyo micrometer.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A Treatment with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of the first application of IMQ, or something thereafter.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered at the same time as the subcutaneous injections (day 0), or they may be administered prior to, or upon, application.
- Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals.
- mice are intravenously injected with Lactococcus lactis cremoris strain A at a dose of between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells per mouse.
- Other mice may receive 25, 50, or 100 mg of Lactococcus lactis cremoris strain A per mouse.
- While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v.
- mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through intraperitoneal (i.p.) injection, nasal route administration, oral gavage, topical administration, intradermal (i.d.) injection, subcutaneous (s.c.) injection, or other means of administration.
- Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g.
- mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A.
- the bacterial cells may be live, dead, or weakened.
- the bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- mice may receive between 1 ⁇ 10 4 and 5 ⁇ 10 9 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration.
- bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, i.d. injection, s.c. injection, topical administration, or nasal route administration.
- mice may be treated with anti-inflammatory agent(s) (e.g. anti-CD154, blockade of members of the TNF family, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- anti-inflammatory agent(s) e.g. anti-CD154, blockade of members of the TNF family, or other treatment
- an appropriate control e.g. vehicle or control antibody
- mice are treated with antibiotics prior to treatment.
- antibiotics for example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment.
- Some immunized mice are treated without receiving antibiotics.
- samples from back and ear skin are taken for cryosection staining analysis using methods known in the art.
- Other groups of mice are sacrificed and lymph nodes, spleen, mesenteric lymph nodes (MLN), the small intestine, colon, and other tissues may be removed for histology studies, ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art.
- Some tissues may be dissociated using dissociation enzymes according to the manufacturer's instructions.
- Cryosection samples, tissue samples, or cells obtained ex vivo are stained for analysis by flow cytometry using techniques known in the art.
- Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103.
- Other markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80).
- serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1.
- Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ skin-infiltrated immune cells obtained ex vivo.
- immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- mice may be studied to assess recovery, or they may be rechallenged with IMQ.
- the groups of rechallenged mice will be analyzed for susceptibility to psoriasis and severity of response.
- Example 9 A Study of the Safety, Tolerability and Efficacy of Lactococcus lactis Cremoris Strain A as an Oral Therapeutic for the Treatment of Mild to Moderate Psoriasis or Atopic Dermatitis
- the study consists of six (6) cohorts and will test doses of Lactococcus lactis cremoris strain A versus placebo.
- the initial three (3) cohorts are in healthy volunteers and will establish the safety and tolerability of Lactococcus lactis cremoris strain A. Once this has been established, the safety and tolerability in participants with psoriasis or atopic dermatitis will be tested, alongside pharmacodynamic effects on the systemic immune system and observation of any clinical effects.
- the treatment arms are described in Table 7, and optional additional cohorts may be added to include dose expansion studies.
- the study has at least three (3) outcome measures: 1) safety and tolerability; 2) clinical improvement in subjects with mild to moderate psoriasis; and 3) clinical improvement in subjects with mild to moderate atopic dermatitis.
- SAE serious adverse events
- EASI electrocardiogram
- IGA investigators' global assessment
- LSS lesion severity score
- Anti-psoriasis and anti-atopic dermatitis activities are assessed by the Investigator according to disease specific response criteria and described in terms of objective response rate, duration of response, progression-free time-periods, clinical benefit rate, and disease control rate. Investigators will look for improvement from baseline at or around day 28 of dosing using the PASI and eczema activity scoring index (EASI), both of which are known in the art.
- PASI PASI and eczema activity scoring index
- a DLT is defined as an adverse event (AE) or abnormal laboratory value that occurs within the first 7 days of treatment with Lactococcus lactis cremoris strain A, except for those that are clearly and incontrovertibly due to underlying disease, disease progression, or extraneous causes. Dose escalation decisions occur when the cohort of patients has met these criteria.
- AE adverse event
- Lactococcus lactis cremoris strain A Lactococcus lactis cremoris strain A
- the available toxicity information i.e., all AEs and all laboratory abnormalities regardless of DLT assessment
- the available toxicity information is evaluated by the enrolling Investigators and Sponsor medical monitor at a dose decision meeting or teleconference. Decisions are based on an evaluation of all relevant data available from all dose cohorts evaluated in the ongoing study. Drug administration at the next higher dose cohort may not proceed until the Investigator receives written confirmation from Sponsor indicating that the results of the previous dose cohort were evaluated and that it is permissible to proceed to the next higher dose cohort.
- Intra-patient dose escalations are permitted for all cohorts after the intended dose level has been shown to be safe (i.e., all patients treated at the intended dose level completed DLT assessments and ⁇ 1 patient experienced a DLT).
- L. lactis cremoris Strains that lacked certain plasmids was evaluated. Knockout strains were created using electroporation techniques known in the art. Briefly, electrocompetent cells were prepared by growing strain overnight in M17 media (5 g Pancreatic digest of casein, 5 g soy peptone, 5 g beef extract, 2.5 g yeast extract, 0.5 g ascorbic acid, 0.25 g MgSO4, 19 g Disodium- ⁇ -glycerophosphate per L) that included 1% glucose. 2 mL of overnight culture was inoculated with 50 mL of M17 media and allowed to grow to an optical density at 600 nm of 0.5-0.7 (about 5-7 hrs).
- M17 media 5 g Pancreatic digest of casein, 5 g soy peptone, 5 g beef extract, 2.5 g yeast extract, 0.5 g ascorbic acid, 0.25 g MgSO4, 19 g Disodium- ⁇ -glycerophosphate per L
- the culture was then cooled on ice for 10 min. Cells were spun down for 15 min at 3000 g and resuspended in electroporation buffer (0.5M Sucrose+10% glycerol) which was repeated 2 more times. Cells were then resuspended in 500 ⁇ L of electroporation buffer and separated into 100 ⁇ L aliquots and stored at ⁇ 80° C. until electroporation.
- electroporation buffer 0.5M Sucrose+10% glycerol
- Electroporation proceeded by defrosting cells on ice prior to transfer to an electroporation cuvette. Cell were then electroporated at 1.2 kV for in Lactococcus lactis cremoris Strain A and 2.5 kV for in Lactococcus lactis cremoris Strain B. 900 ⁇ L of recovery solution (M17+0.5M(0.17 g)Sucrose+0.5%(15 ⁇ l)Glucose+20 mM(10 ⁇ l)MgCl2+0.2 mM(10 ⁇ l)CaCl2 per mL) was then immediately added. The cells were then kept on ice for 10 min. Electroporated cells were subcultuted 1:10 in M17 media and incubated for 20 min at 30° C. before diluting and plating. Cells were then screened for plasmid loss by PCR.
- Lactococcus lactis cremoris Strains A and B were evaluated in the mouse model of DTH.
- mice were injected with KLH and CFA i.d at 4 locations along the back (50 ug per mouse of KLH prepared in a 1:1 ratio with CFA in a total volume of 50 ul per site).
- mice were dosed for 9 days with 1 ⁇ 10 ⁇ circumflex over ( ) ⁇ 9 viable cells per day as follows: 1) anaerobic PBS (vehicle); 2) Lactococcus lactis cremoris Strain A; 3) Lactococcus lactis cremoris Strain A minus a 13 kb plasmid; 4) Lactococcus lactis cremoris Strain B; 5) Lactococcus lactis cremoris Strains B minus a 30 kb plasmid; and 6) Dexamethasone (positive control).
- strains were then sequenced to determine the genes within the 13 kb plasmid from) Lactococcus lactis cremoris Strain A and the 30 kb plasmid from Lactococcus lactis cremoris Strain B. See Table 5 and Table 6.
- Enriched media is used to grow and prepare the bacterium for in vitro and in vivo use.
- media may contain sugar, yeast extracts, plant based peptones, buffers, salts, trace elements, surfactants, anti-foaming agents, and vitamins.
- Composition of complex components such as yeast extracts and peptones may be undefined or partially defined (including approximate concentrations of amino acids, sugars etc.).
- Microbial metabolism may be dependent on the availability of resources such as carbon and nitrogen. Various sugars or other carbon sources may be tested.
- media may be prepared and the selected bacterium grown as shown by Saarela et al., J. Applied Microbiology. 2005. 99: 1330-1339, which is hereby incorporated by reference. Influence of fermentation time, cryoprotectant and neutralization of cell concentrate on freeze-drying survival, storage stability, and acid and bile exposure of the selected bacterium produced without milk-based ingredients.
- the media is sterilized.
- Sterilization may be by Ultra High Temperature (UHT) processing.
- UHT processing is performed at very high temperature for short periods of time.
- the UHT range may be from 135-180° C.
- the medium may be sterilized from between 10 to 30 seconds at 135° C.
- Inoculum can be prepared in flasks or in smaller bioreactors and growth is monitored.
- the inoculum size may be between approximately 0.5 and 3% of the total bioreactor volume.
- bioreactor volume can be at least 2 L, 10 L, 80 L, 100 L, 250 L, 1000 L, 2500 L, 5000 L, 10,000 L.
- the bioreactor Before the inoculation, the bioreactor is prepared with medium at desired pH, temperature, and oxygen concentration.
- the initial pH of the culture medium may be different that the process set-point. pH stress may be detrimental at low cell centration; the initial pH could be between pH 7.5 and the process set-point. For example, pH may be set between 4.5 and 8.0.
- the pH can be controlled through the use of sodium hydroxide, potassium hydroxide, or ammonium hydroxide.
- the temperature may be controlled from 25° C. to 45° C., for example at 37° C. Anaerobic conditions are created by reducing the level of oxygen in the culture broth from around 8 mg/L to 0 mg/L.
- nitrogen or gas mixtures may be used in order to establish anaerobic conditions.
- no gases are used and anaerobic conditions are established by cells consuming remaining oxygen from the medium.
- the bioreactor fermentation time can vary. For example, fermentation time can vary from approximately 5 hours to 48 hours.
- Reviving microbes from a frozen state may require special considerations.
- Production medium may stress cells after a thaw; a specific thaw medium may be required to consistently start a seed train from thawed material.
- the kinetics of transfer or passage of seed material to fresh medium may be influenced by the current state of the microbes (ex. exponential growth, stationary growth, unstressed, stressed).
- Inoculation of the production fermenter(s) can impact growth kinetics and cellular activity.
- the initial state of the bioreactor system must be optimized to facilitate successful and consistent production.
- the fraction of seed culture to total medium (e.g. a percentage) has a dramatic impact on growth kinetics.
- the range may be 1-5% of the fermenter's working volume.
- the initial pH of the culture medium may be different from the process set-point. pH stress may be detrimental at low cell concentration; the initial pH may be between pH 7.5 and the process set-point. Agitation and gas flow into the system during inoculation may be different from the process set-points. Physical and chemical stresses due to both conditions may be detrimental at low cell concentration.
- Process conditions and control settings may influence the kinetics of microbial growth and cellular activity. Shifts in process conditions may change membrane composition, production of metabolites, growth rate, cellular stress, etc.
- Optimal temperature range for growth may vary with strain. The range may be 20-40° C.
- Optimal pH for cell growth and performance of downstream activity may vary with strain. The range may be pH 5-8. Gasses dissolved in the medium may be used by cells for metabolism. Adjusting concentrations of O 2 , CO 2 , and N 2 throughout the process may be required. Availability of nutrients may shift cellular growth. Microbes may have alternate kinetics when excess nutrients are available.
- microbes may be preconditioned shortly before harvest to better prepare them for the physical and chemical stresses involved in separation and downstream processing.
- a change in temperature (often reducing to 20-5° C.) may reduce cellular metabolism, slowing growth (and/or death) and physiological change when removed from the fermenter.
- Effectiveness of centrifugal concentration may be influenced by culture pH. Raising pH by 1-2 points can improve effectiveness of concentration but can also be detrimental to cells.
- Microbes may be stressed shortly before harvest by increasing the concentration of salts and/or sugars in the medium. Cells stressed in this way may better survive freezing and lyophilization during downstream.
- Separation methods and technology may impact how efficiently microbes are separated from the culture medium.
- Solids may be removed using centrifugation techniques. Effectiveness of centrifugal concentration can be influenced by culture pH or by the use of flocculating agents. Raising pH by 1-2 points may improve effectiveness of concentration but can also be detrimental to cells.
- Microbes may be stressed shortly before harvest by increasing the concentration of salts and/or sugars in the medium. Cells stressed in this way may better survive freezing and lyophilization during downstream. Additionally, Microbes may also be separated via filtration. Filtration is superior to centrifugation techniques for purification if the cells require excessive g-minutes to successfully centrifuge. Excipients can be added before after separation.
- Excipients can be added for cryo protection or for protection during lyophilization.
- Excipients can include, but are not limited to, sucrose, trehalose, or lactose, and these may be alternatively mixed with buffer and anti-oxidants.
- droplets of cell pellets mixed with excipients are submerged in liquid nitrogen.
- Harvesting can be performed by continuous centrifugation.
- Product may be resuspended with various excipients to a desired final concentration.
- Excipients can be added for cryo protection or for protection during lyophilization.
- Excipients can include, but are not limited to, sucrose, trehalose, or lactose, and these may be alternatively mixed with buffer and anti-oxidants.
- droplets of cell pellets mixed with excipients are submerged in liquid nitrogen.
- Lyophilization of material begins with primary drying.
- the ice is removed.
- a vacuum is generated and an appropriate amount of heat is supplied to the material for the ice to sublime.
- product bound water molecules are removed.
- the temperature is raised higher than in the primary drying phase to break any physico-chemical interactions that have formed between the water molecules and the product material.
- the pressure may also be lowered further to enhance desorption during this stage.
- the chamber may be filled with an inert gas, such as nitrogen.
- the product may be sealed within the freeze dryer under dry conditions, preventing exposure to atmospheric water and contaminants.
- mice were purchased from Jackson Labs and allowed to acclimate in the vivarium for 1 week prior to start of experiment.
- Mice are housed 5 animals per cage, in individually ventilated cages with standard bedding and enrichment.
- Standard Purina rodent diet (5001) and autoclaved water is provided ad libitum and checked daily. Ventilated cages are changed once weekly.
- Animal housing rooms undergoes a lighting cycle consisting of 12 hours on and 12 hours off.
- Floors, walls, and ceilings are sanitized once a month and rooms maintain a humidity range between 30%-70%, and a temperature range between 68-79 degrees Fahrenheit. Animal health checks are done twice daily.
- mice On day 0, mice were anesthetized with isoflurane (one at a time) and their back was shaved. Mice were injected subcutaneously at 4 sites on the back with 50 ⁇ l of Ovalbumin in CFA emulsion (Hooke Labs catalog #EK-0301).
- a dexamethasone stock solution (17 mg/ml) was created by resuspending 6.8 mg of dexamethasone in 400 ⁇ l of 96% ethanol.
- a working solution is prepared by diluting the stock solution 100 ⁇ in sterile PBS to obtain a final concentration of 0.17 mg/mL in a septum vial for intraperitoneal dosing.
- Dexamethasone-treated mice received 100 ⁇ L Dexamethasone i.p. (5 mL/kg of a 0.17 mg/mL solution). Frozen sucrose served as the negative control (vehicle).
- Lactococcus lactis cremoris Strain A was dosed at 100 ul of bacterial cells at 1 ⁇ 10 ⁇ circumflex over ( ) ⁇ 10 CFU/ml daily.
- Dexamethasone positive control
- vehicle negative control
- Lactococcus lactis cremoris Strain A were dosed daily.
- mice On days 1-9 mice were orally gavaged (groups 1 and 3) or injected intraperitoneally (i.p. group 2).
- Lactococcus lactis cremoris Strain A reduces expression of IL-12p70 ( FIG. 6A ), IL-22 ( FIG. 6B ), and KC ( FIG. 6C ) in an Adoptive Transfer Delayed-Type Hypersensitivity (AdDTH) Mouse Model. Circle represents vehicle, square represents dexamethasone, and triangle represents Lactococcus lactis cremoris Strain A.
- Imiquimod driven psoriasis model is a Th17 driven skin inflammation model. Mice develop flakiness of the skin and erythema which mimics some of the pathology associated with human psoriasis that is scored on a scale of 0-4. Additionally, an ear inflammation may be assessed similar to the DTH.
- mice were purchased from Taconic Labs and allowed to acclimate in the vivarium for 1 week prior to start of experiment. Mice are housed 5 animals per cage, in individually ventilated cages with standard bedding and enrichment. Standard Purina rodent diet (5001) and autoclaved water is provided ad libitum and checked daily. Ventilated cages are changed once weekly. Animal housing rooms undergoes a lighting cycle consisting of 12 hours on and 12 hours off. Floors, walls, and ceilings are sanitized once a month and rooms maintain a humidity range between 30%-70%, and a temperature range between 68-79 degrees Fahrenheit. Animal health checks are done twice daily.
- Standard Purina rodent diet 5001
- autoclaved water is provided ad libitum and checked daily. Ventilated cages are changed once weekly. Animal housing rooms undergoes a lighting cycle consisting of 12 hours on and 12 hours off.
- Floors, walls, and ceilings are sanitized once a month and rooms maintain
- a dexamethasone stock solution (17 mg/ml) was created by resuspending 6.8 mg of dexamethasone in 400 ⁇ l of 96% ethanol.
- a working solution is prepared by diluting the stock solution 100 ⁇ in sterile PBS to obtain a final concentration of 0.17 mg/mL in a septum vial for intraperitoneal dosing.
- Dexamethasone-treated mice received 100 ⁇ L Dexamethasone i.p. (5 mL/kg of a 0.17 mg/mL solution). Frozen sucrose served as the negative control (vehicle).
- Lactococcus lactis cremoris Strain A was dosed at 100 ul of bacterial cells at 1 ⁇ 10 ⁇ circumflex over ( ) ⁇ 10 CFU/ml p.o. daily.
- Dexamethasone positive control
- vehicle negative control
- Lactococcus lactis cremoris Strain A were dosed daily.
- mice On Day 0, the backs of mice were shaved and the depilated with Nair ( ⁇ 25 sec). The Nair is then wiped off and backs of mice washed with warm water (2 ⁇ ).
Abstract
Description
- This application is a divisional application of U.S. application Ser. No. 16/192,172, filed Nov. 15, 2018, which claims the benefit of priority to U.S. Provisional Patent Applications having Ser. No. 62/586,604, filed Nov. 15, 2017, 62/660,693, filed Apr. 20, 2018, 62/661,459, filed Apr. 23, 2018, and 62/721,941 filed Aug. 23, 2018, the contents of each of which are hereby incorporated herein by reference in their entirety.
- The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Apr. 2, 2019, is named ETB-01701_SL.txt and is 482,487 bytes in size.
- In certain aspects, provided herein are methods and compositions (e.g., bacterial compositions, pharmaceutical compositions) related to the treatment and/or prevention of disease (e.g., cancer, autoimmune disease, inflammatory disease, metabolic disease), in a subject (e.g., a human subject) comprising administering a bacterial composition comprising Lactococcus bacteria and/or a product of such bacteria (e.g., extracellular vesicles (EVs) and/or pharmaceutically active biomasses (PhABs)). In certain aspects, provided herein are methods and compositions related to the treatment and/or prevention of an immune disorder in a subject (e.g., a human subject) comprising administering a bacterial (pharmaceutical) composition comprising immune modulating Lactococcus bacteria disclosed herein and/or a product of immune modulating Lactococcus bacteria disclosed herein (e.g., extracellular vesicles (EVs) and/or pharmaceutically active biomasses (PhABs)). Also provided herein are methods of making and/or identifying such a bacterium and/or bacterial product. In some embodiments, provided here are bioreactors comprising Lactococcus bacteria disclosed herein.
- In certain embodiments, provided herein are immune modulating Lactococcus bacteria. In some embodiments the immune modulating Lactococcus bacteria is an immune modulating strain of Lactococcus lactis cremoris. In certain embodiments the immune modulating Lactococcus strain is Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368). In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) comprising a protein listed in Table 1 and/or a gene encoding a protein listed in Table 1. In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) comprising a membrane associated protein listed in Table 2 and/or a gene encoding a membrane associated protein listed in Table 2. In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of a protein listed in Table 3 and/or a gene encoding a protein listed in Table 3. In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of an exopolysaccharide (EPS) synthesis protein listed in Table 4 and/or a gene encoding an EPS synthesis protein listed in Table 4. In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of an EPS synthesized in whole or in part by a protein listed in Table 4. In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of EPS. In some embodiments, the bacterial compositions provided herein comprise an immune modulating Lactococcus strain provided herein. In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of a protein listed in Table 5 and/or a gene encoding a protein listed in Table 5. In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) comprising a protein listed in Table 6 and/or a gene encoding a protein listed in Table 6.
- In some embodiments, provided herein are PhABs made from and/or comprising an immune modulating Lactococcus strain provided herein. In some embodiments, the PhABs comprise whole cells, fractions of cells, supernatant from fermentation, fractions of supernatant and/or extracellular vesicles made immune modulating bacteria described herein. In some embodiments, the bacterial compositions provided herein comprise an immune modulating Lactococcus strain PhAB provided herein.
- In some embodiments, provided herein are EVs produced by and/or generated from and/or isolated from an immune modulating Lactococcus strain provided herein. In some embodiments, the bacterial compositions comprise both immune modulating Lactococcus strain EVs and whole immune modulating Lactococcus strain bacteria (e.g., live bacteria, killed bacteria, attenuated bacteria). In certain embodiments, provided herein are bacterial compositions comprising immune modulating Lactococcus strain bacteria (e.g., Lactococcus lactis cremoris Strain A) in the absence of immune modulating Lactococcus strain EVs. In some embodiments, the pharmaceutical compositions comprise immune modulating Lactococcus strain EVs in the absence of immune modulating Lactococcus strain bacteria.
- In some embodiments, the immune modulating Lactococcus strain comprises at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the nucleotide sequence (e.g., genomic sequence, 16S sequence, CRISPR sequence) of the Lactococcus lactis cremoris Strain A. In some embodiments, the administration of the bacterial composition treats the immune disorder in the subject. In some embodiments, the immune disorder is an autoimmune disease. In some embodiments, the immune disorder is an inflammatory disease. In some embodiments, the immune disorder is an allergy.
- In certain embodiments, provided herein are methods of treating a subject who has an immune disorder (e.g., an autoimmune disease, an inflammatory disease, an allergy), comprising administering to the subject a bacterial composition comprising immune modulating Lactococcus strain bacteria provided herein (e.g., a killed bacterium, a live bacterium, a pharmaceutically active biomass and/or an attenuated bacterium). In some embodiments, immune modulating Lactococcus strain is Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368). In some embodiments, immune modulating Lactococcus strain is a strain comprising at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity (e.g., genomic sequence identity, 16S sequence identity, CRISPR sequence identity) (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the corresponding nucleotide sequence of the Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368). In some embodiments, at least 50%, 60%, 70%, 80%, 85%, 90%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the bacteria in the bacterial composition are the immune modulating Lactococcus strain. In some embodiments, all or substantially all of the bacteria in the bacterial formulation are the immune modulating Lactococcus strain. In some embodiments, the bacterial formulation comprises at least 1×105, 5×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108 or 1×109 colony forming units of the immune modulating Lactococcus strain. In some embodiments, the bacterial composition comprises EVs and/or PhABs (e.g., whole cells, fractions of cells, supernatant from fermentation, fractions of supernatant and/or extracellular vesicles) made from the immune modulating Lactococcus strain.
- In certain embodiments, provided herein are bacterial compositions comprising an immune modulating Lactococcus strain provided herein (e.g., a killed bacterium, a live bacterium, a pharmaceutically active biomass and/or an attenuated bacterium). In some embodiments, immune modulating Lactococcus strain is Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368). In some embodiments, immune modulating Lactococcus strain is a strain comprising at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity (e.g., genomic sequence identity, 16S sequence identity, CRISPR sequence identity) (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the corresponding nucleotide sequence of the Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368). In some embodiments, at least 50%, 60%, 70%, 80%, 85%, 90%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the bacteria in the bacterial composition are the immune modulating Lactococcus strain. In some embodiments, all or substantially all of the bacteria in the bacterial formulation are the immune modulating Lactococcus strain. In some embodiments, the bacterial formulation comprises at least 1×105, 5×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108 or 1×109 colony forming units of the immune modulating Lactococcus strain. In some embodiments, the bacterial composition comprises EVs and/or PhABs (e.g., whole cells, fractions of cells, supernatant from fermentation, fractions of supernatant and/or extracellular vesicles) made from the immune modulating Lactococcus strain.
- In certain embodiments, the bacterial compositions provided herein comprise a specific ratio of immune modulating Lactococcus strain bacteria to immune modulating Lactococcus strain EV particles. For example, in some embodiments, the bacterial composition comprises at least 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain EV particles. In some embodiments, the bacterial composition comprises about 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain EV particles. In some embodiments, the bacterial composition comprises no more than 1 Lactococcus lactis cremoris bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain EV particles. In some embodiments, the bacterial composition comprises at least 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain bacteria. In some embodiments, the bacterial composition comprises about 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain bacteria. In some embodiments, the bacterial composition comprises no more than 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain bacteria.
- In some embodiments, the bacterial composition is administered orally, intravenously, intratumorally, or subcutaneously. In some embodiments, the bacterial composition is administered in 2 or more (e.g., 3 or more, 4 or more or 5 or more doses). In some embodiments, the administration to the subject of the two or more doses are separated by at least 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days or 21 days. In some embodiments, a second bacterium is administered as part of an ecological consortium.
- In some embodiments, the subject has mild to moderate atopic dermatitis. In some embodiments, the subject has mild atopic dermatitis. In some embodiments, the subject has moderate atopic dermatitis.
- In some embodiments, the subject has mild to moderate psoriasis. In some embodiments, the subject has mild psoriasis. In some embodiments the subject has moderate psoriasis.
- In some embodiments, the subject is administered a daily dose of between about 66 mg and about 3.3 g of an immune modulating Lactococcus strain provided herein (e.g., Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368) or a strain comprising at least 99% sequence identity (e.g., genomic sequence identity, 16S sequence identity, CRISPR sequence identity) (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the nucleotide sequence of the Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368)). In some embodiments, the subject is administered a daily dose of about 66 mg of an immune modulating Lactococcus strain provided herein. In some embodiments, the subject is administered a daily dose of about 660 mg of an immune modulating Lactococcus strain provided herein. In some embodiments, the subject is administered a daily dose of about 3.3 g of an immune modulating Lactococcus strain provided herein. In some embodiments, the daily dose is formulated in a capsule. In some embodiments, the subject is administered the dose of an immune modulating Lactococcus strain provided herein for at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days.
- In some embodiments, the subject has a body mass index of 18 kg/m2 to 35 kg/m2. In some embodiments, the subject has a confirmed diagnosis of mild to moderate plaque-type psoriasis for at least 6 months involving ≤5% of body surface area (BSA) (excluding the scalp). In some embodiments, the subject ha a minimum of 2 psoriatic lesions. In some embodiments, the subject has mild to moderate atopic dermatitis with a minimum of 3 to a maximum of 15% BSA involvement. In some embodiments, the subject has had a confirmed diagnosis of mild to moderate atopic dermatitis for at least 6 months with an IGA score of 2 or 3. In some embodiments, the subject has at least 2 atopic dermatitis lesions.
- In some embodiments, the subject is not pregnant. In some embodiments, the subject is not breastfeeding. In some embodiments, the subject is not being treated with an anti-inflammatory drug. In some embodiments, the subject does not have an active infection (e.g., sepsis, pneumonia, abscess). In some embodiments, the subject does not have renal or liver impairment (e.g., for women a serum creatinine level ≥125 μmol/L, for men a serum creatinine level of ≥125 μmol/L, an alanine aminotransferase (ALT) and aspartate aminotransferase (AST) ≥1.5× or 2× the upper limit of normal (ULN), alkaline phosphatase (ALP) and/or bilirubin >1.5×ULN.
- In certain embodiments, the bacterial composition suppresses the immune response in delayed-type hypersensitivity (DTH). In certain embodiments, the bacterial composition induces a regulatory T cell or an anti-inflammatory response. In certain embodiments, the bacterial composition inhibits antigen-specific responses. In certain embodiments, the bacterial composition treats allergic contact dermatitis. In certain embodiments, the bacterial composition treats autoimmune myocarditis. In certain embodiments, the bacterial composition treats
diabetes mellitus type 1. In certain embodiments, the bacterial composition treats granulomas. In certain embodiments, the bacterial composition treats peripheral neuropathies. In certain embodiments, the bacterial composition treats Hashimoto's thyroiditis. In certain embodiments, the bacterial composition treats multiple sclerosis. In certain embodiments, the bacterial composition treats rheumatoid arthritis. - In certain embodiments, the bacterial composition treats inflammation of the colon. In certain embodiments, the bacterial composition treats colitis. Colitis may be acute and self-limited or long-term. In certain embodiments, the bacterial composition treats ulcerative colitis. In certain embodiments, the bacterial composition treats digestive diseases. In certain embodiments, the bacterial composition treats Crohn's disease. In certain embodiments, the bacterial composition treats inflammatory bowel disease (IBD). In certain embodiments, the bacterial composition treats microscopic colitis. In certain embodiments, the bacterial composition treats collagenous colitis. In certain embodiments, the bacterial composition treats diversion colitis. In certain embodiments, the bacterial composition treats chemical colitis. In certain embodiments, the bacterial composition treats ischemic colitis. In certain embodiments, the bacterial composition treats indeterminate colitis. In certain embodiments, the bacterial composition treats atypical colitis. In some embodiments, the method further comprises administering to the subject an additional therapeutic (e.g., an antibiotic an immune suppressant, an anti-inflammatory agent). In some embodiments, the method further comprises administering to the subject is a second therapeutic bacterium.
- In some embodiments, the subject is a mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal (e.g., a dog, a cat, a cow, a horse, a pig, a donkey, a goat, a camel, a mouse, a rat, a guinea pig, a sheep, a llama, a monkey, a gorilla or a chimpanzee).
-
FIG. 1 shows the efficacy of orally administered Lactococcus lactis cremoris Strain A in reducing antigen-specific ear swelling (ear thickness) compared to vehicle (negative control), anti-inflammatory Dexamethasone (positive control), and Bacteria A, B, and C in a delayed type hypersensitivity mouse model. -
FIG. 2 is a line graphing showing percent weight change in acute DSS-induced colitis model over a 12 day period for Lactococcus lactis cremoris Strain A in comparison to Bacteria A, B, and C, positive control (anti-p40), and negative control (Sucrose vehicle). The Lactococcus lactis cremoris Strain A group showed less weight change than the anti-p40 antibody (positive control). -
FIG. 3A andFIG. 3B are plots showing that orally administered Lactococcus lactis cremoris Strain A reduces antigen-specific ear swelling (ear thickness) compared to vehicle (negative control) and Dexamethasone (FIG. 3A ) and Fingolimod (FIG. 3B ). -
FIG. 4 is a plot showing the efficacy of Lactococcus lactis cremoris Strain A (with and without a 13 kb plasmid) and Lactococcus lactis cremoris Strain B (with and without a 30 kb plasmid) in reducing antigen-specific ear swelling (ear thickness) compared to vehicle and Dexamethasone in a KLH-based delayed type hypersensitivity mouse model. Lactococcus lactis cremoris Strain A without a 13 kb plasmid has reduced efficacy compared Lactococcus lactis cremoris Strain A with a 13 kb plasmid. Conversely, removal of a 30 kb plasmid from L. lactis cremoris Strain B enhances efficacy compared to L. lactis cremoris Strain B with the 30 kb plasmid. -
FIG. 5 shows the efficacy of Lactococcus lactis cremoris Strain A in reducing antigen-specific ear swelling (ear thickness) compared to vehicle (negative control), and anti-inflammatory Dexamethasone (positive control) in an OVA based adoptive transfer delayed-type hypersensitivity (AdDTH) Mouse Model. -
FIGS. 6A, 6B, and 6C show the ability of Lactococcus lactis cremoris Strain A in reducing expression of IL-12p70 (FIG. 6A ), IL-22 (FIG. 6B ), and KC (FIG. 6C ) in an Adoptive Transfer Delayed-Type Hypersensitivity (AdDTH) Mouse Model. Circle represents vehicle, square represents dexamethasone, and triangle represents Lactococcus lactis cremoris Strain A. -
FIG. 7 shows the efficacy of Lactococcus lactis cremoris Strain A in improving the skin inflammation scores in an imiquimod model of psoriasis compared to control cream, vehicle, and dexamethasone. -
FIG. 8 shows the efficacy of gamma-irradiated Lactococcus lactis cremoris Strain A in reducing antigen-specific ear swelling (ear thickness) at 24 hours compared to vehicle (negative control) and anti-inflammatory Dexamethasone (positive control) in a KLH-based delayed type hypersensitivity mouse model. As shown, gamma-irradiated Lactococcus lactis cremoris Strain A retains efficacy. -
FIGS. 9A, 9B, 9C, and 9D show the ability of gamma-irradiated Lactococcus lactis cremoris Strain A to reduce expression of IL-12p′70 (FIG. 9A ), TNF (FIG. 9B ), IL-6 (FIG. 9C ), and IL-13 (FIG. 9D ) in a KLH-based delayed type hypersensitivity mouse model. Circle represents vehicle, square represents dexamethasone, and triangle represents gamma-irradiated Lactococcus lactis cremoris Strain A. Gamma-irradiated Lactococcus lactis cremoris Strain A decreases pro-inflammatory cytokine responses in leukocytes from the site-draining lymph node. Circle represents vehicle, square represents dexamethasone, and triangle represents Lactococcus lactis cremoris Strain A. -
FIGS. 10A and 10B show the ability of gamma-irradiated Lactococcus lactis cremoris Strain A to reduce the secretion of pro-inflammatory cytokines (IL-6 and TNFa) from gut-draining lymph nodes (FIG. 10A ), while gamma-irradiated Lactococcus lactis cremoris Strain A induces peripheral immune cells to secrete more IL-10 (FIG. 10B ). - In certain aspects, provided herein are methods and compositions (e.g., bacterial compositions, pharmaceutical compositions) related to the treatment and/or prevention of disease (e.g., cancer, autoimmune disease, inflammatory disease, metabolic disease), in a subject (e.g., a human subject) comprising administering a bacterial composition comprising Lactococcus bacteria and/or a product of such bacteria (e.g., extracellular vesicles (EVs) and/or pharmaceutically active biomasses (PhABs)). In certain aspects, also provided herein are methods of treating an immune disorder (e.g., an autoimmune disease, an inflammatory disease, an allergy) in a subject comprising administering to the subject a bacterial composition comprising an immune modulating Lactococcus strain provided herein, EVs generated by or isolated from an immune modulating Lactococcus strain provided herein and/or a PhAB made from or comprising an immune modulating Lactococcus strain provided herein.
- “Administration” broadly refers to a route of administration of a composition to a subject. Examples of routes of administration include oral administration, rectal administration, topical administration, inhalation (nasal) or injection. Administration by injection includes intravenous (IV), intramuscular (IM), intratumoral (IT) and subcutaneous (SC) administration. The pharmaceutical compositions described herein can be administered in any form by any effective route, including but not limited to intratumoral, oral, parenteral, enteral, intravenous, intraperitoneal, topical, transdermal (e.g., using any standard patch), intradermal, ophthalmic, (intra)nasally, local, non-oral, such as aerosol, inhalation, subcutaneous, intramuscular, buccal, sublingual, (trans)rectal, vaginal, intra-arterial, and intrathecal, transmucosal (e.g., sublingual, lingual, (trans)buccal, (trans)urethral, vaginal (e.g., trans- and perivaginally), intravesical, intrapulmonary, intraduodenal, intragastrical, and intrabronchial. In preferred embodiments, the pharmaceutical compositions described herein are administered orally, rectally, intratumorally, topically, intravesically, by injection into or adjacent to a draining lymph node, intravenously, by inhalation or aerosol, or subcutaneously.
- As used herein, the term “antibody” may refer to both an intact antibody and an antigen binding fragment thereof. Intact antibodies are glycoproteins that include at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain includes a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. Each light chain includes a light chain variable region (abbreviated herein as VL) and a light chain constant region. The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The term “antibody” includes, for example, monoclonal antibodies, polyclonal antibodies, chimeric antibodies, humanized antibodies, human antibodies, multispecific antibodies (e.g., bispecific antibodies), single-chain antibodies and antigen-binding antibody fragments.
- The terms “antigen binding fragment” and “antigen-binding portion” of an antibody, as used herein, refers to one or more fragments of an antibody that retain the ability to bind to an antigen. Examples of binding fragments encompassed within the term “antigen-binding fragment” of an antibody include Fab, Fab′, F(ab′)2, Fv, scFv, disulfide linked Fv, Fd, diabodies, single-chain antibodies, NANOBODIES®, isolated CDRH3, and other antibody fragments that retain at least a portion of the variable region of an intact antibody. These antibody fragments can be obtained using conventional recombinant and/or enzymatic techniques and can be screened for antigen binding in the same manner as intact antibodies.
- “Cellular augmentation” broadly refers to the influx of cells or expansion of cells in an environment that are not substantially present in the environment prior to administration of a composition and not present in the composition itself. Cells that augment the environment include immune cells, stromal cells, bacterial and fungal cells. Environments of particular interest are the microenvironments where cancer cells reside or locate. In some instances, the microenvironment is a tumor microenvironment or a tumor draining lymph node. In other instances, the microenvironment is a pre-cancerous tissue site or the site of local administration of a composition or a site where the composition will accumulate after remote administration.
- “Clade” refers to the OTUs or members of a phylogenetic tree that are downstream of a statistically valid node in a phylogenetic tree. The clade comprises a set of terminal leaves in the phylogenetic tree that is a distinct monophyletic evolutionary unit and that share some extent of sequence similarity. “Operational taxonomic units,” “OTU” (or plural, “OTUs”) refer to a terminal leaf in a phylogenetic tree and is defined by a nucleic acid sequence, e.g., the entire genome, or a specific genetic sequence, and all sequences that share sequence identity to this nucleic acid sequence at the level of species. In some embodiments the specific genetic sequence may be the 16S sequence or a portion of the 16S sequence. In other embodiments, the entire genomes of two entities are sequenced and compared. In another embodiment, select regions such as multilocus sequence tags (MLST), specific genes, or sets of genes may be genetically compared. In 16S embodiments, OTUs that share ≥97% average nucleotide identity across the entire 16S or some variable region of the 16S are considered the same OTU (see e.g. Claesson M J, Wang Q, O'Sullivan O, Greene-Diniz R, Cole J R. Ros R P, and O'Toole P W. 2010. Comparison of two next-generation sequencing technologies for resolving highly complex microbiota composition using tandem variable 16S rRNA gene regions. Nucleic Acids Res 38: e200. Konstantinidis K T, Ramette A, and Tiedje J M. 2006. The bacterial species definition in the genomic era. Philos Trans R Soc Lond B Biol Sci 361: 1929-1940). In embodiments involving the complete genome. MLSTs, specific genes, or sets of genes OTUs that share ≥95% average nucleotide identity are considered the same OTU (see e.g. Achtman M, and Wagner M. 2008. Microbial diversity and the genetic nature of microbial species. Nat. Rep. Microbiol. 6: 431-440. Konstantinidis K T, Ramette A, and Tiedje J M. 2006. The bacterial species definition in the genomic era. Philos Trans R Sew Lond B Biol Sci 361: 1929-1940). OTUs are frequently defined by comparing sequences between organisms. Generally, sequences with less than 95% sequence identity are not considered to form part of the same OTU. OTUs may also be characterized by any combination of nucleotide markers or genes, in particular highly conserved genes (e.g., “house-keeping” genes), or a combination thereof. Such characterization employs, e.g., WGS data or a whole genome sequence.
- A “combination” of two or more microbial strains includes the physical co-existence of the two microbial strains, either in the same material or product or in physically connected products, as well as the temporal co-administration or co-localization of the monoclonal microbial strains.
- The term “decrease” or “deplete” means a change, such that the difference is, depending on circumstances, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 1/100, 1/1000, 1/10,000, 1/100,000, 1/1,000,000 or undetectable after treatment when compared to a pre-treatment state.
- The term “ecological consortium” is a group of bacteria which trades metabolites and positively co-regulates one another, in contrast to two bacteria which induce host synergy through activating complementary host pathways for improved efficacy.
- The term “epitope” means a protein determinant capable of specific binding to an antibody. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains. Certain epitopes can be defined by a particular sequence of amino acids to which an antibody is capable of binding.
- As used herein, “engineered bacteria” are any bacteria that have been genetically altered from their natural state by human intervention and the progeny of any such bacteria. Engineered bacteria include, for example, the products of targeted genetic modification, the products of random mutagenesis screens and the products of directed evolution.
- As used herein, the term “extracellular vesicle” or “EV” or refers to a composition derived from a bacteria that comprises bacterial lipids, and bacterial proteins and/or bacterial nucleic acids and/or carbohydrate moieties contained in a nanoparticle. These EVs may contain 1, 2, 3, 4, 5, 10, or more than 10 different lipid species. EVs may contain 1, 2, 3, 4, 5, 10, or more than 10 different protein species. EVs may contain 1, 2, 3, 4, 5, 10, or more than 10 different nucleic acid species. EVs may contain 1, 2, 3, 4, 5, 10, or more than 10 different carbohydrate species.
- The term “gene” is used broadly to refer to any nucleic acid associated with a biological function. The term “gene” applies to a specific genomic sequence, as well as to a cDNA or an mRNA encoded by that genomic sequence.
- “Identity” as between nucleic acid sequences of two nucleic acid molecules can be determined as a percentage of identity using known computer algorithms such as the “FASTA” program, using for example, the default parameters as in Pearson et al. (1988) Proc. Natl. Acad. Sci. USA 85:2444 (other programs include the GCG program package (Devereux, J., et al., Nucleic Acids Research 12(I):387 (1984)), BLASTP, BLASTN, FASTA Atschul, S. F., et al., J Molec Biol 215:403 (1990); Guide to Huge Computers, Martin J. Bishop, ed., Academic Press, San Diego, 1994, and Carillo et al. (1988) SIAM J Applied Math 48:1073). For example, the BLAST function of the National Center for Biotechnology Information database can be used to determine identity. Other commercially or publicly available programs include, DNAStar “MegAlign” program (Madison, Wis.) and the University of Wisconsin Genetics Computer Group (UWG) “Gap” program (Madison Wis.)).
- As used herein, the term “immune disorder” refers to any disease, disorder or disease symptom caused by an activity of the immune system, including autoimmune diseases, inflammatory diseases and allergies. Immune disorders include, but are not limited to, autoimmune diseases (e.g., Lupus, Scleroderma, hemolytic anemia, vasculitis, type one diabetes, Grave's disease, rheumatoid arthritis, multiple sclerosis, Goodpasture's syndrome, pernicious anemia and/or myopathy), inflammatory diseases (e.g., acne vulgaris, asthma, celiac disease, chronic prostatitis, glomerulonephritis, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, rheumatoid arthritis, sarcoidosis, transplant rejection, vasculitis and/or interstitial cystitis), and/or an allergies (e.g., food allergies, drug allergies and/or environmental allergies).
- The term “increase” means a change, such that the difference is, depending on circumstances, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 2-fold, 4-fold, 10-fold, 100-fold, 10{circumflex over ( )}3 fold, 10{circumflex over ( )}4 fold, 10{circumflex over ( )}5 fold, 10{circumflex over ( )}6 fold, and/or 10{circumflex over ( )}7 fold greater after treatment when compared to a pre-treatment state. Properties that may be increased include immune cells, bacterial cells, stromal cells, myeloid derived suppressor cells, fibroblasts, metabolites, and cytokines.
- The “internal transcribed spacer” or “ITS” is a piece of non-functional RNA located between structural ribosomal RNAs (rRNA) on a common precursor transcript often used for identification of eukaryotic species in particular fungi. The rRNA of fungi that forms the core of the ribosome is transcribed as a signal gene and consists of the 8S, 5.8S and 28S regions with ITS4 and 5 between the 8S and 5.8S and 5.8S and 28S regions, respectively. These two intercistronic segments between the 18S and 5.8S and 5.8S and 28S regions are removed by splicing and contain significant variation between species for barcoding purposes as previously described (Schoch et al Nuclear ribosomal internal transcribed spacer (ITS) region as a universal DNA barcode marker for Fungi. PNAS 109:6241-6246. 2012). 18S rDNA is traditionally used for phylogenetic reconstruction however the ITS can serve this function as it is generally highly conserved but contains hypervariable regions that harbor sufficient nucleotide diversity to differentiate genera and species of most fungus.
- The term “isolated” or “enriched” encompasses a microbe, bacteria or other entity or substance that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature or in an experimental setting), and/or (2) produced, prepared, purified, and/or manufactured by the hand of man. Isolated microbes may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated. In some embodiments, isolated microbes are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is “pure” if it is substantially free of other components. The terms “purify,” “purifying” and “purified” refer to a microbe or other material that has been separated from at least some of the components with which it was associated either when initially produced or generated (e.g., whether in nature or in an experimental setting), or during any time after its initial production. A microbe or a microbial population may be considered purified if it is isolated at or after production, such as from a material or environment containing the microbe or microbial population, and a purified microbe or microbial population may contain other materials up to about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or above about 90% and still be considered “isolated.” In some embodiments, purified microbes or microbial population are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. In the instance of microbial compositions provided herein, the one or more microbial types present in the composition can be independently purified from one or more other microbes produced and/or present in the material or environment containing the microbial type. Microbial compositions and the microbial components thereof are generally purified from residual habitat products.
- “Metabolite” as used herein refers to any and all molecular compounds, compositions, molecules, ions, co-factors, catalysts or nutrients used as substrates in any cellular or microbial metabolic reaction or resulting as product compounds, compositions, molecules, ions, co-factors, catalysts or nutrients from any cellular or microbial metabolic reaction.
- “Microbe” refers to any natural or engineered organism characterized as a bacterium, fungus, microscopic alga, protozoan, and the stages of development or life cycle stages (e.g., vegetative, spore (including sporulation, dormancy, and germination), latent, biofilm) associated with the organism. Examples of gut microbes include: Actinomyces graevenitzii, Actinomyces odontolyticus, Akkermansia muciniphila, Bacteroides caccae, Bacteroides fragilis, Bacteroides putredinis, Bacteroides thetaiotaomicron, Bacteroides vultagus, Bifidobacterium adolescentis, Bifidobacterium bifidum, Bilophila wadsworthia, Lactococcus lactis, Butyrivibrio, Campylobacter gracilis, Clostridia cluster III, Clostridia cluster IV, Clostridia cluster IX (Acidaminococcaceae group), Clostridia cluster XI, Clostridia cluster XIII (Peptostreptococcus group), Clostridia cluster XIV, Clostridia cluster XV, Collinsella aerofaciens, Coprococcus, Corynebacterium sunsvallense, Desulfomonas pigra, Dorea formicigenerans, Dorea longicatena, Escherichia coli, Eubacterium hadrum, Eubacterium rectale, Faecalibacteria prausnitzii, Gemella, Lactococcus, Lanchnospira, Mollicutes cluster XVI, Mollicutes cluster XVIII, Prevotella, Rothia mucilaginosa, Ruminococcus callidus, Ruminococcus gnavus, Ruminococcus torques, and Streptococcus.
- “Microbiome” broadly refers to the microbes residing on or in body site of a subject or patient. Microbes in a microbiome may include bacteria, viruses, eukaryotic microorganisms, and/or viruses. Individual microbes in a microbiome may be metabolically active, dormant, latent, or exist as spores, may exist planktonically or in biofilms, or may be present in the microbiome in sustainable or transient manner. The microbiome may be a commensal or healthy-state microbiome or a disease-state microbiome. The microbiome may be native to the subject or patient, or components of the microbiome may be modulated, introduced, or depleted due to changes in health state (e.g., precancerous or cancerous state) or treatment conditions (e.g., antibiotic treatment, exposure to different microbes). In some aspects, the microbiome occurs at a mucosal surface. In some aspects, the microbiome is a gut microbiome. In some aspects, the microbiome is a tumor microbiome.
- A “microbiome profile” or a “microbiome signature” of a tissue or sample refers to an at least partial characterization of the bacterial makeup of a microbiome. In some embodiments, a microbiome profile indicates whether at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more bacterial strains are present or absent in a microbiome.
- “Modified” in reference to a bacteria broadly refers to a bacteria that has undergone a change from its wild-type form. Examples of bacterial modifications include genetic modification, gene expression, phenotype modification, formulation, chemical modification, and dose or concentration. Examples of improved properties are described throughout this specification and include, e.g., attenuation, auxotrophy, homing, or antigenicity. Phenotype modification might include, by way of example, bacteria growth in media that modify the phenotype of a bacterium that increase or decrease virulence.
- As used herein, a gene is “overexpressed” in a bacteria if it is expressed at a higher level in an engineered bacteria under at least some conditions than it is expressed by a wild-type bacteria of the same species under the same conditions. Similarly, a gene is “underexpressed” in a bacteria if it is expressed at a lower level in an engineered bacteria under at least some conditions than it is expressed by a wild-type bacteria of the same species under the same conditions.
- The terms “polynucleotide” and “nucleic acid” are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure, and may perform any function. The following are non-limiting examples of polynucleotides: coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer. A polynucleotide may be further modified, such as by conjugation with a labeling component. In all nucleic acid sequences provided herein, U nucleotides are interchangeable with T nucleotides.
- As used herein, a substance is “pure” if it is substantially free of other components. The terms “purify,” “purifying” and “purified” refer to a EV or other material that has been separated from at least some of the components with which it was associated either when initially produced or generated (e.g., whether in nature or in an experimental setting), or during any time after its initial production. An EV may be considered purified if it is isolated at or after production, such as from one or more other bacterial components, and a purified microbe or microbial population may contain other materials up to about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or above about 90% and still be considered “purified.” In some embodiments, purified EVs are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. EV compositions and the microbial components thereof are, e.g., purified from residual habitat products.
- As used herein, the term “purified EV composition” or “EV composition” refer to a preparation that includes EVs that have been separated from at least one associated substance found in a source material (e.g. separated from at least one other bacterial component) or any material associated with the EVs in any process used to produce the preparation. It also refers to a composition that has been significantly enriched or concentrated. In some embodiments the EVs are concentrated by 2 fold, 3-fold, 4-fold, 5-fold, 10-fold, 100-fold, 1000-fold, 10,000-fold or more than 10,000 fold.
- “Operational taxonomic units” and “OTU(s)” refer to a terminal leaf in a phylogenetic tree and is defined by a nucleic acid sequence, e.g., the entire genome, or a specific genetic sequence, and all sequences that share sequence identity to this nucleic acid sequence at the level of species. In some embodiments the specific genetic sequence may be the 16S sequence or a portion of the 16S sequence. In other embodiments, the entire genomes of two entities are sequenced and compared. In another embodiment, select regions such as multilocus sequence tags (MLST), specific genes, or sets of genes may be genetically compared. For 16S, OTUs that share ≥97% average nucleotide identity across the entire 16S or some variable region of the 16S are considered the same OTU. See e.g. Claesson M J, Wang Q, O'Sullivan O, Greene-Diniz R, Cole J R, Ross R P, and O'Toole P W. 2010. Comparison of two next-generation sequencing technologies for resolving highly complex microbiota composition using tandem variable 16S rRNA gene regions. Nucleic Acids Res 38: e200. Konstantinidis K T, Ramette A, and Tiedje J M. 2006. The bacterial species definition in the genomic era. Philos Trans R Soc Lond B Biol Sci 361: 1929-1940. For complete genomes, MLSTs, specific genes, other than 16S, or sets of genes OTUs that share ≥95% average nucleotide identity are considered the same OTU. See e.g., Achtman M, and Wagner M. 2008. Microbial diversity and the genetic nature of microbial species. Nat. Rev. Microbiol. 6: 431-440. Konstantinidis K T, Ramette A, and Tiedje J M. 2006. The bacterial species definition in the genomic era. Philos Trans R Soc Lond B Biol Sci 361: 1929-1940. OTUs are frequently defined by comparing sequences between organisms. Generally, sequences with less than 95% sequence identity are not considered to form part of the same OTU. OTUs may also be characterized by any combination of nucleotide markers or genes, in particular highly conserved genes (e.g., “house-keeping” genes), or a combination thereof. Operational Taxonomic Units (OTUs) with taxonomic assignments made to, e.g., genus, species, and phylogenetic clade are provided herein.
- As used herein, “specific binding” refers to the ability of an antibody to bind to a predetermined antigen or the ability of a polypeptide to bind to its predetermined binding partner. Typically, an antibody or polypeptide specifically binds to its predetermined antigen or binding partner with an affinity corresponding to a KD of about 10−7 M or less, and binds to the predetermined antigen/binding partner with an affinity (as expressed by KD) that is at least 10 fold less, at least 100 fold less or at least 1000 fold less than its affinity for binding to a non-specific and unrelated antigen/binding partner (e.g., BSA, casein). Alternatively, specific binding applies more broadly to a two component system where one component is a protein, lipid, or carbohydrate or combination thereof and engages with the second component which is a protein, lipid, carbohydrate or combination thereof in a specific way.
- The terms “subject” or “patient” refers to any animal. A subject or a patient described as “in need thereof” refers to one in need of a treatment for a disease. Mammals (i.e., mammalian animals) include humans, laboratory animals (e.g., primates, rats, mice), livestock (e.g., cows, sheep, goats, pigs), and household pets (e.g., dogs, cats, rodents). For example, the subject may be a non-human mammal including but not limited to of a dog, a cat, a cow, a horse, a pig, a donkey, a goat, a camel, a mouse, a rat, a guinea pig, a sheep, a llama, a monkey, a gorilla or a chimpanzee. The subject or patient may be healthy, or may be suffering from an immune disorder at any developmental stage.
- “Strain” refers to a member of a bacterial species with a genetic signature such that it may be differentiated from closely-related members of the same bacterial species. The genetic signature may be the absence of all or part of at least one gene, the absence of all or part of at least on regulatory region (e.g., a promoter, a terminator, a riboswitch, a ribosome binding site), the absence (“curing”) of at least one native plasmid, the presence of at least one recombinant gene, the presence of at least one mutated gene, the presence of at least one foreign gene (a gene derived from another species), the presence at least one mutated regulatory region (e.g., a promoter, a terminator, a riboswitch, a ribosome binding site), the presence of at least one non-native plasmid, the presence of at least one antibiotic resistance cassette, or a combination thereof. Genetic signatures between different strains may be identified by PCR amplification optionally followed by DNA sequencing of the genomic region(s) of interest or of the whole genome. In the case in which one strain (compared with another of the same species) has gained or lost antibiotic resistance or gained or lost a biosynthetic capability (such as an auxotrophic strain), strains may be differentiated by selection or counter-selection using an antibiotic or nutrient/metabolite, respectively.
- As used herein, the term “treating” a disease in a subject or “treating” a subject having or suspected of having a disease refers to subjecting the subject to a pharmaceutical treatment, e.g., the administration of one or more agents, such that at least one symptom of the disease is decreased or prevented from worsening. Thus, in one embodiment, “treating” refers inter alia to delaying progression, expediting remission, inducing remission, augmenting remission, speeding recovery, increasing efficacy of or decreasing resistance to alternative therapeutics, or a combination thereof.
- In certain aspects, provided herein are methods of using a bacterial composition comprising an immune modulating Lactococcus strain provided herein, EVs generated by or isolated from an immune modulating Lactococcus strain provided herein and/or a PhAB made from or comprising an immune modulating Lactococcus strain provided herein. In some embodiments, the immune modulating Lactococcus strain is a strain of Lactococcus lactis cremoris. In some embodiments, the immune modulating Lactococcus strain is Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368). In some embodiments, the immune modulating Lactococcus strain is a strain comprising at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity (e.g., at least 99.5% sequence identity, at least 99.6% sequence identity, at least 99.7% sequence identity, at least 99.8% sequence identity, at least 99.9% sequence identity) to the nucleotide sequence (e.g., genomic, 16S or CRISPR nucleotide sequence) of the Lactococcus lactis cremoris Strain A (ATCC Deposit Number PTA-125368).
- Under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purpose of Patent Procedure, the Lactococcus lactis cremoris Strain A was deposited on Oct. 11, 2018, with the American Type Culture Collection (ATCC) of 10801 University Boulevard, Manassas, Va. 20110-2209 USA and was assigned ATCC Accession Number PTA-125368.
- Applicant represents that the ATCC is a depository affording permanence of the deposit and ready accessibility thereto by the public if a patent is granted. All restrictions on the availability to the public of the material so deposited will be irrevocably removed upon the granting of a patent. The material will be available during the pendency of the patent application to one determined by the Commissioner to be entitled thereto under 37 CFR 1.14 and 35 U.S.C. 122. The deposited material will be maintained with all the care necessary to keep it viable and uncontaminated for a period of at least five years after the most recent request for the furnishing of a sample of the deposited plasmid, and in any case, for a period of at least thirty (30) years after the date of deposit or for the enforceable life of the patent, whichever period is longer. Applicant acknowledges its duty to replace the deposit should the depository be unable to furnish a sample when requested due to the condition of the deposit.
- In some embodiments, the bacteria described herein are modified to improve colonization and/or engraftment in the mammalian gastrointestinal tract (e.g., modified metabolism, such as improved mucin degradation, enhanced competition profile, increased motility, increased adhesion to gut epithelial cells, modified chemotaxis). In some embodiments, the bacteria described herein are modified to enhance their immunomodulatory and/or therapeutic effect (e.g., either alone or in combination with another therapeutic agent). In some embodiments, the bacteria described herein are modified to enhance immune activation (e.g., through modified production of polysaccharides, pili, fimbriae, adhesins). In some embodiments, the bacteria described herein are modified to improve bacterial manufacturing (e.g., higher oxygen tolerance, improved freeze-thaw tolerance, shorter generation times).
- Lactococcus lactis cremoris Strain A can be cultured according to methods known in the art. For example, Lactococcus lactis cremoris can be grown in ATCC Medium 2722, ATCC Medium 1490, or other medium using methods disclosed, for example in Caballero et al., 2017. “Cooperating Commensals Restore Colonization Resistance to Vancomycin-Resistant Enterococcus faecium” Cell Host & Microbe 21:592-602, which is hereby incorporated by reference in its entirety.
- In some embodiments, the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) comprising one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) proteins listed in Table 1 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) genes encoding proteins listed in Table 1. In some embodiments, the immune modulating bacteria comprises all of the proteins listed in Table 1 and/or all of the genes encoding the proteins listed in Table 1.
- In some embodiments, the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) comprising one or more (e.g., one, two or three) membrane associated proteins listed in Table 2 and/or one or more (e.g., one, two or three) genes encoding membrane associated proteins listed in Table 2. In some embodiments, the immune modulating bacteria comprises all of the proteins listed in Table 2 and/or all of the genes encoding the proteins listed in Table 2.
- In some embodiments, the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) proteins listed in Table 3 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) genes encoding proteins listed in Table 3. In some embodiments, the immune modulating bacteria is free of all of the proteins listed in Table 2 and/or all of the genes encoding the proteins listed in Table 2.
- In some embodiments, the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17) exopolysaccharide (EPS) synthesis proteins listed in Table 4 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17) genes encoding EPS synthesis proteins listed in Table 4. In some embodiments, the immune modulating bacteria is free of all of the proteins listed in Table 4 and/or all of the genes encoding the proteins listed in Table 4. In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of an EPS synthesized in whole or in part by a protein listed in Table 4. In some embodiments, the immune modulating bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of EPS.
- In certain aspects, the immune modulating Lactococcus strain bacteria described herein are substantially free of exopolysaccharides.
- In some embodiments, the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) comprising one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) proteins listed in Table 6 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more) genes encoding proteins listed in Table 6. In some embodiments, the immune modulating bacteria comprises all of the proteins listed in Table 6 and/or all of the genes encoding the proteins listed in Table 6.
- In some embodiments, the immune modulating Lactococcus bacteria is a strain of Lactococcus bacteria (e.g., a strain of Lactococcus lactis cremoris) free or substantially free of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, or more) proteins listed in Table 5 and/or one or more (e.g., 1, 2, 3, 4, 5, 6, 7 or more) genes encoding proteins listed in Table 5. In some embodiments, the immune modulating bacteria is free of all of the proteins listed in Table 5 and/or all of the genes encoding the proteins listed in Table 5.
-
TABLE 1 Exemplary Lactococcus lactis cremoris Strain A Proteins SEQ ID NO. name uniprot_id Protein Sequence 1 Cluster: P35881 MTQFTTELLNFLAQKQDIDEFFRTSLETAMNDLLQAE Transposase LSAFLGYEPYDKVGYNSGNSRNGSYSRQFETKYGT for insertion VQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLY sequence QTGVTTREISDIIERMYGHHYSPATISNISKATQENVA element TFHERSLEANYSVLFLDGTYLPLRRGTVSKECIHIAL IS905 GITPEGQKAVLGYEIAPNENNASWSTLLDKLQNQGI QQVSLVVTDGFKGLEQIISQAYPLAKQQRCLIHISRNL ASKVKRADRAVILEQFKTIYRAENLEMAVQALENFIA EWKPKYRKVMESLENTDNLLTFYQFPYQIWHSIYST NLIESLNKEIKRQTKKKVLFPNEEALERYLVTLFEDYN FKQSQRIHKGFGQCADTLESLFD 2 Cluster: Q9CB06 MKVTGFPKATYYYWVNCFERVNKDELIEKEMLKIRQ Transposase EHANAGYRPMSELLKQRGYHVNHKKVQRLMKKLGL of IS1077E RVTSYWHKSRKYNSYKGKVGTVAKNKLHRRFRTSIP HQKITTDTTEFKYYEDGIQKKCYLNPYIDLFNSEVISY HISKQPSYQSIDIALNQALAVTSDCPYRRTFHSDQG WGYQMRDYVSKLKSHRIFQSMSRKGNCHDNSVME NFFGLLKQEIYYGHIFSSFEELEQVIVIWIRYYNTKRIK QKLNWMSPIQFRLNYQNN 3 Cluster: T0VLJ3 MTQFTTELLNFLAQKQDIDEFFRTSLETAMNDLLQAE Transposase LSAFLGYEPYDKVGYNSGNSRNGSYSRQFETKYGT IS256 VQLSIPRDRNGNFSPALLPAYGRRDDHLEEMGYQTL SNRCNDSRNL 4 Cluster: A2RKL1 MTKYSFELKLKVVQDYDNGVGGCDYLAKKYHVTNE Uncharacterized AIVRRWVKAYKELGAVGIQRKRQNTVYSTQFKLNAV protein NLYLTSEKSYRELAHELGMNNPPLLTRWVSNYRKKG EFAFSNVQGRPRKESELLEISIKKAKDVVNETEQELA RLQNDNLNLRMEVEYLKGLRRLRQEQHKRENPEWS VNSDENSSSHLSNS 5 Cluster: S6EVX2 MVCELRREFKFPLKQLLAISELSKATYYYWVNRFER Transposase PNKDEMIEQVMLEIRQEHTNAGYRPMVELLKQRGIY VNHKKVQRLMKKLGLRVTTFWHKSRKYNSYKGKVG TVAKNKLHRRFNTSIPHQKITTDTTEFKYYDKGVQKK LYLTPYLDLFNNEVISYEISKQPTYQAIATALQEALELT SDCLYRRTFHSDQGWAYQMKNYVFKLKSQKIIQSM SRKGNCHDNSVMENFFGLLKQEIYYGHVFNSFEELE QAITKWIHYYNTKRIKKKLNWMSPIQYRLTYSK 6 Cluster: G0WJR5 MMINYQGEVFTETEFYGREILEAIQLTNKFPTPKKVLI PIL4_5 DRLEEMIHEQLDLIDKEELNNYIHAKK 7 Cluster: T0W7Q8 MKIIENRERSIQKKFFVNEKENERIKLMMKKTGITNFS Molybdopterin- VFARRACCNKEIFTLDFSEYKNIISEISATKSELKRIGN guanine NINQIAKHLNENKNNQTESLMSDYQNQLESLEEKIQK dinucleotide VVHYISEG biosynthesis protein MobC 8 ESAT-6 Q2G188 MMLKKEWQAILKHKFFIIVIIALALVPAIYNYIFLGSMW secretion_ DPSGKLNDLPVAVVNLDKTSELNGKKFKLGDDVITE accessory_ MKKSKDLDYHFVSKDKASEGIKKGDYYMVITFPENF factor_EsaA SENATTLMNKEPKTVQLDYQTTRGHNYISSKMSESA MNQLKSEVSKNITQTYTKTRIAS 9 Foldase_protein_ P0C2B5 MKKKMRLKVLLASTATALLLLSGCQSNQTDQTVATY PrsA SGGKVTESSFYKELKQSPTTKTMLANMLIYRALNHA YGKSVSTKTVNDAYDSYKQQYGENFDAFLSQNGFS RSSFKESLRTNFLSEVALKKLKKVSESQLKAAWKTY QPKVTVQHILTSDEDTAKQVISDLAAGKDFAMLAKTD SIDTATKDNGGKISFELNNKTLDATFKDAAYKLKNGD YTQTPVKVTDGYEVIKMINHPAKGTFTSSKKVLTASV YAKWSRDSSIMQRVISQVLKNQHVTIKDKDLADALD SYKKLATTN 10 PIII- P15292 MQRKKKGLSFLLAGTVALGALAVLPVGEIQAKAAISQ type_proteinase QTKGSSLANTVTAATAKQAATDTTAATTNQAIATQLA AKGIDYNKLNKVQQQDIYVDVIVQMSAAPASENGTL RTDYSSTAEIQQETNKVIAAQASVKAAVEQVTQQTA GESYGYVVNGFSTKVRVVDIPKLKQIAGVKTVTLAKV YYPTDAKANSMANVQAVWSNYKYKGEGTVVSVIDS GIDPTHKDMRLSDDKDVKLTKSDVEKFTDTVKHGRY FNSKVPYGFNYADNNDTITDDKVDEQHGMHVAGIIG ANGTGDDPAKSVVGVAPEAQLLAMKVFTNSDTSATT GSDTLVSAIEDSAKIGADVLNMSLGSDSGNQTLEDP EIAAVQNANESGTAAVISAGNSGTSGSATEGVNKDY YGLQDNEMVGTPGTSRGATTVASAENTDVITQAVTI TDGTGLQLGPETIQLSSNDFTGSFDQKKFYVVKDAS GNLSKGKVADYTADAKGKIAIVKRGELTFDDKQKYA QAAGAAGLIIVNNDGTATPVTSMALTTTFPTFGLSSV TGQKLVDWVTAHPDDSLGVKIALTLVPNQKYTEDKM SDFTSYGPVSNLSFKPDITAPGGNIWSTQNNNGYTN MSGTSMASPFIAGSQALLKQALNNKNNPFYAYYKQL KGTALTDFLKTVEMNTAQPINDINYNNVIVSPRRQGA GLVDVKAAIDALEKNPSTVVAENGYPAVELKDFTSTD KTFKLTFTNRTTHELTYQMDSNTDTNAVYTSATDPN SGVLYDKKIDGAAIKAGSNITVPAGKTAQIEFTLSLPK SFDQQQFVEGFLNFKGSDGSRLNLPYMGFFGDWN DGKIVDSLNGITYSPAGGNFGTVPLLTNKNTGTQYY GGMVIDADGNQTVDDQA1AFSSDKNALYNDISMKYY LLRNISNVQVDILDGQGNKVTTLSSSTNLTKTYYNAH SQQYIYYHAPAWDGTYYDQRDGNIKTADDGSYTYRI SGVPEGGDKRQVFDVPFKLDSKAPTVRHVALSAKTK NGKTQYYLTAEVKDDLSGLDATKSVKTAINEVTNLDA TFTDAGTTADGYTKIETPLSDEQAQALGNGDNSAEL YLTDNASNATDQDASVQKPGSTSFDLIVNGSGIPDKI SSTTTGYEANTQGGGTYTFSGTYPAAVDGTYTDAQ GKKHDLNTTYDAATNSFTASMPVTNADYAAQVDLYA DKAHTQLLKHFDTKVRLTAPTFTDLKFNNGSDQTSE ATIKVTGTVSADTKTVNVGDTVAALDAQHHFSVDVP VNYGDNTIKVIATDEDGNTTTEQKTITSSYDPDMLKN PVTFDQGVTFGSNEFNATSAKFYDPKTGIATITGKVK HPTTTLQVDGKQIPIKDDLTFSFTLDLGTLGQKPFGV VVGDTTQNKTFQEALTFILDAVAPTLSLDSSTDAPVY TNDPNFQITGTATDNAQYLSLSINGSSVASQYADININ SGKPGHMAIDQPVKLLEGKNVLTVAVTDSEDNTTTK NITVYYEPKKTLAAPTVTPSTTEPAQTVTLTANAAAT GETVQYSADGGKTYQDVPAAGVTITANGTFKFKSTD LYGNESPAVDYVVTNIKADDPAQLQAAKQALTNLIAS AKTLSASGKYDDATTTALAAATQKAQTALDQTNASV DSLTGANRDLQTAINQLAAKLPADKKTSLLNQLQSVK DALGTDLGNQTDPSTGKTFTAALDDLVAQAQAGTQT DDQLQATLAKILDEVLAKLAEGIKAATPAEVGNAKDA ATGKTWYADIADTLTSGQASADASDKLAHLQALQSL KTKVAAAVEADKTVGKGDDTTGTSDKGSGQGTPAP ATGDTGKDKGDEGSQPSSGGNIPTNPATTTSTSAD DTTDRNGQHTTGTSDKGGGQGTPAPATGDTGKDK GDEGSQPSSGGNIPTNPATTTSTSADDTTDRNGQH TTGTSDKGGGQGTPAPATGDTGKDKGDEGSQPSS GGNIPTNPATTTSTSTDDTTDRNGQHTTGKGALPKT GETTERPAFGFLGVIVVILMGVLGLKRKQREE 11 Cluster: T0V9Y4 MRAAEGLFVYNKTNFHYLPQNIAFADFKSGKFATSG Uncharacterized MSMILIDSVNHRILDVMKDRGAGQLRAYFNQYSPSA protein RAAVKTITVDLFTPYRAMIKDLFPNANIVADRFHVVTQ AYRELNKVRISVMKQFGSDSKEYRQLKRFWKLLMK HENALDYMTSKNRINFKHAYLTDKEVIDRLLALSDEL RDAYAFYQVIL 12 Cluster: T0UTW8 MDNDIRILIGLTDLNIDFDAKAEQHFNETNLNGTAPIT Uncharacterized WNLLLTYATNCEKFGTPMVHNGIKMVTHKGPRIAFK protein FQNYRIRKQKFL 13 Cluster: T0UZT2 MIENTINIAYARKFYKTKDYHSFCNLIKGNKGLFGNKT Uncharacterized VNQKANISFVKSEGEKHTHIYLDYQETCKVAHPNFLQ protein LINLLKNYDPEFSEEKLPTFDLNDKIFGEYEIKVIPISKT KIVNTIDDVMNEIAKEIVLKYNQDMFKVTSKLGEISLT PIQEKFDKLKDI 14 Cluster: Q9AIQ4 MIIPEKQNKQKQVLTLNELEKRKVVEHNALIQSVAKM RepB QKTALKMFELAVSCIDTEEPPKNNTVYLSKSELFKFF EVSSSSKHSQFKEAVNYMQKQAFFNIKADKKLGIEY ESIVPIPYVKWNDYNDEVTIRFDQAIMPYLIDLKAEFT QYKISELQKLNSKYSIILYRWLSMNYNQYEHYSVKGG RRADQVEAYRTPSIKVKELREITDTINEHQHFPHFET RVLKKAIEEINAHTSFNVTYEKVKKGRSIDSIVFHIEKK RMADDNSYKLEDKVYQEDKARKAETEKDLVFQAMQ SPYTRLLIENMFLNVYETTDSQIMAGLQKNVYPLYDE LKELRGLNGVKDHLSYVSSKQEAYSKRNVAKYLKKA IEQYLPTVKRQDLNHE 15 Cluster: Q7BLH6 MSEDLKTIKELADELGVSKSYVDKIIRILKLHTKLDKV Uncharacterized GNKYVISKKQEKSIITRIENSKSTTETHTESTTQSHTK protein VDAEVDFLKEEIAYLKSNHDKQLTNKDKQIETLSNLL DQQQRLALQDKKWLEEYKAEINDLKALKMPSEDTKE EQSNYRSLEKEKDFVQTIQESYESEIKVLNQKLAEQE EQIQEIQKEKETKEKKWFQFWK 16 Cluster: Q05547 MAQTFDRKILRALQDNGVREIRAYEVVSKRLTIFQTD RepC RGTFKYSDSLYRLVAPRQELWRNCTTGFISEEKYHF YKK 17 Hypothetical MNHFKGKQFKKDVIIVAVGYYLRYNLSYREIQELLYD protein RGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYS WKMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRD TQAAYAFLKRLHKQFGQPRVIVTDKAPSIGSAFRKLQ SNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSL RTASTTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVL MGILA 18 Cluster: Q52233 MKEYFQGDEFKDISKNGKDRKWKERKINNLNLAKIF Replication DSLDYPDSFIFNIKSCAEYLNFKRSSDGSLRLFQMYT protein CKNKQCAICSWRRSMKYQVQISKIVEEAMIRKPKGR FLFLTLTVENVSGEGLNNELSLLSEAFNRLMKYKKVS KNILGFLRATEVTINESMDTYHPHIHVLLFISPTYFKNK NNYISQDEWTELWKKSAKLDYRPIVDVRSIKPKNEKT SDIRSAILETAKYPVKPMELNYDSAKVVDDLQKGLYR KRQIAFGGLFKQIKKELELDDIENGDLINIGDEENPISD GEIISVLWNHERQNYYVR 19 Cluster: T0VLA4 MINYQGEDFTETEFYGREILEAIQLTNKFPTPKKVLID Uncharacterized MLEEMIHEQLDFIDKEELNNYINAKKYVQTLTEDEVK protein NLCFEVKDLYEDVLKEFEIKL 20 Cluster: T0VQK1 MTCSNLTIHLHAKNRSKLFGSKKYALQELEAESTAFV Uncharacterized VANHLNIDTKDYSIGYLNSWGFDKISDEQLENVIKND protein KLSNNKIKGENE (Fragment) -
TABLE 2 Selected membrane associated Lactococcus lactis cremoris Strain A Proteins SEQ ID NO. name uniprot_id Protein Sequence 21 ESAT-6_ Q2G188 MMLKKEWQAILKHKFFIIVIIALALVPAIYNYIFLGSMW secretion_ DPSGKLNDLPVAVVNLDKTSELNGKKFKLGDDVITE accessory_ MKKSKDLDYHFVSKDKASEGIKKGDYYMVITFPENF factor_EsaA SENATTLMNKEPKTVQLDYQTTRGHNYISSKMSESA MNQLKSEVSKNITQTYTKTRIAS 22 Foldase_ P0C2B5 MKKKMRLKVLLASTATALLLLSGCQSNQTDQTVATY protein_PrsA SGGKVTESSFYKELKQSPTTKTMLANMLIYRALNHA YGKSVSTKTVNDAYDSYKQQYGENFDAFLSQNGFS RSSFKESLRTNFLSEVALKKLKKVSESQLKAAWKTY QPKVTVQHILTSDEDTAKQVISDLAAGKDFAMLAKTD SIDTATKDNGGKISFELNNKTLDATFKDAAYKLKNGD YTQTPVKVTDGYEVIKMINHPAKGTFTSSKKVLTASV YAKWSRDSSIMQRVISQVLKNQHVTIKDKDLADALD SYKKLATTN 23 PIII- P15292 MQRKKKGLSFLLAGTVALGALAVLPVGEIQAKAAISQ type_ QTKGSSLANTVTAATAKQAATDTTAATTNQAIATQLA proteinase AKGIDYNKLNKVQQQDIYVDVIVQMSAAPASENGTL RTDYSSTAEIQQETNKVIAAQASVKAAVEQVTQQTA GESYGYVVNGFSTKVRVVDIPKLKQIAGVKTVTLAKV YYPTDAKANSMANVQAVWSNYKYKGEGTVVSVIDS GIDPTHKDMRLSDDKDVKLTKSDVEKFTDTVKHGRY FNSKVPYGFNYADNNDTITDDKVDEQHGMHVAGIIG ANGTGDDPAKSVVGVAPEAQLLAMKVFTNSDTSATT GSDTLVSAIEDSAKIGADVLNMSLGSDSGNQTLEDP EIAAVQNANESGTAAVISAGNSGTSGSATEGVNKDY YGLQDNEMVGTPGTSRGATTVASAENTDVITQAVTI TDGTGLQLGPETIQLSSNDFTGSFDQKKFYVVKDAS GNLSKGKVADYTADAKGKIAIVKRGELTFDDKQKYA QAAGAAGLIIVNNDGTATPVTSMALTTTFPTFGLSSV TGQKLVDWVTAHPDDSLGVKIALTLVPNQKYTEDKM SDFTSYGPVSNLSFKPDITAPGGNIWSTQNNNGYTN MSGTSMASPFIAGSQALLKQALNNKNNPFYAYYKQL KGTALTDFLKTVEMNTAQPINDINYNNVIVSPRRQGA GLVDVKAAIDALEKNPSTVVAENGYPAVELKDFTSTD KTFKLTFTNRTTHELTYQMDSNTDTNAVYTSATDPN SGVLYDKKIDGAAIKAGSNITVPAGKTAQIEFTLSLPK SFDQQQFVEGFLNFKGSDGSRLNLPYMGFFGDWN DGKIVDSLNGITYSPAGGNFGTVPLLTNKNTGTQYY GGMVIDADGNQTVDDQA1AFSSDKNALYNDISMKYY LLRNISNVQVDILDGQGNKVTTLSSSTNLTKTYYNAH SQQYIYYHAPAWDGTYYDQRDGNIKTADDGSYTYRI SGVPEGGDKRQVFDVPFKLDSKAPTVRHVALSAKTK NGKTQYYLTAEVKDDLSGLDATKSVKTAINEVTNLDA TFTDAGTTADGYTKIETPLSDEQAQALGNGDNSAEL YLTDNASNATDQDASVQKPGSTSFDLIVNGSGIPDKI SSTTTGYEANTQGGGTYTFSGTYPAAVDGTYTDAQ GKKHDLNTTYDAATNSFTASMPVTNADYAAQVDLYA DKAHTQLLKHFDTKVRLTAPTFTDLKFNNGSDQTSE ATIKVTGTVSADTKTVNVGDTVAALDAQHHFSVDVP VNYGDNTIKVIATDEDGNTTTEQKTITSSYDPDMLKN PVTFDQGVTFGSNEFNATSAKFYDPKTGIATITGKVK HPTTTLQVDGKQIPIKDDLTFSFTLDLGTLGQKPFGV VVGDTTQNKTFQEALTFILDAVAPTLSLDSSTDAPVY TNDPNFQITGTATDNAQYLSLSINGSSVASQYADININ SGKPGHMAIDQPVKLLEGKNVLTVAVTDSEDNTTTK NITVYYEPKKTLAAPTVTPSTTEPAQTVTLTANAAAT GETVQYSADGGKTYQDVPAAGVTITANGTFKFKSTD LYGNESPAVDYVVTNIKADDPAQLQAAKQALTNLIAS AKTLSASGKYDDATTTALAAATQKAQTALDQTNASV DSLTGANRDLQTAINQLAAKLPADKKTSLLNQLQSVK DALGTDLGNQTDPSTGKTFTAALDDLVAQAQAGTQT DDQLQATLAKILDEVLAKLAEGIKAATPAEVGNAKDA ATGKTWYADIADTLTSGQASADASDKLAHLQALQSL KTKVAAAVEADKTVGKGDDTTGTSDKGSGQGTPAP ATGDTGKDKGDEGSQPSSGGNIPTNPATTTSTSAD DTTDRNGQHTTGTSDKGGGQGTPAPATGDTGKDK GDEGSQPSSGGNIPTNPATTTSTSADDTTDRNGQH TTGTSDKGGGQGTPAPATGDTGKDKGDEGSQPSS GGNIPTNPATTTSTSTDDTTDRNGQHTTGKGALPKT GETTERPAFGFLGVIVVILMGVLGLKRKQREE -
TABLE 3 Exemplary Lactococcus lactis cremoris proteins not found in Lactococcus lactis cremoris Strain A SEQ ID NO. name uniprot_id Protein Sequence 24 Cluster: J7TTI4 MTQFTTELLNFLAQKQDIDEFFRTSLETAMNDLLQAE Transposase LSAFLGYEPYDKVGYNSGNSRNGSYSRQFETKYGT VQLSIPRDRNGNFSPALLPAYGRRDDHLEEMVIKLY QTGVTTREISDIIERMYGHHYSPATISNISKATQENVA TFHERSLEANYSVLFLDGTYLPLRRGTVSKECIHIAHL ALHQKDRRLFLDMKSPQMKTMLLGPPC 25 Cluster: T0USG6 MQKRYSKEFKETLIVFYHSGQSVTQLSKEYDVAPATI Transposase YKWIDLYSKSNESSVSKADFLELKRQLAKVKEERDIL KKY 26 Cluster: A0A1V0NYX4 MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVH Transposase LATSDCLVIACYLWGVLHFSETLKAKHQLAQSLFPNF LEYYRFVRRCNALLPSIQVIRQALVFKEVEGMSVSIID SFPIPLCQPIRNFRSKVLGDYANVGYNATKGQYFYG CKCHALVSESGYVIDYTITPASMADSSMTEEVLNQF GTPTVLGDMGYLG 27 Cluster: T0UZJ0 MISYHISKQPSYQSIDIALNQALAVTSDCPYRRTFHS Transposase DQGWGYQMRDYVSKLKSHRIFQSMSRKGNCHDNS IS1077 VMENFFGLLKQEIYYGHIFSSFEELEQVIVIWIRYYNT (Fragment) KRIKQKLNWMSPIQFRLNYQNN 28 Cluster: S6EVX7 MPENKNFSRRSKKETGKKSLKIPKIRPKKQKNLKK Penicillin- binding protein 2A 29 Cluster: G8P734 MKVTGFPKATYYYWVNCFERVNKDELIEKEMLKIRQ Transposase EHANAGYRPMSELLKQRGYHVNHKKVQPLMKKLGL RVTSYWHKSRKYNSYKGNVGTVAKNKLHRRFRTSIP HQKITTDTTEFKYYEDGIQKKCYLNPYIDLFNSEVISY HISKQPSYQSIDIALNQALAVTSDCPYRRTFHSDQG WGYQMRDYVSKLKSHRIF 30 Cluster: A0A1V0PJ39 MAKNKLHRRFNTSIPHQKITTDTTEFKYYDKGVQKKL Transposase YLTPYLDLFNNEVISYEISKQPTYQAIATALQEALELT SDCLYRRTFHSDQGWAYQMKNYVFKLKSQKIIQSM SRKGNCHDNSVMENFFGLLKQEIYYGHVFNSFEELE QAITKWIHYYNTKRIKKKLNWMSPIQYRLTYSK 31 Inner_ P75788 MEHSATQRESQKIWTAIKNWFLVDKVFLISFIIAIIAISL membrane_ GGVTTRFFNYHVIVTVSGLMLVIGGFKETGLLQYLGQ protein_ TLVKRSTTTRQLVRFTTLLTFFLAVFFTNDLTILTVLPL YbiR YLAITKEIKNRKSVYIGAALIVPACHIGSALLPQGNPH NLYLYSFYKVAAHHGGVPLTNLDFFKGTGALWILGLL ILMIACQFIDNEPLVIETKVNQFNKVETSIFVVLMLLMA ASVFGYVNFYLAGAVVALVVLIYRPRLFKGIDYHLLFT FIFFFLIVGNIANIHVLTDFISNTLVGPQASFLGTVIMS QFISNIAAPILISPFTPHAVSLVLGADIGGIGTIVSSMAT LIAYKVIRMNARGETRGFVKYFIIVNAGFVLILTLIGLIIV TLVG 32 Cluster: G8PA31 MTYNSTLPKVFVYLLTTIDTLYQTRVPLEVQNRKNVH Transposase LATSDCLVIACYLWGVLHFSETLKAKHQLAQSLFPNF LEYSRFVRRCNALLPSIQVIRQALVFKEVEGMSVSIID SFPIPLCQPIRNFRSKVLGDYANVGYNATKGQYFYG CKCHALVTVNQAMS 33 Cluster: A0A1V0PFP4 MAQSLFPNFLEYYRFVRRCNALLPSIQVIRQALVFKE Transposase VEGISVSIIDNFPIPLCQPIRNFRSKVLGDYANVGYNA for insertion TKGQYFYGCKCHALVTVNQAMS sequence element IS982B 34 Cluster: A0A0E2QIB2 MARRKFDKQFKNSAVKLILEEGYSVKEVSQELEVHA Transposase NSLYRWV 35 Cluster: G0WKP8 MQSYDLLDELDSEDKFRKDIKYSRQLPEMFSTEDINA Replication ASENITYAILGELRDRYNGSEPVTFSYQELAELGGLW protein VTRKNGVKSLYNGKRLQKIMYDLNEALKNFSYYQVR ETNDDGTPKSWKTINIFSVIDFDGTKKEVKLTISNAQI SSEQVDAKGHVIDKPLYVYDLINSKDWRTVKHLQYN RGINNSLPSKYSKRVYRFISEFRSFPKGTKMRIDDFD KKILKILKTQEDSFNTKEVFDLRKNRKKYLETAVKEIS ELNTPEGTQIVKNLDYIYHTSGRRIQSIEFTYTPFNAD LSGSNHISMNSRTSSPGTDSPFINEARMVLEYFNYLS KVNFNLDENGIIKHLPNYYDIQFELDDIQLLQPIHKLLE SGVAIDELLQVAEMKAIDWKLDSNQMINNFRPSVVF GNKFSEYRAFLTTYKAQNIHKLVFDSSSDFYVPMNG PWDSK 36 Cluster: G0WKP9 MTYNSTLPKVFVYLLTTIETLYQTKVPLEVQNRKNVH Transposase LATSDCLVIACYLWGVLHFSETLKAKHQLAQSLFPNF for insertion LEYSRFVRRCNALLLSIQLIRQALVFKEFEGIDVSIIDS sequence FPIPLCQPIRNFRSKVLGDYANIGYNATKGQYFYGCK element CHALVSESGYVIDYVISPASIADSTMAEEVLSQFGTPI IS982B VLGDMGYLGQVLHDRLELKEIELITPVRMNMKKKDIT FPNFSKRRKVIERVFSFLTNLGAERCKSRSSYGFLVK LEMTLLTYSLILKSAKTVNSMTLRYSTGYQVMAE 37 Cluster: A0A0V8DWK8 MEKVTDEIKNVVQRLLDDDENFSGWYIEKELEKIGIK Uncharacterized VSRMTISNLRNKKTTLGNTKFETLEGLYHFAKTHENI protein NKE 38 Sporulation_ P37522 MKTISLLNLKGGVAKTTTGGNIAKGLANRGFKTLLIDT initiation_ DMQANATSIFLEDKRSKEDYKGFAELIVDEKLDDVD inhibitor_ QYVYNVSENLDMIGSSLAVAESELKVRNSFNRNSSNIVK protein_Soj KVLKKLDSKYDYCIIDCAPTINLITLNIIIASDEIIIPIK IDKFALEGYRTTLKNINQIIDDYELDTEVTVLYTMVNRN NIDKQFIQEISGNRFETTIRHQAKPVTESALKNEVLID SSKSSKVKDDYLNLIDEIVKRG 39 Nucleoid_ MF_02015 MSNSFGFTDLMNKDEHKRKKTNTKNIPIEEIKENENN occlusion_ NYDLVDIDKLADSIDELGLLQPVLVKQRDKYSYELIAG protein HRRFNAIKKLISENRLPEDYEVLAKKVDEDEDELVTR LKLHETNLQTRSLLKMPEEEKIAIIDDYMDILDKAKKQ GLQINGKPVKGKTRDLIAERFGISHYTAQKLIRKAKE QGGEEEGAKISPQKKTAKKPITQLKKIETQLEKLEFE GTEEEQEIKKKLIELLMK 40 Cluster: Q2VHI9 MSVDRSYSPYEVIRAYHDRGMMKWGAFATGELTEA Uncharacterized QNTFEKEKKDDKVIQTLPHHVVLHLLNQSFSNQVQIK protein VKYQSKDKLTEVYGFVSEFINNQVRVKSTDKIYLISIE QIINIS 41 DNA_ P9WNT3 MEQLKLNKYFDYSLEPRRAILFQDVKSNYASIECVQR polymerase_ NLNPLTTSLCVMSRADHSKGLTLASSPTFKKVFGMK IV_1 NVSRASDLPFLIETRKFNYPQWYRTHTDIHGQRTEP TLQYVAFIESWAKRTWIVPPQMQLYVDYKIEVTDILT NYTSIDEIHSYSIDESFLDITESLNFFYPEIKNRYEQMN RIALDLQREIRDKLGLYVTVGMGDNPLLAKLAMDNYA KHNDNMRALIRYEDVPNKLWTIPKMTDFWGIGKRTE KRLNKLGITSIKELANADPLLLKQKLGTIGLQHFFHAN GIDESNVREKYTPKSTSFSNSQILPRDYHKQREIELVI KEMAENLAIRLRKGGKLASNLSLYAGAASTSEYSSV KVSRNIEATQNTKELQDLAISLFREKYQGGAIRQIGIS GNQLSDSSVKQLSLFESVQENQTNKKQESLQKAIDE IRETFDFLSIQKASSLSEGSRVIYRNKLIGGHAASQDK EEKDVS 42 Cluster: G8P9Y4 MDKYIRRAYQRMNQMSFGGQALAWFLSIRLSDLVLK Uncharacterized K protein 43 Cluster: A0A1V0P5K1 MAEAKFEAALIKKLEAEGWTYRKDLSYVSIKVLEGH HsdR type I WREVLNENNAYKLNGKPLSDVEFGLVIQEVQRIKTP restriction YDAQLLLVGAGGVGSIPITRDDGSNLEVWTNVKYLD enzyme R TK protein 44 Cluster: G8P9Y1 MIFKLRNRTEIAINKRKPKEPIIFHSDHGSHFKSASFR Transposase KLLDEHQLLASYSKPGYPYGNAVTEVFFKYLKHREIN TnpA RRTYHSIQEVQLSCFEYIEQFYNNYNPHSANNGLTP N 45 nan MKVTGFPKATYYYWVNCFERVNKDELVEKEMLKIRQ EHANAGYRPMSELLKQRGYHVNNKKVQRLMKKLGL RVTSYWHKSRKYNSYKGNVGTVAKNKLHRRFRTSIP HQKITTDTTEFKYYEDGIQKKCYLNPYIDLFNSEVISY HISKHPSYQSIETALNQALAVTSDCPYRRTFHSDQG WGYQMRDYVSKLKSHRIFQSMSRKGNCHDNSVME NFFGLLKQEIYYGHIFSSFEELEQVIVIWIRYYNTKRIK QKLNWMSPIQFRLNYQNN 46 nan MVKYSIELKQRVIQDYLSGKGGSTYLAKLHNVGSSS QVRRWIRNYRAEGLHTAHSKVNKNYSMELKENAVQ CYLTTDLTYEAVARKFEITNFTLLASWVNHFKIYGEV PISKKRGRRKKLESIASSMTQNPNDSQRIKELEQELR YAQIEVAYLKGLRRLEKNALMNKNQDSSTVSVKPSN SKKS 47 nan MKHHGKIKIKHAVKVLKVSRSGFYEYMHRRPSKQQV EREILSEKIKAVFHEHKGRYGAVRITKVLHNTGIMTNT KRVGKLMHLMGLYAKGSRYKYKHYNRKGASLSRPN LINQIFKATAPNKVWLGDMTYIPTKEGTLYLAVNIDVF SRKIVGWSMSSRMQDKLVRDCFLQACGKEHPQPGL IVHTDQGSQYTSSRYQSTLRQVGAQSSMSRKGNPY DNAMMESFYKTLKRELINDAHFETRAEATQEIFKYIE TYYNTKRMHSGLDYKSPKDFEKYNS 48 Cluster: A0A1V0PDS7 MNHFKGKQFKKDVIIVAVGYYLRYNLSYREVQELLYD Transposase RGINVCHTTIYRWVQEYSKVLYDLWKKKNRQSFYS WKMDETYIKIKGRGHYLYRAIDADGLTLDIWLRKKRD TQAAYAFLKRLHNQFGEPKAIVTDKAPSLGSAFRKL QSVGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYQS LRTASSTIKGMETLRGIYKKNRRNGTLCSDPQNIDFS NLYFWKGYNKLDTKLREIVERFIMARRKFDKQFKNS AVKLILEEGYSVKEVSQELEVHANSLYRWVQEVEEY GESAFPGNGTALADAQHKIKLLEKENRYLQEELELLK KFRVFLKRSK tRNA-Met nan RNA 49 Cluster: D2BMP1 MKTGDKITLSNGEQATVVSGDINLYKYALIVELENHD Cold-shock VRVVDRETLTLAKENPHENLGNHKKINKF protein 50 Cold_shock- P0A355 MNKGTINWFNADKGYGFIMADDMQDVFAYLLSIQGN like_protein_ DFKKYDEGQKVTFDIKMTSRGRYASNVHKR CspLA 51 Cold_shock_ P96349 MANGTVKWFNADKGFGFITSEEGKDLFAHFSAIQSD protein_2 GFKTLDEGQKVEFDVEEGQRGPQAVNITKA 52 Cluster: Q2VHI5 MARRKFDKQFKNSAVKLILEEGYSVKEVSQELEVHA Uncharacterized NSLYRWVQEVEEYGESAFPGNGTALADAQHKIKLLE protein KENRYLQEELELLKKFRVFLKRSK 53 nan MKHHGKIKIKHAVKVLKVSRSGFYEYMHRRPSKQQV EREILSEKIKAVFHEHKGRYGAVRITKVLHNTGIMTNT KRVGKLMHLMGLYAKGSRYKYKHYNRKGASLSRPN LINQIFKATAPNKVWLGDMTYIPTKEGTLYLAVNIDVF SLKIVGWSMSSRMQDKLVRDCFLQACGKEHPQPGL IVHTDQGSQYTSSRYQSTLRQVGAQSSMSRKGNPY ENAMMESFYKTLKRELINDAHFETRAEATQEIFKYIET YYNTKRMHSGLDYKSPKDFEKYNS 54 Cluster: A0A0V8EKB0 MLENEYFVFTSTLTTMIRKQAQSIITGLKGHNQNSVT DNA- KNTTRLVTGYFPIDLIKGYRPSQKLSEAKQAEQRGQ directed DNA QIIMMTEKQFIDFLAQSFYLLSQGL polymerase 55 Cluster: A0A0V8EK89 MKLREIIKEIPDDDWLEIIEQSSINYRSFIGRAPKKYIV Uncharacterized GELLDYEALYIGEVKKNKNYQNHRFLVEDKFIEHSGR protein 56 Cluster: A0A1V0PE50 MKKTIIFILHIPFILLLWLCITSPFFIKNSLLNSSFGHIFK Uncharacterized GVENISHSGPLATVLLLFVIPLLSLISCLYLAFKKNQSG protein RKYVIYILMSLFSLVCLSVFSVIMIIGLGNYL 57 nan MNHFKGKQFKKDVIIVAVGYYLRYNLSYREVQELLYD CGINVCHTTIYRWVQEYSKVLYDLCKKKNRQSFYSW KMDESYIKIKGRGHYLYRAIDADGLTLDIWLRKKRDT QAAYAFLKRLHKQFGEPKAIVTDKAPSLGSAFRKLQ SVGLYTKTEHRTVNYLNNLIEQDHRPIKRRNKFYQSL RTASSTIKGMETLRGIYKKNRRNGTLFGFSVSTEIKV LMGITA 58 Cluster: G8P9W7 MKTQELNLKQFVMLSEKELQEISGGGGWGSAFAGW Uncharacterized LGGIGVNSGQTAQQVVNQLNGVTDFHAYNHNPYGS protein GGTPND 59 Cluster: Q2VHK7 MFTLIFSNLTGGIIIKAIYKDKTVDVWEISKNNEQPDW Uncharacterized VKNAFKENYLSWYDERLKILMNGIKPSAKSSLKLGIM protein GSVAGSLAGGLAGNNIYVMGEIGDYLDITNRKVVSK EKFLKKYSV 60 Cluster: Q2VHK6 MKYFVTFLSPTQNMGILNWQTMILDDYLVDDSYWEN Uncharacterized TKLELSKEVEWITQSELYKKVKRNDGSGNDIILSVPV protein SAVLETIKSFFILGHS 61 Transcriptional_ Q3J6K8 MRNTKEKILTATEQUYKKGYTGTSINDILDETATGKG regulator_AcuR QFYYYFDSKKEACLAVIDNHVKIWQKHLLNGILSRDE SPLANLKEMLDWIYSDHAQKKIYYGCPVGNLVIELSA LDEDFRKPLEQLFSDLQKKIAENLSGLTGLLVKQNLP AAHAIIAQIQGSLLLLKVTQDLNVLESNFDLLKTIFEKV GEK 62 Cluster: Q2VHK4 MKKLDMIVIGPGPAPPTAVIRRKSLCQQLNLKKKSKL Uncharacterized LQVDAIRREYTIADVQKRWQSCQTFIDVLRKGILKQLI protein AELS 63 Cluster: A0A0D6E0F2 MQNNYTSKGKHLTESERLLIERWHNKEKVSNREIAY Transposase RLGKAPQTIHNEIQRGTVQLKYKTKYSAKIAQESYKT LRTHSKRSTKLNAQLDDQISKAVKNKISLEVIHQELK GVVCLRTLYNWISSGILSVAYHELLYPQYRKPKKQRV TQPKHMLGQSIEERPESVDERSEYGHWEIDTVLLTK EKGECLLTLTERKTRLEIIRLIPNKTTHSVNQALRGIEF LALSVTSDNGREFAKLSEALDCPVYYCHAYASHERG TNENHNRMIRRHLPKGTKKTTKQVVAYIENWMNNYP RKMFNFKTPNQMLIESI 64 Isochorismatase_ P0ADI7 MFNNKNTAFVVTDPQVEFLKPKGAGYGLTKDILRKY family_protein_ HTTENLTELFKHAKAKGYKIFISPHYFYDHDQNWKFG YecD GQGEQMMLNNKMFHREHQYQETVKGSGADFVEEL KPYLDENTIITSPHKIFGPESNDLALQLRKNGIDTVILA GMNANLCVDSHLRELVESGFHVHVAADATGAPGQE AYDAAITNFGFVADRTMSTAKVLEEL 65 putative_ P77212 MKKIDVKNIVVGFGKGGKTLAKFLSGKGESVVVIEQS pyridine_ TLMYGGTCINIGCIPSKFLIVNGEKGLKFTEASEKKAM nucleotide- LTGNLNLKNYHMIADEATAEVIDGKAKFVSDHEIEVM disulfide DAEGEVIAQLIGERIFINTGATPVLPPIPGLVDSRNVV TSTELMDLKQLPEHLTIIGSGYIGLEFASMFASYGSKV TVLDIFDNFLPRDDEDISKLVRSDLESRGIIFKLGVKID AITDNSVEIINKEGKKVSILSDKILVATGRKPNTAGLGL ENTNIQLGQRGEIVVNDKLETTVQNVWALGDVHGGL QFTYTSLDDFRIVSNNLYGDGKRSLSDRKNVPTSVFI TPALSKVGLNEKDAKAAGIDYRLFKLAATAIPKSAVLN QSKGLLKALVDPETDKILGITIYAEESYETINLVSLAIE VGLPYTLLRDKIYTHPTMTEALNDLFAAKNEVK 66 nan MELKENAVQCYLTTDLTYEAVARKFEITNFTLLASWV NHFKIYGEVPISKKRGWRKKLESIASSMTQNPNDSQ RIKEPEQELRYAQIEVAYLKGLRRLEKNALMNKNQD SSTVSVKPSNSKKS 67 Cluster: G8P734 MKVTGFPKATYYYWVNCFERVNKDELIEKEMLKIRQ Transposase EHANAGYRPMSELLKQRGYHVNHKKVQPLMKKLGL RVTSYWHKSRKYNSYKGNVGTVAKNKLHRRFRTSIP HQKITTDTTEFKYYEDGIQKKCYLNPYIDLFNSEVISY HISKHPSYQSIDIALNQALAVTSDCPYRRTFHSDQG WGYQMRDYVSKLKSHRIF 68 Cluster: I7LSK3 MSHKGNCQDNSVMENFFGLLKQEIYYGHIFSSFEEL Transposase EQVIVIWIRYYNTKRIKQKLNWMSPIQFRLNYQDN 69 nan MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVH LATSDCLVIACYLWGVLHFSETLKAKHQLAQSLFPNF LEYSRFVRRCNALLPIIQVIRQALVFKEVEGMSVSIID SFPIPLCQPIRNFRSKVLGDYANVGYNATKGQYFYG CKCHALVSESGYVIDYTITPASMADSSMTEEVLSQF GTPTVLGDMGYLGQSLHDRLELKEIDLMTPVRKNMK QKKILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQ GFQLKLEMILLAYSLLLKSAKSLEPETLRYSIGYQVMA K 70 Putative_ Q5XD45 MIKLVAIDLDGTLLDPNRQITAEVKTAVKKAKAAGVKI phosphatase VITTGRPLPGVVDILKALELTDQSDYVITYNGGLVQQ ATGEEFIKETLSSEDWLDLDAAARKIGLPIHAITREGIY TPNHDVGRYTVQEAQMVKMPLYIRQPEDIAALEIAKV MMVDEPAALDDGIAYLPFEFFERYNVVKSTPFYLEF MNKKASKGSAVQHLAEKLSFDLDEVMAIGDEENDRS MLEVAVCSVVMENGKSKLKKIAKYVTKSNAKSGVAY AINEWVLKDYQD 71 nan MKITFDEKTADKIKAFGDVDLVFDFDHTLSEVNTEVD ACAGGISRYRIVAVEKGNVPEVFDASIDSEFGPIYYK GYGSYFFQDEMYTKINPSYNLIELHSTAELLSPNLLIV DFRGKQKAS 72 Cluster: T0SFW4 MLSAGLLGIDPGHYIEHAFIGLVADKLRSFDLGVKIYE Uncharacterized SQEKTNPFYDI protein 73 Cluster: IS30 Q47803 MTYTHLTSNELAMIEAYYNNHQSVAKTAVLLNRSRQ family TIHKVYQFFKTGHNALDYFNQYKKNKTRCGRRPIVLS transposase DEQTEYIQKRVVQGWTPDVIVGRAEFSISCSMRTLY IS1062 RMFKQGVFEVTHLPMKGKRKANGHKETRGKQSFR RSLRDRGNDYSKFNQEFGHLEGDTIVGKKHKSAVIT LVERLSKVIITLQPEGRRAIDIENRLNQWMQSVPKHL FKSMTFDCGKEFSNWKSISNINDIDIYFADPGTPSQR GLNENSNGLLRKDGLPKQMDFNEVDESFIQSIASKR NNIPRKSLNYKTPIEVFLSHICKEELSNLI 74 Cold_shock- P0A355 MANGTVKWFNATKGFGFITSEDGQDLFAHFSSIQSD like_protein_ GFKSLDEGQKVEFDVEEGQRGPQAVNITKA CspLA 75 nan MNYFKGKQFQKDVIIVAVGYYLRYNLSYREIQELLYD LGINVCHTTIYRWVQEYSKVLYHLWKKKNRPSFYSW KMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRDT QAAYAFLKRLHKQFGQPRVIVTDKAPSIGSAFRKLQS NGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSLR TASTTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVLM GILA 76 Cluster: G0WKN9 MVTYTDLLPKPTENQQAFILDHGKTEDDGQLKYADD PIL7_11 AKSYGWNMRQYGKLKAGAVVLNRHPGKITKDRKWE IYGGGYVESVSDEDENGNVTAVITHAFTIEPPIKQGD SFIENFDWNTPNKKKRKKPNSWAYFWDQYGMNEIS YTDFVGLIENRHLSPIDDTQSLPVEKDLTNAEVEEIEE ASSKGFTVLVDEVGPNRPNGTQKRKFTGRHTDWER VNKAKQKTGALGEEIVLDFLIQKAEKNKTKLPEHVSK TEGDGHGYDIRAFDQSGNEIHIEVKASKTNFSDGFE MSANEVASSLEDTPYKIYFVHDLDVTSKVCKIKIYDG PFTEENFMMVPTNYKIFKK 77 Cluster: Q2VHL9 MFWTNVKYLDAHILKQNEQLKYENPTEENKLKIKALQ Uncharacterized LERKDLQAQYRKVIKKMKTYDAGQEIVQEKLKEKEIN protein KEKTQDIPS 78 Cluster: S6EPX4 MIYTIGYYIAVIGLVIMMFGFKSFYSQMNKWSRFGFIF Uncharacterized LALGLAFPIVYDFIVGFINGLLKNVN protein 79 Aminodeoxy P28819 MKLLLIDNYDSFTYLLVQYFEELDCSVTVVNDQDKM chorismate/ SQKIRISPDFICENYDAITISPGPKTPKEAVFSRDVVQ anthranilate_ LYAGKIPMLGICLGQQVIAECFGGNVVLGERPMHGKI synthase SVIRHNCQGIFKGLPQNLKVARYHSLIVDKLPNDFEID AQSEDGVIQAMHQPKLKLWALQFHPESLVTEYGHE MLNNFLKVV 80 Aminodeoxy P05041 MKEFIIKNTDIWKIFLKYYRSDEEIVFLHSSQATENEH chorismate_ YSILAHKPYKKVSKYKGQVFFNGEKKKFNFLDAVDLL synthase_ KNEKVERPKNWPFYPELLGFVSYEQDPAYFAAYDE component_1 VLLFDHRTKRLRVVQFEQTDGQYWLTESEEIEVDSEI EFDGQNGIGAVFIDQTRQEYIASIKRLQDYMKAGDIY VANLTQQFEIWSDQKPIDVFKKTRNQIPAPFSSFLQY PEWKMTQISSSVERFVSIHDGALISKPIKGTIARGEDV VTDRLQKEILSNSIKERTELLMVTDLLRNDIARISQPF SLSVPKFAEIETFSHVHQLVTSIKSRIKEDLTFSEFMT ALFPGGSITGTPKKRAMEIIKEVEKQPRGIYTGMQG WLSREMDLDMNIVIRTLVHDGEHYQLGVGGGITFES EAEAEFSEILLKAKPFLDILGLKDVPSILFTTGLVKNGE LLNLEGHVNRLKKQYHHPDLEEKLRKFAQNVTDGVL RVSTDGDSLNPEIRQLTHSNESYRVKLSSINDKPSPL SNFKLSGPDFQKVFRQEVLDVKKEGFQDILFHTDGL VSELSIGNFVAKKGNQYETPAKYALKGTFLDLFAKNH TLIYKDIAISDLKNYDCFYMTNAVRGLVEIKIDGISGSV AKFSKKSILV 81 nan MNYFKGKQFQKDVIIVAVGYYLRYNLSYREIQELLYD RGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYS WKMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRD TQAAYAFLKRLHKQFGQPRVIVTDKAPSIGSAFRKLQ SNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSL RTASTTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVL MGILA 82 Cluster: Q8GAR6 MDNKDIELIQQMENKYDTFMPVLTNLIDSVEKFNSIY Uncharacterized NNYIELRNFYGSEKWFEYMEIEKIPVKCGVLTEDQLF protein DMISDHNELLGVLLDLTSKMYKNF 83 Cluster: Q7BLP2 MVQDTLLDSFRAGRRNYTIFQVGKATLLRVSDVMKL Integrase KKTDVFNLDGTVKQTAFIHDQKTGKGNTLYLKPVQQ DLMLYHAWLIQQNMNSEWLFPSTSRPYRPITEKQFY KIMARVGDLLGINYLGTHTMRKTGAYRVYTQSNYYW LSYAFIKPFK 84 nan MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQELLY DRGINVCHTTIYRWVKEYSKILYHLWKKKNKQSFYS WKMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRD TQAAYAFLKRLHKQFGQPRVIVTDKAPSIGSAFRKLQ RNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSL RTASSTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKIL MGIPA 85 Bis(5′- MF_00199 MYNEVFVVSDIHGEYKKFKEILKYWDSNRQQLILLGD nucleosyl)- LCDRGLQSYECFYLAKYLCDNYGAILIKGNHEDLFLK tetraphosphatase,_ FLNKTEDFKENYIKNGGLKTLESFGYSENNTFKDIVL symmetrical DIKKNNDKLIEFLTYLPNFYEWNDYIFVHAGVNLKINN WKDTSIRDFMWIREDFHFTPNRLNKTIVFGHTETKIL NKNNKYDIWIHDNKIGIDGGAVYGGYLYGVILDVHGI KDYVYV 86 Cluster: T0VLA4 MINYQGEVFTETEFYGREILEAIQLTNKFPTPKKVLID Uncharacterized MLEEMIHEQLDLIDKEELNNYINAKKYVQTLTEDEVK protein NLCFEVKDLYEDVLKEFEIKL 87 Cluster: T0V569 MKKTGITNFSVFARRACCNKEIFTLDFSEYKNIISEISA Molybdopterin- TKSELKRIGNNINQIAKHLNENKNNQTESLMSDYQN guanine QLESLEEKIQKVVHYISEG dinucleotide biosynthesis protein MobC 88 Cluster: Q9FB66 MTVIYMPKQSNGTVHSAKDLKQLIDYVMNSEKTNDF Relaxase EYVSGQNILDIHSTCDEMLATRTMANALKNKPQKNE Mob DEI RFGYHFVQSFSPDDHLTPEQVHEIGCKTMKEYLGSS AEFIIATHTDKPHLHNVRPDRVLSQVV 89 Group_II_ P0A3U0 MKPTMAILERISKNSQENIDEVFTRLYRYLLRPDIYYV intron- AYQNLYSNKGASTKGILDDTADGFSEEKIKKIIQSLKD encoded_ GTYYPQPVRRMYIAKKNSKKMRPLGIPTFTDKLIQEA protein_ VRIILESIYEPVFEDVSHGFRPQRSCHTALKTIKREFG LtrA GARWFVEGDIKGCFDNIDHVTLIGLINLKIKDMKMSQ LIYKFLKAGYLENWQYHKTYSGTPQGGILSPLLANIYL HELDKFVLQLKMKFDRESPERITPEYRELHNEIKRIS HRLKKLEGEEKAKVLLEYQEKRKRLPTLPCTSQTNK VLKYVRYADDFIISVKGSKEDCQWIKEQLKLFIHNKLK MELSEEKTLITHSSQPARFLGYDIRVRRSGTIKRSGK VKKRTLNGSVELLIPLQDKIRQFIFDKKIAIQKKDSSW FPVHRKYLIRSTDLEIITIYNSELRGICNYYGLASNFNQ LNYFAYLMEYSCLKTIASKHKGTLSKTISMFKDGSGS WGIPYEIKQGKQRRYFANFSECKSPYQFTDKISQAP VLYGYARNTLENRLKAKCCELCGTSDENTSYEIHHV NKVKNLKGKEKWEMAMIAKQRKTLVVCFHCHRHVIH KHK 90 Cluster: T0UZ98 MKEISDNISKEYGCKIIVRPEQKLGNSHKNYLVYLAK Primosome NSYRKEIKNKLDFLMNHSHTWEDFKEKARALNLKVD assembly DTKKYTTYLLEGSEQTKKIRDRSLKNDKFLKENLKER protein PriA IEKNTIGYSVDEVVKLWKDKESIQEKGREKEIEILLEH WQVTKETEKDLVVTIDTAFDNEATIKIPARCVDKLEN GQYKIFIKKGDRFSYLDKKSPANHKIMYGATVAKNLQ RQSGNIPLYSDNVNIKLKQVFHEFDFLISQGLSFDRS FETIGEELKATYQETQHQLDKLDTKILEYVETTKTLPY EDTSIRDTIKNLTKERDDLRDTLYKVDKNIQYYQKSE QRLEAYQKNQSPKHKARDDDFEI 91 Cluster: A0A1B1RSI6 MSKNVKTIKELADELGTNKTRISRIINKNSIPTQKIKNKI Replication- VLEDNSVSLIRQYFKNETVSILRTELDKAHSHIEKLSN associated LSDQQQRLALQDKKLLEEYKAENDSLKALKMPTEGS protein QAEQANSQPKEEVKALKFEIRALQEELNKQKIHSQE RepX, RepB EREKLKAELTTPKKWYQFWK family 92 Cluster: G0WJT7 MSGFKRYDEDFKQSLVNLYQTGKTQTELCKDYGVS Transposase SSALAKWIKQYSQVRLEDNTVLTAKQIQELQKRNAQ LEEENLILKKASAIFMQNSK 93 Cluster: F9VEW3 MKAKKRIGTRAFKIILLRDYGVNISEGRILRLLKSMTLP Transposase KMSTIKPRFKSNKSPVFSSDNLLKQEFNPNSPNQVW TTDFTYISIGPKRHVYLCAILDLYSRKCIAWKVSDKID AQLACDTLEIALNKRKPKEPIIFHSDQGSQFKSASFR KLLDEHQLLASYSKPGYPYDNAVTEVFFKYLKQREIN RRTYHSIQEVQLSCFEYIEQFYNNYNPHSANNGLTP N 94 Cluster: G0WKP7 MRQLADALNVSFEYLTDTEILPIYQELSDDNKQQTIN Putative YAEDKLKSQKEQENIIHFRNSLIPYKQATEQALSAGL transcriptional GEGYTDNIETCTVYWDKQVNYDIGIPIKGDSMEPEFH regulator YGQTALIKYQSSPDYDGQVCAVDNVSMGNGFIKCVT VEEDGLLLQSLNIEEGQNGERKFPDIKLYWDDNPRII GKVVAAFTPIEIDFLFKNLEL 95 Cluster: A0A218PFY7 MERKKKKKENIWAIIVPILIIISLIGAWAYALRDSLIPND Exopolysaccharide YTKTNSSDQPTKTSVSNGYVEQKGVEAAVGSIALVD biosynthesis DAGVPEWVKVPSKVNLDKFTDLSTNNITIYRINNPEV protein EpsL LKTVTNRTDQRMKMSEVIAKYPNALIMNASAFDMQT GQVAGFQINNGKLIQDWSPGTTTQYAFVINKDGSCKI YDSSTPASTIIKNGGQQAYDFGTAIIRDGKIQPSDGS VDWKIHIFIANDKDNNLYAILSDTNAGYDNIMKSVSNL KLQNMLLLDSGGSSQLSVNGKTIVASQDDRAVPDYI VMK 96 hypothetical_ MAQTIQTLALNVRLSCQLLDVPESSYYERINRHPSKT protein QLRRQYLSLKISQLFNANRGIYGAPKIHHLLLKQGEK VGLKLVQKLMKQLQLKSVVIKKFKPGYSLSDHINRKN LIQTEPTKKNKVWSTDITYIPTQQGWAYLSTIMDRYT KKVIAWDLGKRMTVELVQRTLNKAIKSQDYPEAVILH SDQGSQYTSLEYEELLKYYGMTHSFSRRGYPYHNA SLESWHGHLKREWVYQFKYKNFEEAYQSIFWYIEAF YNSKRIHQSLGYLTPNQFEKVSA 97 Cluster: A0A0M2ZR43 MVDAYLDNNLGDDLMIRYFASYFYQHKIYLVESREHI Polysaccharide RKTFYDIPNIYFYSEEDYKMNEYDFQLHVTIGGSMFIL pyruvyl DDFKKLIRFRHRIKNSRKIKKRNIPSAIIGCNLGPFDKR transferase NFGLKLAKFELKYKNLVTVRDKQSKELLLRGFKRKKI CsaB, csaB NIKLFPDIIFSKVLYKSIPKYGLGMTLSQVFRVTNVEF 98 putative_ P71059 MKNKFSIIVPVYNGESHIKKCIDTLLKQTYNDFEIIIIND glycosyltransferase_ GSTDDTKSVLTKFYAKNLKVKIVNTSNKGVSFARNLG EpsJ INQSSGQYLLFVDSDDELSINALKYLSIMLNKKDRDLI LFGFSLTGDNNRKNDTSILKSIANQNTDCKMNILKSIL STKNNILGYVWRAVYSLDFIKKNNIFFETHLKISEDYL FLLQSVEHSNNLFVITEEFYKYNLGETSMSNKFVPTL LNDMVWVNNWIESNILTVYPQFFVGFNCLVANTYIRY VQNAIRNKEENFMLKYREIKINKRKYNFQRSINQVIFH LDKFDFKSKIGVILFRIHLDIVYELLFNIKERKN 99 Cluster: Q3ZK44 MTNLNRKKFFINFQSLVFFILIIIYGLTTKNVMGGSGIF EpsH SIDSILKYGILFICISVEGYIFLKNGNERRETSENYNNF KYYFIIITFLSLFASFKQVHFSFRTVQSFIFIFIPMLYSY LILNNWTFRQINFSMKIALFLSVIEYLFSIRMGFSQIISS LASINYNNTNASALESSTFALLSLGFAAYFGYYKKNF LCKIVSLLFVIMTFKRVITLSGCILVILGILKIKNLRVNRF FLIVSTITLVSFSLIYYYSIQPQNILEISEKIGFSIRDFST NRTDRLAWLSMTDFKSYGLGSTTDFMYKLWGVDLE MDIVQLILEVGAFGVIVFIYFYLRFSKSNLYAFSFMALL LLNSILSSGMMSTFSWIIILIAMSTIMEYKEGM 100 Cluster: A0A0M2ZW08 MKKLKISVIIRTYNEVKHIGEVLKSLTDQTYLNHEIIIVD Transferase SGSVDGTLDIIERYPVKLVSINKEDFNYSYASNVGVQ 2, NSSGDIVCFLSGHSVPVYKNYLEKINEIFQETEIGACY rSAM/seleno GEVIALPDGSITEKIFNRIGYLKSKLSLNNKRFFLENKI domain- HPGIFSCSNACARKKLLLKYPFKVELGHGGEDVEVA associated YRIIQDGYFVAKSVELLVMHSHGSSLKKFIKEYKAWG KMYEDVLKFIKKNNDKSQ 101 Cluster: Q3ZK46 MIFVTVGTHEQPFNRLIQKIDELVRDGQIKDDVFMQI EpsF GYSTYEPKYTKWASVIGYNDMTAYFNKADIVITHGG PSTYMQVLQHGKIPIVVPRQEKFGEHINDHQLRVSK QVIKKGYPLILCEDVSALKICIESSRIRTDEFIKSNNKN FISNFKKIIAFEE 102 Cluster: Q9X491 MKIALVGSSGGHLTHLYLLKKFWENEDRFWVTFDKT EpsE DAKSILKEERFYPCYYPTNRNVKNTIKNTILAFKILRKE KPDLIISSGAAVAVPFFWIGKLFGAKTVYIEIFDRIDKP TLTGKLVYPVTDKFIVQWEELKKVYPKAINLGGIF 103 putative_ P71062 MEFFEDASSPESEEPKLVELKNFSYRELIIKRAIDILG sugar_ GLAGSVLFLIAAALLYVPYKMSSKKDQGPMFYKQKR transferase_ YGKNGKIFYILKFRTMIFNAEQYLELNPDVKAAYHAN EpsL GNKLENDPRVTKIGSFIRRHSIDELPQFINVLKGDMAL VGPRPILLFEAKEYGERLSYLLMCKPGITGYWTTHG RSKVLFPQRADLELYYLQYHSTKNDIKLLSLTIVQSIN GSDAY 104 Tyrosine- P96717 MIDIHCHILPGIDDGAKTSGDTLTMLKSAIDEGITTITA protein_ TPHHNPQFNNESPLILKKVKEVQNIIDEHQLPIEVLPG phosphatase_ QEVRIYGDLLKEFSEGKLLTAAGTSSYILIEFPSNHVP YwqE AYAKELFYNIKLEGLQPILVHPERNSGIIENPDILFDFIE QGVLSQITASSVTGHFGKKIQKLSFKMIENHLTHFVA SDAHNVISRAFKMKEAFEIIEDSYGSDVSRMFQNNA ESVILNESFYQEKPTKIKTKKLLGLF 105 Tyrosine- P96716 MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFK protein_ MADQGIKSFLVTSSEAAAGKSTVSANIAVAFAQQGK kinase_ KVLLIDGDLRKPTVNITFKVQNRVGLTNILMHQSSIED YwqD AIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSV SDFFDVVLIDTPPLSAVTDAQILSSYVGGVVLVVRAY ETKKESLAKTKKMLEQVNANILGVVLHGVDSSDSPS YYYYGVE 106 putative_ P96715 MQETQEQTIDLRGIFKIIRKRLSLILFSALIVTILGSIYTF capsular_ FIASPVYTASTQLVVKLPNSDNSDAYAGQVSGNIQM polysaccharide_ ANTINQVIVSPVILDKVQSNLNLSDDSFQKQVTAANQ biosynthesis TNSQVITLTVKYSNPYIAQKIADETAKIFSSDAAKLLNV TNVNILSKAKAQTTPISPKPKLYLAISVIAGLVLGLAIAL LKELFDNKINKEEDIEALGLTVLGVTSLCSNE 107 Cluster: A9QSJ2 MMKKGIFVITIVISIALIIGGFYSYNSRINNLSKADKGKE Polysaccharide VVKNSSEKNQIDLTYKKYYKNLPKSVQNKIDDISSKN biosynthesis KEVTLTCIWQSDSVISEQFQQNLQKYYGNKFWNIKNI protein TYNGETSEQLLAEKVQNQVLATNPDVVLYEAPLFND NONIEATASWTSNEQLITNLASTGAEVIVQPSPPIYG GVVYPVQEEQFKQSLSTKYPYIDYWASYPDKNSDE MKGLFSDDGVYRTLNASGNKVWLDYITKYFTAN 108 Cluster: O06027 MNNLFYHRLKELVESSGKSANQIERELGYPRNSLNN EpsR YKLGGEPSGTRLIGLSEYFNVSPKYLMGIIDEPNDSS AINLFKTLTQEEKKEMFIICQKWLFLEYQIEL 109 hypothetical_ MSVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYNATK protein GQYFYGCKCHALVSESGYVIDYTITPASMADSSMTE EVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTP VRKNMKQKKILFPNFSKRRKVIERVFSFLTNLGAERC KSRSPQGFQLKLEMILLAYSLLLKSAKSLEPETLRYSI GYQVMAK 110 Cluster: A0A0B8QXZ2 MTIKNKKDLSSSIEQLEKAINQQETILKKFDNEQLDFE Signal QIKKLENLLIQEREKAKQVQIKINRSVLQNNSENYKER transduction KKRTRQLIQKGALLEKYLEAKHLTVDETEQLLQIFAN histidine MINKPELLVNFIGK kinase 111 Cluster: B1N0G0 MVQQIVLPIKDSNILKMVQDTLLDSFRAGRRNYTIFQ Tyrosine VGKATLLRVSDVMKLKKTDVFNSDGTVKQTAFIHDQ recombinase KTGKANTLYLKPVQQDLVVYHDWMVQQNLNSEWLF PSTSRPDRPITEKQFYKIMARVGDLLSINYLGTHTMR KTGAYRVYTQSNYNIGLVIHLLNHSSEAMTLTYLGLD QASRETMLDQIDFG 112 Cluster: G1FE57 MDQKEVSQNQTKYIQFRLSEEQYNKLKISGETYGLS Uncharacterized PNLYAKKLAQKSHLKKPYLEHDQAKSLLLELSKQGT protein NLNQIAKKLNQFDRMDNQDKELIEALRYTYGVLAQA QKGYQELWQQLQK 113 Cluster: H2A9L4 MATIAKISNGASAASALNYALGQDRPMHEKTEQWLQ Mobilization DHQLERPVELTNCRAVAVGGTNGIDPFIAKEQFDVV protein RQLHNQTKESNQVMRITQSFALDELNPKVQKDWQK ANDLGVELAENLYPNHQSAVYTHLDGKNHVLHNHIIV NKVNLETGKKLREQKGESVQRAREMNDRLASREN WHILEPPKERQTETEKELIAKNEYSYMDDLRERINKS LQDVSVSSYETFKERLSDNGVILSERGQTFSYAFLDA NNKQRRARETRLGSDFGKETILHELENRARQNEFSA VEQREPAITPLERDTQQRESEIVSLEQAIEPRKSEAL KRESKINRFIDTIKQFAGRVPELTQRVTRKLKQTKDKI LDDFERRFSKDMKNYEQEQQKSLEKQANRDVQSEK KPTKDHDRGMSR 114 Cluster: S6EPU9 MNKDEQLVVQVLNAYKNGKIDFSNVPELDRLVRQEV Putative NKDFRDYQEKIEAVANQKIESAIQEQLHRLEAENLKA mobilization TILKDIQVEKQALLALKKELNEQKEQIKADRKREIVER protein YGILIANIVCLFCFLVVGILIGRWIYKGIWDGWGLHILY DTVMEIKPKHPYGAVILGLGGFGLIGAGIYGSFRLMY TASTWFDQRPKIFKRIFPKK 115 Adenosine_ Q7DDR9 MVLDNKLGLTNSAELAKQEELLTKKRAKELFESGKIE monophosphate- DLEIGTFQGLSDIHQFLFQDIYDFAGKIREVNIAKGNF protein_ QFAPRIFLAQTLEYIDKLPQETFDEIIDKYSDMNVAHP transferase FREGNGRATRIWLDLILKNKLHKIVDWNQIDKDEYLN AMIRSTVSTNELKYLIQKALTDDLGKEQFFKGIDASYY YEGYYEIKTEDL 116 Cluster: O54680 MSIITEFEKNQKQVKALNELSKRKVVEHNSLITSIAKM RepB DKTPLKMFELAVSCINTEAPPKDHTVYLSKTELFAFF KVSDNDKHSRFKQAVENMQKQAFFKIQEKKEYGFE FENIVPIPYVKWADYHDEVTIRFSPEIMPYLINLKQNF TQHALSDIAELNSKYSIILYRWLSMNYNQYEHYSAKG GRREEQVETYRNPSISIRELREMTDTMKDYPRFQSL ESYIIKNSLKEINEHTSFKVTYEKVKKGRSINSIVFHIT KKRRADDNSYKLEDKVYQKAKVQKEQKENLLYAEA MQSKYTKLLLEHFLLSPYEMTNPATMAGLQRNVYPK YDELKDLMGIDGVKKHLSYIYDKQEPYSKGNIAKYLK KAIEQYLPTVKRRGL 117 Cluster: G0WJS1 MSDNLKTIKELADELGVSKTAINKKVTDRERKLWFSK Replication- IGNKFVINEDGQKSIKRMFEGLTENQESQTENLEQKP associated NSQTENFRNNNESNADIKYILDIIEYQKEQIKDLQNTK protein RepX DEQFKQLSNMQNLLDQQQRLALQDKKLLEEYKSEN DRLKVLKMPSQETKEEQANIQPQEELETLKEQTRAL NDKIKGQEELNNKSSKKWYQFWK 118 Cluster: G0WJS2 MFSYIYIILSYNTIKVKEVLKFEYRICTSFNWTSKFAEE Truncated MKTCFFNSGFKFKNFKGLDNRNAKEKSELISEAEVVI peptidase E LAGGHVPTQNIFFQQINLKNMSPVRIF 119 Putative_O- P37746 MQIAKNYLYNAIYQVFIIIVPLLTIPYLSRILGPSGIGINS antigen_ YINSIVQYFVLFGSIGVGLYGNRQIAFVRDNQVKMSK transporter VFYEIFILRLFTICLAYFLFVAFLIINGQYHAYYLSQSIAI VAAAFDISWFFMGIENFKVTVLRNFIVKLLALFSIFLFV KSYNDLNIYILITVLSTLIGNLTFFPSLHRYLVKVNYRE LRPIKHLKQSLVMFIPQIAVQIYWVLNKTMLGSLDSVT SSGFFDQSDKIVKLVLAIATATGTVMLPRVANAFAHR EYSKIKEYMYAGFSFVSAISIPMMFGLIAITPKFVPLFF TSQFSDVIPVLMIESIAIIFIAWSNAIGNQYLLPTNQNK SYTVSVIIGAIVNLMLNIPLIIYLGTVGASIATVISEMSVT VYQLFIIHKQLNLHTLFSDLSKYLIAGLVMFLIVFKISLL TPTSWIFILLEITVGIIIYVVLLIFLKAEIINKLKFIMHK 120 Cluster: O50546 MNLFGDSDYLEKLSSKGDPLERLEKVVDFECFRPTL Transposase NRIFKYDLKNKSHGGRPPYDLVLMLKILILQRLYNLSD DAMEYQMIDRISFRRFLKIDDKVPDAKTIWNFRNQLS KSNRGNWLFSAFQEKLESQGMIAHKGQIVDATFIEA PKQRNPKDENELIKANRVPVNWTKNKRAQKDTAAR WTIKGNERHYGYKNHIAIDTKSKFVKNYQTTPANVH DSQVIGVLVDPDEITLADSAYQNKATPKGAELFTFLK NTRSKSLKADDKMFNKIISKIRVRIEHVFGFVENSMH GSSLRSIGFDRAVLNTDLTNLTYNLLRHEQVKRLNLK TWR 121 Cluster: Q9RCJ9 MRKYMIYLSSLLVTFILSYATITWLIMPVLTRYQSLARL Orf14.9 INHFDYTALTLILLLTLIIWLFGIQYHLKHFSVIYLYLAFS VYLLLLFMVIFNKTTDFQAISLNPFDFIKADTRTIQEAV LNIIYFIPLGGLYCINTDFKQFVIISLVTLLGIETIQFIFYL GTFAISDIILNFLGCLIGYYCCWEIKKS 122 hypothetical_ MDETYIKIKGRGHYLYRTIDADGLTLDIWLRKKRDTQ protein AAYAFLKRLHKQFGEPKAIVTDKAPSLGSAFRKLQSV GLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYQSLRT ASSTIKGMETLRGIYKNNRRNGTLFGFSVSTEIKVLM GITA 123 Putative_ P71057 MKKNVLLSIIVPIYNVEKYIGSLVNSLVKQTNKNFEVIF glycosyltransferase_ IDDGSTDESMQILKEIIAGSEQEFSLKLLQQVNQGLS EpsH SARNIGILNATGEYIFFLDSDDEIEINFVETILTSCYKYS QPDTLIFDYSSIDEFGNALDSNYGHGSIYRQKDLCTS EQILTALYKDEIPITAWSFVTKRSVIEKHNLLFSVGKK FEDNNFTPKVFYFSKNIGVISLRLYRYRKRSGSIMSN HPEKFFSDDAIFVTYDLLDFYDQYKIRELGAVVGKLV MTRLAFFPDSKKLYNELNPIIKKVFKDYISIEKRHTKRI KMYVKMYVFSSYVGYKLYRLVKGKHWK 124 hypothetical_ MNHFKGKQFKKDVIIVAVGYYLRYNLSYREVQELLYD protein RGINVCHTTIYRWVQEYSKVLYDLCKKKNRQSFYSW KMDETYIKIKGRWHYLYRAIDADGLTLDIWLQKKRDT QAAYAFLKRLHKQFGEPKAIVTDKAPSLGSAFRKLQ SVGLYTKTEHRTVKYLNNLIEQDHWPIKRRNKFYQSL RTASSTIKGMETLRGIYKNNRRNGTLFGFSVSTEIKV LMGITA 125 Cluster: H5SYB4 MQQNLLKYYGMTHSFSRRGYPYHNASLESWHGHL Transposase KREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRIHQSL GYLTPNQFEKVSA 126 Replication_ P03856 MNDLEKRKVVEHNSLITSIAKMQKTALKMFELAVSCI initiation_ DTENPPKDNIIYLSKKELFAFFDVSSASKHTRFKEAIE protein LMQKQAFFQIKEVKDKGYEMTSIVPIPTVKWNSYND DVMIQFNQFIMPYLIDLKAEFTQYKISELKELNSKYSII LYRWLSMNYNQYEHYNVKGGRRAEQVENYRKPSIS VKELREITDTVNEYKEIYDFEKRVLKKSLAEINAHTSF NVNYEKIKKGRSIDSIVFHIEKKRMADDNSYKLGDKD YQDDKKQKSRNEADLLKQAMESKYTRLLSENFLIGM NDIMDTTTMVGLQKNVYPLYDELKELRGLNGVKDHL SYVSSKREEYSKHNIAKYLKKAIEQYLPTVKRQDLEN E 127 Cluster: A0A0D4CCQ1 MNDNLKTIKEVADELGVSKKKIENKLSYIKKKGNTLG RepX-like KVIGGVRYLNKQEIKILNISPETSKAPETSKVPETSKV protein PETSKVPETSKVPETSKAPETSEVPETSKVPDKHVF SSSFDLLREQTAYLLKELEEKNKHIEKLIDNEKSMQN LLDQQQRLALQDKKLLEEYKSEINELKALKMPQEDM KDDSSIRGEAQEEIVRLKAQLKLSEEERNKAKEKEPV KTESKKWWQLWK 128 Cluster: G6FEV8 MNFGEVLQTKRKSMGLTQEDLADKLFVSSKTISNWE Uncharacterized TNKTTPDIDNVIRISQLFDISLNNLLLEGSNMVENIKKK protein AEINNLKKYSYCTVITDLVFLFIILSSHYGAELPISILIAT CIGIGVNIAVMFYFLNRIKILEDKTKKQQRKEIFITIILCI LAFVVTILVSWFKH 129 Cluster: G6FEV7 MIDLEEEGFLVLWGISIASSYTETISTLQQSGGSAIFT Uncharacterized FLTYAIGLLFFILTVLPTNAVTTKSDNGFILFFLRAK protein 130 Cluster: A0A0B8R3X5 MNYIKKFFIVLRLAILSQIGVAVYGGAKGFSLENGAHK Exosortase LSLLAVLILIIFIVGNIYLLMYLGKKLGFLTLSKDFLTKK E/protease, NIIYILVGTLIARTAGIGGTLLLNATGVTQTANDETIGQ VPEID- LFTGENPLLIILLIGIAAPIMEEIVFRGGIVGYLFKDLPV CTERM VGIIVSSVLFGLMHSPTNIISFLIYGLIGLTCAIAYFKTR system, xrtE RLEVSIAIHFLNNILPALVLAFGIS 131 Cluster: S6FVR0 MKKIKNRERIIQKKFFVNEKEDERIKLMMRKTGITNFS Mobilization IFARRACCNKEIFSIDFSEYKNIISEISATKSELKRIGNN protein INQIAKHLNENKNNQTKELMSDYQKQLENLEDKIQKV VHYISEG 132 Cluster: Q93T03 MAKKQNYIWRNDRNFALDEYEQQQYYYVVESNDIIN Replication KARHDLTARELKLMDFVISKIQPEDTQFNVIKTSMYE protein LTKVLNIKQNGKNYGDMAKAIGDLRKKEVLIYDDVHR TVTQTGWVQSAKYQENGQVEIKLNEDLAPHLLGLKT HYTQHLLIDTTKLKSRYSILLYKLMREADKDKGNSIAIL QGTPEEFKEWLGAPKDYEYKDLKRNILKKAVEEINLK IDDMDLEILQGRCGRKVVQVEIHNNWTVQRAIEENS EYVESITTHDWLKGDSK 133 Cluster: G9ZK11 MIYTSGYFIAFLGLIIMLFNFKDLYPKLNIWCRLGFILL Uncharacterized CLGLILPMLFGFITGFINNH protein 134 Cluster: O53072 MAREKSDIEYQVVTVRFPKEIYQEYKKILKSEGKIPTY Uncharacterized DLRNYIFSVVDEYEKGQR protein 135 hypothetical_ MNYFKGKQFQKDVIIVAVGYYLRYNLSYREIQELLYD protein RGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYS WKMDETYIKIKGRWHYLYRAIDVDGLTLDIWLRKKRD TQAAYAFLKRLHKQFGQPRVIVKDKAPSIGSAFRKLQ SNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYQSL RTASTTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVL MGILA 136 Cluster: A0A0E2UHK8 MAGYNVLDDAKARNLGLDILEVKETEYAVVPVKGSV AraC family PDSIHQAWKYLLEEFFPENGYKHSGLPDFEVYTENDI transcriptional HDPNYEMELWVPISKQ regulator 137 Cluster: D2BRG5 MIIVAVGYYLRYNLSYREVQDLLYDRGINVCHTTIYR Transposase WVQEYGKLLYQNGFYQGTEHRTIKYLNNLIEQDHRP of IS1216E, VKRRNKFYRSLRTASPTIKGMEAIRGLYKKTRKEGTL IS6 family FGFSVCTEIKVLLGIPA 138 Cluster: Q48724 MIKNHWMKKLKYLSLFFLLFAIYWFPDVILAYPEVYLK UPF0177 SLVGYERQVVATWIFLGNMSISLFLGILICYKLGYYKNTIS protein in IFKIKNLLFLLITTIILFVIYFFSYTYYNSHFITPGIAKT abiGi QAAFSIQIVFPFVQFITIAICAPIFEEAAFRTTIYRFFKN 5′region DKIAYIVSCVGFAWMHTGPNPILIVYLPMSIVLTSIYHR RRVLGESILVHGVFNALLPIVIPLLQVITGLYYL 139 Cluster: A0A0M2ZU19 MKYFVTTLSPSKNMGTMNWQTMILSDYCVNDSYWE Uncharacterized KAKRELSEEVQWVTQSDLYKKIKWNHDSNDDIILSKP protein VSIILETVKSDFPHANVWVYQ 140 Cluster: A0A0M2ZU05 MEIQTNFQIISDEELSEIVGGGYPNNQSMNDVLHWL Bacteriocin- NGHNDGNPKQLPKWMCGLG type signal sequence 141 Cluster: A0A0M2ZV61 MTKYIYPNLKDNQKYLLKIIDGILTSNNISSEEKKLFLIA Uncharacterized KSNIEKGRNFDPQISELISSLQYLVHSDDVLVFFEEAR protein KIMQINPGTGGSPYGWSNFESK 142 putative_ Q60048 MAKITLNFQKRLQQHSNHLVILSAILIVLGYLGKYGVNQIW cadmium- IWNSTMIIASIIGFIPVAIHAYQAIKVKQISIDLLVSIA transporting_ VIGALFIGEYEESAIVTFLFAFGGFLEKKTLEKTRSSIK ATPase ELTNMAPRTALSADGEEMDIDEVEIGDKLLVKTGRQ VPVDGRIYQGSGYVNEASITGESREIRKEAGTKVFA GSILENGTIYVEAEKVGEDTTFGKIIELVEEAQDTKSP AEKFIDRFAKYYTPAVLVIAAITWVFSHNLELAITILVL GCPGALVIGAPVSNVAGIGNGAKRGVLIKGGDVMNT FSHIDTLLFDKTGTLTKGNTEVVVVKNYGASKELIDA VASAENESDHPLATAVVRMIGKFNPIKFEKTDVVKG QGIIADNLLIGNEKMMVVNHITISPEQKQDITEITDSGA SVVLVAADNRLQLIYGIADEIRSGVKESLEELRHEGIS RMIMLTGDNETTAKAVAAQLGIDEVRANLMPEEKAE VVKSLKNSGKKIAFIGDGVNDSPSLALANIGIAMGSG TDTAIETSDIVLMRSSFDELVHAYGLSKRTVANMTQN IVIAIVVVLFLLASLILGGTGLVPSFVNMGTGMFVHEA SILIVIVNGMRLIRYREK 143 Cluster: A0A0D6E0F2 MQNNYTSKGKHLTESERLLIERWHNKEKVSNREIAY Transposase RLGKAPQTIHNEIQRGTVQLKYKTKYSAKIAQESYKT LRTHSKRSTKLNAQLDDQISKAVKNKISLEVIHQELK GVVCLRTLYNWISSGILSVAYHELLYPQYRKPKKQRV TQPKHMLGQSIEERPESVDERSEYGHWEIDTVLLTK EKGECLLTLTERKTRLEIIRLIPNKTTHSVNQALRGIEF LALSVTSDNGREFAKLSEALDCPVYYCHAYASHERG TNENHNRMIRRHLPKGTKKTTKQVVAYIENWMNNYP RKMFNFKTPNQMLIESI 144 Cluster: P94884 MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYD Transposase RGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSW KMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDT QAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKE YGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSL RTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVL LGIPA 145 Alpha- Q8L208 MNSRIFQHNTFTTLSIGFYKGTITLKEALTHGKVGIGT acetolactate_ LDTANGEVTIIDGIAYHGDSENQVRLVEENETMPYVA decarboxylase MVEHQPIVKFTDNSVSNSEDFLSALTKRFPTANTAYT IVMTGQFKEVTVSSKPANNTRPYDEIMADQPYFTKE NISGTMLGVWAPKHLTDLFGIGFHLHFVSEDKTFTAH VQNFITENLAIELGKITQIEQEFPDEDENFDQHLFQ 146 DNA- P03013 MNIGYARVSTGLQNLDLQKDSLKKYNCEKIFTDHMS invertase_ GSKRERPGLKSAIEFSRPGDTIVVWRLDRLGRNMED hin LINIVNSLNNKGVSFHSLQENITMDKSSSTGQLMFHL FAAFAEFERNLILERSAAGREAARARGRLGGRPEKF SEQDVKLLKTLVESGTPIKSIADSWGVSRTTIYRYINK F 147 Cluster: D2BPF3 MKIITATLLLVISLLGILGTAFLYLGELTQGKGGGFLFIL Uncharacterized GCFLILGIQSFTWLEILFGKRQNGEVKKYDYFLFNILK protein VIFSIGALQLFIQRCFF 148 Nitrogen_ P29286 MSKYKHHFSHHEHHCVQLVPLFGLLSESELVQVEQV fixation_ VNHKIFEKGETVISPFAVPQLAIVAHGTLKIYQLSSAG regulation_ KEQLLRVIEPGGYAGEDALFGVMNDNLYGETLEETQ protein_ ICFLRQQDFKNLLLKYPELSLKLLETTVRRAAEMQYQ FixK AQFLMMEDVESRIANYLLQLVKVVDSNSVMIPMKMK DLATFIGTTPETISRKFKILEEKGFIERRGKIIKILDID SLEDDYA 149 Cluster: Non- A0A161UM95 MMTKLMIDEKYAKELDKAEIDHHKPTAGAMLGHVLS specific NLFIENIRLTQAGIYAKSPVKCEYLREIAQKEVEYFFKI DNA-binding SDLLLDENEIVPSTTEEFLKYHKFITEDPKAKYWTDE protein Dps/ DLLESFIVDFQAQNMFITRAIKLANKEEKFALAAGVVE Iron-binding LYGYNLQVIRNLAGDLGKSVADFHDEDEDNDN ferritin-like antioxidant protein/ Ferroxidase 150 Cluster: A0A0M2ZU22 MSKVIMRLNELSCPSCMAKIEAAMTTTKGVANAKVL Copper ion FNASKVKAEFDENVVSADELISKVEKLGYPVLSSKVT binding VV protein 151 Cluster: P94884 MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYD Transposase RGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSW KMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDT QAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKE YGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSL RTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVL LGIPA 152 hypothetical_ MKMLRVQKPLLFKFSQIQVLQYTKTQDAVYKVNSNTI protein CSVYKLSFTLVQLRL 153 Tyrosine_ MF_01808 MTYIELNPVNNVVLPKHNSSVEDFEISENKTITYDELK recombinase_ IVLEYCHKHNKNQRLTLIIEFLFLTGLRLEELGGLQKS XerC SVDFKKQTIKIKHVIDTKAIGDNSRKLYLPKTFASRREI YVNDRCIEILKWFFDNSLDDDFVFTTMIGTTVKQSAT YLFVRNVCEASLGKQKNRKYNVHMLRHAHISLLAEL DIPIKATMKRVGHSQESTTLRIYSHVSQKMNDSIMRK LNEI 154 Cluster: P94884 MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYD Transposase RGINVSHTTIYRWVQEYGKLLYQIWKKKNKKSFYSW KMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDT QAAYAFLKRLVKQFDEPKVVVTDKAPSITSAFKKLKE YGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFYRSL RTASTTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVL LGIPA 155 Replication_ P13921 MKQKKREQRSNKWAFLIYQESVPEDYLNLLEELHVP protein_ FILSPWHDKDVNRTTGEFKKPHKHGVFFFESLKSYS RepB QVSELISDKLNSPEHVEVVMSPKGMYDYFTHAENPE KSPYNIEDIESGAGFELDKFLAENNEDLLNQVYEVMR DSGIKEFADFTDLIAKQFPDLLYFVFSKSYFFKIYLDS KRYIEIKQKDDEDNHGK 156 hypothetical_ MENNYPYLLNREQASKFIGIRDDTFSVFFIVKIS protein 157 Na(+)/H(+)_ P26235 MEDIFQITIILFFSMLATLLSKKLKIPEVVGQMLIGIILAP antiporter SVLGLINGGHTIEVMSEIGVILLMFLAGLESDLEVLKK NLKPSILVVLLQSLKIKRALSELQIS 158 hypothetical_ MNHFKGKQFKKDVIIVAVGYYLRYNLSYREIQELLYD protein RGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYS WKMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRD TQAAYAFLKRLHKQFGQPRVIVTDKAPSIGSAFRKLQ SNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSL RTASTTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVL MGIPA 159 Cluster: I6TH45 MSEHLNMASIKKKQPNRKERKQISFRVSEPEYLNLE MobC RSAKVLNISVPAFVKKKAQGARVVAPKINPDDSKEM mobilization ARQLAALGNNVNQLAKRVNQIEFADKDTQERLSADL protein RRTLHGLGEIWRQLT 160 Cluster: A0A1V0PDY6 MATTHIKRSNGASRLVNYAEKRAVQKDGYNLDIEYA Relaxase/ KSELKQVREIYGNKGATQAYASRVAFSPKEFDPKNV Mobilization KDQLKALEIAKEIYSTAYPNQQIAMYVHNDTDSLHVH nuclease AVIGAINLLTGKKMHGNWQEYRERLVKITDKVVEKH domain GLTVTVPHPRPEKRTMAELKMKARGQVTWKDKIRQ AVDTTMREAHISDFKSFKEKLGELAVNVIERGRDLTY TLTGTDYKSRGAKLGEDYKKETIFYELDRRNQLQYG TSRQRQGRAWLEGRGERLEQEQRARQNLAKRAED LQRRTLESTEQSIQPSHQRPQKSKERGLGGPSL 161 Cluster: A0A1V0PDZ8 MVHEIVQYHNDFNTVPLRGFNERERRIVMALLHQVK Replication NKDVEVVQLDFDTLRGLSGWNDTLAKSENSNAKFN initiator RYLENLSDKIMTLRGTLRSEDGLQVVKFSLFPTFIIDG protein KNTMTLKVQINPTFKYLTNIFDMFTAFELDDYNRMNT SYGQELYRLLKQYRTSGFYRVKIEDLRHLLSVPESYT NAKMDQKVFSKTTVTDLTNAFPNFKIKQERGTGRGR PIIGYTFTFDKEAPNKYELDRKKQEQIAQFWKSNDPE PMPNAVAQTEYQNPELRKEKEELEKHNASFGDLLK GWFKK 162 Cluster: A0A1V0PDX6 MKFKKKNYTPQVDEKDCGCAALSMILKTYETEKSLA CAAX amino SFLLNQRIKMHKVFEKIITIFFAFFLFFISQIPIYYVNYK terminal NKENNLYGISNKISLPFIFIALFVIIIAVALGKKRGFYHHSK protease KTLEFKNIMLILVLVTISIILNILINRFIIFHHLGIMNNQI family protein NIDSILSSLSCLGKIFGIALLAPILEESIFRASIYQIFNND KVSFLISSLLFAFLHSGYSWVFFTYLPVSLCMTFIYHR RKILTDSILFHSLFNLLVLGLNFLI 163 Cluster: A0A1V0PES5 MLDILNKARIHKKWFLFSYSIISFCITIIYIVFNHTFFKVN Putative WAKYNSDDSYKNKVDEILKHGVFWINGNLTSISSPLL transporter ICLFLLGAFFSLTIFFLTWRNLSTRTWTPIISFLGFLIPF IHSDGNFINLLILSFILILFGAISSVPSLRYF 164 hypothetical_ MNHFKGKQFKKDVIIVAVGYYLRYNLSYREIQELLYD protein RGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYS WKMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRD TQAAYAFLKRLHKQFGQPRVIVTDKAPSIGSAFRKLQ SNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSL RTASTTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVL MGIPA 165 Cluster: O54674 MSIIPEKQNNQKQVLTLNELSKRKVVEHNSLITSIAKM RepB DKTPLKMFELAVSCIDTEKPLEDNTVYLSKRDLFAFF KVSDNDKHSRFKQAVEKMQKQAFFQIKEEAGKGFK FKSIVPIPYVEWTDYNDEVKIEFHREIMPYLINLKKNF TQHALSDIAELNSKYSLILYRWLSMNYNQYEHYSVK GGRRAEQVEAYRNPSIKVKEMRLMTDTVNEYHKYN DWDRYILKNSLKEINAHTSFNVTYDKIKKGRSIDSIVF HIEKKRMADDNSYKLGDKDYQEDKARKAETEDMLTL QALKSPYTKLLMEHFLLSYLDLTDTKILSGLQAHVYPL YDELKDLRGLNGVKDHLSYVRAKREDYSKKNITKYL KKAIEQYLPTVKRQDL 166 Cluster: Q2VHR8 MSEKLKTIKELADEIGVSKQAVWQKIKKESSIDLRQFT Replication- SKKGNTVYVDVDGQKVIKSAFF associated protein RepX 167 Cluster: G9BNK7 MVKKLLRVLFFNKTSTKKRQQKVFVDDNVNNSVDG Replication NPEGNEEILFLRNLVSELQSEKKDLHKLLDQQQRLAL protein X QDKKLLEEYKAENDSLKALKMPTEGSQAEQANSQP KEEVKALKFEIRTLQEELNKQKIHSQEEREKLKAELTT PKKWYQFWK 168 Cluster: A0A0H1RR04 MNKLKKLQELEAKSDKQAELMGELEARLGLIENKQI Uncharacterized protein 169 Cluster: G8P721 MANTETVIWKSVKGFEGQYEVSNTGLVKSFKGKTER Uncharacterized IDRFDSNVQEILKRLSYDDCRRYKR protein 170 Cluster: G8P722 MNMKNKTNENFVQIPNKMFMNINNDEKLVYVKLLQ Uncharacterized SQMIGYLDKDNRTTMTTVSLLVTLLGWSKGQYSNKK protein VVKALNGLKDKKYINFESIQDVFTVQINKWNDKEEHI VPVDWKQSGVKFSGHTQIRLSVIDNLLEGKDFTLYA YTEYRKMKTHQYRICYEEWGFVLRMTKDGAFKNVN SSEVIIKVSNGFDSDTKRRETNSYLTFDSVEDVKEVS LKPTYKAQSSKSVVKEQEPELVEDDFDNFEEEELSF KAEAKKPLIKEKKITKKQANELKDEINKFFGNTMEDNI FKKMASDKRITSVEQAMEIQDINKPMSLEMWKVVQD SDNFFVRESGNKKLKNKAWQKKFWSDLKEEIDKAK ELAYKTKFTSKYLYNTITEYYVDGGECVISSDKLYDY VHNRRVYSNDEYTYFTPTNMVPHLKFIKVTEKY 171 Cluster: A0A0V8EN50 MYFCYSNKQKDFLNQKGIDSLFSARHAKTNKLFYVF Uncharacterized YQSEELGQALTEFTEKKAEFFKNN protein 172 Carbon_ P15078 MKDIGNSSNFTEDEELFLLRNKQGKIVGIKDLKQANF starvation_ QETMKDWKKHLPKPSLLSIIIWVAVALLGGLAWSLIAL protein_A AQGETINAIWFVIAAVCSYLIGYRFYALYIQRKIMRPN DLRATPSESHNDGKEFDPTNRVVLFGHHFASIAGAG PLVGPVLAAQMGYLPGTIWIIFGVIFAGGVQDMLVLW YSHRRRAKSIGAMAHDEVGRFAGGLTSFIVFIMTMIV LAVLALICVTAMANSAWAVFSIGMTIPIALLMGIYLKYI RPGHVNEISAIGFILLLVAIFGGRWVSESSFAHIFMLS PTALVWWVMGYTFIAAIIPAWILLTPRDYLSMFMKIGT IAVLAIAVVGVRPDVTIPALTNFAHNTDGPAFAGSLFP FLFVTIACGALSGFHVMMSSGTTPHLIAKESQTRMIG YGGMLFESFVAIMALVAAISLNPGIYYSMNTPQASIQ KLAASSYQADKSAEYNAAKAIPNVAMMPDGSKLSID WEGTTGEKALEQVAKDVGEQSIVSRTGGAPTLAVS MSNILHKVPLIGGTNMMGFWYHFAIMFEALFILSAVS AATKSTRYLLNDALRGFKKLGRLGDDDWLPSKIITTA VIVGVWGALLLMGVSDPNGGIKIMYPLFGISNQLIAAV ALAIVCVMVIRKGYLKWVWIPALPLVWDVCVTFAAS WQKIFSNDVNIGYFASYSAAKAQVASGKISGLALTNT QATMRNTMIQGSLSVIFLLCVAILLVICALKVAKILRTN EVGDKFSSEEVFEESNLFETSSFWPSKLEHKVLKSK VNE 173 hypothetical_ MNYFKGKQFQKDVIIVAVGYYLRYNLSYREIQELLYD protein RGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYS WKMDETYIKIKGRWHYLYRAIDVDGLTLDIWLRKKRD TQAAYAFLKRLHKQFGQPRVIVKDKAPSIGSAFRKLQ SNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYQSL RTASTTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVL MGILA 174 Cluster: G8PA25 MKTLIHEDLRGKIIYLQEEIPFGOGRLIEQLRLPFLSQK Putative LLTIPLIVDLKLAEFIRRQLYYCSPKWLKLQEKYYQRG competence ENLLNLTFERSFIAPLGLNLLEVFDDEIPLHKFTQIKQ protein/ NINLYYENFLINFQQNSFKAVYPPRFYAIMKKQKKDM transcription NE factor 175 Oligoendopeptidase_ P54124 MAKNRNEIPEKLTWDLTTIYKTDKEWEAELTRIKSEL F,_plasmid SLVEETDPGHLLDSAESLLTITEKMLSISQQVEKLYVY ASMKNDQDTREAKYQEYQSKATALYVKFGEVYAFY EPEFLKISKEVYNKWLGELQKLKNYDHMFERLFAKK AHILSQKEEKLLAAAGEIFESPSETFEIFDNADIKLPM VKNESDEMIQLTHGNYSSLMESKNRGVRKAAYKALY SNYEQYQHTYAKTLQTNVKVHNLNAQIRSYDSARQA ALANNFVPEKVYDVLMEAIHQHLPLLHRYIELRKKILG ITDLKMYDIYTPLSNLDYKFNYEDGVKKAEEVLAIFGK EYKGKVKAAFEQRWIDVEENIGKRSGAYSGGSYDT NAFMLLNWQETLDDLFTLVHETGHSMHSAFTRENQ PYVYGNYPIFLAEIASTTNENILTETLLKESKDDKERF ALLNHWLDSFRGTVFRQSQFAEFEQKIHEADAAGEV LTSEYLNSLYGEINEKYYNLAVKENPEIQYEWARIPH FYYNFYVFQYATGFAAATFLAEKVVHGSTEDRQKYL EYLKAGSSAYPLEVIAKAGVDMESTDYLDAAFELFEN RLSELEKLVEKGVHL 176 Cluster: P94881 MVETYKRTSNPMMNRPVVKAELVEWMRSSQTQITG ORF4 ELASLASVPVLTRLFPLV protein 177 Cluster: Q48667 MQKRYSKEFKETLIAFYHSGOSVTQLSKEYDVAPATI Insertion YKWIDLYSKSNESSVSKADFLELKRQLAKVKEERDIL sequence KKVLTIFAEKKK IS981 178 Serine_ P0ADI0 MKIGYARVSTFEQKLESQIEVLKEAGAEEVFQEKFTG recombinase_ TTVERPQFNLVFKKLKDGDTLIVTKLDRLARNTREVL PinR EIVQSLFNRGIKVHILNIGLIDNTPTGQLIFTIFSAFAQF ERDLIVIRTQEGKNFAKLHDPSFREGRPQKFTEEQI QFAYELKQQGMTYKMIERKTGISIATQKRRFIKAKNQ AIDKDY 179 Cluster: Q52233 MKEYFQGDEFKDISKNGKDRKWKERKINNLNLAKIF Replication DSLDYPDSFIFNIKSCAEYLNFKRSSDGSLRLFQMYT protein CKNKQCAICSWRRSMKYQVQISKIVEEAMIRKPKGR FLFLTLTVENVSGEGLNNELSLLSEAFNRLMKYKKVS KNILGFLRATEVTINESMDTYHPHIHVLLFISPTYFKNK NNYISQDEWTELWKKSAKLDYRPIVDVRSIKPKNEKT SDIRSAILETAKYPVKPMELNYDSAKVVDDLQKGLYR KRQIAFGGLFKQIKKELELDDIENGDLINIGDEENPISD GEIISVLWNHERQNYYVR 180 Cluster: T0VQK1 MTCSNLTIHLHAKNRSKLFGSKKYALQELEAESTAFV Uncharacterized VANHLNIDTKDYSIGYLNSWGFDKISDEQLENVIKND protein KLSNNKIKGENE (Fragment) 181 Cluster: T0VLA4 MINYQGEDFTETEFYGREILEAIQLTNKFPTPKKVLID Uncharacterized MLEEMIHEQLDFIDKEELNNYINAKKYVQTLTEDEVK protein NLCFEVKDLYEDVLKEFEIKL -
TABLE 4 Selected Exopolysaccharide producing Lactococcus lactis cremoris Proteins not found in Lactococcus lactis cremoris Strain A SEQ ID NO. name uniprot_id Protein Sequence 182 Cluster: A0A218PFY7 MERKKKKKENIWAIIVPILIIISLIGAWAYALRDSLIPND Exopolysaccharide YTKTNSSDQPTKTSVSNGYVEQKGVEAAVGSIALVD biosynthesis DAGVPEWVKVPSKVNLDKFTDLSTNNITIYRINNPEV protein EpsL LKTVTNRTDQRMKMSEVIAKYPNALIMNASAFDMQT GQVAGFQINNGKLIQDWSPGTTTQYAFVINKDGSCKI YDSSTPASTIIKNGGQQAYDFGTAIIRDGKIQPSDGS VDWKIHIFIANDKDNNLYAILSDTNAGYDNIMKSVSNL KLQNMLLLDSGGSSQLSVNGKTIVASQDDRAVPDYI VMK 183 Cluster: A0A0M2ZR43 MVDAYLDNNLGDDLMIRYFASYFYQHKIYLVESREHI Polysaccharide RKTFYDIPNIYFYSEEDYKMNEYDFQLHVTIGGSMFIL pyruvyl DDFKKLIRFRHRIKNSRKIKKRNIPSAIIGCNLGPFDKR transferase NFGLKLAKFELKYKNLVTVRDKQSKELLLRGFKRKKI CsaB, csaB NIKLFPDIIFSKVLYKSIPKYGLGMTLSQVFRVTNVEF 184 putative_ P71059 MKNKFSIIVPVYNGESHIKKCIDTLLKQTYNDFEIIIIND glycosyltransferase_ GSTDDTKSVLTKFYAKNLKVKIVNTSNKGVSFARNLG EpsJ INQSSGQYLLFVDSDDELSINALKYLSIMLNKKDRDLI LFGFSLTGDNNRKNDTSILKSIANQNTDCKMNILKSIL STKNNILGYVWRAVYSLDFIKKNNIFFETHLKISEDYL FLLQSVEHSNNLFVITEEFYKYNLGETSMSNKFVPTL LNDMVWVNNWIESNILTVYPQFFVGFNCLVANTYIRY VQNAIRNKEENFMLKYREIKINKRKYNFQRSINQVIFH LDKFDFKSKIGVILFRIHLDIVYELLFNIKERKN 185 Cluster: Q3ZK44 MTNLNRKKFFINFQSLVFFILIIIYGLTTKNVMGGSGIF EpsH SIDSILKYGILFICISVEGYIFLKNGNERRETSENYNNF KYYFIIITFLSLFASFKQVHFSFRTVQSFIFIFIPMLYSY LILNNWTFRQINFSMKIALFLSVIEYLFSIRMGFSQIISS LASINYNNTNASALESSTFALLSLGFAAYFGYYKKNF LCKIVSLLFVIMTFKRVITLSGCILVILGILKIKNLRVNRF FLIVSTITLVSFSLIYYYSIQPQNILEISEKIGFSIRDFST NRTDRLAWLSMTDFKSYGLGSTTDFMYKLWGVDLE MDIVQLILEVGAFGVIVFIYFYLRFSKSNLYAFSFMALL LLNSILSSGMMSTFSWIIILIAMSTIMEYKEGM 186 Cluster: Q3ZK46 MIFVTVGTHEQPFNRLIQKIDELVRDGQIKDDVFMQI EpsF GYSTYEPKYTKWASVIGYNDMTAYFNKADIVITHGG PSTYMQVLQHGKIPIVVPRQEKFGEHINDHQLRVSK QVIKKGYPLILCEDVSALKICIESSRIRTDEFIKSNNKN FISNFKKIIAFEE 187 Cluster: Q9X491 MKIALVGSSGGHLTHLYLLKKFWENEDRFWVTFDKT EpsE DAKSILKEERFYPCYYPTNRNVKNTIKNTILAFKILRKE KPDLIISSGAAVAVPFFWIGKLFGAKTVYIEIFDRIDKP TLTGKLVYPVTDKFIVQWEELKKVYPKAINLGGIF 188 putative_sugar_ P71062 MEFFEDASSPESEEPKLVELKNFSYRELIIKRAIDILG transferase_ GLAGSVLFLIAAALLYVPYKMSSKKDQGPMFYKQKR EpsL YGKNGKIFYILKFRTMIFNAEQYLELNPDVKAAYHAN GNKLENDPRVTKIGSFIRRHSIDELPQFINVLKGDMAL VGPRPILLFEAKEYGERLSYLLMCKPGITGYWTTHG RSKVLFPQRADLELYYLQYHSTKNDIKLLSLTIVQSIN GSDAY 189 Tyrosine- P96716 MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTIDFK protein_ MADQGIKSFLVTSSEAAAGKSTVSANIAVAFAQQGK kinase_YwqD KVLLIDGDLRKPTVNITFKVQNRVGLTNILMHQSSIED AIQGTRLSENLTIITSGPIPPNPSELLASSAMKNLIDSV SDFFDVVLIDTPPLSAVTDAQILSSYVGGVVLVVRAY ETKKESLAKTKKMLEQVNANILGVVLHGVDSSDSPS YYYYGVE 190 putative_ P96715 MQETQEQTIDLRGIFKIIRKRLSLILFSALIVTILGSIYTF capsular_ FIASPVYTASTQLVVKLPNSDNSDAYAGQVSGNIQM polysaccharide_ ANTINQVIVSPVILDKVQSNLNLSDDSFQKQVTAANQ biosynthesis TNSQVITLTVKYSNPYIAQKIADETAKIFSSDAAKLLNV TNVNILSKAKAQTTPISPKPKLYLAISVIAGLVLGLAIAL LKELFDNKINKEEDIEALGLTVLGVTSLCSNE 191 Cluster: A9QSJ2 MMKKGIFVITIVISIALIIGGFYSYNSRINNLSKADKGKE Polysaccharide VVKNSSEKNQIDLTYKKYYKNLPKSVQNKIDDISSKN biosynthesis KEVTLTCIWQSDSVISEQFQQNLQKYYGNKFWNIKNI protein TYNGETSEQLLAEKVQNQVLATNPDVVLYEAPLFND NQNIEATASWTSNEQLITNLASTGAEVIVQPSPPIYG GVVYPVQEEQFKQSLSTKYPYIDYWASYPDKNSDE MKGLFSDDGVYRTLNASGNKVWLDYITKYFTAN 192 Cluster: O06027 MNNLFYHRLKELVESSGKSANQIERELGYPRNSLNN EpsR YKLGGEPSGTRLIGLSEYFNVSPKYLMGIIDEPNDSS AINLFKTLTQEEKKEMFIICQKWLFLEYQIEL 193 Putative_O- P37746 MQIAKNYLYNAIYQVFIIIVPLLTIPYLSRILGPSGIGINS antigen_ YINSIVQYFVLFGSIGVGLYGNRQIAFVRDNQVKMSK transporter VFYEIFILRLFTICLAYFLFVAFLIINGQYHAYYLSQSIAI VAAAFDISWFFMGIENFKVTVLRNFIVKLLALFSIFLFV KSYNDLNIYILITVLSTLIGNLTFFPSLHRYLVKVNYRE LRPIKHLKQSLVMFIPQIAVQIYWVLNKTMLGSLDSVT SSGFFDQSDKIVKLVLAIATATGTVMLPRVANAFAHR EYSKIKEYMYAGFSFVSAISIPMMFGLIAITPKFVPLFF TSQFSDVIPVLMIESIAIIFIAWSNAIGNQYLLPTNQNK SYTVSVIIGAIVNLMLNIPLIIYLGTVGASIATVISEMSVT VYQLFIIHKQLNLHTLFSDLSKYLIAGLVMFLIVFKISLL TPTSWIFILLEITVGIIIYVVLLIFLKAEIINKLKFIMHK 194 Putative_ P71057 MKKNVLLSIIVPIYNVEKYIGSLVNSLVKQTNKNFEVIF glycosyltransferase_ IDDGSTDESMQILKEIIAGSEQEFSLKLLQQVNQGLS EpsH SARNIGILNATGEYIFFLDSDDEIEINFVETILTSCYKYS QPDTLIFDYSSIDEFGNALDSNYGHGSIYRQKDLCTS EQILTALYKDEIPITAWSFVTKRSVIEKHNLLFSVGKK FEDNNFTPKVFYFSKNIGVISLRLYRYRKRSGSIMSN HPEKFFSDDAIFVTYDLLDFYDQYKIRELGAVVGKLV MTRLAFFPDSKKLYNELNPIIKKVFKDYISIEKRHTKRI KMYVKMYVFSSYVGYKLYRLVKGKHWK -
TABLE 5 Select Proteins from 13 kb plasmid of Lactococcus lactis cremoris Strain A SEQ ID NO. name uniprot_id Protein Sequence 195 Foldase_ P0C2B5 MKKKMRLKVLLASTATALLLLSGCQSNQTDQT protein_ VATYSGGKVTESSFYKELKQSPTTKTMLANMLI PrsA YRALNHAYGKSVSTKTVNDAYDSYKQQYGENF DAFLSQNGFSRSSFKESLRTNFLSEVALKKLKKV SESQLKAAWKTYQPKVTVQHILTSDEDTAKQVI SDLAAGKDFAMLAKTDSIDTATKDNGGKISFEL NNKTLDATFKDAAYKLKNGDYTQTPVKVTDG YEVIKMINHPAKGTFTSSKKVLTASVYAKWSRD SSIMQRVISQVLKNQHVTIKDKDLADALDSYKK LATTN 196 PIII- P15292 MQRKKKGLSFLLAGTVALGALAVLPVGEIQAK type_ AAISQQTKGSSLANTVTAATAKQAATDTTAATT proteinase NQAIATQLAAKGIDYNKLNKVQQQDIYVDVIVQ MSAAPASENGTLRTDYSSTAEIQQETNKVIAAQ ASVKAAVEQVTQQTAGESYGYVVNGFSTKVRV VDIPKLKQIAGVKTVTLAKVYYPTDAKANSMA NVQAVWSNYKYKGEGTVVSVIDSGIDPTHKDM RLSDDKDVKLTKSDVEKFTDTVKHGRYFNSKV PYGFNYADNNDTITDDKVDEQHGMHVAGIIGA NGTGDDPAKSVVGVAPEAQLLAMKVFTNSDTS ATTGSDTLVSAIEDSAKIGADVLNMSLGSDSGN QTLEDPEIAAVQNANESGTAAVISAGNSGTSGS ATEGVNKDYYGLQDNEMVGTPGTSRGATTVAS AENTDVITQAVTITDGTGLQLGPETIQLSSNDFT GSFDQKKFYVVKDASGNLSKGKVADYTADAK GKIAIVKRGELTFDDKQKYAQAAGAAGLIIVNN DGTATPVTSMALTTTFPTFGLSSVTGQKLVDWV TAHPDDSLGVKIALTLVPNQKYTEDKMSDFTSY GPVSNLSFKPDITAPGGNIWSTQNNNGYTNMSG TSMASPFIAGSQALLKQALNNKNNPFYAYYKQL KGTALTDFLKTVEMNTAQPINDINYNNVIVSPR RQGAGLVDVKAAIDALEKNPSTVVAENGYPAV ELKDFTSTDKTFKLTFTNRTTHELTYQMDSNTD TNAVYTSATDPNSGVLYDKKIDGAAIKAGSNIT VPAGKTAQIEFTLSLPKSFDQQQFVEGFLNFKGS DGSRLNLPYMGFFGDWNDGKIVDSLNGITYSPA GGNFGTVPLLTNKNTGTQYYGGMVTDADGNQ TVDDQAIAFSSDKNALYNDISMKYYLLRNISNV QVDILDGQGNKVTTLSSSTNLTKTYYNAHSQQY IYYHAPAWDGTYYDQRDGNIKTADDGSYTYRIS GVPEGGDKRQVFDVPFKLDSKAPTVRHVALSA KTKNGKTQYYLTAEVKDDLSGLDATKSVKTAI NEVTNLDATFTDAGTTADGYTKIETPLSDEQAQ ALGNGDNSAELYLTDNASNATDQDASVQKPGS TSFDLIVNGSGIPDKISSTTTGYEANTQGGGTYTF SGTYPAAVDGTYTDAQGKKHDLNTTYDAATNS FTASMPVTNADYAAQVDLYADKAHTQLLKHFD TKVRLTAPTFTDLKFNNGSDQTSEATIKVTGTVS ADTKTVNVGDTVAALDAQHHFSVDVPVNYGD NTIKVIATDEDGNTTTEQKTITSSYDPDMLKNPV TFDQGVTFGSNEFNATSAKFYDPKTGIATITGKV KHPTTTLQVDGKQIPIKDDLTFSFTLDLGTLGQK PFGVVVGDTTQNKTFQEALTFILDAVAPTLSLDS STDAPVYTNDPNFQITGTATDNAQYLSLSINGSS VASQYADININSGKPGHMAIDQPVKLLEGKNVL TVAVTDSEDNTTTKNITVYYEPKKTLAAPTVTP STTEPAQTVTLTANAAATGETVQYSADGGKTY QDVPAAGVTITANGTFKFKSTDLYGNESPAVDY VVTNIKADDPAQLQAAKQALTNLIASAKTLSAS GKYDDATTTALAAATQKAQTALDQTNASVDSL TGANRDLQTAINQLAAKLPADKKTSLLNQLQSV KDALGTDLGNQTDPSTGKTFTAALDDLVAQAQ AGTQTDDQLQATLAKILDEVLAKLAEGIKAATP AEVGNAKDAATGKTWYADIADTLTSGQASADA SDKLAHLQALQSLKTKVAAAVEADKTVGKGD DTTGTSDKGSGQGTPAPATGDTGKDKGDEGSQ PSSGGNIPTNPATTTSTSADDTTDRNGQHTTGTS DKGGGQGTPAPATGDTGKDKGDEGSQPSSGGN IPTNPATTTSTSADDTTDRNGQHTTGTSDKGGG QGTPAPATGDTGKDKGDEGSQPSSGGNIPTNPA TTTSTSTDDTTDRNGQHTTGKGALPKTGETTER PAFGFLGVIVVILMGVLGLKRKQREE 197 Cluster: T0V9Y4 MRAAEGLFVYNKTNFHYLPQNIAFADFKSGKFA Uncharacterized TSGMSMILIDSVNHRILDVMKDRGAGQLRAYFN protein QYSPSARAAVKTITVDLFTPYRAMIKDLFPNANI VADRFHVVTQAYRELNKVRISVMKQFGSDSKE YRQLKRFWKLLMKHENALDYMTSKNRINFKHA YLTDKEVIDRLLALSDELRDAYAFYQVIL 198 Cluster: T0UTW8 MDNDIRILIGLTDLNIDFDAKAEQHFNETNLNGT Uncharacterized APITWNLLLTYATNCEKFGTPMVHNGIKMVTH protein KGPRIAFKFQNYRIRKQKFL 199 Cluster: T0UZT2 MIENTINIAYARKFYKTKDYHSFCNLIKGNKGLF Uncharacterized GNKTVNQKANISFVKSEGEKHTHIYLDYQETCK protein VAHPNFLQLINLLKNYDPEFSEEKLPTFDLNDKI FGEYEIKVIPISKTKIVNTIDDVMNEIAKEIVLKY NQDMFKVTSKLGEISLTPIQEKFDKLKDI 200 Cluster: RepB Q9AIQ4 MIIPEKQNKQKQVLTLNELEKRKVVEHNALIQS VAKMQKTALKMFELAVSCIDTEEPPKNNTVYLS KSELFKFFEVSSSSKHSQFKEAVNYMQKQAFFNI KADKKLGIEYESIVPIPYVKWNDYNDEVTIRFDQ AIMPYLIDLKAEFTQYKISELQKLNSKYSIILYRW LSMNYNQYEHYSVKGGRRADQVEAYRTPSIKV KELREITDTINEHQHFPHFETRVLKKAIEEINAHT SFNVTYEKVKKGRSIDSIVFHIEKKRMADDNSY KLEDKVYQEDKARKAETEKDLVFQAMQSPYTR LLIENMFLNVYETTDSQIMAGLQKNVYPLYDEL KELRGLNGVKDHLSYVSSKQEAYSKRNVAKYL KKAIEQYLPTVKRQDLNHE 201 Cluster: Q7BLH6 MSEDLKTIKELADELGVSKSYVDKIIRILKLHTK Uncharacterized LDKVGNKYVISKKQEKSIITRIENSKSTTETHTES protein TTQSHTKVDAEVDFLKEEIAYLKSNHDKQLTNK DKQIETLSNLLDQQQRLALQDKKWLEEYKAEIN DLKALKMPSEDTKEEQSNYRSLEKEKDFVQTIQ ESYESEIKVLNQKLAEQEEQIQEIQKEKETKEKK WFQFWK 202 Cluster: RepC O05547 MAQTFDRKILRALQDNGVREIRAYEVVSKRLTI FQTDRGTFKYSDSLYRLVAPRQELWRNCTTGFI SEEKYHFYKK 203 Cluster: Q2VHJ0 MNHFKGKQFKKDVIIVAVGYYLRYNLSYREIQE Transposase LLYDRGINVCHTTIYRWVQEYSKVLYHLWKKK NRQSFYSWKMDETYIKIKGRWHYLYRAIDADG LTLDIWLRKKRDTQAAYAFLKRLHKQFGQPRVI VTDKAPSIGSAFRKLQSNGLYTKTEHRTVKYLN NLIEQDHRPIKRRNKFYRSLRTASTTIKGMETIR GIYKKNRRNGTLFGFSVSTEIKVLMGILA -
TABLE 6 Select Proteins from 30 kb plasmid of Lactococcus lactis cremoris Strain B SEQ ID NO. name uniprot_id Protein Sequence 204 Cluster: A0A218PFY7 MERKKKKKENIWAIIVPILIIISLIGAWAYALRD Exopolysaccharide SLIPNDYTKTNSSDQPTKTSVSNGYVEQKGVEA biosynthesis AVGSIALVDDAGVPEWVKVPSKVNLDKFTDLS protein EpsL TNNITIYRINNPEVLKTVTNRTDQRMKMSEVIA KYPNALIMNASAFDMQTGQVAGFQINNGKLIQ DWSPGTTTQYAFVINKDGSCKIYDSSTPASTIIK NGGQQAYDFGTAIIRDGKIQPSDGSVDWKIHIFI ANDKDNNLYAILSDTNAGYDNIMKSVSNLKLQ NMLLLDSGGSSQLSVNGKTIVASQDDRAVPDY IVMK 205 Cluster: A4VC87 MAQTIQTLALNVRLSCQLLDVPESSYYERINRH Transposase B PSKTQLRRQYLSLKISQLFNANRGIYGAPKIHHL of IS981 LLKQGEKVGLKLVQKLMKQLQLKSVVIKKFKP GYSLSDHINRKNLIQTEPTKKNKVWSTDITYIPT QQGWAYLSTIMDRYTKKVIAWDLGKRMTVEL VQRTLNKAIKSQDYPEAVILHSDQGSQYTSLEY EELLKYYGMTHSFSRRGYPYHNASLESWHGHL KREWVYQFKYKNFEEAYQSIFWYIEAFYNSKRI HQSLGYLTPNQFEKVSA 206 Cluster: A0A0M2ZR43 MVDAYLDNNLGDDLMIRYFASYFYQHKIYLVE Polysaccharide SREHIRKTFYDIPNIYFYSEEDYKMNEYDFQLH pyruvyl VTIGGSMFILDDFKKLIRFRHRIKNSRKIKKRNIP transferase SAIIGCNLGPFDKRNFGLKLAKFELKYKNLVTV CsaB, csaB RDKQSKELLLRGFKRKKINIKLFPDIIFSKVLYK SIPKYGLGMTLSQVFRVTNVEF 207 putative_ P71059 MKNKFSIIVPVYNGESHIKKCIDTLLKQTYNDF glycosyltransferase_ EIIIINDGSTDDTKSVLTKFYAKNLKVKIVNTSN EpsJ KGVSFARNLGINQSSGQYLLFVDSDDELSINAL KYLSIMLNKKDRDLILFGFSLTGDNNRKNDTSI LKSIANQNTDCKMNILKSILSTKNNILGYVWRA VYSLDFIKKNNIFFETHLKISEDYLFLLQSVEHS NNLFVITEEFYKYNLGETSMSNKFVPTLLNDM VWVNNWIESNILTVYPQFFVGFNCLVANTYIR YVQNAIRNKEENFMLKYREIKINKRKYNFQRSI NQVIFHLDKFDFKSKIGVILFRIHLDIVYELLFNI KERKN 208 Cluster: EpsH Q3ZK44 MTNLNRKKFFINFQSLVFFILIIIYGLTTKNVMG GSGIFSIDSILKYGILFICISVEGYIFLKNGNERRE TSENYNNFKYYFIIITFLSLFASFKQVHFSFRTVQ SFIFIFIPMLYSYLILNNWTFRQINFSMKIALFLS VIEYLFSIRMGFSQIISSLASINYNNTNASALESS TFALLSLGFAAYFGYYKKNFLCKIVSLLFVIMT FKRVITLSGCILVILGILKIKNLRVNRFFLIVSTIT LVSFSLIYYYSIQPQNILEISEKIGFSIRDFSTNRT DRLAWLSMTDFKSYGLGSTTDFMYKLWGVDL EMDIVQLILEVGAFGVIVFIYFYLRFSKSNLYAF SFMALLLLNSILSSGMMSTFSWIIILIAMSTIMEY KEGM 209 Cluster: A0A0M2ZW08 MKKLKISVIIRTYNEVKHIGEVLKSLTDQTYLN Transferase 2, HEIIIVDSGSVDGTLDIIERYPVKLVSINKEDFNY rSAM/selenodo SYASNVGVQNSSGDIVCFLSGHSVPVYKNYLE main-associated KINEIFQETEIGACYGEVIALPDGSITEKIFNRIG YLKSKLSLNNKRFFLENKIHPGIFSCSNACARK KLLLKYPFKVELGHGGEDVEVAYRIIQDGYFV AKSVELLVMHSHGSSLKKFIKEYKAWGKMYE DVLKFIKKNNDKSQ 210 Cluster: EpsF Q3ZK46 MIFVTVGTHEQPFNRLIQKIDELVRDGQIKDDV FMQIGYSTYEPKYTKWASVIGYNDMTAYFNK ADIVITHGGPSTYMQVLQHGKIPIVVPRQEKFG EHINDHQLRVSKQVIKKGYPLILCEDVSALKICI ESSRIRTDEFIKSNNKNFISNFKKIIAFEE 211 Cluster: EpsE Q9X491 MKIALVGSSGGHLTHLYLLKKFWENEDRFWV TFDKTDAKSILKEERFYPCYYPTNRNVKNTIKN TILAFKILRKEKPDLIISSGAAVAVPFFWIGKLFG AKTVYIEIFDRIDKPTLTGKLVYPVTDKFIVQW EELKKVYPKAINLGGIF 212 putative_sugar_ P71062 MEFFEDASSPESEEPKLVELKNFSYRELIIKRAID transferase_EpsL ILGGLAGSVLFLIAAALLYVPYKMSSKKDQGP MFYKQKRYGKNGKIFYILKFRTMIFNAEQYLEL NPDVKAAYHANGNKLENDPRVTKIGSFIRRHSI DELPQFINVLKGDMALVGPRPILLFEAKEYGER LSYLLMCKPGITGYWTTHGRSKVLFPQRADLE LYYLQYHSTKNDIKLLSLTIVQSINGSDAY 213 Tyrosine- P96717 MIDIHCHILPGIDDGAKTSGDTLTMLKSAIDEGI protein_ TTITATPHHNPQFNNESPLILKKVKEVQNIIDEH phosphatase_YwqE QLPIEVLPGQEVRIYGDLLKEFSEGKLLTAAGTS SYILIEFPSNHVPAYAKELFYNIKLEGLQPILVHP ERNSGIIENPDILFDFIEQGVLSQITASSVTGHFG KKIQKLSFKMIENHLTHFVASDAHNVTSRAFK MKEAFEIIEDSYGSDVSRMFQNNAESVILNESF YQEKPTKIKTKKLLGLF 214 Tyrosine- P96716 MAKNKRSIDNNRYIITSVNPQSPISEQYRTIRTTI protein_kinase_ DFKMADQGIKSFLVTSSEAAAGKSTVSANIAV YwqD AFAQQGKKVLLIDGDLRKPTVNITFKVQNRVG LTNILMHQSSIEDAIQGTRLSENLTIITSGPIPPNP SELLASSAMKNLIDSVSDFFDVVLIDTPPLSAVT DAQILSSYVGGVVLVVRAYETKKESLAKTKKM LEQVNANILGVVLHGVDSSDSPSYYYYGVE 215 putative_ P96715 MQETQEQTIDLRGIFKIIRKRLSLILFSALIVTILG capsular_ SIYTFFIASPVYTASTQLVVKLPNSDNSDAYAG polysaccharide_ QVSGNIQMANTINQVIVSPVILDKVQSNLNLSD biosynthesis DSFQKQVTAANQTNSQVITLTVKYSNPYIAQKI ADETAKIFSSDAAKLLNVTNVNILSKAKAQTTP ISPKPKLYLAISVIAGLVLGLAIALLKELFDNKIN KEEDIEALGLTVLGVTSLCSNE 216 Cluster: A9QSJ2 MMKKGIFVITIVISIALIIGGFYSYNSRINNLSKA Polysaccharide DKGKEVVKNSSEKNQIDLTYKKYYKNLPKSVQ biosynthesis NKIDDISSKNKEVTLTCIWQSDSVISEQFQQNLQ protein KYYGNKFWNIKNITYNGETSEQLLAEKVQNQV LATNPDVVLYEAPLFNDNQNIEATASWTSNEQ LITNLASTGAEVIVQPSPPIYGGVVYPVQEEQFK QSLSTKYPYIDYWASYPDKNSDEMKGLFSDDG VYRTLNASGNKVWLDYITKYFTAN 217 Cluster: EpsR O06027 MNNLFYHRLKELVESSGKSANQIERELGYPRNS LNNYKLGGEPSGTRLIGLSEYFNVSPKYLMGII DEPNDSSAINLFKTLTQEEKKEMFIICQKWLFLE YQIEL 218 Cluster: Q2VHJ5 MSVSIIDSFPIPLCQPIRNFRSKGLGDYANVGYN Transposase A ATKGQYFYGCKCHALVSESGYVIDYTITPASM ADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDR LELKGIDLMTPVRKNMKQKKILFPNFSKRRKVI ERVFSFLTNLGAERCKSRSPQGFQLKLEMILLA YSLLLKSAKSLEPETLRYSIGYQVMAK 219 Cluster: Signal A0A0B8QXZ2 MTIKNKKDLSSSIEQLEKAINQQETILKKFDNEQ transduction LDFEQIKKLENLLIQEREKAKQVQIKINRSVLQN histidine kinase NSENYKERKKRTRQLIQKGALLEKYLEAKHLT VDETEQLLQIFANMINKPELLVNFIGK 220 Cluster: B1N0G0 MVQQIVLPIKDSNILKMVQDTLLDSFRAGRRN Tyrosine YTIFQVGKATLLRVSDVMKLKKTDVFNSDGTV recombinase KQTAFIHDQKTGKANTLYLKPVQQDLVVYHD WMVQQNLNSEWLFPSTSRPDRPITEKQFYKIM ARVGDLLSINYLGTHTMRKTGAYRVYTQSNY NIGLVIHLLNHSSEAMTLTYLGLDQASRETMLD QIDFG 221 Cluster: G1FE57 MDQKEVSQNQTKYIQFRLSEEQYNKLKISGET Uncharacterized YGLSPNLYAKKLAQKSHLKKPYLEHDQAKSLL protein LELSKQGTNLNQIAKKLNQFDRMDNQDKELIE ALRYTYGVLAQAQKGYQELWQQLQK 222 Cluster: H2A9L4 MATIAKISNGASAASALNYALGQDRPMHEKTE Mobilization QWLQDHQLERPVELTNCRAVAVGGTNGIDPFI protein AKEQFDVVRQLHNQTKESNQVMRITQSFALDE LNPKVQKDWQKANDLGVELAENLYPNHQSAV YTHLDGKNHVLHNHIIVNKVNLETGKKLREQK GESVQRAREMNDRLASRENWHILEPPKERQTE TEKELIAKNEYSYMDDLRERINKSLQDVSVSSY ETFKERLSDNGVILSERGQTFSYAFLDANNKQR RARETRLGSDFGKETILHELENRARQNEFSAVE QREPAITPLERDTQQRESEIVSLEQAIEPRKSEAL KRESKINRFIDTIKQFAGRVPELTQRVTRKLKQT KDKILDDFERRFSKDMKNYEQEQQKSLEKQAN RDVQSEKKPTKDHDRGMSR 223 Cluster: S6EPU9 MNKDEQLVVQVLNAYKNGKIDFSNVPELDRL Putative VRQEVNKDFRDYQEKIEAVANQKIESAIQEQLH mobilization RLEAENLKATILKDIQVEKQALLALKKELNEQK protein EQIKADRKREIVERYGILIANIVCLFCFLVVGILI GRWIYKGIWDGWGLHILYDTVMEIKPKHPYGA VILGLGGFGLIGAGIYGSFRLMYTASTWFDQRP KIFKRIFPKK 224 Adenosine_ Q7DDR9 MVLDNKLGLTNSAELAKQEELLTKKRAKELFE monophosphate- SGKIEDLEIGTFQGLSDIHQFLFQDIYDFAGKIRE protein_ VNIAKGNFQFAPRIFLAQTLEYIDKLPQETFDEII transferase DKYSDMNVAHPFREGNGRATRIWLDLILKNKL HKIVDWNQIDKDEYLNAMIRSTVSTNELKYLIQ KALTDDLGKEQFFKGIDASYYYEGYYEIKTEDL 225 Cluster: RepB O54680 MSIITEFEKNQKQVKALNELSKRKVVEHNSLIT SIAKMDKTPLKMFELAVSCINTEAPPKDHTVYL SKTELFAFFKVSDNDKHSRFKQAVENMQKQAF FKIQEKKEYGFEFENIVPIPYVKWADYHDEVTI RFSPEIMPYLINLKQNFTQHALSDIAELNSKYSII LYRWLSMNYNQYEHYSAKGGRREEQVETYRN PSISIRELREMTDTMKDYPRFQSLESYIIKNSLKE INEHTSFKVTYEKVKKGRSINSIVFHITKKRRAD DNSYKLEDKVYQKAKVQKEQKENLLYAEAM QSKYTKLLLEHFLLSPYEMTNPATMAGLQRNV YPKYDELKDLMGIDGVKKHLSYIYDKQEPYSK GNIAKYLKKAIEQYLPTVKRRGL 226 Cluster: G0WJS1 MSDNLKTIKELADELGVSKTAINKKVTDRERK Replication- LWFSKIGNKFVINEDGQKSIKRMFEGLTENQES associated QTENLEQKPNSQTENFRNNNESNADIKYILDIIE protein RepX YQKEQIKDLQNTKDEQFKQLSNMQNLLDQQQ RLALQDKKLLEEYKSENDRLKVLKMPSQETKE EQANIQPQEELETLKEQTRALNDKIKGQEELNN KSSKKWYQFWK 227 Cluster: G0WJS2 MFSYIYIILSYNTIKVKEVLKFEYRICTSFNWTS Truncated KFAEEMKTCFFNSGFKFKNFKGLDNRNAKEKS peptidase E ELISEAEVVILAGGHVPTQNIFFQQINLKNMSPV RIF 228 Putative_O- P37746 MQIAKNYLYNAIYQVFIIIVPLLTIPYLSRILGPS antigen_ GIGINSYTNSIVQYFVLFGSIGVGLYGNRQIAFV transporter RDNQVKMSKVFYEIFILRLFTICLAYFLFVAFLII NGQYHAYYLSQSIAIVAAAFDISWFFMGIENFK VTVLRNFIVKLLALFSIFLFVKSYNDLNIYILITV LSTLIGNLTFFPSLHRYLVKVNYRELRPIKHLKQ SLVMFIPQIAVQIYWVLNKTMLGSLDSVTSSGF FDQSDKIVKLVLAIATATGTVMLPRVANAFAH REYSKIKEYMYAGFSFVSAISIPMMFGLIAITPK FVPLFFTSQFSDVIPVLMIESIAIIFIAWSNAIGNQ YLLPTNQNKSYTVSVIIGAIVNLMLNIPLIIYLGT VGASIATVISEMSVTVYQLFIIHKQLNLHTLFSD LSKYLIAGLVMFLIVFKISLLTPTSWIFILLEITVG IIIYVVLLIFLKAEIINKLKFIMHK 229 Cluster: O50546 MNLFGDSDYLEKLSSKGDPLERLEKVVDFECF Transposase RPTLNRIFKYDLKNKSHGGRPPYDLVLMLKILI LQRLYNLSDDAMEYQMIDRISFRRFLKIDDKVP DAKTIWNFRNQLSKSNRGNWLFSAFQEKLESQ GMIAHKGQIVDATFIEAPKQRNPKDENELIKAN RVPVNWTKNKRAQKDTAARWTIKGNERHYG YKNHIAIDTKSKFVKNYQTTPANVHDSQVIGVL VDPDEITLADSAYQNKATPKGAELFTFLKNTRS KSLKADDKMFNKIISKIRVRIEHVFGFVENSMH GSSLRSIGFDRAVLNTDLTNLTYNLLRHEQVKR LNLKTWR 230 Cluster: Orf14.9 Q9RCJ9 MRKYMIYLSSLLVTFILSYATITWLIMPVLTRY QSLARLINHFDYTALTLILLLTLIIWLFGIQYHLK HFSVIYLYLAFSVYLLLLFMVIFNKTTDFQAISL NPFDFIKADTRTIQEAVLNIIYFIPLGGLYCINTD FKQFVIISLVTLLGIETIQFIFYLGTFAISDIILNFL GCLIGYYCCWEIKKS 231 Cluster: Q2VHJ0 MDETYIKIKGRGHYLYRTIDADGLTLDIWLRK Transposase KRDTQAAYAFLKRLHKQFGEPKAIVTDKAPSL GSAFRKLQSVGLYTKTEHRTVKYLNNLIEQDH RPIKRRNKFYQSLRTASSTIKGMETLRGIYKNN RRNGTLFGFSVSTEIKVLMGITA 232 Putative_ P71057 MKKNVLLSIIVPIYNVEKYIGSLVNSLVKQTNK glycosyltransferase_ NFEVIFIDDGSTDESMQILKEIIAGSEQEFSLKLL EpsH QQVNQGLSSARNIGILNATGEYIFFLDSDDEIEI NFVETILTSCYKYSQPDTLIFDYSSIDEFGNALD SNYGHGSIYRQKDLCTSEQILTALYKDEIPITAW SFVTKRSVIEKHNLLFSVGKKFEDNNFTPKVFY FSKNIGVISLRLYRYRKRSGSIMSNHPEKFFSDD AIFVTYDLLDFYDQYKIRELGAVVGKLVMTRL AFFPDSKKLYNELNPIIKKVFKDYISIEKRHTKRI KMYVKMYVFSSYVGYKLYRLVKGKHWK 233 Cluster: Q2VHJ0 MNHFKGKQFKKDVIIVAVGYYLRYNLSYREVQ Transposase ELLYDRGINVCHTTIYRWVQEYSKVLYDLCKK KNRQSFYSWKMDETYIKIKGRWHYLYRAIDAD GLTLDIWLQKKRDTQAAYAFLKRLHKQFGEPK AIVTDKAPSLGSAFRKLQSVGLYTKTEHRTVK YLNNLIEQDHWPIKRRNKFYQSLRTASSTIKGM ETLRGIYKNNRRNGTLFGFSVSTEIKVLMGITA 234 Cluster: H5SYB4 MQQNLLKYYGMTHSFSRRGYPYHNASLESWH Transposase GHLKREWVYQFKYKNFEEAYQSIFWYIEAFYN SKRIHQSLGYLTPNQFEKVSA - In certain aspects, the immune modulating Lactococcus strain EVs described herein can be prepared using any method known in the art.
- In some embodiments, the immune modulating Lactococcus strain EVs are prepared without an EV purification step. For example, in some embodiments, immune modulating Lactococcus strain bacteria comprising the EVs described herein are killed using a method that leaves the immune modulating Lactococcus strain bacterial EVs intact and the resulting bacterial components, including the EVs, are used in the methods and compositions described herein. In some embodiments, the immune modulating Lactococcus strain bacteria are killed using an antibiotic (e.g., using an antibiotic described herein). In some embodiments, the immune modulating Lactococcus strain bacteria are killed using UV irradiation.
- In some embodiments, the EVs described herein are purified from one or more other bacterial components. Methods for purifying EVs from bacteria are known in the art. In some embodiments EVs are prepared from bacterial cultures using methods described in S. Bin Park, et al. PLoS ONE. 6(3):e17629 (2011) or G. Norheim, et al. PLoS ONE. 10(9): e0134353 (2015), each of which is hereby incorporated by reference in its entirety. In some embodiments, the bacteria are cultured to high optical density and then centrifuged to pellet bacteria (e.g., at 10,000×g for 30 min at 4° C.). In some embodiments, the culture supernatants are then passed through filter to exclude intact bacterial cells (e.g., a 0.22 μm filter). In some embodiments, filtered supernatants are centrifuged to pellet bacterial EVs (e.g., at 100,000-150,000×g for 1-3 hours at 4° C.). In some embodiments, the EVs are further purified by resuspending the resulting EV pellets (e.g., in PBS), and applying the resuspended EVs to sucrose gradient (e.g., a 30-60% discontinuous sucrose gradient), followed by centrifugation (e.g., at 200,000×g for 20 hours at 4° C.). EV bands can be collected, washed with (e.g., with PBS), and centrifuged to pellet the EVs (e.g., at 150,000×g for 3 hours at 4° C.). The purified EVs can be stored, for example, at −80° C. until use. In some embodiments, the EVs are further purified by treatment with DNase and/or proteinase K.
- For example, in some embodiments, cultures of immune modulating Lactococcus strain bacteria disclosed herein can be centrifuged at 11,000×g for 20-40 min at 4° C. to pellet bacteria. Culture supernatants may be passed through a 0.22 μm filter to exclude intact bacterial cells. Filtered supernatants may then be concentrated using methods that may include, but are not limited to, ammonium sulfate precipitation, ultracentrifugation, or filtration. For example, for ammonium sulfate precipitation, 1.5-3 M ammonium sulfate can be added to filtered supernatant slowly, while stirring at 4° C. Precipitations can be incubated at 4° C. for 8-48 hours and then centrifuged at 11,000×g for 20-40 min at 4° C. The resulting pellets contain immune modulating Lactococcus strain EVs and other debris. Using ultracentrifugation, filtered supernatants can be centrifuged at 100,000-200,000×g for 1-16 hours at 4° C. The pellet of this centrifugation contains immune modulating Lactococcus strain EVs and other debris. In some embodiments, using a filtration technique, such as through the use of an Amicon Ultra spin filter or by tangential flow filtration, supernatants can be filtered so as to retain species of molecular weight >50 or 100 kDa.
- Alternatively, EVs can be obtained from immune modulating Lactococcus strain bacterial cultures continuously during growth, or at selected time points during growth, by connecting a bioreactor to an alternating tangential flow (ATF) system (e.g., XCell ATF from Repligen). The ATF system retains intact cells (>0.22 um) in the bioreactor, and allows smaller components (e.g., EVs, free proteins) to pass through a filter for collection. For example, the system may be configured so that the <0.22 um filtrate is then passed through a second filter of 100 kDa, allowing species such as EVs between 0.22 um and 100 kDa to be collected, and species smaller than 100 kDa to be pumped back into the bioreactor. Alternatively, the system may be configured to allow for medium in the bioreactor to be replenished and/or modified during growth of the culture. EVs collected by this method may be further purified and/or concentrated by ultracentrifugation or filtration as described above for filtered supernatants.
- EVs obtained by methods provided herein may be further purified by size based column chromatography, by affinity chromatography, and by gradient ultracentrifugation, using methods that may include, but are not limited to, use of a sucrose gradient or Optiprep gradient. Briefly, using a sucrose gradient method, if ammonium sulfate precipitation or ultracentrifugation were used to concentrate the filtered supernatants, pellets are resuspended in 60% sucrose, 30 mM Tris, pH 8.0. If filtration was used to concentrate the filtered supernatant, the concentrate is buffer exchanged into 60% sucrose, 30 mM Tris, pH 8.0, using an Amicon Ultra column. Samples are applied to a 35-60% discontinuous sucrose gradient and centrifuged at 200,000×g for 3-24 hours at 4° C. Briefly, using an Optiprep gradient method, if ammonium sulfate precipitation or ultracentrifugation were used to concentrate the filtered supernatants, pellets are resuspended in 35% Optiprep in PBS. In some embodiments, if filtration was used to concentrate the filtered supernatant, the concentrate is diluted using 60% Optiprep to a final concentration of 35% Optiprep. Samples are applied to a 35-60% discontinuous sucrose gradient and centrifuged at 200,000×g for 3-24 hours at 4° C.
- In some embodiments, to confirm sterility and isolation of the EV preparations, EVs are serially diluted onto agar medium used for routine culture of the bacteria being tested, and incubated using routine conditions. Non-sterile preparations are passed through a 0.22 um filter to exclude intact cells. To further increase purity, isolated EVs may be DNase or proteinase K treated.
- In some embodiments, for preparation of EVs used for in vivo injections, purified EVs are processed as described previously (G. Norheim, et al. PLoS ONE. 10(9): e0134353 (2015)). Briefly, after sucrose gradient centrifugation, bands containing EVs are resuspended to a final concentration of 50 μg/mL in a solution containing 3% sucrose or other solution suitable for in vivo injection known to one skilled in the art. This solution may also contain adjuvant, for example aluminum hydroxide at a concentration of 0-0.5% (w/v).
- In certain embodiments, to make samples compatible with further testing (e.g. to remove sucrose prior to TEM imaging or in vitro assays), samples are buffer exchanged into PBS or 30 mM Tris, pH 8.0 using filtration (e.g. Amicon Ultra columns), dialysis, or ultracentrifugation (200,000×g, ≥3 hours, 4° C.) and resuspension.
- In some embodiments, the sterility of the EV preparations can be confirmed by plating a portion of the EVs onto agar medium used for standard culture of the bacteria used in the generation of the EVs and incubating using standard conditions.
- In some embodiments select EVs are isolated and enriched by chromatography and binding surface moieties on EVs. In other embodiments, select EVs are isolated and/or enriched by fluorescent cell sorting by methods using affinity reagents, chemical dyes, recombinant proteins or other methods known to one skilled in the art.
- In certain aspects, provided herein are bacterial compositions comprising an immune modulating Lactococcus strain provided herein, an immune modulating Lactococcus strain EVs provided herein, and/or an immune modulating Lactococcus strain PhAB provided herein. In some embodiments, the bacterial formulation further comprises a pharmaceutically acceptable carrier.
- In some embodiments, the bacterial composition comprises a killed bacterium, a live bacterium and/or an attenuated bacterium. Bacteria may be heat-killed by pasteurization, sterilization, high temperature treatment, spray cooking and/or spray drying (heat treatments can be performed at 50° C., 65° C., 85° C. or a variety of other temperatures and/or a varied amount of time). Bacteria may also be killed or inactivated using γ-irradiation (gamma irradiation), exposure to UV light, formalin-inactivation, and/or freezing methods, or a combination thereof. For example, the bacteria may be exposed to 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, or 50 kGy of radiation prior to administration. In some embodiments, bacteria (e.g., Lactococcus strain) are killed using gamma irradiation. In some embodiments, the bacteria are killed or inactivated using electron irradiation (e.g., beta radiation) or x-ray irradiation.
- In certain embodiments, at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the bacteria in the bacterial composition are the immune modulating Lactococcus strain. In certain embodiments, substantially all of the bacteria in the bacterial composition are the immune modulating Lactococcus strain. In certain embodiments, the bacterial composition comprises at least 1×103 colony forming units (CFUs), 1×104 colony forming units (CFUs), 1×105 colony forming units (CFUs), 5×105 colony forming units (CFUs), 1×106 colony forming units (CFUs), 2×106 colony forming units (CFUs), 3×106 colony forming units (CFUs), 4×106 colony forming units (CFUs), 5×106 colony forming units (CFUs), 6×106 colony forming units (CFUs), 7×106 colony forming units (CFUs), 8×106 colony forming units (CFUs), 9×106 colony forming units (CFUs), 1×107 colony forming units (CFUs), 2×107 colony forming units (CFUs), 3×107 colony forming units (CFUs), 4×107 colony forming units (CFUs), 5×107 colony forming units (CFUs), 6×107 colony forming units (CFUs), 7×107 colony forming units (CFUs), 8×107 colony forming units (CFUs), 9×107 colony forming units (CFUs), 1×108 colony forming units (CFUs), 2×108 colony forming units (CFUs), 3×108 colony forming units (CFUs), 4×108 colony forming units (CFUs), 5×108 colony forming units (CFUs), 6×108 colony forming units (CFUs), 7×108 colony forming units (CFUs), 8×108 colony forming units (CFUs), 9×108 colony forming units (CFUs), 1×109 colony forming units (CFUs), 5×109 colony forming units (CFUs), 1×1010 colony forming units (CFUs) 5×1010 colony forming units (CFUs), 1×1011 colony forming units (CFUs) 5×1011 colony forming units (CFUs), 1×1012 colony forming units (CFUs) 5×1012 colony forming units (CFUs), 1×1013 colony forming units (CFUs) of the immune modulating Lactococcus strain.
- In some embodiments, at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% of the bacteria in the composition are of the immune modulating Lactococcus strain. 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% of the bacteria in the composition are of the immune modulating Lactococcus strain.
- In some embodiments, the compositions described herein may include only one strains of the immune modulating Lactococcus described herein. For example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 of the immune modulating Lactococcus strains described herein, in any combination, can be included in the compositions provided herein.
- In some embodiments, the pharmaceutical compositions comprise immune modulating Lactococcus strain EVs substantially or entirely free of bacteria. In some embodiments, the pharmaceutical compositions comprise both immune modulating Lactococcus strain EVs and whole immune modulating Lactococcus strain bacteria (e.g., live bacteria, killed bacteria, attenuated bacteria). In certain embodiments, the pharmaceutical compositions comprise immune modulating Lactococcus strain bacteria that is substantially or entirely free of EVs.
- In some embodiments, the pharmaceutical composition comprises at least 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8. 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8. 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8. 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8. 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain EV particles.
- In some embodiments, the pharmaceutical composition comprises about 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8. 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8. 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8. 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8. 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain EV particles.
- In certain embodiments, the pharmaceutical composition comprises a certain ratio of immune modulating Lactococcus strain bacteria particles to immune modulating Lactococcus strain EV particles. The number of immune modulating Lactococcus strain bacteria particles can be based on actual particle number or (if the bacteria is live) the number of CFUs. The particle number can be established by combining a set number of purified immune modulating Lactococcus strain EVs with a set number of purified immune modulating Lactococcus strain bacterium, by modifying the growth conditions under which the immune modulating Lactococcus strain bacteria are cultured, or by modifying the immune modulating Lactococcus strain bacteria itself to produce more or fewer immune modulating Lactococcus strain EVs.
- In some embodiments, to quantify the numbers of immune modulating Lactococcus strain EVs and/or immune modulating Lactococcus strain bacteria present in a bacterial sample, electron microscopy (e.g., EM of ultrathin frozen sections) can be used to visualize the vesicles and bacteria and count their relative numbers. Alternatively, combinations of nanoparticle tracking analysis (NTA), Coulter counting, and dynamic light scattering (DLS) or a combination of these techniques can be used. NTA and the Coulter counter count particles and show their sizes. DLS gives the size distribution of particles, but not the concentration. Bacteria frequently have diameters of 1-2 um. The full range is 0.2-20 um. Combined results from Coulter counting and NTA can reveal the numbers of bacteria in a given sample. Coulter counting reveals the numbers of particles with diameters of 0.7-10 um. NTA reveals the numbers of particles with diameters of 50-1400 nm. For most bacterial samples, the Coulter counter alone can reveal the number of bacteria in a sample. EVs are 20-250 nm in diameter. NTA will allow us to count the numbers of particles that are 50-250 nm in diameter. DLS reveals the distribution of particles of different diameters within an approximate range of 1 nm-3 um.
- In some embodiments, the pharmaceutical composition comprises no more than 1 immune modulating Lactococcus strain bacterium for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8. 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8. 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8. 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8. 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain EV particles.
- In some embodiments, the pharmaceutical composition comprises at least 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8. 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8. 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8. 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8. 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain bacterium.
- In some embodiments, the pharmaceutical composition comprises about 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8. 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8. 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8. 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8. 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain bacterium. In some embodiments, the pharmaceutical composition comprises no more than 1 immune modulating Lactococcus strain EV particle for every 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8. 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8. 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8. 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8. 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8. 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8. 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8. 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8. 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8. 9.9, 10, 11, 12, 13, 14, 15, 16, 17, 18. 19, 20, 21, 22, 23, 24, 25, 26, 27, 28. 29, 30, 31, 32, 33, 34, 35, 36, 37, 38. 39, 40, 41, 42, 43, 44, 45, 46, 47, 48. 49, 50, 51, 52, 53, 54, 55, 56, 57, 58. 59, 60, 61, 62, 63, 64, 65, 66, 67, 68. 69, 70, 71, 72, 73, 74, 75, 76, 77, 78. 79, 80, 81, 82, 83, 84, 85, 86, 87, 88. 89, 90, 91, 92, 93, 94, 95, 96, 97, 98. 99, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1×103, 2×103, 3×103, 4×103, 5×103, 6×103, 7×103, 8×103, 9×103, 1×104, 2×104, 3×104, 4×104, 5×104, 6×104, 7×104, 8×104, 9×104, 1×105, 2×105, 3×105, 4×105, 5×105, 6×105, 7×105, 8×105, 9×105, 1×106, 2×106, 3×106, 4×106, 5×106, 6×106, 7×106, 8×106, 9×106, 1×107, 2×107, 3×107, 4×107, 5×107, 6×107, 7×107, 8×107, 9×107, 1×108, 2×108, 3×108, 4×108, 5×108, 6×108, 7×108, 8×108, 9×108, 1×109, 2×109, 3×109, 4×109, 5×109, 6×109, 7×109, 8×109, 9×109, 1×1010, 2×1010, 3×1010, 4×1010, 5×1010, 6×1010, 7×1010, 8×1010, 9×1010, 1×1011, 2×1011, 3×1011, 4×1011, 5×1011, 6×1011, 7×1011, 8×1011, 9×1011, and/or 1×1012 immune modulating Lactococcus strain bacterium.
- In some embodiments, at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the particles in the pharmaceutical composition are immune modulating Lactococcus strain EVs.
- In some embodiments, at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the particles in the pharmaceutical composition are immune modulating Lactococcus strain bacteria.
- In some embodiments, no more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the particles in the pharmaceutical composition are immune modulating Lactococcus strain EVs.
- In some embodiments, no more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the particles in the pharmaceutical composition are immune modulating Lactococcus strain bacteria.
- In some embodiments, about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the particles in the pharmaceutical composition are immune modulating Lactococcus strain EVs.
- In some embodiments, about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the particles in the pharmaceutical composition are immune modulating Lactococcus strain bacteria.
- In some embodiments, at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the protein in the pharmaceutical composition is immune modulating Lactococcus strain EV protein.
- In some embodiments, at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the protein in the pharmaceutical composition is immune modulating Lactococcus strain bacteria protein.
- In some embodiments, no more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the protein in the pharmaceutical composition is immune modulating Lactococcus strain EV protein.
- In some embodiments, no more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the protein in the pharmaceutical composition is immune modulating Lactococcus strain bacteria protein.
- In some embodiments, about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the protein in the pharmaceutical composition is immune modulating Lactococcus strain EV protein.
- In some embodiments, about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the protein in the pharmaceutical composition is immune modulating Lactococcus strain bacteria protein.
- In some embodiments, at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the lipids in the pharmaceutical composition are immune modulating Lactococcus strain EV lipids.
- In some embodiments, at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the lipids in the pharmaceutical composition are immune modulating Lactococcus strain bacteria lipids.
- In some embodiments, no more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the lipids in the pharmaceutical composition are immune modulating Lactococcus strain EV lipids.
- In some embodiments, no more than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the lipids in the pharmaceutical composition are immune modulating Lactococcus strain bacteria lipids.
- In some embodiments, about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the lipids in the pharmaceutical composition are immune modulating Lactococcus strain EV lipids.
- In some embodiments, about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of the lipids in the pharmaceutical composition are immune modulating Lactococcus strain bacteria lipids.
- In some embodiments, the immune modulating Lactococcus strain EVs in the pharmaceutical composition are purified from one or more other bacterial components. In some embodiments, the pharmaceutical composition further comprises other bacterial components. In some embodiments, the pharmaceutical composition comprise bacteria cells.
- As described in detail below, the pharmaceutical compositions disclosed herein may be specially formulated for administration in solid or liquid form, including those adapted for oral or rectal administration.
- In some embodiments, the composition described herein may be a pharmaceutical composition, a dietary supplement, or a food product (e.g., a food or beverage). In some embodiments, the food product is an animal feed.
- In certain embodiments, the pharmaceutical composition for oral administration described herein comprises an additional component that enables efficient delivery of the bacteria to the colon. In some embodiments, pharmaceutical preparation that enables the delivery of the bacteria to the colon can be used. Examples of such formulations include pH sensitive compositions, such as buffered sachet formulations or enteric polymers that release their contents when the pH becomes alkaline after the enteric polymers pass through the stomach. When a pH sensitive composition is used for formulating the pharmaceutical preparation, the pH sensitive composition can be a polymer whose pH threshold of the decomposition of the composition is between about 6.8 and about 7.5.
- Another embodiment of a pharmaceutical composition useful for delivery of the bacteria to the colon is one that ensures the delivery to the colon by delaying the release of the bacteria by approximately 3 to 5 hours, which corresponds to the small intestinal transit time. In some embodiments, the pharmaceutical composition for delayed release includes a hydrogel shell. The hydrogel is hydrated and swells upon contact with gastrointestinal fluid, with the result that the contents are effectively released (released predominantly in the colon). Delayed release dosage units include bacteria-containing compositions having a material which coats or selectively coats the bacteria. Examples of such a selective coating material include in vivo degradable polymers, gradually hydrolyzable polymers, gradually water-soluble polymers, and/or enzyme degradable polymers. A wide variety of coating materials for efficiently delaying the release is available and includes, for example, cellulose-based polymers such as hydroxypropyl cellulose, acrylic acid polymers and copolymers such as methacrylic acid polymers and copolymers, and vinyl polymers and copolymers such as polyvinylpyrrolidone.
- Examples of composition enabling the delivery to the colon further include bioadhesive compositions which specifically adhere to the colonic mucosal membrane (for example, a polymer described in the specification of U.S. Pat. No. 6,368,586, hereby incorporated by reference) and compositions into which a protease inhibitor is incorporated for protecting particularly a biopharmaceutical preparation in the gastrointestinal tracts from decomposition due to an activity of a protease.
- An example of a system enabling the delivery to the colon is a system of delivering a composition to the colon by pressure change in such a way that the contents are released by utilizing pressure change caused by generation of gas in bacterial fermentation at a distal portion of the stomach. Such a system is not particularly limited, and a more specific example thereof is a capsule which has contents dispersed in a suppository base and which is coated with a hydrophobic polymer (for example, ethyl cellulose).
- Another example of the system enabling the delivery to the colon is a system of delivering a composition to the colon, the system being specifically decomposed by an enzyme (for example, a carbohydrate hydrolase or a carbohydrate reductase) present in the colon. Such a system is not particularly limited, and more specific examples thereof include systems which use food components such as non-starch polysaccharides, amylose, xanthan gum, and azopolymers.
- In some embodiments, Probiotic formulations are provided as encapsulated, enteric coated, or powder forms, with doses ranging up to 1011 cfu (e.g., up to 1010 cfu). In some embodiments, the composition comprises 5×1011 cfu of immune modulating Lactococcus strain and 10% (w/w) corn starch in a capsule. The capsule is enteric coated for duodenal release at pH 5.5 In some embodiments, the capsule is enteric coated for duodenal release at pH 5.5. In some embodiments, the composition comprises a powder of freeze-dried immune modulating Lactococcus strain which is deemed “Qualified Presumption of Safety” (QPS) status. In some embodiments, the composition is stable at frozen or refrigerated temperature.
- Methods for producing microbial compositions may include three main processing steps. The steps are: organism banking, organism production, and preservation. In certain embodiments, a sample that contains an abundance of immune modulating Lactococcus strain may be cultured by avoiding an isolation step.
- For banking, the strains included in the microbial composition may be (1) isolated directly from a specimen or taken from a banked stock, (2) optionally cultured on a nutrient agar or broth that supports growth to generate viable biomass, and (3) the biomass optionally preserved in multiple aliquots in long-term storage.
- In embodiments using a culturing step, the agar or broth may contain nutrients that provide essential elements and specific factors that enable growth. An example would be a medium composed of 20 g/L glucose, 10 g/L yeast extract, 10 g/L soy peptone, 2 g/L citric acid, 1.5 g/L sodium phosphate monobasic, 100 mg/L ferric ammonium citrate, 80 mg/L magnesium sulfate, 10 mg/L hemin chloride, 2 mg/L calcium chloride, 1 mg/L menadione. Another example would be a medium composed of 10 g/L beef extract, 10 g/L peptone, 5 g/L sodium chloride, 5 g/L dextrose, 3 g/L yeast extract, 3 g/L sodium acetate, 1 g/L soluble starch, and 0.5 g/L L-cysteine HCl, at pH 6.8. A variety of microbiological media and variations are well known in the art (e.g., R. M. Atlas, Handbook of Microbiological Media (2010) CRC Press). Culture media can be added to the culture at the start, may be added during the culture, or may be intermittently/continuously flowed through the culture. The strains in the bacterial composition may be cultivated alone, as a subset of the microbial composition, or as an entire collection comprising the microbial composition. As an example, a first strain may be cultivated together with a second strain in a mixed continuous culture, at a dilution rate lower than the maximum growth rate of either cell to prevent the culture from washing out of the cultivation.
- The inoculated culture is incubated under favorable conditions for a time sufficient to build biomass. For microbial compositions for human use this is often at 37° C. temperature, pH, and other parameter with values similar to the normal human niche. The environment may be actively controlled, passively controlled (e.g., via buffers), or allowed to drift. For example, for anaerobic bacterial compositions, an anoxic/reducing environment may be employed. This can be accomplished by addition of reducing agents such as cysteine to the broth, and/or stripping it of oxygen. As an example, a culture of a bacterial composition may be grown at 37° C.,
pH 7, in the medium above, pre-reduced with 1 g/L cysteine-HCl. - When the culture has generated sufficient biomass, it may be preserved for banking. The organisms may be placed into a chemical milieu that protects from freezing (adding ‘cryoprotectants’), drying (‘lyoprotectants’), and/or osmotic shock (‘osmoprotectants’), dispensing into multiple (optionally identical) containers to create a uniform bank, and then treating the culture for preservation. Containers are generally impermeable and have closures that assure isolation from the environment. Cryopreservation treatment is accomplished by freezing a liquid at ultra-low temperatures (e.g., at or below −80° C.). Dried preservation removes water from the culture by evaporation (in the case of spray drying or ‘cool drying’) or by sublimation (e.g., for freeze drying, spray freeze drying). Removal of water improves long-term microbial composition storage stability at temperatures elevated above cryogenic conditions. If the microbial composition comprises, for example, spore forming species and results in the production of spores, the final composition may be purified by additional means such as density gradient centrifugation and preserved using the techniques [?]described above[?]. Microbial composition banking may be done by culturing and preserving the strains individually, or by mixing the strains together to create a combined bank. As an example of cryopreservation, a microbial composition culture may be harvested by centrifugation to pellet the cells from the culture medium, the supernatant decanted and replaced with fresh culture broth containing 15% glycerol. The culture can then be aliquoted into 1 mL cryotubes, sealed, and placed at −80° C. for long-term viability retention. This procedure achieves acceptable viability upon recovery from frozen storage.
- Microbial production may be conducted using similar culture steps to banking, including medium composition and culture conditions described above. It may be conducted at larger scales of operation, especially for clinical development or commercial production. At larger scales, there may be several subcultivations of the microbial composition prior to the final cultivation. At the end of cultivation, the culture is harvested to enable further formulation into a dosage form for administration. This can involve concentration, removal of undesirable medium components, and/or introduction into a chemical milieu that preserves the microbial composition and renders it acceptable for administration via the chosen route. For example, a microbial composition may be cultivated to a concentration of 1010 CFU/mL, then concentrated 20-fold by tangential flow microfiltration; the spent medium may be exchanged by diafiltering with a preservative medium consisting of 2% gelatin, 100 mM trehalose, and 10 mM sodium phosphate buffer. The suspension can then be freeze-dried to a powder and titrated.
- After drying, the powder may be blended to an appropriate potency, and mixed with other cultures and/or a filler such as microcrystalline cellulose for consistency and ease of handling, and the bacterial composition formulated as provided herein.
- In certain aspects, provided are bacterial compositions for administration subjects. In some embodiments, the bacterial compositions are combined with additional active and/or inactive materials in order to produce a final product, which may be in single dosage unit or in a multi-dose format.
- In some embodiments, the composition comprises at least one carbohydrate. A “carbohydrate” refers to a sugar or polymer of sugars. The terms “saccharide,” “polysaccharide,” “carbohydrate,” and “oligosaccharide” may be used interchangeably. Most carbohydrates are aldehydes or ketones with many hydroxyl groups, usually one on each carbon atom of the molecule. Carbohydrates generally have the molecular formula CnH2nOn. A carbohydrate may be a monosaccharide, a disaccharide, trisaccharide, oligosaccharide, or polysaccharide. The most basic carbohydrate is a monosaccharide, such as glucose, sucrose, galactose, mannose, ribose, arabinose, xylose, and fructose. Disaccharides are two joined monosaccharides. Exemplary disaccharides include sucrose, maltose, cellobiose, and lactose. Typically, an oligosaccharide includes between three and six monosaccharide units (e.g., raffinose, stachyose), and polysaccharides include six or more monosaccharide units. Exemplary polysaccharides include starch, glycogen, and cellulose. Carbohydrates may contain modified saccharide units such as 2′-deoxyribose wherein a hydroxyl group is removed, 2′-fluororibose wherein a hydroxyl group is replaced with a fluorine, or N-acetylglucosamine, a nitrogen-containing form of glucose (e.g., 2′-fluororibose, deoxyribose, and hexose). Carbohydrates may exist in many different forms, for example, conformers, cyclic forms, acyclic forms, stereoisomers, tautomers, anomers, and isomers.
- In some embodiments, the composition comprises at least one lipid. As used herein, a “lipid” includes fats, oils, triglycerides, cholesterol, phospholipids, fatty acids in any form including free fatty acids. Fats, oils and fatty acids can be saturated, unsaturated (cis or trans) or partially unsaturated (cis or trans). In some embodiments the lipid comprises at least one fatty acid selected from lauric acid (12:0), myristic acid (14:0), palmitic acid (16:0), palmitoleic acid (16:1), margaric acid (17:0), heptadecenoic acid (17:1), stearic acid (18:0), oleic acid (18:1), linoleic acid (18:2), linolenic acid (18:3), octadecatetraenoic acid (18:4), arachidic acid (20:0), eicosenoic acid (20:1), eicosadienoic acid (20:2), eicosatetraenoic acid (20:4), eicosapentaenoic acid (20:5) (EPA), docosanoic acid (22:0), docosenoic acid (22:1), docosapentaenoic acid (22:5), docosahexaenoic acid (22:6) (DHA), and tetracosanoic acid (24:0). In some embodiments the composition comprises at least one modified lipid, for example a lipid that has been modified by cooking.
- In some embodiments, the composition comprises at least one supplemental mineral or mineral source. Examples of minerals include, without limitation: chloride, sodium, calcium, iron, chromium, copper, iodine, zinc, magnesium, manganese, molybdenum, phosphorus, potassium, and selenium. Suitable forms of any of the foregoing minerals include soluble mineral salts, slightly soluble mineral salts, insoluble mineral salts, chelated minerals, mineral complexes, non-reactive minerals such as carbonyl minerals, and reduced minerals, and combinations thereof.
- In some embodiments, the composition comprises at least one supplemental vitamin. The at least one vitamin can be fat-soluble or water soluble vitamins. Suitable vitamins include but are not limited to vitamin C, vitamin A, vitamin E, vitamin B12, vitamin K, riboflavin, niacin, vitamin D, vitamin B6, folic acid, pyridoxine, thiamine, pantothenic acid, and biotin. Suitable forms of any of the foregoing are salts of the vitamin, derivatives of the vitamin, compounds having the same or similar activity of the vitamin, and metabolites of the vitamin.
- In some embodiments, the composition comprises an excipient. Non-limiting examples of suitable excipients include a buffering agent, a preservative, a stabilizer, a binder, a compaction agent, a lubricant, a dispersion enhancer, a disintegration agent, a flavoring agent, a sweetener, and a coloring agent.
- In some embodiments, the excipient is a buffering agent. Non-limiting examples of suitable buffering agents include sodium citrate, magnesium carbonate, magnesium bicarbonate, calcium carbonate, and calcium bicarbonate.
- In some embodiments, the excipient comprises a preservative. Non-limiting examples of suitable preservatives include antioxidants, such as alpha-tocopherol and ascorbate, and antimicrobials, such as parabens, chlorobutanol, and phenol.
- In some embodiments, the composition comprises a binder as an excipient. Non-limiting examples of suitable binders include starches, pregelatinized starches, gelatin, polyvinylpyrolidone, cellulose, methylcellulose, sodium carboxymethylcellulose, ethylcellulose, polyacrylamides, polyvinyloxoazolidone, polyvinylalcohols, C12-C18 fatty acid alcohol, polyethylene glycol, polyols, saccharides, oligosaccharides, and combinations thereof.
- In some embodiments, the composition comprises a lubricant as an excipient. Non-limiting examples of suitable lubricants include magnesium stearate, calcium stearate, zinc stearate, hydrogenated vegetable oils, sterotex, polyoxyethylene monostearate, talc, polyethyleneglycol, sodium benzoate, sodium lauryl sulfate, magnesium lauryl sulfate, and light mineral oil.
- In some embodiments, the composition comprises a dispersion enhancer as an excipient. Non-limiting examples of suitable dispersants include starch, alginic acid, polyvinylpyrrolidones, guar gum, kaolin, bentonite, purified wood cellulose, sodium starch glycolate, isoamorphous silicate, and microcrystalline cellulose as high HLB emulsifier surfactants.
- In some embodiments, the composition comprises a disintegrant as an excipient. In some embodiments the disintegrant is a non-effervescent disintegrant. Non-limiting examples of suitable non-effervescent disintegrants include starches such as corn starch, potato starch, pregelatinized and modified starches thereof, sweeteners, clays, such as bentonite, microcrystalline cellulose, alginates, sodium starch glycolate, gums such as agar, guar, locust bean, karaya, pectin, and tragacanth. In some embodiments the disintegrant is an effervescent disintegrant. Non-limiting examples of suitable effervescent disintegrants include sodium bicarbonate in combination with citric acid, and sodium bicarbonate in combination with tartaric acid.
- In some embodiments, the bacterial formulation comprises an enteric coating or micro encapsulation. In certain embodiments, the enteric coating or micro encapsulation improves targeting to a desired region of the gastrointestinal tract. For example, in certain embodiments, the bacterial composition comprises an enteric coating and/or microcapsules that dissolves at a pH associated with a particular region of the gastrointestinal tract. In some embodiments, the enteric coating and/or microcapsules dissolve at a pH of about 5.5-6.2 to release in the duodenum, at a pH value of about 7.2-7.5 to release in the ileum, and/or at a pH value of about 5.6-6.2 to release in the colon. Exemplary enteric coatings and microcapsules are described, for example, in U.S. Pat. Pub. No. 2016/0022592, which is hereby incorporated by reference in its entirety.
- In some embodiments, the composition is a food product (e.g., a food or beverage) such as a health food or beverage, a food or beverage for infants, a food or beverage for pregnant women, athletes, senior citizens or other specified group, a functional food, a beverage, a food or beverage for specified health use, a dietary supplement, a food or beverage for patients, or an animal feed. Specific examples of the foods and beverages include various beverages such as juices, refreshing beverages, tea beverages, drink preparations, jelly beverages, and functional beverages; alcoholic beverages such as beers; carbohydrate-containing foods such as rice food products, noodles, breads, and pastas; paste products such as fish hams, sausages, paste products of seafood; retort pouch products such as curries, food dressed with a thick starchy sauces, and Chinese soups; soups; dairy products such as milk, dairy beverages, ice creams, cheeses, and yogurts; fermented products such as fermented soybean pastes, yogurts, fermented beverages, and pickles; bean products; various confectionery products, including biscuits, cookies, and the like, candies, chewing gums, gummies, cold desserts including jellies, cream caramels, and frozen desserts; instant foods such as instant soups and instant soy-bean soups; microwavable foods; and the like. Further, the examples also include health foods and beverages prepared in the forms of powders, granules, tablets, capsules, liquids, pastes, and jellies.
- In certain embodiments, the bacteria disclosed herein are administered in conjunction with a prebiotic to the subject. Prebiotics are carbohydrates which are generally indigestible by a host animal and are selectively fermented or metabolized by bacteria. Prebiotics may be short-chain carbohydrates (e.g., oligosaccharides) and/or simple sugars (e.g., mono- and di-saccharides) and/or mucins (heavily glycosylated proteins) that alter the composition or metabolism of a microbiome in the host. The short chain carbohydrates are also referred to as oligosaccharides, and usually contain from 2 or 3 and up to 8, 9, 10, 15 or more sugar moieties. When prebiotics are introduced to a host, the prebiotics affect the bacteria within the host and do not directly affect the host. In certain aspects, a prebiotic composition can selectively stimulate the growth and/or activity of one of a limited number of bacteria in a host. Prebiotics include oligosaccharides such as fructooligosaccharides (FOS) (including inulin), galactooligosaccharides (GOS), trans-galactooligosaccharides, xylooligosaccharides (XOS), chitooligosaccharides (COS), soy oligosaccharides (e.g., stachyose and raffinose) gentiooligosaccharides, isomaltooligosaccharides, mannooligosaccharides, maltooligosaccharides and mannanoligosaccharides. Oligosaccharides are not necessarily single components, and can be mixtures containing oligosaccharides with different degrees of oligomerization, sometimes including the parent disaccharide and the monomeric sugars. Various types of oligosaccharides are found as natural components in many common foods, including fruits, vegetables, milk, and honey. Specific examples of oligosaccharides are lactulose, lactosucrose, palatinose, glycosyl sucrose, guar gum, gum Arabic, tagalose, amylose, amylopectin, pectin, xylan, and cyclodextrins. Prebiotics may also be purified or chemically or enzymatically synthesized.
- In certain aspects, the PhABs described herein can be prepared using any method known in the art.
- In some embodiments, the PhABs described herein are prepared by fractionation. Bacterial cells and/or supernatants from cultured bacteria cells are fractionated into various pharmacologically active biomass (PhABs) and/or products derived therefrom. Bacterial cells and/or supernatants are fractionated using materials and methods known in the art (see e.g. Sandrini et al. Fractionation by ultracentrifugation of gram negative cytoplasmic and membrane proteins. 2014. Bio-Protocol. 4(21); Scholler et al. Protoplast and cytoplasmic membrane preparations from Streptococcus sanguis and Streptococcus mutans. 1983. J Gen Micro. 129: 3271-3279; Thein et al. Efficient subfractionation of gram-negative bacteria for proteomics studies. 2010. Am Chem Society. 9: 6135-6147; Hobb et al. Evaluation of procedures for outer membrane isolation from Campylobacter jejuni. 2009. 155(Pt. 3): 979-988).
- Additionally, PhABs obtained by methods provided herein may be further purified by size based column chromatography, by affinity chromatography, and by gradient ultracentrifugation, using methods that may include, but are not limited to, use of a sucrose gradient or Optiprep gradient. Briefly, using a sucrose gradient method, if ammonium sulfate precipitation or ultracentrifugation were used to concentrate the filtered supernatants, pellets are resuspended in 60% sucrose, 30 mM Tris, pH 8.0. If filtration was used to concentrate the filtered supernatant, the concentrate is buffer exchanged into 60% sucrose, 30 mM Tris, pH 8.0, using an Amicon Ultra column. Samples are applied to a 35-60% discontinuous sucrose gradient and centrifuged at 200,000×g for 3-24 hours at 4° C. Briefly, using an Optiprep gradient method, if ammonium sulfate precipitation or ultracentrifugation were used to concentrate the filtered supernatants, pellets are resuspended in 35% Optiprep in PBS. In some embodiments, if filtration was used to concentrate the filtered supernatant, the concentrate is diluted using 60% Optiprep to a final concentration of 35% Optiprep. Samples are applied to a 35-60% discontinuous sucrose gradient and centrifuged at 200,000×g for 3-24 hours at 4° C.
- In some embodiments, to confirm sterility and isolation of the PhAB preparations, PhABs are serially diluted onto agar medium used for routine culture of the bacteria being tested, and incubated using routine conditions. Non-sterile preparations are passed through a 0.22 um filter to exclude intact cells. To further increase purity, isolated PhABs may be DNase or proteinase K treated.
- In some embodiments, for preparation of PhABs used for in vivo injections, purified PhABs are processed as described previously (G. Norheim, et al. PLoS ONE. 10(9): e0134353 (2015)). Briefly, after sucrose gradient centrifugation, bands containing PhABs are resuspended to a final concentration of 50 μg/mL in a solution containing 3% sucrose or other solution suitable for in vivo injection known to one skilled in the art. This solution may also contain adjuvant, for example aluminum hydroxide at a concentration of 0-0.5% (w/v).
- In certain embodiments, to make samples compatible with further testing (e.g. to remove sucrose prior to TEM imaging or in vitro assays), samples are buffer exchanged into PBS or 30 mM Tris, pH 8.0 using filtration (e.g. Amicon Ultra columns), dialysis, or ultracentrifugation (200,000×g, ≥3 hours, 4° C.) and resuspension.
- In some embodiments, the sterility of the PhAB preparations can be confirmed by plating a portion of the PhABs onto agar medium used for standard culture of the bacteria used in the generation of the PhABs and incubating using standard conditions.
- In some embodiments select PhABs are isolated and enriched by chromatography and binding surface moieties on PhABs. In other embodiments, select PhABs are isolated and/or enriched by fluorescent cell sorting by methods using affinity reagents, chemical dyes, recombinant proteins or other methods known to one skilled in the art.
- In certain aspects, provided herein is a method of delivering a bacterium and/or a bacterial composition described herein to a subject. In some embodiments of the methods provided herein, the bacteria are administered in conjunction with the administration of an additional therapeutic. In some embodiments, the bacteria is co-formulated in a pharmaceutical composition with the additional therapeutic. In some embodiments, the bacteria is co-administered with the additional therapeutic. In some embodiments, the additional therapeutic is administered to the subject before administration of the bacteria (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 or 55 minutes before, about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22 or 23 hours before, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days before). In some embodiments, the additional therapeutic is administered to the subject after administration of the bacteria (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 or 55 minutes after, about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22 or 23 hours after, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 days after). In some embodiments, the same mode of delivery is used to deliver both the bacteria and the additional therapeutic. In some embodiments different modes of delivery are used to administer the bacteria and the additional therapeutic. For example, in some embodiments, the bacteria is administered orally while the additional therapeutic is administered via injection (e.g., an intravenous, intramuscular and/or intratumoral injection).
- In certain embodiments, the pharmaceutical compositions, dosage forms, and kits described herein can be administered in conjunction with any other conventional anti-immune disorder treatment. These treatments may be applied as necessary and/or as indicated and may occur before, concurrent with or after administration of the pharmaceutical compositions, dosage forms, and kits described herein.
- The dosage regimen can be any of a variety of methods and amounts, and can be determined by one skilled in the art according to known clinical factors. As is known in the medical arts, dosages for any one patient can depend on many factors, including the subject's species, size, body surface area, age, sex, immunocompetence, and general health, the particular microorganism to be administered, duration and route of administration, the kind and stage of the disease, for example, tumor size, and other compounds such as drugs being administered concurrently. In addition to the above factors, such levels can be affected by the infectivity of the microorganism, and the nature of the microorganism, as can be determined by one skilled in the art. In the present methods, appropriate minimum dosage levels of microorganisms can be levels sufficient for the microorganism to survive, grow and replicate. The methods of treatment described herein may be suitable for the treatment of an immune disorder (e.g., an autoimmune disease, an inflammatory disease, an allergy). The dose of the pharmaceutical compositions described herein may be appropriately set or adjusted in accordance with the dosage form, the route of administration, the degree or stage of a target disease, and the like. For example, the general effective dose of the agents may range between 0.01 mg/kg body weight/day and 1000 mg/kg body weight/day, between 0.1 mg/kg body weight/day and 1000 mg/kg body weight/day, 0.5 mg/kg body weight/day and 500 mg/kg body weight/day, 1 mg/kg body weight/day and 100 mg/kg body weight/day, or between 5 mg/kg body weight/day and 50 mg/kg body weight/day. The effective dose may be 0.01, 0.05, 0.1, 0.5, 1, 2, 3, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 500, or 1000 mg/kg body weight/day or more, but the dose is not limited thereto.
- In some embodiments, the dose administered to a subject is sufficient to prevent the immune disorder, delay its onset, or slow or stop its progression or prevent a relapse of the immune disorder. One skilled in the art will recognize that dosage will depend upon a variety of factors including the strength of the particular compound employed, as well as the age, species, condition, and body weight of the subject. The size of the dose will also be determined by the route, timing, and frequency of administration as well as the existence, nature, and extent of any adverse side-effects that might accompany the administration of a particular compound and the desired physiological effect.
- Suitable doses and dosage regimens can be determined by conventional range-finding techniques known to those of ordinary skill in the art. Generally, treatment is initiated with smaller dosages, which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under the circumstances is reached. An effective dosage and treatment protocol can be determined by routine and conventional means, starting e.g., with a low dose in laboratory animals and then increasing the dosage while monitoring the effects, and systematically varying the dosage regimen as well. Animal studies are commonly used to determine the maximal tolerable dose (“MTD”) of bioactive agent per kilogram weight. Those skilled in the art regularly extrapolate doses for efficacy, while avoiding toxicity, in other species, including humans.
- In accordance with the above, in therapeutic applications, the dosages of the active agents used in accordance with the invention vary depending on the active agent, the age, weight, and clinical condition of the recipient patient, and the experience and judgment of the clinician or practitioner administering the therapy, among other factors affecting the selected dosage. Generally, the dose should be sufficient to result in slowing, and preferably regressing, the advancement of an immune disorder.
- Separate administrations can include any number of two or more administrations (e.g., doses), including two, three, four, five or six administrations. One skilled in the art can readily determine the number of administrations to perform, or the desirability of performing one or more additional administrations, according to methods known in the art for monitoring therapeutic methods and other monitoring methods provided herein. In some embodiments, the doses may be separated by at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days or 1, 2, 3, or 4 weeks. Accordingly, the methods provided herein include methods of providing to the subject one or more administrations of a bacterium, where the number of administrations can be determined by monitoring the subject, and, based on the results of the monitoring, determining whether or not to provide one or more additional administrations. Deciding on whether or not to provide one or more additional administrations can be based on a variety of monitoring results, including, but not limited to, indication of tumor growth or inhibition of tumor growth, appearance of new metastases or inhibition of metastasis, the subject's anti-bacterium antibody titer, the subject's anti-tumor antibody titer, the overall health of the subject and/or the weight of the subject.
- The time period between administrations can be any of a variety of time periods. The time period between administrations can be a function of any of a variety of factors, including monitoring steps, as described in relation to the number of administrations, the time period for a subject to mount an immune response and/or the time period for a subject to clear the bacteria from normal tissue. In one example, the time period can be a function of the time period for a subject to mount an immune response; for example, the time period can be more than the time period for a subject to mount an immune response, such as more than about one week, more than about ten days, more than about two weeks, or more than about a month; in another example, the time period can be less than the time period for a subject to mount an immune response, such as less than about one week, less than about ten days, less than about two weeks, or less than about a month. In another example, the time period can be a function of the time period for a subject to clear the bacteria from normal tissue; for example, the time period can be more than the time period for a subject to clear the bacteria from normal tissue, such as more than about a day, more than about two days, more than about three days, more than about five days, or more than about a week.
- In some embodiments, the delivery of an immune disorder therapeutic in combination with the bacteria described herein reduces the adverse effects and/or improves the efficacy of the immune disorder therapeutic.
- The effective dose of an immune disorder therapeutic described herein is the amount of the therapeutic agent that is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, with the least toxicity to the patient. The effective dosage level can be identified using the methods described herein and will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions administered, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts. In general, an effective dose of an immune disorder therapy will be the amount of the therapeutic agent, which is the lowest dose effective to produce a therapeutic effect. Such an effective dose will generally depend upon the factors described above.
- The toxicity of an immune disorder therapy is the level of adverse effects experienced by the subject during and following treatment. Adverse events associated with immune disorder therapy toxicity include, but are not limited to, abdominal pain, acid indigestion, acid reflux, allergic reactions, alopecia, anaphylaxis, anemia, anxiety, lack of appetite, arthralgias, asthenia, ataxia, azotemia, loss of balance, bone pain, bleeding, blood clots, low blood pressure, elevated blood pressure, difficulty breathing, bronchitis, bruising, low white blood cell count, low red blood cell count, low platelet count, cardiotoxicity, cystitis, hemorrhagic cystitis, arrhythmias, heart valve disease, cardiomyopathy, coronary artery disease, cataracts, central neurotoxicity, cognitive impairment, confusion, conjunctivitis, constipation, coughing, cramping, cystitis, deep vein thrombosis, dehydration, depression, diarrhea, dizziness, dry mouth, dry skin, dyspepsia, dyspnea, edema, electrolyte imbalance, esophagitis, fatigue, loss of fertility, fever, flatulence, flushing, gastric reflux, gastroesophageal reflux disease, genital pain, granulocytopenia, gynecomastia, glaucoma, hair loss, hand-foot syndrome, headache, hearing loss, heart failure, heart palpitations, heartburn, hematoma, hemorrhagic cystitis, hepatotoxicity, hyperamylasemia, hypercalcemia, hyperchloremia, hyperglycemia, hyperkalemia, hyperlipasemia, hypermagnesemia, hypernatremia, hyperphosphatemia, hyperpigmentation, hypertriglyceridemia, hyperuricemia, hypoalbuminemia, hypocalcemia, hypochloremia, hypoglycemia, hypokalemia, hypomagnesemia, hyponatremia, hypophosphatemia, impotence, infection, injection site reactions, insomnia, iron deficiency, itching, joint pain, kidney failure, leukopenia, liver dysfunction, memory loss, menopause, mouth sores, mucositis, muscle pain, myalgias, myelosuppression, myocarditis, neutropenic fever, nausea, nephrotoxicity, neutropenia, nosebleeds, numbness, ototoxicity, pain, palmar-plantar erythrodysesthesia, pancytopenia, pericarditis, peripheral neuropathy, pharyngitis, photophobia, photosensitivity, pneumonia, pneumonitis, proteinuria, pulmonary embolus, pulmonary fibrosis, pulmonary toxicity, rash, rapid heart beat, rectal bleeding, restlessness, rhinitis, seizures, shortness of breath, sinusitis, thrombocytopenia, tinnitus, urinary tract infection, vaginal bleeding, vaginal dryness, vertigo, water retention, weakness, weight loss, weight gain, and xerostomia. In general, toxicity is acceptable if the benefits to the subject achieved through the therapy outweigh the adverse events experienced by the subject due to the therapy.
- In some embodiments, the administration of the bacterial composition treats the immune disorder.
- In certain aspects, the methods provided herein include the administration to a subject of a bacterium and/or a bacterial composition described herein (e.g., an immune modulating Lactococcus strain-containing bacterial composition) either alone or in combination with another therapeutic. In some embodiments, the bacterial composition and the other therapy can be administered to the subject in any order. In some embodiments, the bacterial composition and the other therapy are administered conjointly.
- In some embodiments the bacterium is administered to the subject before the additional therapeutic is administered (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 hours before or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days before). In some embodiments the bacterium is administered to the subject after the additional therapeutic is administered (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 hours after or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days after). In some embodiments, the bacterium and the additional therapeutic are administered to the subject simultaneously or nearly simultaneously (e.g., administrations occur within an hour of each other). In some embodiments, the subject is administered an antibiotic before the bacterium is administered to the subject (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 hours before or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days before). In some embodiments, the subject is administered an antibiotic after the bacterium is administered to the subject (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 hours before or at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 days after). In some embodiments, the bacterium and the antibiotic are administered to the subject simultaneously or nearly simultaneously (e.g., administrations occur within an hour of each other).
- In certain embodiments, the subject may undergo surgery. Types of surgery include but are not limited to preventative, diagnostic or staging, curative and palliative surgery.
- In some embodiments, the additional therapeutic is an antibiotic. For example, if the presence of a immune-disorder-associated bacteria and/or an immune-disorder-associated microbiome profile is detected according to the methods provided herein, antibiotics can be administered to eliminate the immune-disorder-associated bacteria from the subject. “Antibiotics” broadly refers to compounds capable of inhibiting or preventing a bacterial infection. Antibiotics can be classified in a number of ways, including their use for specific infections, their mechanism of action, their bioavailability, or their spectrum of target microbe (e.g., Gram-negative vs. Gram-positive bacteria, aerobic vs. anaerobic bacteria, etc.) and these may be used to kill specific bacteria in specific areas of the host (“niches”) (Leekha, et al 2011. General Principles of Antimicrobial Therapy. Mayo Clin Proc. 86(2): 156-167). In certain embodiments, antibiotics can be used to selectively target bacteria of a specific niche. In some embodiments, antibiotics known to treat a particular infection that includes an immune disorder niche may be used to target immune-disorder-associated microbes, including immune-disorder-associated bacteria in that niche. In other embodiments, antibiotics are administered after the bacterial treatment. In some embodiments, antibiotics are administered after the bacterial treatment to remove the engraftment.
- In some aspects, antibiotics can be selected based on their bactericidal or bacteriostatic properties. Bactericidal antibiotics include mechanisms of action that disrupt the cell wall (e.g., β-lactams), the cell membrane (e.g., daptomycin), or bacterial DNA (e.g., fluoroquinolones). Bacteriostatic agents inhibit bacterial replication and include sulfonamides, tetracyclines, and macrolides, and act by inhibiting protein synthesis. Furthermore, while some drugs can be bactericidal in certain organisms and bacteriostatic in others, knowing the target organism allows one skilled in the art to select an antibiotic with the appropriate properties. In certain treatment conditions, bacteriostatic antibiotics inhibit the activity of bactericidal antibiotics. Thus, in certain embodiments, bactericidal and bacteriostatic antibiotics are not combined.
- Antibiotics include, but are not limited to aminoglycosides, ansamycins, carbacephems, carbapenems, cephalosporins, glycopeptides, lincosamides, lipopeptides, macrolides, monobactams, nitrofurans, oxazolidonones, penicillins, polypeptide antibiotics, quinolones, fluoroquinolone, sulfonamides, tetracyclines, and anti-mycobacterial compounds, and combinations thereof.
- Aminoglycosides include, but are not limited to Amikacin, Gentamicin, Kanamycin, Neomycin, Netilmicin, Tobramycin, Paromomycin, and Spectinomycin. Aminoglycosides are effective, e.g., against Gram-negative bacteria, such as Escherichia coli, Klebsiella, Pseudomonas aeruginosa, and Francisella tularensis, and against certain aerobic bacteria but less effective against obligate/facultative anaerobes. Aminoglycosides are believed to bind to the bacterial 30S or 50S ribosomal subunit thereby inhibiting bacterial protein synthesis.
- Ansamycins include, but are not limited to, Geldanamycin, Herbimycin, Rifamycin, and Streptovaricin. Geldanamycin and Herbimycin are believed to inhibit or alter the function of Heat Shock Protein 90.
- Carbacephems include, but are not limited to, Loracarbef. Carbacephems are believed to inhibit bacterial cell wall synthesis.
- Carbapenems include, but are not limited to, Ertapenem, Doripenem, Imipenem/Cilastatin, and Meropenem. Carbapenems are bactericidal for both Gram-positive and Gram-negative bacteria as broad-spectrum antibiotics. Carbapenems are believed to inhibit bacterial cell wall synthesis.
- Cephalosporins include, but are not limited to, Cefadroxil, Cefazolin, Cefalotin, Cefalothin, Cefalexin, Cefaclor, Cefamandole, Cefoxitin, Cefprozil, Cefuroxime, Cefixime, Cefdinir, Cefditoren, Cefoperazone, Cefotaxime, Cefpodoxime, Ceftazidime, Ceftibuten, Ceftizoxime, Ceftriaxone, Cefepime, Ceftaroline fosamil, and Ceftobiprole. Selected Cephalosporins are effective, e.g., against Gram-negative bacteria and against Gram-positive bacteria, including Pseudomonas, certain Cephalosporins are effective against methicillin-resistant Staphylococcus aureus (MRSA). Cephalosporins are believed to inhibit bacterial cell wall synthesis by disrupting synthesis of the peptidoglycan layer of bacterial cell walls.
- Glycopeptides include, but are not limited to, Teicoplanin, Vancomycin, and Telavancin. Glycopeptides are effective, e.g., against aerobic and anaerobic Gram-positive bacteria including MRSA and Clostridium difficile. Glycopeptides are believed to inhibit bacterial cell wall synthesis by disrupting synthesis of the peptidoglycan layer of bacterial cell walls.
- Lincosamides include, but are not limited to, Clindamycin and Lincomycin. Lincosamides are effective, e.g., against anaerobic bacteria, as well as Staphylococcus, and Streptococcus. Lincosamides are believed to bind to the bacterial 50S ribosomal subunit thereby inhibiting bacterial protein synthesis.
- Lipopeptides include, but are not limited to, Daptomycin. Lipopeptides are effective, e.g., against Gram-positive bacteria. Lipopeptides are believed to bind to the bacterial membrane and cause rapid depolarization.
- Macrolides include, but are not limited to, Azithromycin, Clarithromycin, Dirithromycin, Erythromycin, Roxithromycin, Troleandomycin, Telithromycin, and Spiramycin. Macrolides are effective, e.g., against Streptococcus and Mycoplasma. Macrolides are believed to bind to the bacterial or 50S ribosomal subunit, thereby inhibiting bacterial protein synthesis.
- Monobactams include, but are not limited to, Aztreonam. Monobactams are effective, e.g., against Gram-negative bacteria. Monobactams are believed to inhibit bacterial cell wall synthesis by disrupting synthesis of the peptidoglycan layer of bacterial cell walls.
- Nitrofurans include, but are not limited to, Furazolidone and Nitrofurantoin.
- Oxazolidonones include, but are not limited to, Linezolid, Posizolid, Radezolid, and Torezolid. Oxazolidonones are believed to be protein synthesis inhibitors.
- Penicillins include, but are not limited to, Amoxicillin, Ampicillin, Azlocillin, Carbenicillin, Cloxacillin, Dicloxacillin, Flucloxacillin, Mezlocillin, Methicillin, Nafcillin, Oxacillin, Penicillin G, Penicillin V, Piperacillin, Temocillin and Ticarcillin. Penicillins are effective, e.g., against Gram-positive bacteria, facultative anaerobes, e.g., Streptococcus, Borrelia, and Treponema. Penicillins are believed to inhibit bacterial cell wall synthesis by disrupting synthesis of the peptidoglycan layer of bacterial cell walls.
- Penicillin combinations include, but are not limited to, Amoxicillin/clavulanate, Ampicillin/sulbactam, Piperacillin/tazobactam, and Ticarcillin/clavulanate.
- Polypeptide antibiotics include, but are not limited to, Bacitracin, Colistin, and Polymyxin B and E. Polypeptide Antibiotics are effective, e.g., against Gram-negative bacteria. Certain polypeptide antibiotics are believed to inhibit isoprenyl pyrophosphate involved in synthesis of the peptidoglycan layer of bacterial cell walls, while others destabilize the bacterial outer membrane by displacing bacterial counter-ions.
- Quinolones and Fluoroquinolone include, but are not limited to, Ciprofloxacin, Enoxacin, Gatifloxacin, Gemifloxacin, Levofloxacin, Lomefloxacin, Moxifloxacin, Nalidixic acid, Norfloxacin, Ofloxacin, Trovafloxacin, Grepafloxacin, Sparfloxacin, and Temafloxacin. Quinolones/Fluoroquinolone are effective, e.g., against Streptococcus and Neisseria. Quinolones/Fluoroquinolone are believed to inhibit the bacterial DNA gyrase or topoisomerase IV, thereby inhibiting DNA replication and transcription.
- Sulfonamides include, but are not limited to, Mafenide, Sulfacetamide, Sulfadiazine, Silver sulfadiazine, Sulfadimethoxine, Sulfamethizole, Sulfamethoxazole, Sulfanilimide, Sulfasalazine, Sulfisoxazole, Trimethoprim-Sulfamethoxazole (Co-trimoxazole), and Sulfonamidochrysoidine. Sulfonamides are believed to inhibit folate synthesis by competitive inhibition of dihydropteroate synthetase, thereby inhibiting nucleic acid synthesis.
- Tetracyclines include, but are not limited to, Demeclocycline, Doxycycline, Minocycline, Oxytetracycline, and Tetracycline. Tetracyclines are effective, e.g., against Gram-negative bacteria. Tetracyclines are believed to bind to the bacterial 30S ribosomal subunit thereby inhibiting bacterial protein synthesis.
- Anti-mycobacterial compounds include, but are not limited to, Clofazimine, Dapsone, Capreomycin, Cycloserine, Ethambutol, Ethionamide, Isoniazid, Pyrazinamide, Rifampicin, Rifabutin, Rifapentine, and Streptomycin.
- Suitable antibiotics also include arsphenamine, chloramphenicol, fosfomycin, fusidic acid, metronidazole, mupirocin, platensimycin, quinupristin/dalfopristin, tigecycline, tinidazole, trimethoprim amoxicillin/clavulanate, ampicillin/sulbactam, amphomycin ristocetin, azithromycin, bacitracin, buforin II, carbomycin, cecropin Pl, clarithromycin, erythromycins, furazolidone, fusidic acid, Na fusidate, gramicidin, imipenem, indolicidin, josamycin, magainan II, metronidazole, nitroimidazoles, mikamycin, mutacin B-Ny266, mutacin B-JH1 140, mutacin J-T8, nisin, nisin A, novobiocin, oleandomycin, ostreogrycin, piperacillin/tazobactam, pristinamycin, ramoplanin, ranalexin, reuterin, rifaximin, rosamicin, rosaramicin, spectinomycin, spiramycin, staphylomycin, streptogramin, streptogramin A, synergistin, taurolidine, teicoplanin, telithromycin, ticarcillin/clavulanic acid, triacetyloleandomycin, tylosin, tyrocidin, tyrothricin, vancomycin, vemamycin, and virginiamycin.
- In some embodiments, the additional therapeutic is an immunosuppressive agent, a DMARD, a pain-control drug, a steroid, a non-steroidal antiinflammatory drug (NSAID), or a cytokine antagonist, and combinations thereof. Representative agents include, but are not limited to, cyclosporin, retinoids, corticosteroids, propionic acid derivative, acetic acid derivative, enolic acid derivatives, fenamic acid derivatives, Cox-2 inhibitors, lumiracoxib, ibuprophen, cholin magnesium salicylate, fenoprofen, salsalate, difunisal, tolmetin, ketoprofen, flurbiprofen, oxaprozin, indomethacin, sulindac, etodolac, ketorolac, nabumetone, naproxen, valdecoxib, etoricoxib, MK0966; rofecoxib, acetominophen, Celecoxib, Diclofenac, tramadol, piroxicam, meloxicam, tenoxicam, droxicam, lornoxicam, isoxicam, mefanamic acid, meclofenamic acid, flufenamic acid, tolfenamic, valdecoxib, parecoxib, etodolac, indomethacin, aspirin, ibuprophen, firocoxib, methotrexate (MTX), antimalarial drugs (e.g., hydroxychloroquine and chloroquine), sulfasalazine, Leflunomide, azathioprine, cyclosporin, gold salts, minocycline, cyclophosphamide, D-penicillamine, minocycline, auranofin, tacrolimus, myocrisin, chlorambucil, TNF alpha antagonists (e.g., TNF alpha antagonists or TNF alpha receptor antagonists), e.g., ADALIMUMAB (Humira®), ETANERCEPT (Enbrel®), INFLIXIMAB (Remicade®; TA-650), CERTOLIZUMAB PEGOL (Cimzia®; CDP870), GOLIMUMAB (Simpom®; CNTO 148), ANAKINRA (Kineret®), RITUXIMAB (Rituxan®; MabThera®), ABATACEPT (Orencia®), TOCILIZUMAB (RoActemra/Actemra®), integrin antagonists (TYSABRI® (natalizumab)), IL-1 antagonists (ACZ885 (Ilaris)), Anakinra (Kineret®)), CD4 antagonists, IL-23 antagonists, IL-20 antagonists, IL-6 antagonists, BLyS antagonists (e.g., Atacicept, Benlysta®/LymphoStat-B® (belimumab)), p38 Inhibitors, CD20 antagonists (Ocrelizumab, Ofatumumab (Arzerra®)), interferon gamma antagonists (Fontolizumab), prednisolone, Prednisone, dexamethasone, Cortisol, cortisone, hydrocortisone, methylprednisolone, betamethasone, triamcinolone, beclometasome, fludrocortisone, deoxycorticosterone, aldosterone, Doxycycline, vancomycin, pioglitazone, SBI-087, SC10-469, Cura-100, Oncoxin+Viusid, TwHF, Methoxsalen, Vitamin D—ergocalciferol, Milnacipran, Paclitaxel, rosig tazone, Tacrolimus (Prograf®), RADOO1, rapamune, rapamycin, fostamatinib, Fentanyl, XOMA 052, Fostamatinib disodium, rosightazone, Curcumin (Longvida™) Rosuvastatin, Maraviroc, ramipnl, Milnacipran, Cobiprostone, somatropin, tgAAC94 gene therapy vector, MK0359, GW856553, esomeprazole, everolimus, trastuzumab, JAK1 and JAK2 inhibitors, pan JAK inhibitors, e.g., tetracyclic pyridone 6 (P6), 325, PF-956980, denosumab, IL-6 antagonists, CD20 antagonistis, CTLA4 antagonists, IL-8 antagonists, IL-21 antagonists, IL-22 antagonist, integrin antagonists (Tysarbri® (natalizumab)), VGEF antagnosits, CXCL antagonists, MMP antagonists, defensin antagonists, IL-1 antagonists (including IL-1 beta antagonsits), and IL-23 antagonists (e.g., receptor decoys, antagonistic antibodies, etc.).
- In some embodiments, the agent is an immunosuppressive agent. Examples of immunosuppressive agents include, but are not limited to, corticosteroids, mesalazine, mesalamine, sulfasalazine, sulfasalazine derivatives, immunosuppressive drugs, cyclosporin A, mercaptopurine, azathiopurine, prednisone, methotrexate, antihistamines, glucocorticoids, epinephrine, theophylline, cromolyn sodium, anti-leukotrienes, anti-cholinergic drugs for rhinitis, TLR antagonists, inflammasome inhibitors, anti-cholinergic decongestants, mast-cell stabilizers, monoclonal anti-IgE antibodies, vaccines (e.g., vaccines used for vaccination where the amount of an allergen is gradually increased), cytokine inhibitors, such as anti-IL-6 antibodies, TNF inhibitors such as infliximab, adalimumab, certolizumab pegol, golimumab, or etanercept, and combinations thereof.
- In some embodiments, the immune disorder therapy comprises administering a therapeutic bacteria and/or a therapeutic combination of bacteria to the subject so a healthy microbiome can be reconstituted in the subject. In some embodiments, the therapeutic bacteria is a non-immune-disorder-associated bacteria. In some embodiments the therapeutic bacteria is a probiotic bacteria.
- In some embodiments, the additional therapeutic is a cancer therapeutic. In some embodiments, the cancer therapeutic is a chemotherapeutic agent. Examples of such chemotherapeutic agents include, but are not limited to, alkylating agents such as cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammalI and calicheamicin omegal1; dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores, aclacinomysins, actinomycin, authrarnycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK polysaccharide complex); razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2′,2″-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (“Ara-C”); cyclophosphamide; thiotepa; taxoids, e.g., paclitaxel and doxetaxel; chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum coordination complexes such as cisplatin, oxaliplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (e.g., CPT-11); topoisomerase inhibitor RFS 2000; difluoromethylomithine (DMFO); retinoids such as retinoic acid; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- In some embodiments, the cancer therapeutic is a cancer immunotherapy agent. Immunotherapy refers to a treatment that uses a subject's immune system to treat cancer, e.g., checkpoint inhibitors, cancer vaccines, cytokines, cell therapy, CAR-T cells, and dendritic cell therapy. Non-limiting examples of immunotherapies are checkpoint inhibitors include Nivolumab (BMS, anti-PD-1), Pembrolizumab (Merck, anti-PD-1), Ipilimumab (BMS, anti-CTLA-4), MEDI4736 (AstraZeneca, anti-PD-L1), and MPDL3280A (Roche, anti-PD-L1). Other immunotherapies may be tumor vaccines, such as Gardail, Cervarix, BCG, sipulencel-T, Gp100:209-217, AGS-003, DCVax-L, Algenpantucel-L, Tergenpantucel-L, TG4010, ProstAtak, Prostvac-V/R-TRICOM, Rindopepimul, E75 peptide acetate, IMA901, POL-103A, Belagenpumatucel-L, GSK1572932A, MDX-1279, GV1001, and Tecemotide. Immunotherapy may be administered via injection (e.g., intravenously, intratumorally, subcutaneously, or into lymph nodes), but may also be administered orally, topically, or via aerosol. Immunotherapies may comprise adjuvants such as cytokines.
- In some embodiments, the immunotherapy agent is an immune checkpoint inhibitor. Immune checkpoint inhibition broadly refers to inhibiting the checkpoints that cancer cells can produce to prevent or downregulate an immune response. Examples of immune checkpoint proteins include, but are not limited to, CTLA4, PD-1, PD-L1, PD-L2, A2AR, B7-H3, B7-H4, BTLA, KIR, LAGS, TIM-3 or VISTA. Immune checkpoint inhibitors can be antibodies or antigen binding fragments thereof that bind to and inhibit an immune checkpoint protein. Examples of immune checkpoint inhibitors include, but are not limited to, nivolumab, pembrolizumab, pidilizumab, AMP-224, AMP-514, STI-A1110, TSR-042, RG-7446, BMS-936559, MEDI-4736, MSB-0020718C, AUR-012 and STI-A1010.
- In some embodiments, the immunotherapy agent is an antibody or antigen binding fragment thereof that, for example, binds to a cancer-associated antigen. Examples of cancer-associated antigens include, but are not limited to, adipophilin, AIM-2, ALDH1A1, alpha-actinin-4, alpha-fetoprotein (“AFP”), ARTC1, B-RAF, BAGE-1, BCLX (L), BCR-ABL fusion protein b3a2, beta-catenin, BING-4, CA-125, CALCA, carcinoembryonic antigen (“CEA”), CASP-5, CASP-8, CD274, CD45, Cdc27, CDK12, CDK4, CDKN2A, CEA, CLPP, COA-1, CPSF, CSNK1A1, CTAG1, CTAG2, cyclin D1, Cyclin-A1, dek-can fusion protein, DKK1, EFTUD2, Elongation factor 2, ENAH (hMena), Ep-CAM, EpCAM, EphA3, epithelial tumor antigen (“ETA”), ETV6-AML1 fusion protein, EZH2, FGF5, FLT3-ITD, FN1, G250/MN/CAIX, GAGE-1,2,8, GAGE-3,4,5,6,7, GAS7, glypican-3, GnTV, gp100/Pme117, GPNMB, HAUS3, Hepsin, HER-2/neu, HERV-K-MEL, HLA-A11, HLA-A2, HLA-DOB, hsp70-2, IDO1, IGF2B3, IL13Ralpha2, Intestinal carboxyl esterase, K-ras, Kallikrein 4, KIF20A, KK-LC-1, KKLC1, KM-HN-1, KMHN1 also known as CCDC110, LAGE-1, LDLR-fucosyltransferaseAS fusion protein, Lengsin, M-CSF, MAGE-A1, MAGE-A10, MAGE-A12, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A9, MAGE-C1, MAGE-C2, malic enzyme, mammaglobin-A, MART2, MATN, MC1R, MCSP, mdm-2, ME1, Melan-A/MART-1, Meloe, Midkine, MMP-2, MMP-7, MUC1, MUCSAC, mucin, MUM-1, MUM-2, MUM-3, Myosin, Myosin class I, N-raw, NA88-A, neo-PAP, NFYC, NY-BR-1, NY-ESO-1/LAGE-2, OA1, OGT, OS-9, P polypeptide, p53, PAP, PAX5, PBF, pml-RARalpha fusion protein, polymorphic epithelial mucin (“PEM”), PPP1R3B, PRAME, PRDX5, PSA, PSMA, PTPRK, RAB38/NY-MEL-1, RAGE-1, RBAF600, RGS5, RhoC, RNF43, RU2AS, SAGE, secernin 1, SIRT2, SNRPD1, SOX10, Sp17, SPA17, SSX-2, SSX-4, STEAP1, survivin, SYT-SSX1 or -SSX2 fusion protein, TAG-1, TAG-2, Telomerase, TGF-betaRll, TPBG, TRAG-3, Triosephosphate isomerase, TRP-1/gp75, TRP-2, TRP2-INT2, tyrosinase, tyrosinase (“TYR”), VEGF, WT1, XAGE-1b/GAGED2a. In some embodiments, the antigen is a neo-antigen.
- In some embodiments, the immunotherapy agent is a cancer vaccine and/or a component of a cancer vaccine (e.g., an antigenic peptide and/or protein). The cancer vaccine can be a protein vaccine, a nucleic acid vaccine or a combination thereof. For example, in some embodiments, the cancer vaccine comprises a polypeptide comprising an epitope of a cancer-associated antigen. In some embodiments, the cancer vaccine comprises a nucleic acid (e.g., DNA or RNA, such as mRNA) that encodes an epitope of a cancer-associated antigen. In some embodiments, the nucleic acid is a vector (e.g., a bacterial vector, viral vector). Examples of bacterial vectors include, but are not limited to, Mycobacterium bovis (BCG), Salmonella Typhimurium ssp., Salmonella Typhi ssp., Clostridium sp. spores, Escherichia coli Nissle 1917, Escherichia coli K-12/LLO, Listeria monocytogenes, and Shigella flexneri. Examples of viral vectors include, but are not limited to, vaccinia, adenovirus, RNA viruses, and replication defective avipox, replication-defective fowlpox, replication-defective canarypox, replication defective MVA and replication-defective adenovirus.
- In some embodiments, the cancer immunotherapy comprises administration of an antigen presenting cell (APC) primed with a cancer-specific antigen. In some embodiments, the APC is a dendritic cell, a macrophage or a B cell.
- Examples of cancer-associated antigens include, but are not limited to, adipophilin, AIM-2, ALDH1A1, alpha-actinin-4, alpha-fetoprotein (“AFP”), ARTC1, B-RAF, BAGE-1, BCLX (L), BCR-ABL fusion protein b3a2, beta-catenin, BING-4, CA-125, CALCA, carcinoembryonic antigen (“CEA”), CASP-5, CASP-8, CD274, CD45, Cdc27, CDK12, CDK4, CDKN2A, CEA, CLPP, COA-1, CPSF, CSNK1A1, CTAG1, CTAG2, cyclin D1, Cyclin-A1, dek-can fusion protein, DKK1, EFTUD2, Elongation factor 2, ENAH (hMena), Ep-CAM, EpCAM, EphA3, epithelial tumor antigen (“ETA”), ETV6-AML1 fusion protein, EZH2, FGF5, FLT3-ITD, FN1, G250/MN/CAIX, GAGE-1,2,8, GAGE-3,4,5,6,7, GAS7, glypican-3, GnTV, gp100/Pme117, GPNMB, HAUS3, Hepsin, HER-2/neu, HERV-K-MEL, HLA-A11, HLA-A2, HLA-DOB, hsp70-2, IDO1, IGF2B3, IL13Ralpha2, Intestinal carboxyl esterase, K-ras, Kallikrein 4, KIF20A, KK-LC-1, KKLC1, KM-HN-1, KMHN1 also known as CCDC110, LAGE-1, LDLR-fucosyltransferaseAS fusion protein, Lengsin, M-CSF, MAGE-A1, MAGE-A10, MAGE-A12, MAGE-A2, MAGE-A3, MAGE-A4, MAGE-A6, MAGE-A9, MAGE-C1, MAGE-C2, malic enzyme, mammaglobin-A, MART2, MATN, MC1R, MCSP, mdm-2, ME1, Melan-A/MART-1, Meloe, Midkine, MMP-2, MMP-7, MUC1, MUC5AC, mucin, MUM-1, MUM-2, MUM-3, Myosin, Myosin class I, N-raw, NA88-A, neo-PAP, NFYC, NY-BR-1, NY-ESO-1/LAGE-2, OA1, OGT, OS-9, P polypeptide, p53, PAP, PAX5, PBF, pml-RARalpha fusion protein, polymorphic epithelial mucin (“PEM”), PPP1R3B, PRAME, PRDX5, PSA, PSMA, PTPRK, RAB38/NY-MEL-1, RAGE-1, RBAF600, RGS5, RhoC, RNF43, RU2AS, SAGE, secernin 1, SIRT2, SNRPD1, SOX10, Sp17, SPA17, SSX-2, SSX-4, STEAP1, survivin, SYT-SSX1 or -SSX2 fusion protein, TAG-1, TAG-2, Telomerase, TGF-betaRll, TPBG, TRAG-3, Triosephosphate isomerase, TRP-1/gp75, TRP-2, TRP2-INT2, tyrosinase, tyrosinase (“TYR”), VEGF, WT1, XAGE-1b/GAGED2a. In some embodiments, the antigen is a neo-antigen.
- In some embodiments, the cancer immunotherapy comprises administration of a cancer-specific chimeric antigen receptor (CAR). In some embodiments, the CAR is administered on the surface of a T cell. In some embodiments, the CAR binds specifically to a cancer-associated antigen.
- In some embodiments, the cancer immunotherapy comprises administration of a cancer-specific T cell to the subject. In some embodiments, the T cell is a CD4+ T cell. In some embodiments, the CD4+ T cell is a TH1 T cell, a TH2 T cell or a TH17 T cell. In some embodiments, the T cell expresses a T cell receptor specific for a cancer-associated antigen.
- In some embodiments, the cancer vaccine is administered with an adjuvant. Examples of adjuvants include, but are not limited to, an immune modulatory protein, Adjuvant 65, α-GalCer, aluminum phosphate, aluminum hydroxide, calcium phosphate, β-Glucan Peptide, CpG ODN DNA, GPI-0100, lipid A, lipopolysaccharide, Lipovant, Montanide, N-acetyl-muramyl-L-alanyl-D-isoglutamine, Pam3CSK4, quil A, cholera toxin (CT) and heat-labile toxin from enterotoxigenic Escherichia coli (LT) including derivatives of these (CTB, mmCT, CTA1-DD, LTB, LTK63, LTR72, dmLT) and trehalose dimycolate.
- In some embodiments, the immunotherapy agent is an immune modulating protein to the subject. In some embodiments, the immune modulatory protein is a cytokine or chemokine. Examples of immune modulating proteins include, but are not limited to, B lymphocyte chemoattractant (“BLC”), C—C motif chemokine 11 (“Eotaxin-1”), Eosinophil chemotactic protein 2 (“Eotaxin-2”), Granulocyte colony-stimulating factor (“G-CSF”), Granulocyte macrophage colony-stimulating factor (“GM-CSF”), 1-309, Intercellular Adhesion Molecule 1 (“ICAM-1”), Interferon alpha (“IFN-alpha”), Interferon beta (“IFN-beta”) Interferon gamma (“IFN-gamma”), Interlukin-1 alpha (“IL-1 alpha”), Interlukin-1 beta (“IL-1 beta”), Interleukin 1 receptor antagonist (“IL-1 ra”), Interleukin-2 (“IL-2”), Interleukin-4 (“IL-4”), Interleukin-5 (“IL-5”), Interleukin-6 (“IL-6”), Interleukin-6 soluble receptor (“IL-6 sR”), Interleukin-7 (“IL-7”), Interleukin-8 (“IL-8”), Interleukin-10 (“IL-10”), Interleukin-11 (“IL-11”), Subunit beta of Interleukin-12 (“IL-12 p40” or “IL-12 p70”), Interleukin-13 (“IL-13”), Interleukin-15 (“IL-15”), Interleukin-16 (“IL-16”), Interleukin-17A-F (“IL-17A-F”), Interleukin-18 (“IL-18”), Interleukin-21 (“IL-21”), Interleukin-22 (“IL-22”), Interleukin-23 (“IL-23”), Interleukin-33 (“IL-33”), Chemokine (C—C motif) Ligand 2 (“MCP-1”), Macrophage colony-stimulating factor (“M-CSF”), Monokine induced by gamma interferon (“MIG”), Chemokine (C—C motif) ligand 2 (“MIP-1 alpha”), Chemokine (C—C motif) ligand 4 (“MIP-1 beta”), Macrophage inflammatory protein-1-delta (“MIP-1 delta”), Platelet-derived growth factor subunit B (“PDGF-BB”), Chemokine (C—C motif) ligand 5, Regulated on Activation, Normal T cell Expressed and Secreted (“RANTES”), TIMP metallopeptidase inhibitor 1 (“TIMP-1”), TIMP metallopeptidase inhibitor 2 (“TIMP-2”), Tumor necrosis factor, lymphotoxin-alpha (“TNF alpha”), Tumor necrosis factor, lymphotoxin-beta (“TNF beta”), Soluble TNF receptor type 1 (“sTNFRI”), sTNFRIIAR, Brain-derived neurotrophic factor (“BDNF”), Basic fibroblast growth factor (“bFGF”), Bone morphogenetic protein 4 (“BMP-4”), Bone morphogenetic protein 5 (“BMP-5”), Bone morphogenetic protein 7 (“BMP-7”), Nerve growth factor (“b-NGF”), Epidermal growth factor (“EGF”), Epidermal growth factor receptor (“EGFR”), Endocrine-gland-derived vascular endothelial growth factor (“EG-VEGF”), Fibroblast growth factor 4 (“FGF-4”), Keratinocyte growth factor (“FGF-7”), Growth differentiation factor 15 (“GDF-15”), Glial cell-derived neurotrophic factor (“GDNF”), Growth Hormone, Heparin-binding EGF-like growth factor (“HB-EGF”), Hepatocyte growth factor (“HGF”), Insulin-like growth factor binding protein 1 (“IGFBP-1”), Insulin-like growth factor binding protein 2 (“IGFBP-2”), Insulin-like growth factor binding protein 3 (“IGFBP-3”), Insulin-like growth factor binding protein 4 (“IGFBP-4”), Insulin-like growth factor binding protein 6 (“IGFBP-6”), Insulin-like growth factor 1 (“IGF-1”), Insulin, Macrophage colony-stimulating factor (“M-CSF R”), Nerve growth factor receptor (“NGF R”), Neurotrophin-3 (“NT-3”), Neurotrophin-4 (“NT-4”), Osteoclastogenesis inhibitory factor (“Osteoprotegerin”), Platelet-derived growth factor receptors (“PDGF-AA”), Phosphatidylinositol-glycan biosynthesis (“PIGF”), Skp, Cullin, F-box containing comples (“SCF”), Stem cell factor receptor (“SCF R”), Transforming growth factor alpha (“TGFalpha”), Transforming growth factor beta-1 (“TGF beta 1”), Transforming growth factor beta-3 (“TGF beta 3”), Vascular endothelial growth factor (“VEGF”), Vascular endothelial growth factor receptor 2 (“VEGFR2”), Vascular endothelial growth factor receptor 3 (“VEGFR3”), VEGF-D 6Ckine, Tyrosine-protein kinase receptor UFO (“Axl”), Betacellulin (“BTC”), Mucosae-associated epithelial chemokine (“CCL28”), Chemokine (C—C motif) ligand 27 (“CTACK”), Chemokine (C—X—C motif) ligand 16 (“CXCL16”), C—X—C motif chemokine 5 (“ENA-78”), Chemokine (C—C motif) ligand 26 (“Eotaxin-3”), Granulocyte chemotactic protein 2 (“GCP-2”), GRO, Chemokine (C—C motif) ligand 14 (“HCC-1”), Chemokine (C—C motif) ligand 16 (“HCC-4”), Interleukin-9 (“IL-9”), Interleukin-17 F (“IL-17F”), Interleukin-18-binding protein (“IL-18 BPa”), Interleukin-28 A (“IL-28A”), Interleukin 29 (“IL-29”), Interleukin 31 (“IL-31”), C—X—C motif chemokine 10 (“IP-10”), Chemokine receptor CXCR3 (“I-TAC”), Leukemia inhibitory factor (“LIF”), Light, Chemokine (C motif) ligand (“Lymphotactin”), Monocyte chemoattractant protein 2 (“MCP-2”), Monocyte chemoattractant protein 3 (“MCP-3”), Monocyte chemoattractant protein 4 (“MCP-4”), Macrophage-derived chemokine (“MDC”), Macrophage migration inhibitory factor (“MIF”), Chemokine (C—C motif) ligand 20 (“MIP-3 alpha”), C—C motif chemokine 19 (“MIP-3 beta”), Chemokine (C—C motif) ligand 23 (“MPIF-1”), Macrophage stimulating protein alpha chain (“MSPalpha”), Nucleosome assembly protein 1-like 4 (“NAP-2”), Secreted phosphoprotein 1 (“Osteopontin”), Pulmonary and activation-regulated cytokine (“PARC”), Platelet factor 4 (“PF4”), Stroma cell-derived factor-1 alpha (“SDF-1 alpha”), Chemokine (C—C motif) ligand 17 (“TARC”), Thymus-expressed chemokine (“TECK”), Thymic stromal lymphopoietin (“TSLP 4-IBB”), CD 166 antigen (“ALCAM”), Cluster of Differentiation 80 (“B7-1”), Tumor necrosis factor receptor superfamily member 17 (“BCMA”), Cluster of Differentiation 14 (“CD14”), Cluster of Differentiation 30 (“CD30”), Cluster of Differentiation 40 (“CD40 Ligand”), Carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) (“CEACAM-1”), Death Receptor 6 (“DR6”), Deoxythymidine kinase (“Dtk”), Type 1 membrane glycoprotein (“Endoglin”), Receptor tyrosine-protein kinase erbB-3 (“ErbB3”), Endothelial-leukocyte adhesion molecule 1 (“E-Selectin”), Apoptosis antigen 1 (“Fas”), Fms-like tyrosine kinase 3 (“Flt-3L”), Tumor necrosis factor receptor superfamily member 1 (“GITR”), Tumor necrosis factor receptor superfamily member 14 (“HVEM”), Intercellular adhesion molecule 3 (“ICAM-3”), IL-1 R4, IL-1 RI, IL-10 Rbeta, IL-17R, IL-2Rgamma, IL-21R, Lysosome membrane protein 2 (“LIMPII”), Neutrophil gelatinase-associated lipocalin (“Lipocalin-2”), CD62L (“L-Selectin”), Lymphatic endothelium (“LYVE-1”), MHC class I polypeptide-related sequence A (“MICA”), MHC class I polypeptide-related sequence B (“MICB”), NRG1-betal, Beta-type platelet-derived growth factor receptor (“PDGF Rbeta”), Platelet endothelial cell adhesion molecule (“PECAM-1”), RAGE, Hepatitis A virus cellular receptor 1 (“TIM-1”), Tumor necrosis factor receptor superfamily member IOC (“TRAIL R3”), Trappin protein transglutaminase binding domain (“Trappin-2”), Urokinase receptor (“uPAR”), Vascular cell adhesion protein 1 (“VCAM-1”), XEDARActivin A, Agouti-related protein (“AgRP”), Ribonuclease 5 (“Angiogenin”), Angiopoietin 1, Angiostatin, Catheprin S, CD40, Cryptic family protein IB (“Cripto-1”), DAN, Dickkopf-related protein 1 (“DKK-1”), E-Cadherin, Epithelial cell adhesion molecule (“EpCAM”), Fas Ligand (FasL or CD95L), Fcg RIIB/C, FoUistatin, Galectin-7, Intercellular adhesion molecule 2 (“ICAM-2”), IL-13 R1, IL-13R2, IL-17B, IL-2 Ra, IL-2 Rb, IL-23, LAP, Neuronal cell adhesion molecule (“NrCAM”), Plasminogen activator inhibitor-1 (“PAI-1”), Platelet derived growth factor receptors (“PDGF-AB”), Resistin, stromal cell-derived factor 1 (“SDF-1 beta”), sgp130, Secreted frizzled-related protein 2 (“ShhN”), Sialic acid-binding immunoglobulin-type lectins (“Siglec-5”), ST2, Transforming growth factor-beta 2 (“TGF beta 2”), Tie-2, Thrombopoietin (“TPO”), Tumor necrosis factor receptor superfamily member 10D (“TRAIL R4”), Triggering receptor expressed on myeloid cells 1 (“TREM-1”), Vascular endothelial growth factor C (“VEGF-C”), VEGFRlAdiponectin, Adipsin (“AND”), Alpha-fetoprotein (“AFP”), Angiopoietin-like 4 (“ANGPTL4”), Beta-2-microglobulin (“B2M”), Basal cell adhesion molecule (“BCAM”), Carbohydrate antigen 125 (“CA125”), Cancer Antigen 15-3 (“CA15-3”), Carcinoembryonic antigen (“CEA”), cAMP receptor protein (“CRP”), Human Epidermal Growth Factor Receptor 2 (“ErbB2”), Follistatin, Follicle-stimulating hormone (“FSH”), Chemokine (C—X—C motif) ligand 1 (“GRO alpha”), human chorionic gonadotropin (“beta HCG”), Insulin-like growth factor 1 receptor (“IGF-1 sR”), IL-1 sRII, IL-3, IL-18 Rb, IL-21, Leptin, Matrix metalloproteinase-1 (“MMP-1”), Matrix metalloproteinase-2 (“MMP-2”), Matrix metalloproteinase-3 (“MMP-3”), Matrix metalloproteinase-8 (“MMP-8”), Matrix metalloproteinase-9 (“MMP-9”), Matrix metalloproteinase-10 (“MMP-10”), Matrix metalloproteinase-13 (“MMP-13”), Neural Cell Adhesion Molecule (“NCAM-1”), Entactin (“Nidogen-1”), Neuron specific enolase (“NSE”), Oncostatin M (“OSM”), Procalcitonin, Prolactin, Prostate specific antigen (“PSA”), Sialic acid-binding Ig-like lectin 9 (“Siglec-9”), ADAM 17 endopeptidase (“TACE”), Thyroglobulin, Metalloproteinase inhibitor 4 (“TIMP-4”), TSH2B4, Disintegrin and metalloproteinase domain-containing protein 9 (“ADAM-9”), Angiopoietin 2, Tumor necrosis factor ligand superfamily member 13/Acidic leucine-rich nuclear phosphoprotein 32 family member B (“APRIL”), Bone morphogenetic protein 2 (“BMP-2”), Bone morphogenetic protein 9 (“BMP-9”), Complement component 5a (“C5a”), Cathepsin L, CD200, CD97, Chemerin, Tumor necrosis factor receptor superfamily member 6B (“DcR3”), Fatty acid-binding protein 2 (“FABP2”), Fibroblast activation protein, alpha (“FAP”), Fibroblast growth factor 19 (“FGF-19”), Galectin-3, Hepatocyte growth factor receptor (“HGF R”), IFN-gammalpha/beta R2, Insulin-like growth factor 2 (“IGF-2”), Insulin-like growth factor 2 receptor (“IGF-2 R”), Interleukin-1 receptor 6 (“IL-1R6”), Interleukin 24 (“IL-24”), Interleukin 33 (“IL-33”, Kallikrein 14, Asparaginyl endopeptidase (“Legumain”), Oxidized low-density lipoprotein receptor 1 (“LOX-1”), Mannose-binding lectin (“MBL”), Neprilysin (“NEP”), Notch homolog 1, translocation-associated (Drosophila) (“Notch-1”), Nephroblastoma overexpressed (“NOV”), Osteoactivin, Programmed cell death protein 1 (“PD-1”), N-acetylmuramoyl-L-alanine amidase (“PGRP-5”), Serpin A4, Secreted frizzled related protein 3 (“sFRP-3”), Thrombomodulin, Tolllike receptor 2 (“TLR2”), Tumor necrosis factor receptor superfamily member 10A (“TRAIL R1”), Transferrin (“TRF”), WIF-1ACE-2, Albumin, AMICA, Angiopoietin 4, B-cell activating factor (“BAFF”), Carbohydrate antigen 19-9 (“CA19-9”), CD 163, Clusterin, CRT AM, Chemokine (C—X—C motif) ligand 14 (“CXCL14”), Cystatin C, Decorin (“DCN”), Dickkopf-related protein 3 (“Dkk-3”), Delta-like protein 1 (“DLL1”), Fetuin A, Heparin-binding growth factor 1 (“aFGF”), Folate receptor alpha (“FOLR1”), Furin, GPCR-associated sorting protein 1 (“GASP-1”), GPCR-associated sorting protein 2 (“GASP-2”), Granulocyte colony-stimulating factor receptor (“GCSF R”), Serine protease hepsin (“HAI-2”), Interleukin-17B Receptor (“IL-17B R”), Interleukin 27 (“IL-27”), Lymphocyte-activation gene 3 (“LAG-3”), Apolipoprotein A-V (“LDL R”), Pepsinogen I, Retinol binding protein 4 (“RBP4”), SOST, Heparan sulfate proteoglycan (“Syndecan-1”), Tumor necrosis factor receptor superfamily member 13B (“TACI”), Tissue factor pathway inhibitor (“TFPI”), TSP-1, Tumor necrosis factor receptor superfamily, member 10b (“TRAIL R2”), TRANCE, Troponin I, Urokinase Plasminogen Activator (“uPA”), Cadherin 5, type 2 or VE-cadherin (vascular endothelial) also known as CD144 (“VE-Cadherin”), WNT1-inducible-signaling pathway protein 1 (“WISP-1”), and Receptor Activator of Nuclear Factor κ B (“RANK”).
- In some embodiments, the cancer therapeutic agent is an anti-cancer compound. Exemplary anti-cancer compounds include, but are not limited to, Alemtuzumab (Campath®), Alitretinoin (Panretin®), Anastrozole (Arimidex®), Bevacizumab (Avastin®), Bexarotene (Targretin®), Bortezomib (Velcade®), Bosutinib (Bosulif®), Brentuximab vedotin (Adcetris®), Cabozantinib (Cometriq™), Carfilzomib (Kyprolis™), Cetuximab (Erbitux®), Crizotinib (Xalkori®), Dasatinib (Sprycel®), Denileukin diftitox (Ontak®), Erlotinib hydrochloride (Tarceva®), Everolimus (Afinitor®), Exemestane (Aromasin®), Fulvestrant (Faslodex®), Gefitinib (Iressa®), Ibritumomab tiuxetan (Zevalin®), Imatinib mesylate (Gleevec®), Ipilimumab (Yervoy™), Lapatinib ditosylate (Tykerb®), Letrozole (Femara®), Nilotinib (Tasigna®), Ofatumumab (Arzerra®), Panitumumab (Vectibix®), Pazopanib hydrochloride (Votrient®), Pertuzumab (Perjeta™), Pralatrexate (Folotyn®), Regorafenib (Stivarga®), Rituximab (Rituxan®), Romidepsin (Istodax®), Sorafenib tosylate (Nexavar®), Sunitinib malate (Sutent®), Tamoxifen, Temsirolimus (Torisel®), Toremifene (Fareston®), Tositumomab and 131I-tositumomab (Bexxar®), Trastuzumab (Herceptin®), Tretinoin (Vesanoid®), Vandetanib (Caprelsa®), Vemurafenib (Zelboraf®), Vorinostat (Zolinza®), and Ziv-aflibercept (Zaltrap®).
- Exemplary anti-cancer compounds that modify the function of proteins that regulate gene expression and other cellular functions (e.g., HDAC inhibitors, retinoid receptor ligants) are Vorinostat (Zolinza®), Bexarotene (Targretin®) and Romidepsin (Istodax®), Alitretinoin (Panretin®), and Tretinoin (Vesanoid®).
- Exemplary anti-cancer compounds that induce apoptosis (e.g., proteasome inhibitors, antifolates) are Bortezomib (Velcade®), Carfilzomib (Kyprolis™), and Pralatrexate (Folotyn®).
- Exemplary anti-cancer compounds that increase anti-tumor immune response (e.g., anti CD20, anti CD52; anti-cytotoxic T-lymphocyte-associated antigen-4) are Rituximab (Rituxan®), Alemtuzumab (Campath®), Ofatumumab (Arzerra®), and Ipilimumab (Yervoy™)
- Exemplary anti-cancer compounds that deliver toxic agents to cancer cells (e.g., anti-CD20-radionuclide fusions; IL-2-diphtheria toxin fusions; anti-CD30-monomethylauristatin E (MMAE)-fusions) are Tositumomab and 131I-tositumomab (Bexxar®) and Ibritumomab tiuxetan (Zevalin®), Denileukin diftitox (Ontak®), and Brentuximab vedotin (Adcetris®).
- Other exemplary anti-cancer compounds are small molecule inhibitors and conjugates thereof of, e.g., Janus kinase, ALK, Bcl-2, PARP, PI3K, VEGF receptor, Braf, MEK, CDK, and HSP90.
- Exemplary platinum-based anti-cancer compounds include, for example, cisplatin, carboplatin, oxaliplatin, satraplatin, picoplatin, Nedaplatin, Triplatin, and Lipoplatin. Other metal-based drugs suitable for treatment include, but are not limited to ruthenium-based compounds, ferrocene derivatives, titanium-based compounds, and gallium-based compounds.
- In some embodiments, the cancer therapeutic is a radioactive moiety that comprises a radionuclide. Exemplary radionuclides include, but are not limited to Cr-51, Cs-131, Ce-134, Se-75, Ru-97, 1-125, Eu-149, Os-189m, Sb-119, 1-123, Ho-161, Sb-117, Ce-139, In-111, Rh-103m, Ga-67, T1-201, Pd-103, Au-195, Hg-197, Sr-87m, Pt-191, P-33, Er-169, Ru-103, Yb-169, Au-199, Sn-121, Tm-167, Yb-175, In-113m, Sn-113, Lu-177, Rh-105, Sn-117m, Cu-67, Sc-47, Pt-195m, Ce-141, 1-131, Tb-161, As-77, Pt-197, Sm-153, Gd-159, Tm-173, Pr-143, Au-198, Tm-170, Re-186, Ag-111, Pd-109, Ga-73, Dy-165, Pm-149, Sn-123, Sr-89, Ho-166, P-32, Re-188, Pr-142, Ir-194, In-114m/In-114, and Y-90.
- In some embodiments, the methods and compositions described herein relate to the treatment or prevention of a disease or disorder associated with a pathological immune response, such as an autoimmune disease, an allergic reaction and/or an inflammatory disease. In some embodiments, the disease or disorder is an inflammatory bowel disease (e.g., Crohn's disease or ulcerative colitis). In some embodiments, the methods and compositions described herein relate to the treatment or prevention of delayed-type hypersensitivity, autoimmune myocarditis, granulomas, peripheral neuropathies, Hashimoto's thyroiditis, inflammation of the colon, colitis, microscopic colitis, collagenous colitis, diversion colitis, chemical colitis, ischemic colitis, indeterminate colitis, atypical colitis.
- The methods described herein can be used to treat any subject in need thereof. As used herein, a “subject in need thereof” includes any subject that has a disease or disorder associated with a pathological immune response (e.g., an inflammatory bowel disease), as well as any subject with an increased likelihood of acquiring a such a disease or disorder.
- The compositions described herein can be used, for example, as a pharmaceutical composition for preventing or treating (reducing, partially or completely, the adverse effects of) an autoimmune disease, such as chronic inflammatory bowel disease, systemic lupus erythematosus, psoriasis, muckle-wells syndrome, rheumatoid arthritis, multiple sclerosis, or Hashimoto's disease; an allergic disease, such as a food allergy, pollenosis, or asthma; an infectious disease, such as an infection with Clostridium difficile; an inflammatory disease such as a TNF-mediated inflammatory disease (e.g., an inflammatory disease of the gastrointestinal tract, such as pouchitis, a cardiovascular inflammatory condition, such as atherosclerosis, or an inflammatory lung disease, such as chronic obstructive pulmonary disease); a pharmaceutical composition for suppressing rejection in organ transplantation or other situations in which tissue rejection might occur; a supplement, food, or beverage for improving immune functions; or a reagent for suppressing the proliferation or function of immune cells.
- In some embodiments, the methods provided herein are useful for the treatment of inflammation. In certain embodiments, the inflammation of any tissue and organs of the body, including musculoskeletal inflammation, vascular inflammation, neural inflammation, digestive system inflammation, ocular inflammation, inflammation of the reproductive system, and other inflammation, as discussed below.
- Immune disorders of the musculoskeletal system include, but are not limited, to those conditions affecting skeletal joints, including joints of the hand, wrist, elbow, shoulder, jaw, spine, neck, hip, knew, ankle, and foot, and conditions affecting tissues connecting muscles to bones such as tendons. Examples of such immune disorders, which may be treated with the methods and compositions described herein include, but are not limited to, arthritis (including, for example, osteoarthritis, rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, acute and chronic infectious arthritis, arthritis associated with gout and pseudogout, and juvenile idiopathic arthritis), tendonitis, synovitis, tenosynovitis, bursitis, fibrositis (fibromyalgia), epicondylitis, myositis, and osteitis (including, for example, Paget's disease, osteitis pubis, and osteitis fibrosa cystic).
- Ocular immune disorders refers to an immune disorder that affects any structure of the eye, including the eye lids. Examples of ocular immune disorders which may be treated with the methods and compositions described herein include, but are not limited to, blepharitis, blepharochalasis, conjunctivitis, dacryoadenitis, keratitis, keratoconjunctivitis sicca (dry eye), scleritis, trichiasis, and uveitis
- Examples of nervous system immune disorders which may be treated with the methods and compositions described herein include, but are not limited to, encephalitis, Guillain-Barre syndrome, meningitis, neuromyotonia, narcolepsy, multiple sclerosis, myelitis and schizophrenia. Examples of inflammation of the vasculature or lymphatic system which may be treated with the methods and compositions described herein include, but are not limited to, arthrosclerosis, arthritis, phlebitis, vasculitis, and lymphangitis.
- Examples of digestive system immune disorders which may be treated with the methods and compositions described herein include, but are not limited to, cholangitis, cholecystitis, enteritis, enterocolitis, gastritis, gastroenteritis, inflammatory bowel disease, ileitis, and proctitis. Inflammatory bowel diseases include, for example, certain art-recognized forms of a group of related conditions. Several major forms of inflammatory bowel diseases are known, with Crohn's disease (regional bowel disease, e.g., inactive and active forms) and ulcerative colitis (e.g., inactive and active forms) the most common of these disorders. In addition, the inflammatory bowel disease encompasses irritable bowel syndrome, microscopic colitis, lymphocytic-plasmocytic enteritis, coeliac disease, collagenous colitis, lymphocytic colitis and eosinophilic enterocolitis. Other less common forms of IBD include indeterminate colitis, pseudomembranous colitis (necrotizing colitis), ischemic inflammatory bowel disease, Behcet's disease, sarcoidosis, scleroderma, IBD-associated dysplasia, dysplasia associated masses or lesions, and primary sclerosing cholangitis.
- Examples of reproductive system immune disorders which may be treated with the methods and compositions described herein include, but are not limited to, cervicitis, chorioamnionitis, endometritis, epididymitis, omphalitis, oophoritis, orchitis, salpingitis, tubo-ovarian abscess, urethritis, vaginitis, vulvitis, and vulvodynia.
- The methods and compositions described herein may be used to treat autoimmune conditions having an inflammatory component. Such conditions include, but are not limited to, acute disseminated alopecia universalise, Behcet's disease, Chagas' disease, chronic fatigue syndrome, dysautonomia, encephalomyelitis, ankylosing spondylitis, aplastic anemia, hidradenitis suppurativa, autoimmune hepatitis, autoimmune oophoritis, celiac disease, Crohn's disease,
diabetes mellitus type 1, giant cell arteritis, goodpasture's syndrome, Grave's disease, Guillain-Barre syndrome, Hashimoto's disease, Henoch-Schonlein purpura, Kawasaki's disease, lupus erythematosus, microscopic colitis, microscopic polyarteritis, mixed connective tissue disease, Muckle-Wells syndrome, multiple sclerosis, myasthenia gravis, opsoclonus myoclonus syndrome, optic neuritis, ord's thyroiditis, pemphigus, polyarteritis nodosa, polymyalgia, rheumatoid arthritis, Reiter's syndrome, Sjogren's syndrome, temporal arteritis, Wegener's granulomatosis, warm autoimmune haemolytic anemia, interstitial cystitis, Lyme disease, morphea, psoriasis, sarcoidosis, scleroderma, ulcerative colitis, and vitiligo. - The methods and compositions described herein may be used to treat T-cell mediated hypersensitivity diseases having an inflammatory component. Such conditions include, but are not limited to, contact hypersensitivity, contact dermatitis (including that due to poison ivy), uticaria, skin allergies, respiratory allergies (hay fever, allergic rhinitis, house dustmite allergy) and gluten-sensitive enteropathy (Celiac disease).
- Other immune disorders which may be treated with the methods and compositions include, for example, appendicitis, dermatitis, dermatomyositis, endocarditis, fibrositis, gingivitis, glossitis, hepatitis, hidradenitis suppurativa, iritis, laryngitis, mastitis, myocarditis, nephritis, otitis, pancreatitis, parotitis, percarditis, peritonoitis, pharyngitis, pleuritis, pneumonitis, prostatistis, pyelonephritis, and stomatisi, transplant rejection (involving organs such as kidney, liver, heart, lung, pancreas (e.g., islet cells), bone marrow, cornea, small bowel, skin allografts, skin homografts, and heart valve xengrafts, sewrum sickness, and graft vs host disease), acute pancreatitis, chronic pancreatitis, acute respiratory distress syndrome, Sexary's syndrome, congenital adrenal hyperplasis, nonsuppurative thyroiditis, hypercalcemia associated with cancer, pemphigus, bullous dermatitis herpetiformis, severe erythema multiforme, exfoliative dermatitis, seborrheic dermatitis, seasonal or perennial allergic rhinitis, bronchial asthma, contact dermatitis, atopic dermatitis, drug hypersensistivity reactions, allergic conjunctivitis, keratitis, herpes zoster ophthalmicus, iritis and oiridocyclitis, chorioretinitis, optic neuritis, symptomatic sarcoidosis, fulminating or disseminated pulmonary tuberculosis chemotherapy, idiopathic thrombocytopenic purpura in adults, secondary thrombocytopenia in adults, acquired (autoimmune) haemolytic anemia, leukaemia and lymphomas in adults, acute leukaemia of childhood, regional enteritis, autoimmune vasculitis, multiple sclerosis, chronic obstructive pulmonary disease, solid organ transplant rejection, sepsis. Preferred treatments include treatment of transplant rejection, rheumatoid arthritis, psoriatic arthritis, multiple sclerosis,
Type 1 diabetes, asthma, inflammatory bowel disease, systemic lupus erythematosus, psoriasis, chronic obstructive pulmonary disease, and inflammation accompanying infectious conditions (e.g., sepsis). - The methods and compositions described herein may be used to treat metabolic disorders and metabolic syndromes. Such conditions include, but are not limited to, Type II Diabetes, Encephalopathy, Tay-Sachs disease, Krabbe disease, Galactosemia, Phenylketonuria (PKU), and Maple syrup urine disease.
- The methods and compositions described herein may be used to treat neurodegenerative and neurological diseases. Such conditions include, but are not limited to, Parkinson's disease, Alzheimer's disease, prion disease, Huntington's disease, motor neurone diseases (MND), spinocerebellar ataxia, spinal muscular atrophy, dystonia, idiopathic intracranial hypertension, epilepsy, nervous system disease, central nervous system disease, movement disorders, multiple sclerosis, encephalopathy, and, post-operative cognitive dysfunction.
- In some embodiments, the methods and compositions described herein relate to the treatment of cancer. In some embodiments, any cancer can be treated using the methods described herein. Examples of cancers that may treated by methods and compositions described herein include, but are not limited to, cancer cells from the bladder, blood, bone, bone marrow, brain, breast, colon, esophagus, gastrointestine, gum, head, kidney, liver, lung, nasopharynx, neck, ovary, prostate, skin, stomach, testis, tongue, or uterus. In addition, the cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma; chromophobe carcinoma; acidophil carcinoma; oxyphilic adenocarcinoma; basophil carcinoma; clear cell adenocarcinoma; granular cell carcinoma; follicular adenocarcinoma; papillary and follicular adenocarcinoma; nonencapsulating sclerosing carcinoma; adrenal cortical carcinoma; endometroid carcinoma; skin appendage carcinoma; apocrine adenocarcinoma; sebaceous adenocarcinoma; ceruminous adenocarcinoma; mucoepidermoid carcinoma; cystadenocarcinoma; papillary cystadenocarcinoma; papillary serous cystadenocarcinoma; mucinous cystadenocarcinoma; mucinous adenocarcinoma; signet ring cell carcinoma; infiltrating duct carcinoma; medullary carcinoma; lobular carcinoma; inflammatory carcinoma; paget's disease, mammary; acinar cell carcinoma; adenosquamous carcinoma; adenocarcinoma w/squamous metaplasia; thymoma, malignant; ovarian stromal tumor, malignant; thecoma, malignant; granulosa cell tumor, malignant; and roblastoma, malignant; sertoli cell carcinoma; leydig cell tumor, malignant; lipid cell tumor, malignant; paraganglioma, malignant; extra-mammary paraganglioma, malignant; pheochromocytoma; glomangiosarcoma; malignant melanoma; amelanotic melanoma; superficial spreading melanoma; malig melanoma in giant pigmented nevus; epithelioid cell melanoma; blue nevus, malignant; sarcoma; fibrosarcoma; fibrous histiocytoma, malignant; myxosarcoma; liposarcoma; leiomyosarcoma; rhabdomyosarcoma; embryonal rhabdomyosarcoma; alveolar rhabdomyosarcoma; stromal sarcoma; mixed tumor, malignant; mullerian mixed tumor; nephroblastoma; hepatoblastoma; carcinosarcoma; mesenchymoma, malignant; brenner tumor, malignant; phyllodes tumor, malignant; synovial sarcoma; mesothelioma, malignant; dysgerminoma; embryonal carcinoma; teratoma, malignant; struma ovarii, malignant; choriocarcinoma; mesonephroma, malignant; hemangio sarcoma; hemangioendothelioma, malignant; kaposi's sarcoma; hemangiopericytoma, malignant; lymphangiosarcoma; osteosarcoma; juxtacortical osteosarcoma; chondrosarcoma; chondroblastoma, malignant; mesenchymal chondrosarcoma; giant cell tumor of bone; ewing's sarcoma; odontogenic tumor, malignant; ameloblastic odontosarcoma; ameloblastoma, malignant; ameloblastic fibrosarcoma; pinealoma, malignant; chordoma; glioma, malignant; ependymoma; astrocytoma; protoplasmic astrocytoma; fibrillary astrocytoma; astroblastoma; glioblastoma; oligodendroglioma; oligodendroblastoma; primitive neuroectodermal; cerebellar sarcoma; ganglioneuroblastoma; neuroblastoma; retinoblastoma; olfactory neurogenic tumor; meningioma, malignant; neurofibrosarcoma; neurilemmoma, malignant; granular cell tumor, malignant; malignant lymphoma; Hodgkin's disease; Hodgkin's lymphoma; paragranuloma; malignant lymphoma, small lymphocytic; malignant lymphoma, large cell, diffuse; malignant lymphoma, follicular; mycosis fungoides; other specified non-Hodgkin's lymphomas; malignant histiocytosis; multiple myeloma; mast cell sarcoma; immunoproliferative small intestinal disease; leukemia; lymphoid leukemia; plasma cell leukemia; erythroleukemia; lymphosarcoma cell leukemia; myeloid leukemia; basophilic leukemia; eosinophilic leukemia; monocytic leukemia; mast cell leukemia; megakaryoblastic leukemia; myeloid sarcoma; plasmacytoma, colorectal cancer, rectal cancer, and hairy cell leukemia.
- In some embodiments, the methods and compositions provided herein relate to the treatment of a leukemia. The term “leukemia” is meant broadly progressive, malignant diseases of the hematopoietic organs/systems and is generally characterized by a distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow. Non-limiting examples of leukemia diseases include, acute nonlymphocytic leukemia, chronic lymphocytic leukemia, acute granulocytic leukemia, chronic granulocytic leukemia, acute promyelocytic leukemia, adult T-cell leukemia, aleukemic leukemia, a leukocythemic leukemia, basophilic leukemia, blast cell leukemia, bovine leukemia, chronic myelocytic leukemia, leukemia cutis, embryonal leukemia, eosinophilic leukemia, Gross' leukemia, Rieder cell leukemia, Schilling's leukemia, stem cell leukemia, subleukemic leukemia, undifferentiated cell leukemia, hairy-cell leukemia, hemoblastic leukemia, hemocytoblastic leukemia, histiocytic leukemia, stem cell leukemia, acute monocytic leukemia, leukopenic leukemia, lymphatic leukemia, lymphoblastic leukemia, lymphocytic leukemia, lymphogenous leukemia, lymphoid leukemia, lymphosarcoma cell leukemia, mast cell leukemia, megakaryocytic leukemia, micromyeloblastic leukemia, monocytic leukemia, myeloblastic leukemia, myelocytic leukemia, myeloid granulocytic leukemia, myelomonocytic leukemia, Naegeli leukemia, plasma cell leukemia, plasmacytic leukemia, and promyelocytic leukemia.
- In some embodiments, the methods and compositions provided herein relate to the treatment of a carcinoma. The term “carcinoma” refers to a malignant growth made up of epithelial cells tending to infiltrate the surrounding tissues, and/or resist physiological and non-physiological cell death signals and gives rise to metastases. Non-limiting exemplary types of carcinomas include, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, basosquamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epiennoid carcinoma, carcinoma epitheliale adenoides, exophytic carcinoma, carcinoma ex ulcere, carcinoma fibrosum, gelatiniform carcinoma, gelatinous carcinoma, giant cell carcinoma, signet-ring cell carcinoma, carcinoma simplex, small-cell carcinoma, solanoid carcinoma, spheroidal cell carcinoma, spindle cell carcinoma, carcinoma spongiosum, squamous carcinoma, squamous cell carcinoma, string carcinoma, carcinoma telangiectaticum, carcinoma telangiectodes, transitional cell carcinoma, carcinoma tuberosum, tuberous carcinoma, verrucous carcinoma, carcinoma villosum, carcinoma gigantocellulare, glandular carcinoma, granulosa cell carcinoma, hair-matrix carcinoma, hematoid carcinoma, hepatocellular carcinoma, Hurthle cell carcinoma, hyaline carcinoma, hypernephroid carcinoma, infantile embryonal carcinoma, carcinoma in situ, intraepidermal carcinoma, intraepithelial carcinoma, Krompecher's carcinoma, Kulchitzky-cell carcinoma, large-cell carcinoma, lenticular carcinoma, carcinoma lenticulare, lipomatous carcinoma, lymphoepithelial carcinoma, carcinoma medullare, medullary carcinoma, melanotic carcinoma, carcinoma molle, mucinous carcinoma, carcinoma muciparum, carcinoma mucocellulare, mucoepidermoid carcinoma, carcinoma mucosum, mucous carcinoma, carcinoma myxomatodes, naspharyngeal carcinoma, oat cell carcinoma, carcinoma ossificans, osteoid carcinoma, papillary carcinoma, periportal carcinoma, preinvasive carcinoma, prickle cell carcinoma, pultaceous carcinoma, renal cell carcinoma of kidney, reserve cell carcinoma, carcinoma sarcomatodes, schneiderian carcinoma, scirrhous carcinoma, merkel cell carcinoma, salivary gland carcinoma and carcinoma scroti.
- In some embodiments, the methods and compositions provided herein relate to the treatment of a sarcoma. The term “sarcoma” generally refers to a tumor which is made up of a substance like the embryonic connective tissue and is generally composed of closely packed cells embedded in a fibrillar, heterogeneous, or homogeneous substance. Sarcomas include, but are not limited to, chondrosarcoma, fibrosarcoma, lymphosarcoma, melanosarcoma, myxosarcoma, osteosarcoma, endometrial sarcoma, stromal sarcoma, Ewing's sarcoma, fascial sarcoma, fibroblastic sarcoma, giant cell sarcoma, Abemethy's sarcoma, adipose sarcoma, liposarcoma, alveolar soft part sarcoma, ameloblastic sarcoma, botryoid sarcoma, chloroma sarcoma, chorio carcinoma, embryonal sarcoma, Wilms' tumor sarcoma, granulocytic sarcoma, Hodgkin's sarcoma, idiopathic multiple pigmented hemorrhagic sarcoma, immunoblastic sarcoma of B cells, lymphoma, immunoblastic sarcoma of T-cells, Jensen's sarcoma, Kaposi's sarcoma, Kupffer cell sarcoma, angiosarcoma, leukosarcoma, malignant mesenchymoma sarcoma, parosteal sarcoma, reticulocytic sarcoma, Rous sarcoma, serocystic sarcoma, synovial sarcoma, and telangiectaltic sarcoma.
- Additional exemplary neoplasias that can be treated using the methods and compositions described herein include Hodgkin's Disease, Non-Hodgkin's Lymphoma, multiple myeloma, neuroblastoma, breast cancer, ovarian cancer, lung cancer, rhabdomyosarcoma, primary thrombocytosis, primary macroglobulinemia, small-cell lung tumors, primary brain tumors, stomach cancer, colon cancer, malignant pancreatic insulanoma, malignant carcinoid, premalignant skin lesions, testicular cancer, lymphomas, thyroid cancer, neuroblastoma, esophageal cancer, genitourinary tract cancer, malignant hypercalcemia, cervical cancer, endometrial cancer, and adrenal cortical cancer.
- In some embodiments, the cancer treated is a melanoma. The term “melanoma” is taken to mean a tumor arising from the melanocytic system of the skin and other organs. Non-limiting examples of melanomas are Harding-Passey melanoma, juvenile melanoma, lentigo maligna melanoma, malignant melanoma, acral-lentiginous melanoma, amelanotic melanoma, benign juvenile melanoma, Cloudman's melanoma, S91 melanoma, nodular melanoma subungal melanoma, and superficial spreading melanoma.
- Particular categories of tumors that can be treated using methods and compositions described herein include lymphoproliferative disorders, breast cancer, ovarian cancer, prostate cancer, cervical cancer, endometrial cancer, bone cancer, liver cancer, stomach cancer, colon cancer, pancreatic cancer, cancer of the thyroid, head and neck cancer, cancer of the central nervous system, cancer of the peripheral nervous system, skin cancer, kidney cancer, as well as metastases of all the above. Particular types of tumors include hepatocellular carcinoma, hepatoma, hepatoblastoma, rhabdomyosarcoma, esophageal carcinoma, thyroid carcinoma, ganglioblastoma, fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, Ewing's tumor, leimyosarcoma, rhabdotheliosarcoma, invasive ductal carcinoma, papillary adenocarcinoma, melanoma, pulmonary squamous cell carcinoma, basal cell carcinoma, adenocarcinoma (well differentiated, moderately differentiated, poorly differentiated or undifferentiated), bronchioloalveolar carcinoma, renal cell carcinoma, hypernephroma, hypernephroid adenocarcinoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms' tumor, testicular tumor, lung carcinoma including small cell, non-small and large cell lung carcinoma, bladder carcinoma, glioma, astrocyoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, retinoblastoma, neuroblastoma, colon carcinoma, rectal carcinoma, hematopoietic malignancies including all types of leukemia and lymphoma including: acute myelogenous leukemia, acute myelocytic leukemia, acute lymphocytic leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, mast cell leukemia, multiple myeloma, myeloid lymphoma, Hodgkin's lymphoma, non-Hodgkin's lymphoma.
- Cancers treated in certain embodiments also include precancerous lesions, e.g., actinic keratosis (solar keratosis), moles (dysplastic nevi), acitinic chelitis (farmer's lip), cutaneous horns, Barrett's esophagus, atrophic gastritis, dyskeratosis congenita, sideropenic dysphagia, lichen planus, oral submucous fibrosis, actinic (solar) elastosis and cervical dysplasia.
- Cancers treated in some embodiments include non-cancerous or benign tumors, e.g., of endodermal, ectodermal or mesenchymal origin, including, but not limited to cholangioma, colonic polyp, adenoma, papilloma, cystadenoma, liver cell adenoma, hydatidiform mole, renal tubular adenoma, squamous cell papilloma, gastric polyp, hemangioma, osteoma, chondroma, lipoma, fibroma, lymphangioma, leiomyoma, rhabdomyoma, astrocytoma, nevus, meningioma, and ganglioneuroma.
- Delayed-type hypersensitivity (DTH) is an animal model of atopic dermatitis (or allergic contact dermatitis), as reviewed by Petersen et al. (In vivo pharmacological disease models for psoriasis and atopic dermatitis in drug discovery. Basic & Clinical Pharm & Toxicology. 2006. 99(2): 104-115; see also Irving C. Allen (ed.) Mouse Models of Innate Immunity: Methods and Protocols, Methods in Molecular Biology, 2013. vol. 1031, DOI 10.1007/978-1-62703-481-4_13). It can be induced in a variety of mouse and rat strains using various haptens or antigens, for example an antigen emulsified with an adjuvant. DTH is characterized by sensitization as well as an antigen-specific T cell-mediated reaction that results in erythema, edema, and cellular infiltration—especially infiltration of antigen presenting cells (APCs), eosinophils, activated CD4+ T cells, and cytokine-expressing Th2 cells.
- The test formulations were prepared for KLH-based delayed type hypersensitivity model. The delayed-type hypersensitivity (DTH) model provides an in vivo mechanism to study the cell-mediated immune response, and resulting inflammation, following exposure to a specific antigen to which the mice have been sensitized. Several variations of the DTH model have been used and are well known in the art (Irving C. Allen (ed.). Mouse Models of Innate Immunity: Methods and Protocols, Methods in Molecular Biology. Vol. 1031, DOI 10.1007/978-1-62703-481-4_13, Springer Science+Business Media, LLC 2013). For example, the emulsion of Keyhole Limpet Hemocyanin (KLH) and Complete Freund's Adjuvant (CFA) are prepared freshly on the day of immunization (day 0). To this end, 8 mg of KLH powder is weighed and is thoroughly re-suspended in 16 mL saline. An emulsion is prepared by mixing the KLH/saline with an equal volume of CFA solution (e.g. 10 mL KLH/saline+10 mL CFA solution) using syringes and a luer lock connector. KLH and CFA is mixed vigorously for several minutes to form a white-colored emulsion to obtain maximum stability. A drop test is performed to check if a homogenous emulsion is obtained, mixing is continued until an intact drop remains visible in the water.
- On
day 0, C57Bl/6J female mice, approximately 7 weeks old, were primed with KLH antigen in CFA by subcutaneous immunization (4 sites, 50 μL per site). - Dexamethasone, a corticosteroid, is a known anti-inflammatory that ameliorates DTH reactions in mice, and serves as a positive control for suppressing inflammation in this model (Taube and Carlsten, Action of dexamethasone in the suppression of delayed-type hypersensitivity in reconstituted SCID mice. Inflamm Res. 2000. 49(10): 548-52). For the positive control group, a stock solution of 17 mg/mL of Dexamethasone was prepared on by diluting 6.8 mg Dexamethasone in 400 μL 96% ethanol. For each day of dosing, a working solution is prepared by diluting the
stock solution 100× in sterile PBS to obtain a final concentration of 0.17 mg/mL in a septum vial for intraperitoneal dosing. Dexamethasone-treated mice received 100 μL Dexamethasone i.p. (5 mL/kg of a 0.17 mg/mL solution). Frozen sucrose served as the negative control (vehicle). Lactococcus lactis cremoris Strain A was dosed at 100 ul of bacterial cells at 1×10{circumflex over ( )}10 CFU/ml p.o. daily. Dexamethasone (positive control), vehicle (negative control), and Lactococcus lactis cremoris Strain A were dosed daily. - On
day 8, mice were challenged intradermally (i.d.) with 10 μg KLH in saline (in a volume of 10 μL) in the right ear and a control in the left ear Inflammatory response were measured using methods known in the art. Ear pinna thickness was measured at 48 hours following antigen challenge (FIGS. 1 and 3 ). As determined by ear thickness, Lactococcus lactis cremoris Strain A was as efficacious as Dexamethasone at suppressing inflammation compared to mice that received vehicle alone. - The efficacy of Lactococcus lactis cremoris Strain A may be studied further using varied timing and varied doses. For instance, treatment with Lactococcus lactis cremoris Strain A-containing bacterial composition may be initiated at some point, either around the time of priming or around the time of DTH challenge. For example, Lactococcus lactis cremoris strain A (1×109 CFU per mouse per day) may be administered at the same time as the subcutaneous injections (day 0), or they may be administered prior to, or upon, intradermal injection. Lactococcus lactis cremoris strain A is administered at varied doses and at defined intervals. For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at a range of between 1×104 and 5×109 bacterial cells per mouse. While some mice will receive Lactococcus lactis cremoris strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, topical administration, intradermal (i.d.) injection, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A every day (e.g. starting on day 0), while others may receive Lactococcus lactis cremoris strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A. The bacterial cells may be live, dead, or weakened. The bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- For example, some groups of mice may receive between 1×104 and 5×109 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A administration. As with the Lactococcus lactis cremoris strain A, bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, i.d. injection, topical administration, or nasal route administration.
- Some groups of mice may be treated with anti-inflammatory agent(s) (e.g. anti-CD154, blockade of members of the TNF family, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- In addition, some mice are treated with antibiotics prior to treatment. For example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment. Some immunized mice are treated without receiving antibiotics.
- Study animals may be sacrificed by exsanguination from the orbital plexus under CO2/O2 anesthesia, followed by cervical dislocation on
day 10. For serum preparation, the blood samples are allowed to clot before centrifuging. The sera are transferred into clean tubes, each animal in a separate tube. Following exsanguination, of all animals both ears (each ear in a separate vial), the spleen, the mesenteric lymph nodes (MLN), the entire small intestine, and the colon are collected in cryovials, snap frozen and stored at <−70° C. - Tissues may be dissociated using dissociation enzymes according to the manufacturer's instructions. Cells are stained for analysis by flow cytometry using techniques known in the art. Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103. Other markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80). In addition to immunophenotyping, serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1. Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ infiltrated immune cells obtained ex vivo. Finally, immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- Dextran sulfate sodium (DSS)-induced colitis is a well-studied animal model of colitis, as reviewed by Randhawa et al. (A review on chemical-induced inflammatory bowel disease models in rodents. Korean J Physiol Pharmacol. 2014. 18(4): 279-288; see also Chassaing et al. Dextran sulfate sodium (DSS)-induced colitis in mice. Curr Protoc Immunol. 2014 Feb. 4; 104: Unit 15.25). In this model, mice are treated with DSS in drinking water, resulting in diarrhea and weight loss.
- Groups of mice were treated with DSS to induce colitis as known in the art (Randhawa et al. 2014; Chassaing et al. 2014; see also Kim et al. Investigating intestinal inflammation in DSS-induced model of IBD. J Vis Exp. 2012. 60: 3678). For example, colitis was induced in mice by exposure to 3% DSS-treated drinking water from
Day 0 toDay 5. One group did not receive DSS and served as naive controls. Animals were dosed with sucrose vehicle (negative control), Lactococcus lactis cremoris Strain A (1×109 CFU per mouse per day), Lactococcus lactis cremoris Strain X (1×109 CFU per mouse per day), or anti-p40 positive control (administered i.p. ondays FIG. 2 ). - In other studies, treatment with Lactococcus lactis cremoris Strain A-containing bacterial composition may be initiated at some point, either on
day 1 of DSS administration, or sometime thereafter. For example, Lactococcus lactis cremoris strain A may be administered at the same time as DSS initiation (day 1), or they may be administered upon the first signs of disease (e.g. weight loss or diarrhea), or during the stages of severe colitis. Mice may be observed daily for weight, morbidity, survival, presence of diarrhea and/or bloody stool. - Lactococcus lactis cremoris strain A is administered at varied doses, varied intervals, and/or varied routes of administration. For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at a dose of between 1×104 and 5×109 bacterial cells per mouse. While some mice will receive Lactococcus lactis cremoris strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A. The bacterial cells may be live, dead, or weakened. The bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- Lactococcus lactis cremoris Strain A-containing bacterial compositions may be tested for their efficacy in a mouse model of DSS-induced colitis, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory agents.
- For example, some groups of mice may receive between 1×104 and 5×109 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A administration. As with the Lactococcus lactis cremoris strain A, bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration.
- Some groups of mice may be treated with additional anti-inflammatory agent(s) (e.g. anti-CD154, blockade of members of the TNF family, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- In addition, some mice are treated with antibiotics prior to treatment. For example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment. Some mice receive DSS without receiving antibiotics beforehand.
- At various time points, mice undergo video endoscopy using a small animal endoscope (Karl Storz Endoskipe, Germany) under isoflurane anesthesia. Still images and video will be recorded to evaluate the extent of colitis and the response to treatment. Colitis will be scored using criteria known in the art. Fecal material will be collected for study.
- The gastrointestinal (GI) tract, lymph nodes, and/or other tissues may be removed for ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art. For example, tissues are harvested and may be dissociated using dissociation enzymes according to the manufacturer's instructions. Cells are stained for analysis by flow cytometry using techniques known in the art. Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103. Other markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80). In addition to immunophenotyping, serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1. Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ GI tract-infiltrated immune cells obtained ex vivo. Finally, immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be rechallenged with a disease trigger. Mice will be analyzed for susceptibility to colitis severity following rechallenge.
- Following sacrifice, the colon, small intestine, spleen, and mesenteric lymph nodes may be collected from all animals, and blood collected for analysis.
- EAE is a well-studied animal model of multiple sclerosis, as reviewed by Constantinescu et al. (Experimental autoimmune encephalomyelitis (EAE) as a model for multiple sclerosis (MS). Br J Pharmacol. 2011 October; 164(4): 1079-1106). It can be induced in a variety of mouse and rat strains using different myelin-associated peptides, by the adoptive transfer of activated encephalitogenic T cells, or the use of TCR transgenic mice susceptible to EAE, as discussed in Mangalam et al. (Two discreet subsets of CD8+ T cells modulate PLP91-110 induced experimental autoimmune encephalomyelitis in HLA-DR3 transgenic mice. J Autoimmun. 2012 June; 38(4): 344-353).
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in the rodent model of EAE, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory treatments. For example, female 6-8 week old C57Bl/6 mice are obtained from Taconic (Germantown, N.Y.). Groups of mice will be administered two subcutaneous (s.c.) injections at two sites on the back (upper and lower) of 0.1 ml myelin oligodentrocyte glycoprotein 35-55 (MOG35-55; 100 ug per injection; 200 ug per mouse (total 0.2 ml per mouse)), emulsified in Complete Freund's Adjuvant (CFA; 2-5 mg killed Mycobacterium tuberculosis H37Ra/ml emulsion). Approximately 1-2 hours after the above, mice are intraperitoneally (i.p.) injected with 200 ng Pertussis toxin (PTx) in 0.1 ml PBS (2 ug/ml). An additional IP injection of PTx is administered on
day 2. Alternatively, an appropriate amount of an alternative myelin peptide (e.g. proteolipid protein (PLP)) will be used to induce EAE. Some animals will serve as naïve controls. EAE severity will be assessed and a disability score will be assigned daily beginning onday 4 according to methods known in the art (Mangalam et al. 2012). - Treatment with Lactococcus lactis cremoris Strain A-containing bacterial composition and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of immunization or following EAE immunization. For example, Lactococcus lactis cremoris Strain A-containing bacterial and/or EVs derived from Lactococcus lactis cremoris Strain A composition may be administered at the same time as immunization (day 1), or they may be administered upon the first signs of disability (e.g. limp tail), or during severe EAE. Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are administered at varied doses and at defined intervals. For example, some mice are intravenously injected with effective doses of Lactococcus lactis cremoris Strain A. For example, mice may receive between 1×104 and 5×109 bacterial cells per mouse. While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris and/or EVs derived from Lactococcus lactis cremoris Strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A. The bacterial cells may be live, dead, or weakened. The bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- For example, some groups of mice may receive between 1×104 and 5×109 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration. As with the Lactococcus lactis cremoris strain A, bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, subcutaneous (s.c.) injection, or nasal route administration.
- Some groups of mice may be treated with additional anti-inflammatory agent(s) or EAE therapeutic(s) (e.g. anti-CD154, blockade of members of the TNF family, Vitamin D, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- In addition, some mice are treated with antibiotics prior to treatment. For example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment. Some immunized mice are treated without receiving antibiotics.
- At various time points, mice are sacrificed and sites of inflammation (e.g. brain and spinal cord), lymph nodes, or other tissues may be removed for ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art. For example, tissues are dissociated using dissociation enzymes according to the manufacturer's instructions. Cells are stained for analysis by flow cytometry using techniques known in the art. Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103. Other markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80). In addition to immunophenotyping, serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1. Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ central nervous system (CNS)-infiltrated immune cells obtained ex vivo. Finally, immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be rechallenged with a disease trigger (e.g. activated encephalitogenic T cells or re-injection of EAE-inducing peptides). Mice will be analyzed for susceptibility to disease and EAE severity following rechallenge.
- Collagen-induced arthritis (CIA) is an animal model commonly used to study rheumatoid arthritis (RA), as described by Caplazi et al. (Mouse models of rheumatoid arthritis. Veterinary Pathology. Sep. 1, 2015. 52(5): 819-826) (see also Brand et al. Collagen-induced arthritis. Nature Protocols. 2007. 2: 1269-1275; Pietrosimone et al. Collagen-induced arthritis: a model for murine autoimmune arthritis. Bio Protoc. 2015 Oct. 20; 5(20): e1626).
- Among other versions of the CIA rodent model, one model involves immunizing HLA-DQ8 Tg mice with chick type II collagen as described by Taneja et al. (J. Immunology. 2007. 56: 69-78; see also Taneja et al. J. Immunology 2008. 181: 2869-2877; and Taneja et al. Arthritis Rheum., 2007. 56: 69-78). Purification of chick CII has been described by Taneja et al. (Arthritis Rheum., 2007. 56: 69-78). Mice are monitored for CIA disease onset and progression following immunization, and severity of disease is evaluated and “graded” as described by Wooley, J. Exp. Med. 1981. 154: 688-700.
- Mice are immunized for CIA induction and separated into various treatment groups. Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in CIA, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory treatments.
- Treatment with Lactococcus lactis cremoris Strain A-containing bacterial composition and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated either around the time of immunization with collagen or post-immunization. For example, in some groups, Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered at the same time as immunization (day 1), or Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered upon first signs of disease, or upon the onset of severe symptoms. Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals.
- For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at a dose of between 1×104 and 5×109 bacterial cells per mouse. While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other groups of mice may receive Lactococcus lactis cremoris strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A. The bacterial cells may be live, dead, or weakened. The bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- For example, some groups of mice may receive between 1×104 and 5×109 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration. As with the Lactococcus lactis cremoris strain A, bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, subcutaneous (s.c.) injection, intradermal (i.d.) injection, or nasal route administration.
- Some groups of mice may be treated with additional anti-inflammatory agent(s) or CIA therapeutic(s) (e.g. anti-CD154, blockade of members of the TNF family, Vitamin D, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- In addition, some mice are treated with antibiotics prior to treatment. For example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment. Some immunized mice are treated without receiving antibiotics.
- At various time points, serum samples are obtained to assess levels of anti-chick and anti-mouse CII IgG antibodies using a standard ELISA (Batsalova et al. Comparative analysis of collagen type II-specific immune responses during development of collagen-induced arthritis in two B10 mouse strains. Arthritis Res Ther. 2012. 14(6): R237). Also, some mice are sacrificed and sites of inflammation (e.g. synovium), lymph nodes, or other tissues may be removed for ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art. The synovium and synovial fluid will be analyzed for plasma cell infiltration and the presence of antibodies using techniques known in the art. In addition, tissues are dissociated using dissociation enzymes according to the manufacturer's instructions to examine the profiles of the cellular infiltrates. Cells are stained for analysis by flow cytometry using techniques known in the art. Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103. Other markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80). In addition to immunophenotyping, serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1. Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ synovium-infiltrated immune cells obtained ex vivo. Finally, immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be rechallenged with a disease trigger (e.g. activated re-injection with CIA-inducing peptides). Mice will be analyzed for susceptibility to disease and CIA severity following rechallenge.
-
Type 1 diabetes (T1D) is an autoimmune disease in which the immune system targets the islets of Langerhans of the pancreas, thereby destroying the body's ability to produce insulin. - There are various models of animal models of T1D, as reviewed by Belle et al. (Mouse models for
type 1 diabetes. Drug Discov Today Dis Models. 2009; 6(2): 41-45; see also Aileen J F King. The use of animal models in diabetes research. Br J Pharmacol. 2012 June; 166(3): 877-894. There are models for chemically-induced T1D, pathogen-induced T1D, as well as models in which the mice spontaneously develop T1D. - Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in a mouse model of T1D, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory treatments.
- Depending on the method of T1D induction and/or whether T1D development is spontaneous, treatment with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of induction or following induction, or prior to the onset (or upon the onset) of spontaneously-occurring T1D. Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals. For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at a dose of between 1×104 and 5×109 bacterial cells per mouse. Other mice may receive 25, 50, or 100 mg of Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A per mouse. While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day, while others may receive Lactococcus lactis cremoris strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A. The bacterial cells may be live, dead, or weakened. The bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- For example, some groups of mice may receive between 1×104 and 5×109 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration. As with the Lactococcus lactis cremoris strain A, bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration.
- Some groups of mice may be treated with additional treatments and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- In addition, some mice are treated with antibiotics prior to treatment. For example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment. Some immunized mice are treated without receiving antibiotics.
- Blood glucose is monitored biweekly prior to the start of the experiment. At various time points thereafter, nonfasting blood glucose is measured. At various time points, mice are sacrificed and site the pancreas, lymph nodes, or other tissues may be removed for ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art. For example, tissues are dissociated using dissociation enzymes according to the manufacturer's instructions. Cells are stained for analysis by flow cytometry using techniques known in the art. Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103. Other markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80). In addition to immunophenotyping, serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1. Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified tissue-infiltrating immune cells obtained ex vivo. Finally, immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression. Antibody production may also be assessed by ELISA.
- In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be rechallenged with a disease trigger, or assessed for susceptibility to relapse. Mice will be analyzed for susceptibility to diabetes onset and severity following rechallenge (or spontaneously-occurring relapse).
- Primary Sclerosing Cholangitis (PSC) is a chronic liver disease that slowly damages the bile ducts and leads to end-stage cirrhosis. It is associated with inflammatory bowel disease (IBD).
- There are various animal models for PSC, as reviewed by Fickert et al. (Characterization of animal models for primary sclerosing cholangitis (PSC). J Hepatol. 2014 June 60(6): 1290-1303; see also Pollheimer and Fickert. Animal models in primary biliary cirrhosis and primary sclerosing cholangitis. Clin Rev Allergy Immunol. 2015 June 48(2-3): 207-17). Induction of disease in PSC models includes chemical induction (e.g. 3,5-diethoxycarbonyl-1,4-dihydrocollidine (DDC)-induced cholangitis), pathogen-induced (e.g. Cryptosporidium parvum), experimental biliary obstruction (e.g. common bile duct ligation (CBDL)), and transgenic mouse model of antigen-driven biliary injury (e.g. Ova-Bil transgenic mice). For example, bile duct ligation is performed as described by Georgiev et al. (Characterization of time-related changes after experimental bile duct ligation. Br J Surg. 2008. 95(5): 646-56), or disease is induced by DCC exposure as described by Fickert et al. (A new xenobiotic-induced mouse model of sclerosing cholangitis and biliary fibrosis. Am J Path. Vol 171(2): 525-536.
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in a mouse model of PSC, either alone or in combination with whole bacterial cells, with or without the addition of some other therapeutic agent.
- For example, 6-8 week old C57bl/6 mice are obtained from Taconic or other vendor. Mice are fed a 0.1% DCC-supplemented diet for various durations. Some groups will receive DCC-supplement food for 1 week, others for 4 weeks, others for 8 weeks. Some groups of mice may receive a DCC-supplemented diet for a length of time and then be allowed to recover, thereafter receiving a normal diet. These mice may be studied for their ability to recover from disease and/or their susceptibility to relapse upon subsequent exposure to DCC. Treatment with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of DCC-feeding or subsequent to initial exposure to DCC. For example, Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered on
day 1, or they may be administered sometime thereafter. Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals. For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at a range between 1×104 and 5×109 bacterial cells per mouse. Other mice may receive 25, 50, 100 mg of Lactococcus lactis cremoris strain A per mouse. While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A through i.p. injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A. The bacterial cells may be live, dead, or weakened. The bacterial cells may be harvested fresh (or frozen), and administered, or they may be irradiated or heat-killed prior to administration. For example, some groups of mice may receive between 1×104 and 5×109 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration. As with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A, bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration. Some groups of mice may be treated with additional agents and/or an appropriate control (e.g. vehicle or antibody) at various time points and at effective doses. - In addition, some mice are treated with antibiotics prior to treatment. For example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment. Some immunized mice are treated without receiving antibiotics. At various time points, serum samples are analyzed for ALT, AP, bilirubin, and serum bile acid (BA) levels.
- At various time points, mice are sacrificed, body and liver weight are recorded, and sites of inflammation (e.g. liver, small and large intestine, spleen), lymph nodes, or other tissues may be removed for ex vivo histolomorphological characterization, cytokine and/or flow cytometric analysis using methods known in the art (see Fickert et al. Characterization of animal models for primary sclerosing cholangitis (PSC)). J Hepatol. 2014. 60(6): 1290-1303). For example, bile ducts are stained for expression of ICAM-1, VCAM-1, MadCAM-1. Some tissues are stained for histological examination, while others are dissociated using dissociation enzymes according to the manufacturer's instructions. Cells are stained for analysis by flow cytometry using techniques known in the art. Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103. Other markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80), as well as adhesion molecule expression (ICAM-1, VCAM-1, MadCAM-1). In addition to immunophenotyping, serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1. Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ bile duct-infiltrated immune cells obtained ex vivo.
- Liver tissue is prepared for histological analysis, for example, using Sirius-red staining followed by quantification of the fibrotic area. At the end of the treatment, blood is collected for plasma analysis of liver enzymes, for example, AST or ALT, and to determine Bilirubin levels. The hepatic content of Hydroxyproline can be measured using established protocols. Hepatic gene expression analysis of inflammation and fibrosis markers may be performed by qRT-PCR using validated primers. These markers may include, but are not limited to, MCP-1, alpha-SMA, Coll1a1, and TIMP. Metabolite measurements may be performed in plasma, tissue and fecal samples using established metabolomics methods. Finally, immunohistochemistry is carried out on liver sections to measure neutrophils, T cells, macrophages, dendritic cells, or other immune cell infiltrates.
- In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be rechallenged with DCC at a later time. Mice will be analyzed for susceptibility to cholangitis and cholangitis severity following rechallenge.
- Alternatively, Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in BDL-induced cholangitis. For example, 6-8 week old C57Bl/6J mice are obtained from Taconic or other vendor. After an acclimation period the mice are subjected to a surgical procedure to perform a bile duct ligation (BDL). Some control animals receive a sham surgery. The BDL procedure leads to liver injury, inflammation and fibrosis within 7-21 days.
- Treatment with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of surgery or some time following the surgery. Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals. For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at a range between 1×104 and 5×109 bacterial cells per mouse. Other mice may receive 25, 50, or 100 mg of Lactococcus lactis cremoris strain A per mouse. While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.p. injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration. Some mice receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A. The bacterial cells may be live, dead, or weakened. They bacterial cells may be harvested fresh (or frozen), and administered, or they may be irradiated or heat-killed prior to administration. For example, some groups of mice may receive between 1×104 and 5×109 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration. As with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A, bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration. Some groups of mice may be treated with additional agents and/or an appropriate control (e.g. vehicle or antibody) at various time points and at effective doses.
- In addition, some mice are treated with antibiotics prior to treatment. For example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment. Some immunized mice are treated without receiving antibiotics. At various time points, serum samples are analyzed for ALT, AP, bilirubin, and serum bile acid (BA) levels.
- At various time points, mice are sacrificed, body and liver weight are recorded, and sites of inflammation (e.g. liver, small and large intestine, spleen), lymph nodes, or other tissues may be removed for ex vivo histolomorphological characterization, cytokine and/or flow cytometric analysis using methods known in the art (see Fickert et al. Characterization of animal models for primary sclerosing cholangitis (PSC)). J Hepatol. 2014. 60(6): 1290-1303). For example, bile ducts are stained for expression of ICAM-1, VCAM-1, MadCAM-1. Some tissues are stained for histological examination, while others are dissociated using dissociation enzymes according to the manufacturer's instructions. Cells are stained for analysis by flow cytometry using techniques known in the art. Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103. Other markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80), as well as adhesion molecule expression (ICAM-1, VCAM-1, MadCAM-1). In addition to immunophenotyping, serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1. Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ bile duct-infiltrated immune cells obtained ex vivo.
- Liver tissue is prepared for histological analysis, for example, using Sirius-red staining followed by quantification of the fibrotic area. At the end of the treatment, blood is collected for plasma analysis of liver enzymes, for example, AST or ALT, and to determine Bilirubin levels. The hepatic content of Hydroxyproline can be measured using established protocols. Hepatic gene expression analysis of inflammation and fibrosis markers may be performed by qRT-PCR using validated primers. These markers may include, but are not limited to, MCP-1, alpha-SMA, Coll1a1, and TIMP. Metabolite measurements may be performed in plasma, tissue and fecal samples using established metabolomics methods. Finally, immunohistochemistry is carried out on liver sections to measure neutrophils, T cells, macrophages, dendritic cells, or other immune cell infiltrates.
- In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be analyzed for recovery.
- Nonalcoholic Steatohepattiis (NASH) is a severe form of Nonalcoholic Fatty Liver Disease (NAFLD), where buildup of hepatic fat (steatosis) and inflammation lead to liver injury and hepatocyte cell death (ballooning).
- There are various animal models of NASH, as reviewed by Ibrahim et al. (Animal models of nonalcoholic steatohepatitis: Eat, Delete, and Inflame. Dig Dis Sci. 2016 May. 61(5): 1325-1336; see also Lau et al. Animal models of non-alcoholic fatty liver disease: current perspectives and recent advances 2017 January 241(1): 36-44).
- Lactococcus lactis cremoris Strain A-containing bacterial compositions are tested for their efficacy in a mouse model of NASH, either alone or in combination with whole bacterial cells, with or without the addition of another therapeutic agent. For example, 8-10 week old C57Bl/6J mice, obtained from Taconic (Germantown, N.Y.), or other vendor, are placed on a methionine choline deficient (MCD) diet for a period of 4-8 weeks during which NASH features will develop, including steatosis, inflammation, ballooning and fibrosis.
- Treatment with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either at the beginning of the diet, or at some point following diet initiation (for example, one week after). For example, Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered starting in the same day as the initiation of the MCD diet. Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals. For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at doses between 1×104 and 5×109 bacterial cells per mouse. Other mice may receive 25, 50, or 100 mg of Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A per mouse. While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through intraperitoneal (i.p.) injection, subcutaneous (s.c.) injection, nasal route administration, oral gavage, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 1), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A. The bacterial cells may be live, dead, or weakened. The bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- For example, some groups of mice may receive between 1×104 and 5×109 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration. As with the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A, bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, or nasal route administration. Some groups of mice may be treated with additional NASH therapeutic(s) (e.g., FXR agonists, PPAR agonists, CCR2/5 antagonists or other treatment) and/or appropriate control at various time points and effective doses.
- At various time points and/or at the end of the treatment, mice are sacrificed and liver, intestine, blood, feces, or other tissues may be removed for ex vivo histological, biochemical, molecular or cytokine and/or flow cytometry analysis using methods known in the art. For example, liver tissues are weighed and prepared for histological analysis, which may comprise staining with H&E, Sirius Red, and determination of NASH activity score (NAS). At various time points, blood is collected for plasma analysis of liver enzymes, for example, AST or ALT, using standards assays. In addition, the hepatic content of cholesterol, triglycerides, or fatty acid acids can be measured using established protocols. Hepatic gene expression analysis of inflammation, fibrosis, steatosis, ER stress, or oxidative stress markers may be performed by qRT-PCR using validated primers. These markers may include, but are not limited to, IL-6, MCP-1, alpha-SMA, Coll1a1, CHOP, and NRF2. Metabolite measurements may be performed in plasma, tissue and fecal samples using established biochemical and mass-spectrometry-based metabolomics methods. Serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1. Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ bile duct-infiltrated immune cells obtained ex vivo. Finally, immunohistochemistry is carried out on liver or intestine sections to measure neutrophils, T cells, macrophages, dendritic cells, or other immune cell infiltrates.
- In order to examine the impact and longevity of disease protection, rather than being sacrificed, some mice may be analyzed for recovery.
- Psoriasis is a T-cell-mediated chronic inflammatory skin disease. So-called “plaque-type” psoriasis is the most common form of psoriasis and is typified by dry scales, red plaques, and thickening of the skin due to infiltration of immune cells into the dermis and epidermis. Several animal models have contributed to the understanding of this disease, as reviewed by Gudjonsson et al. (Mouse models of psoriasis. J Invest Derm. 2007. 127: 1292-1308; see also van der Fits et al. Imiquimod-induced psoriasis-like skin inflammation in mice is mediated via the IL-23/IL-17 axis. J. Immunol. 2009 May 1. 182(9): 5836-45).
- Psoriasis can be induced in a variety of mouse models, including those that use transgenic, knockout, or xenograft models, as well as topical application of imiquimod (IMQ), a TLR7/8 ligand.
- Lactococcus lactis cremoris Strain A-containing bacterial compositions and/or EVs derived from Lactococcus lactis cremoris Strain A are tested for their efficacy in the mouse model of psoriasis, either alone or in combination with whole bacterial cells, with or without the addition of other anti-inflammatory treatments. For example, 6-8 week old C57Bl/6 or Balb/c mice are obtained from Taconic (Germantown, N.Y.), or other vendor. Mice are shaved on the back and the right ear. Groups of mice receive a daily topical dose of 62.5 mg of commercially available IMQ cream (5%) (Aldara; 3M Pharmaceuticals). The dose is applied to the shaved areas for 5 or 6 consecutive days. At regular intervals, mice are scored for erythema, scaling, and thickening on a scale from 0 to 4, as described by van der Fits et al. (2009). Mice are monitored for ear thickness using a Mitutoyo micrometer.
- Treatment with Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is initiated at some point, either around the time of the first application of IMQ, or something thereafter. For example, Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A may be administered at the same time as the subcutaneous injections (day 0), or they may be administered prior to, or upon, application. Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A is administered at varied doses and at defined intervals. For example, some mice are intravenously injected with Lactococcus lactis cremoris strain A at a dose of between 1×104 and 5×109 bacterial cells per mouse. Other mice may receive 25, 50, or 100 mg of Lactococcus lactis cremoris strain A per mouse. While some mice will receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through i.v. injection, other mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A through intraperitoneal (i.p.) injection, nasal route administration, oral gavage, topical administration, intradermal (i.d.) injection, subcutaneous (s.c.) injection, or other means of administration. Some mice may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A every day (e.g. starting on day 0), while others may receive Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A at alternative intervals (e.g. every other day, or once every three days). Additional groups of mice may receive some ratio of bacterial cells to Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A. The bacterial cells may be live, dead, or weakened. The bacterial cells may be harvested fresh (or frozen) and administered, or they may be irradiated or heat-killed prior to administration.
- For example, some groups of mice may receive between 1×104 and 5×109 bacterial cells in an administration separate from, or comingled with, the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A administration. As with the Lactococcus lactis cremoris strain A and/or EVs derived from Lactococcus lactis cremoris Strain A, bacterial cell administration may be varied by route of administration, dose, and schedule. This can include oral gavage, i.v. injection, i.p. injection, i.d. injection, s.c. injection, topical administration, or nasal route administration.
- Some groups of mice may be treated with anti-inflammatory agent(s) (e.g. anti-CD154, blockade of members of the TNF family, or other treatment), and/or an appropriate control (e.g. vehicle or control antibody) at various time points and at effective doses.
- In addition, some mice are treated with antibiotics prior to treatment. For example, vancomycin (0.5 g/L), ampicillin (1.0 g/L), gentamicin (1.0 g/L) and amphotericin B (0.2 g/L) are added to the drinking water, and antibiotic treatment is halted at the time of treatment or a few days prior to treatment. Some immunized mice are treated without receiving antibiotics.
- At various time points, samples from back and ear skin are taken for cryosection staining analysis using methods known in the art. Other groups of mice are sacrificed and lymph nodes, spleen, mesenteric lymph nodes (MLN), the small intestine, colon, and other tissues may be removed for histology studies, ex vivo histological, cytokine and/or flow cytometric analysis using methods known in the art. Some tissues may be dissociated using dissociation enzymes according to the manufacturer's instructions. Cryosection samples, tissue samples, or cells obtained ex vivo are stained for analysis by flow cytometry using techniques known in the art. Staining antibodies can include anti-CD11c (dendritic cells), anti-CD80, anti-CD86, anti-CD40, anti-MHCII, anti-CD8a, anti-CD4, and anti-CD103. Other markers that may be analyzed include pan-immune cell marker CD45, T cell markers (CD3, CD4, CD8, CD25, Foxp3, T-bet, Gata3, Roryt, Granzyme B, CD69, PD-1, CTLA-4), and macrophage/myeloid markers (CD11b, MHCII, CD206, CD40, CSF1R, PD-L1, Gr-1, F4/80). In addition to immunophenotyping, serum cytokines are analyzed including, but not limited to, TNFa, IL-17, IL-13, IL-12p70, IL12p40, IL-10, IL-6, IL-5, IL-4, IL-2, IL-1b, IFNy, GM-CSF, G-CSF, M-CSF, MIG, IP10, MIP1b, RANTES, and MCP-1. Cytokine analysis may be carried out on immune cells obtained from lymph nodes or other tissue, and/or on purified CD45+ skin-infiltrated immune cells obtained ex vivo. Finally, immunohistochemistry is carried out on various tissue sections to measure T cells, macrophages, dendritic cells, and checkpoint molecule protein expression.
- In order to examine the impact and longevity of psoriasis protection, rather than being sacrificed, some mice may be studied to assess recovery, or they may be rechallenged with IMQ. The groups of rechallenged mice will be analyzed for susceptibility to psoriasis and severity of response.
- A single-center,
Phase 1 clinical study in performed in which preliminary safety, tolerability, and pharmacodynamic effect of Lactococcus lactis cremoris strain A is determined in healthy participants and participants with mild to moderate psoriasis or atopic dermatitis, but who are otherwise well. - This is a randomized, placebo-controlled clinical study with dose escalations and dose expansions to assess preliminary safety, tolerability, and pharmacodynamic effect of Lactococcus lactis cremoris strain A, and is participant and investigator blind, sponsor unblinded, with single and multiple ascending doses. This investigation provides an opportunity to gain pharmacodynamic information using a range of tissue biopsies and composite clinical endpoints.
- The study consists of six (6) cohorts and will test doses of Lactococcus lactis cremoris strain A versus placebo. The initial three (3) cohorts are in healthy volunteers and will establish the safety and tolerability of Lactococcus lactis cremoris strain A. Once this has been established, the safety and tolerability in participants with psoriasis or atopic dermatitis will be tested, alongside pharmacodynamic effects on the systemic immune system and observation of any clinical effects.
- The treatment arms are described in Table 7, and optional additional cohorts may be added to include dose expansion studies.
-
TABLE 7 Arms and Interventions Cohort Arms Assigned Interventions 1 12 healthy volunteers: Lactococcus lactis cremoris 8 on Lactococcus lactis strain A is orally cremoris strain A, administered 4 on placebo Drug: placebo oral capsule Dose = 66 mg capsule, once daily for 15 days 2 12 healthy volunteers: 8 on Lactococcus lactis Lactococcus lactis cremoris cremoris strain A, strain A is orally 4 on placebo administered Dose = 660 mg capsule, once Drug: placebo oral capsule daily for 15 days 3 12 healthy volunteers: Lactococcus lactis cremoris 8 on Lactococcus lactis strain A is orally cremoris strain A, administered 4 on placebo Drug: placebo oral capsule Dose = 3.3 g capsule, once daily for 15 days 4 12 subjects with mild to Lactococcus lactis cremoris moderate psoriasis: strain A is orally 8 on Lactococcus lactis administered cremoris strain A, Drug: placebo oral capsule 4 on placebo Dose = 660 mg, capsule, once daily, 29 days 5 24 subjects with mild to Lactococcus lactis cremoris moderate psoriasis: strain A is orally 16 on Lactococcus lactis administered cremoris strain A, Drug: placebo oral capsule 8 on placebo Dose = 3.3 g, capsule, once daily, 29 days 6 24 subjects with mild to Lactococcus lactis cremoris moderate atopic dermatitis: strain A is orally 16 on Lactococcus lactis administered cremoris strain A, Drug: placebo oral capsule 8 on placebo Dose = 3.3 g capsule, once daily, 29 days - The study has at least three (3) outcome measures: 1) safety and tolerability; 2) clinical improvement in subjects with mild to moderate psoriasis; and 3) clinical improvement in subjects with mild to moderate atopic dermatitis.
- For (1) Safety and tolerability, serious adverse events (SAE), lab measurements, electrocardiogram (ECG) measurements, vital sign measurements, physical examination, Bristol stool scale, markers of GI integrity, and immune biomarkers are conducted and assessed; for (2) Clinical improvement in subjects with mild to moderate psoriasis, psoriasis activity scoring index (PASI), investigators' global assessment (IGA), and lesion severity score (LSS) are assessed over a period of 14 months; and for (3) Clinical improvement in subjects with mild to moderate atopic dermatitis, EASI, severity scoring of atopic dermatitis (SCORAD), LSS, and IGA are assessed over a period of 14 months.
- Anti-psoriasis and anti-atopic dermatitis activities are assessed by the Investigator according to disease specific response criteria and described in terms of objective response rate, duration of response, progression-free time-periods, clinical benefit rate, and disease control rate. Investigators will look for improvement from baseline at or around day 28 of dosing using the PASI and eczema activity scoring index (EASI), both of which are known in the art.
- The inclusion criteria for all parts of the study include the following:
-
- 1. Participant has a body mass index of ≥18 kg/m2 to ≤35 kg/m2 at screening.
- 2. Participants who are overtly healthy as determined by medical evaluation including medical history, physical examination, laboratory tests, and cardia monitoring.
- 3. For patients with mild to moderate psoriasis:
- a. Participant has had a confirmed diagnosis of mild to moderate plaque-type psoriasis for at least 6 months involving ≤5% of body surface area (BSA) (excluding the scalp).
- b. Participant has a minimum of 2 psoriatic lesions with at least 1 plaque in a site suitable for biopsy.
- 4. For patients with mild to moderate atopic dermatitis:
- a. Participant has mild to moderate atopic dermatitis with a minimum of 3 to a maximum of 15% BSA involvement.
- b. Participant has had a confirmed diagnosis of mild to moderate atopic dermatitis for at least 6 months with IGA score of 2 or 3.
- c. Participant has a minimum of 2 atopic dermatitis lesions with at least 1 in a site suitable for biopsy.
- The following categories of patient are excluded from the study:
-
- 1. Female participant who is pregnant or plans to become pregnant during the study, and/or female participant who is breastfeeding or is sexually active with childbearing potential who is not using a medically accepted birth control method.
- 2. Participant has received live attenuated vaccination within 6 weeks prior to screening or intends to have such a vaccination during the course of the study.
- 3. Participant has received any investigational drug or experimental procedure within 90 days or 5 half-lives, whichever is longer, prior to study intervention administration.
- 4. Participant requires treatment with an anti-inflammatory drug during the study period. Paracetamol will be permitted for use as an antipyretic and/or analgesic (maximum of 2 grams/day in any 24 hour period).
- 5. Participant has an active infection (e.g. sepsis, pneumonia, abscess) or has had an infection requiring antibiotic treatment within 6 weeks prior to investigational medicinal product (IMP) administration. When in doubt, the investigator should confer with the Sponsor study physician.
- 6. Participant has renal or liver impairment, defined as:
- a. For healthy volunteers: i. for women, serum creatinine level ≥125 μmol/L; for men, ≥135 μmol/L, or ii: Alanine aminotransferase (ALT) and aspartate aminotransferase (AST) ≥1.5× upper limit of normal (ULN), or iii. Alkaline phosphatase (ALP) and/or bilirubin >1.5×ULN.
- b. For participants with mild to moderate atopic dermatitis, or psoriasis: i. For women, serum creatinine level ≥125 μmol/L; for men ≥135 μmol/L, or ii. ALT or AST>2×ULN and/or bilirubin >1.5×ULN.
- Patients receive all Lactococcus lactis cremoris strain A doses during the treatment period, or have had a dose-limiting toxicity (DLT) within the treatment period, may be considered evaluable for dose escalation decisions. Dose escalation decisions occur when the cohort of patients has met these criteria.
- A DLT is defined as an adverse event (AE) or abnormal laboratory value that occurs within the first 7 days of treatment with Lactococcus lactis cremoris strain A, except for those that are clearly and incontrovertibly due to underlying disease, disease progression, or extraneous causes. Dose escalation decisions occur when the cohort of patients has met these criteria.
- To implement dose escalation decisions, the available toxicity information (i.e., all AEs and all laboratory abnormalities regardless of DLT assessment) is evaluated by the enrolling Investigators and Sponsor medical monitor at a dose decision meeting or teleconference. Decisions are based on an evaluation of all relevant data available from all dose cohorts evaluated in the ongoing study. Drug administration at the next higher dose cohort may not proceed until the Investigator receives written confirmation from Sponsor indicating that the results of the previous dose cohort were evaluated and that it is permissible to proceed to the next higher dose cohort.
- Intra-patient dose escalations are permitted for all cohorts after the intended dose level has been shown to be safe (i.e., all patients treated at the intended dose level completed DLT assessments and ≤1 patient experienced a DLT).
- The efficacy of L. lactis cremoris Strains that lacked certain plasmids was evaluated. Knockout strains were created using electroporation techniques known in the art. Briefly, electrocompetent cells were prepared by growing strain overnight in M17 media (5 g Pancreatic digest of casein, 5 g soy peptone, 5 g beef extract, 2.5 g yeast extract, 0.5 g ascorbic acid, 0.25 g MgSO4, 19 g Disodium-β-glycerophosphate per L) that included 1% glucose. 2 mL of overnight culture was inoculated with 50 mL of M17 media and allowed to grow to an optical density at 600 nm of 0.5-0.7 (about 5-7 hrs). The culture was then cooled on ice for 10 min. Cells were spun down for 15 min at 3000 g and resuspended in electroporation buffer (0.5M Sucrose+10% glycerol) which was repeated 2 more times. Cells were then resuspended in 500 μL of electroporation buffer and separated into 100 μL aliquots and stored at −80° C. until electroporation.
- Electroporation proceeded by defrosting cells on ice prior to transfer to an electroporation cuvette. Cell were then electroporated at 1.2 kV for in Lactococcus lactis cremoris Strain A and 2.5 kV for in Lactococcus lactis cremoris Strain B. 900 μL of recovery solution (M17+0.5M(0.17 g)Sucrose+0.5%(15 μl)Glucose+20 mM(10 μl)MgCl2+0.2 mM(10 μl)CaCl2 per mL) was then immediately added. The cells were then kept on ice for 10 min. Electroporated cells were subcultuted 1:10 in M17 media and incubated for 20 min at 30° C. before diluting and plating. Cells were then screened for plasmid loss by PCR.
- To elucidate the effect of the strains without the plasmids, the Lactococcus lactis cremoris Strains A and B (both with and without plasmids) were evaluated in the mouse model of DTH. As noted above in Example 1, mice were injected with KLH and CFA i.d at 4 locations along the back (50 ug per mouse of KLH prepared in a 1:1 ratio with CFA in a total volume of 50 ul per site). Mice were dosed for 9 days with 1×10{circumflex over ( )}9 viable cells per day as follows: 1) anaerobic PBS (vehicle); 2) Lactococcus lactis cremoris Strain A; 3) Lactococcus lactis cremoris Strain A minus a 13 kb plasmid; 4) Lactococcus lactis cremoris Strain B; 5) Lactococcus lactis cremoris Strains B minus a 30 kb plasmid; and 6) Dexamethasone (positive control). At 24 hours post-challenge, the removal of a 13 kb plasmid from Lactococcus lactis cremoris Strain A reduced the efficacy of the strain while the removal of a 30 kb plasmid from Lactococcus lactis cremoris Strain B improved the efficacy of the strain (
FIG. 4 ). - The strains were then sequenced to determine the genes within the 13 kb plasmid from) Lactococcus lactis cremoris Strain A and the 30 kb plasmid from Lactococcus lactis cremoris Strain B. See Table 5 and Table 6.
- Enriched media is used to grow and prepare the bacterium for in vitro and in vivo use. For example, media may contain sugar, yeast extracts, plant based peptones, buffers, salts, trace elements, surfactants, anti-foaming agents, and vitamins. Composition of complex components such as yeast extracts and peptones may be undefined or partially defined (including approximate concentrations of amino acids, sugars etc.). Microbial metabolism may be dependent on the availability of resources such as carbon and nitrogen. Various sugars or other carbon sources may be tested. Alternatively, media may be prepared and the selected bacterium grown as shown by Saarela et al., J. Applied Microbiology. 2005. 99: 1330-1339, which is hereby incorporated by reference. Influence of fermentation time, cryoprotectant and neutralization of cell concentrate on freeze-drying survival, storage stability, and acid and bile exposure of the selected bacterium produced without milk-based ingredients.
- At large scale, the media is sterilized. Sterilization may be by Ultra High Temperature (UHT) processing. The UHT processing is performed at very high temperature for short periods of time. The UHT range may be from 135-180° C. For example, the medium may be sterilized from between 10 to 30 seconds at 135° C.
- Inoculum can be prepared in flasks or in smaller bioreactors and growth is monitored. For example, the inoculum size may be between approximately 0.5 and 3% of the total bioreactor volume. Depending on the application and need for material, bioreactor volume can be at least 2 L, 10 L, 80 L, 100 L, 250 L, 1000 L, 2500 L, 5000 L, 10,000 L.
- Before the inoculation, the bioreactor is prepared with medium at desired pH, temperature, and oxygen concentration. The initial pH of the culture medium may be different that the process set-point. pH stress may be detrimental at low cell centration; the initial pH could be between pH 7.5 and the process set-point. For example, pH may be set between 4.5 and 8.0. During the fermentation, the pH can be controlled through the use of sodium hydroxide, potassium hydroxide, or ammonium hydroxide. The temperature may be controlled from 25° C. to 45° C., for example at 37° C. Anaerobic conditions are created by reducing the level of oxygen in the culture broth from around 8 mg/L to 0 mg/L. For example, nitrogen or gas mixtures (N2, CO2, and H2) may be used in order to establish anaerobic conditions. Alternatively, no gases are used and anaerobic conditions are established by cells consuming remaining oxygen from the medium. Depending on strain and inoculum size, the bioreactor fermentation time can vary. For example, fermentation time can vary from approximately 5 hours to 48 hours.
- Reviving microbes from a frozen state may require special considerations. Production medium may stress cells after a thaw; a specific thaw medium may be required to consistently start a seed train from thawed material. The kinetics of transfer or passage of seed material to fresh medium, for the purposes of increasing the seed volume or maintaining the microbial growth state, may be influenced by the current state of the microbes (ex. exponential growth, stationary growth, unstressed, stressed).
- Inoculation of the production fermenter(s) can impact growth kinetics and cellular activity. The initial state of the bioreactor system must be optimized to facilitate successful and consistent production. The fraction of seed culture to total medium (e.g. a percentage) has a dramatic impact on growth kinetics. The range may be 1-5% of the fermenter's working volume. The initial pH of the culture medium may be different from the process set-point. pH stress may be detrimental at low cell concentration; the initial pH may be between pH 7.5 and the process set-point. Agitation and gas flow into the system during inoculation may be different from the process set-points. Physical and chemical stresses due to both conditions may be detrimental at low cell concentration.
- Process conditions and control settings may influence the kinetics of microbial growth and cellular activity. Shifts in process conditions may change membrane composition, production of metabolites, growth rate, cellular stress, etc. Optimal temperature range for growth may vary with strain. The range may be 20-40° C. Optimal pH for cell growth and performance of downstream activity may vary with strain. The range may be pH 5-8. Gasses dissolved in the medium may be used by cells for metabolism. Adjusting concentrations of O2, CO2, and N2 throughout the process may be required. Availability of nutrients may shift cellular growth. Microbes may have alternate kinetics when excess nutrients are available.
- The state of microbes at the end of a fermentation and during harvesting may impact cell survival and activity. Microbes may be preconditioned shortly before harvest to better prepare them for the physical and chemical stresses involved in separation and downstream processing. A change in temperature (often reducing to 20-5° C.) may reduce cellular metabolism, slowing growth (and/or death) and physiological change when removed from the fermenter. Effectiveness of centrifugal concentration may be influenced by culture pH. Raising pH by 1-2 points can improve effectiveness of concentration but can also be detrimental to cells. Microbes may be stressed shortly before harvest by increasing the concentration of salts and/or sugars in the medium. Cells stressed in this way may better survive freezing and lyophilization during downstream.
- Separation methods and technology may impact how efficiently microbes are separated from the culture medium. Solids may be removed using centrifugation techniques. Effectiveness of centrifugal concentration can be influenced by culture pH or by the use of flocculating agents. Raising pH by 1-2 points may improve effectiveness of concentration but can also be detrimental to cells. Microbes may be stressed shortly before harvest by increasing the concentration of salts and/or sugars in the medium. Cells stressed in this way may better survive freezing and lyophilization during downstream. Additionally, Microbes may also be separated via filtration. Filtration is superior to centrifugation techniques for purification if the cells require excessive g-minutes to successfully centrifuge. Excipients can be added before after separation. Excipients can be added for cryo protection or for protection during lyophilization. Excipients can include, but are not limited to, sucrose, trehalose, or lactose, and these may be alternatively mixed with buffer and anti-oxidants. Prior to lyophilization, droplets of cell pellets mixed with excipients are submerged in liquid nitrogen.
- Harvesting can be performed by continuous centrifugation. Product may be resuspended with various excipients to a desired final concentration. Excipients can be added for cryo protection or for protection during lyophilization. Excipients can include, but are not limited to, sucrose, trehalose, or lactose, and these may be alternatively mixed with buffer and anti-oxidants. Prior to lyophilization, droplets of cell pellets mixed with excipients are submerged in liquid nitrogen.
- Lyophilization of material, including live bacteria, begins with primary drying. During the primary drying phase, the ice is removed. Here, a vacuum is generated and an appropriate amount of heat is supplied to the material for the ice to sublime. During the secondary drying phase, product bound water molecules are removed. Here, the temperature is raised higher than in the primary drying phase to break any physico-chemical interactions that have formed between the water molecules and the product material. The pressure may also be lowered further to enhance desorption during this stage. After the freeze-drying process is complete, the chamber may be filled with an inert gas, such as nitrogen. The product may be sealed within the freeze dryer under dry conditions, preventing exposure to atmospheric water and contaminants.
- Briefly, mice were purchased from Jackson Labs and allowed to acclimate in the vivarium for 1 week prior to start of experiment. Mice are housed 5 animals per cage, in individually ventilated cages with standard bedding and enrichment. Standard Purina rodent diet (5001) and autoclaved water is provided ad libitum and checked daily. Ventilated cages are changed once weekly. Animal housing rooms undergoes a lighting cycle consisting of 12 hours on and 12 hours off. Floors, walls, and ceilings are sanitized once a month and rooms maintain a humidity range between 30%-70%, and a temperature range between 68-79 degrees Fahrenheit. Animal health checks are done twice daily.
- On day −1, recipient BALB/c mice were adoptively transferred with 1×10{circumflex over ( )}8 DO11. TCR Tg lymphocytes (i.p.).
- On
day 0, mice were anesthetized with isoflurane (one at a time) and their back was shaved. Mice were injected subcutaneously at 4 sites on the back with 50 μl of Ovalbumin in CFA emulsion (Hooke Labs catalog #EK-0301). - A dexamethasone stock solution (17 mg/ml) was created by resuspending 6.8 mg of dexamethasone in 400 μl of 96% ethanol. For each day of dosing, a working solution is prepared by diluting the
stock solution 100× in sterile PBS to obtain a final concentration of 0.17 mg/mL in a septum vial for intraperitoneal dosing. Dexamethasone-treated mice received 100 μL Dexamethasone i.p. (5 mL/kg of a 0.17 mg/mL solution). Frozen sucrose served as the negative control (vehicle). Lactococcus lactis cremoris Strain A was dosed at 100 ul of bacterial cells at 1×10{circumflex over ( )}10 CFU/ml daily. Dexamethasone (positive control), vehicle (negative control), and Lactococcus lactis cremoris Strain A were dosed daily. - On days 1-9 mice were orally gavaged (
groups 1 and 3) or injected intraperitoneally (i.p. group 2). - On
day 8, after all mice were gavaged, each mouse was anesthetized with isoflurane and a baseline left ear measurement was obtained using Fowler calipers. Then 10 μl of OVA323-339 (Invivogen) (dissolved in sterile PBS to a concentration of 1 mg/ml) was injected intradermally in the left ear. As shown inFIG. 5 , Lactococcus lactis cremoris Strain A reduces antigen-specific ear swelling (ear thickness) compared to vehicle (negative control), and anti-inflammatory Dexamethasone (positive control) in an OVA based adoptive transfer delayed-type hypersensitivity (AdDTH) Mouse Model. - On
day 9, a 24-hour ear measurement was obtained using Fowler calipers and mice were euthanized and tissues like spleen, draining cervical lymph nodes and mesenteric lymph nodes were collected for ex vivo processing. - Single cell suspensions of tissues were prepared, counted and plated to 200,000 cells/well and restimulated with LPS and PMA/Ionomycin for 48 hours or with OVA323-339 peptide or left unstimulated for 72 hours. Supernatants were collected at the end of stimulations and used for downstream MSD or Luminex analyses.
- As shown in
FIGS. 6A, 6B, and 6C , Lactococcus lactis cremoris Strain A reduces expression of IL-12p70 (FIG. 6A ), IL-22 (FIG. 6B ), and KC (FIG. 6C ) in an Adoptive Transfer Delayed-Type Hypersensitivity (AdDTH) Mouse Model. Circle represents vehicle, square represents dexamethasone, and triangle represents Lactococcus lactis cremoris Strain A. - Imiquimod driven psoriasis model is a Th17 driven skin inflammation model. Mice develop flakiness of the skin and erythema which mimics some of the pathology associated with human psoriasis that is scored on a scale of 0-4. Additionally, an ear inflammation may be assessed similar to the DTH.
- Briefly, mice were purchased from Taconic Labs and allowed to acclimate in the vivarium for 1 week prior to start of experiment. Mice are housed 5 animals per cage, in individually ventilated cages with standard bedding and enrichment. Standard Purina rodent diet (5001) and autoclaved water is provided ad libitum and checked daily. Ventilated cages are changed once weekly. Animal housing rooms undergoes a lighting cycle consisting of 12 hours on and 12 hours off. Floors, walls, and ceilings are sanitized once a month and rooms maintain a humidity range between 30%-70%, and a temperature range between 68-79 degrees Fahrenheit. Animal health checks are done twice daily.
- A dexamethasone stock solution (17 mg/ml) was created by resuspending 6.8 mg of dexamethasone in 400 μl of 96% ethanol. For each day of dosing, a working solution is prepared by diluting the
stock solution 100× in sterile PBS to obtain a final concentration of 0.17 mg/mL in a septum vial for intraperitoneal dosing. Dexamethasone-treated mice received 100 μL Dexamethasone i.p. (5 mL/kg of a 0.17 mg/mL solution). Frozen sucrose served as the negative control (vehicle). Lactococcus lactis cremoris Strain A was dosed at 100 ul of bacterial cells at 1×10{circumflex over ( )}10 CFU/ml p.o. daily. Dexamethasone (positive control), vehicle (negative control), and Lactococcus lactis cremoris Strain A were dosed daily. - On
Day 0, the backs of mice were shaved and the depilated with Nair (˜25 sec). The Nair is then wiped off and backs of mice washed with warm water (2×). - On Days 1-7, Aldara (5% Imiquimod 62.5 mg per mouse) or control cream is applied on the backs of mice. The cream is re-spread to ensure uniform application. Every day an inflammation skin score is recorded.
- On
Day 8, back skin punches are collected for downstream RNA analyses. Skin inflammation scores are evaluated based on the following scale: 0—normal, no reaction; 1—slight erythema; 2—moderate to severe erythema and some plaques; 3—marked erythema and plaques; 4—very marked erythema and plaques. As depicted inFIG. 7 , Lactococcus lactis cremoris Strain A improved the skin inflammation scores in an imiquimod model of psoriasis compared to control cream, vehicle, and dexamethasone. - All publications patent applications mentioned herein are hereby incorporated by reference in their entirety as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference. In case of conflict, the present application, including any definitions herein, will control.
- Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.
Claims (24)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/583,775 US20220211773A1 (en) | 2017-11-15 | 2022-01-25 | Compositions and methods for treating immune disorders using immune modulating lactococcus bacteria strains |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201762586604P | 2017-11-15 | 2017-11-15 | |
US201862660693P | 2018-04-20 | 2018-04-20 | |
US201862661459P | 2018-04-23 | 2018-04-23 | |
US201862721941P | 2018-08-23 | 2018-08-23 | |
US16/192,172 US11266700B2 (en) | 2017-11-15 | 2018-11-15 | Compositions and methods for treating immune disorders using immune modulating Lactococcus bacteria strains |
US17/583,775 US20220211773A1 (en) | 2017-11-15 | 2022-01-25 | Compositions and methods for treating immune disorders using immune modulating lactococcus bacteria strains |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/192,172 Division US11266700B2 (en) | 2017-11-15 | 2018-11-15 | Compositions and methods for treating immune disorders using immune modulating Lactococcus bacteria strains |
Publications (1)
Publication Number | Publication Date |
---|---|
US20220211773A1 true US20220211773A1 (en) | 2022-07-07 |
Family
ID=66539145
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/192,172 Active 2039-07-19 US11266700B2 (en) | 2017-11-15 | 2018-11-15 | Compositions and methods for treating immune disorders using immune modulating Lactococcus bacteria strains |
US17/583,775 Abandoned US20220211773A1 (en) | 2017-11-15 | 2022-01-25 | Compositions and methods for treating immune disorders using immune modulating lactococcus bacteria strains |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/192,172 Active 2039-07-19 US11266700B2 (en) | 2017-11-15 | 2018-11-15 | Compositions and methods for treating immune disorders using immune modulating Lactococcus bacteria strains |
Country Status (12)
Country | Link |
---|---|
US (2) | US11266700B2 (en) |
EP (1) | EP3710024A1 (en) |
JP (1) | JP2021502970A (en) |
KR (1) | KR20200090189A (en) |
CN (1) | CN111787932A (en) |
AU (1) | AU2018367596A1 (en) |
BR (1) | BR112020009133A2 (en) |
CA (1) | CA3082578A1 (en) |
CO (1) | CO2020007142A2 (en) |
MX (1) | MX2020004934A (en) |
TW (1) | TW201922270A (en) |
WO (1) | WO2019099682A1 (en) |
Families Citing this family (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP3694553A4 (en) | 2017-10-12 | 2021-08-11 | Amphivena Therapeutics, Inc. | Dosing regimen for cd3 binding proteins |
JP2021502970A (en) | 2017-11-15 | 2021-02-04 | エヴェロ バイオサイエンシズ,インコーポレーテッド | Compositions and Methods for Treating Immune Disorders Using the Immunomodulatory Lactococcus Bacterial Strain |
US20220249579A1 (en) * | 2019-06-11 | 2022-08-11 | Evelo Biosciences, Inc. | Secreted microbial extracellular vesicles |
WO2021022070A2 (en) * | 2019-07-31 | 2021-02-04 | Sanford Burnham Prebys Medical Discovery Institute | Prebiotic-induced anti-tumor immunity |
KR20230004619A (en) * | 2020-04-17 | 2023-01-06 | 에벨로 바이오사이언시즈, 인크. | Solid dosage form with improved disintegration profile |
KR102523743B1 (en) * | 2020-07-20 | 2023-04-19 | 건국대학교 산학협력단 | Compositions for preventing or treating of neurodegenarative disease comprising lactococcus lactis KC24 strain |
KR102461600B1 (en) | 2020-07-21 | 2022-11-02 | 주식회사 피토맵 | N-glycosylation mutated rice, method for manufacturing thereof, and method for manufacturing rice for protein production using the same |
CN111803476A (en) * | 2020-08-14 | 2020-10-23 | 华中科技大学协和深圳医院 | Use of fingolimod for inhibiting gram-positive bacterial activity |
CN112442472B (en) * | 2020-11-30 | 2023-05-26 | 四川大学华西医院 | Recombinant lactococcus lactis for resisting clostridium difficile, live carrier vaccine and preparation method thereof |
WO2022114528A1 (en) * | 2020-11-30 | 2022-06-02 | 주식회사 엠디헬스케어 | Composition for preventing, treating or ameliorating eosinophilic inflammatory diseases or th2 hypersensitivity immune diseases comprising lactococcus lactis-derived vesicles |
KR20230138497A (en) * | 2021-01-26 | 2023-10-05 | 유키지루시 메그밀크 가부시키가이샤 | Composition for improving joint function |
KR102391017B1 (en) * | 2021-07-13 | 2022-04-29 | 한국식품연구원 | Composition for preventing, improving or treating cancer comprising the Lactococcus lactis WiKim0133 |
CN114540235B (en) * | 2022-03-04 | 2023-10-31 | 中国海洋大学 | Method for inducing lactic acid bacteria to sleep and application thereof |
WO2023192361A1 (en) * | 2022-03-31 | 2023-10-05 | Incelldx, Inc. | Methods of treating a subject for fibromyalgia and compositions for use in the same |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005107484A1 (en) * | 2004-05-07 | 2005-11-17 | Friesland Brands B.V. | Dairy product with at least one characteristic of a dairy product mixture |
WO2009007515A1 (en) * | 2007-07-12 | 2009-01-15 | Valio Ltd | Lactic acid bacteria having pro-inflammatory characteristics |
Family Cites Families (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6368586B1 (en) | 1996-01-26 | 2002-04-09 | Brown University Research Foundation | Methods and compositions for enhancing the bioadhesive properties of polymers |
US7101565B2 (en) * | 2002-02-05 | 2006-09-05 | Corpak Medsystems, Inc. | Probiotic/prebiotic composition and delivery method |
JP2007269737A (en) * | 2006-03-31 | 2007-10-18 | Morinaga Milk Ind Co Ltd | Interleukin production regulator, pharmaceutical composition and food and drink comprising the interleukin production regulator and method for producing the same |
EP2251020A1 (en) * | 2009-05-11 | 2010-11-17 | Nestec S.A. | Short-time high temperature treatment generates microbial preparations with anti-inflammatory profiles |
CA3101218A1 (en) | 2013-03-14 | 2014-09-25 | Therabiome, Llc | Targeted gastrointestinal tract delivery of probiotic organisms and/or therapeutic agents |
US20150017208A1 (en) * | 2013-07-12 | 2015-01-15 | National Yang-Ming University | Lactic acid bacterium having immunomodulatory and anti-allergic effects |
JP6325828B2 (en) * | 2014-02-04 | 2018-05-16 | 小林 孝 | TGF-β2 inhibitor containing pulverized lactic acid bacteria (Lactococcus lactis subspecies Cremoris H-61 strain (NITE BP-01787)) as an active ingredient, and a TGF-β2 lowering drug and TGF-β2 containing the same Food for lowering |
WO2016144139A2 (en) * | 2015-03-11 | 2016-09-15 | 주식회사 엠디헬스케어 | Composition for preventing or treating inflammatory diseases, comprising lactic acid bacteria-derived extracellular vesicles as active ingredients |
EP3081227A1 (en) * | 2015-04-15 | 2016-10-19 | Institut National De La Recherche Agronomique | Lactococcus lactis producing tslp or il-25 and their uses as probiotics and therapeutics |
WO2019006534A1 (en) | 2017-07-06 | 2019-01-10 | Probionase Therapies Inc. | Probiotic-based treatment of resistant chronic rhinosinusitis |
JP2021502970A (en) | 2017-11-15 | 2021-02-04 | エヴェロ バイオサイエンシズ,インコーポレーテッド | Compositions and Methods for Treating Immune Disorders Using the Immunomodulatory Lactococcus Bacterial Strain |
-
2018
- 2018-11-15 JP JP2020526359A patent/JP2021502970A/en active Pending
- 2018-11-15 AU AU2018367596A patent/AU2018367596A1/en active Pending
- 2018-11-15 CN CN201880073835.6A patent/CN111787932A/en active Pending
- 2018-11-15 KR KR1020207017093A patent/KR20200090189A/en not_active Application Discontinuation
- 2018-11-15 MX MX2020004934A patent/MX2020004934A/en unknown
- 2018-11-15 WO PCT/US2018/061297 patent/WO2019099682A1/en unknown
- 2018-11-15 TW TW107140646A patent/TW201922270A/en unknown
- 2018-11-15 EP EP18814754.0A patent/EP3710024A1/en active Pending
- 2018-11-15 BR BR112020009133-2A patent/BR112020009133A2/en unknown
- 2018-11-15 CA CA3082578A patent/CA3082578A1/en active Pending
- 2018-11-15 US US16/192,172 patent/US11266700B2/en active Active
-
2020
- 2020-06-11 CO CONC2020/0007142A patent/CO2020007142A2/en unknown
-
2022
- 2022-01-25 US US17/583,775 patent/US20220211773A1/en not_active Abandoned
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005107484A1 (en) * | 2004-05-07 | 2005-11-17 | Friesland Brands B.V. | Dairy product with at least one characteristic of a dairy product mixture |
WO2009007515A1 (en) * | 2007-07-12 | 2009-01-15 | Valio Ltd | Lactic acid bacteria having pro-inflammatory characteristics |
Non-Patent Citations (2)
Title |
---|
Larisch, B.C. et al. 1994. Microencapsulation of Lactococcus lactis subsp. cremoris. Journal of Microencapsulation 11(2): 189-195; specif. pg. 189 * |
Looijesteijn, P.J. et al. (2000). 2000. Influence of different substrate limitations on the yield, composition and molecular mass of exopolysaccharides produced by Lactococcus lactis subsp. cremoris in continuous cultures. Journal of Applied Microbiology 89: 116-122; specif. pp. 117, 121 * |
Also Published As
Publication number | Publication date |
---|---|
US20190231829A1 (en) | 2019-08-01 |
CO2020007142A2 (en) | 2020-06-19 |
US11266700B2 (en) | 2022-03-08 |
WO2019099682A9 (en) | 2019-07-04 |
JP2021502970A (en) | 2021-02-04 |
WO2019099682A1 (en) | 2019-05-23 |
BR112020009133A2 (en) | 2020-10-13 |
CA3082578A1 (en) | 2019-05-23 |
EP3710024A1 (en) | 2020-09-23 |
KR20200090189A (en) | 2020-07-28 |
CN111787932A (en) | 2020-10-16 |
MX2020004934A (en) | 2020-12-03 |
AU2018367596A1 (en) | 2020-05-21 |
TW201922270A (en) | 2019-06-16 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10702561B2 (en) | Pharmaceutical compositions comprising a Blautia strain | |
US20220211773A1 (en) | Compositions and methods for treating immune disorders using immune modulating lactococcus bacteria strains | |
US20230405058A1 (en) | Extracellular vesicles from prevotella | |
US11090341B2 (en) | Compositions and methods for treating cancer and immune disorders using Veillonella bacteria | |
US20210052669A1 (en) | Compositions and methods for treating immune disorders using lachnospiraceae bacteria | |
AU2020291003A1 (en) | Secreted microbial extracellular vesicles | |
WO2019178487A2 (en) | Compositions and methods for treating disease using klebsiella quasipneumoniae subsp. similipneumoniae | |
WO2021146523A1 (en) | Solid dosage forms with improved disintegration profiles | |
WO2019178490A1 (en) | Compositions and methods for treating cancer and inflammation using klebsiella oxytoca | |
WO2019178494A1 (en) | Compositions and methods for treating cancer and inflammation using tyzzerella nexilis | |
US20230263838A1 (en) | Compositions and methods for treating diseases and disorders using oscillospiraceae microbial extracellular vesicles | |
WO2019075452A1 (en) | Identification of bacteria for cancer therapy | |
US20230302061A1 (en) | Compositions and methods for treating diseases and disorders using fournierella massiliensis | |
WO2022217030A1 (en) | Pharmaceutical composition containing bacteria |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
AS | Assignment |
Owner name: EVELO BIOSCIENCES, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GOODMAN, BRIAN;PONICHTERA, HOLLY;ITANO, ANDREA;AND OTHERS;SIGNING DATES FROM 20181128 TO 20190320;REEL/FRAME:060237/0851 Owner name: EVELO BIOSCIENCES, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:RAMANI, KRITIKA;REEL/FRAME:060237/0847 Effective date: 20200303 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
AS | Assignment |
Owner name: HORIZON TECHNOLOGY FINANCE CORPORATION, CONNECTICUT Free format text: SECURITY INTEREST;ASSIGNOR:EVELO BIOSCIENCES, INC.;REEL/FRAME:064274/0354 Effective date: 20230711 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |