US20220169741A1 - Methods of Engineering Surface Charge for Bispecific Antibody Production - Google Patents
Methods of Engineering Surface Charge for Bispecific Antibody Production Download PDFInfo
- Publication number
- US20220169741A1 US20220169741A1 US17/523,058 US202117523058A US2022169741A1 US 20220169741 A1 US20220169741 A1 US 20220169741A1 US 202117523058 A US202117523058 A US 202117523058A US 2022169741 A1 US2022169741 A1 US 2022169741A1
- Authority
- US
- United States
- Prior art keywords
- amino acid
- antibody
- acid residues
- heavy chain
- variable region
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000000034 method Methods 0.000 title claims abstract description 80
- 230000016784 immunoglobulin production Effects 0.000 title description 6
- 125000000539 amino acid group Chemical group 0.000 claims abstract description 188
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 101
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 101
- 229920001184 polypeptide Polymers 0.000 claims abstract description 99
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 claims abstract description 74
- 230000007423 decrease Effects 0.000 claims abstract description 44
- 238000006467 substitution reaction Methods 0.000 claims description 110
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 60
- 230000007935 neutral effect Effects 0.000 claims description 25
- 238000000926 separation method Methods 0.000 claims description 12
- 230000002708 enhancing effect Effects 0.000 claims description 6
- 230000002776 aggregation Effects 0.000 description 59
- 238000004220 aggregation Methods 0.000 description 59
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 59
- 235000001014 amino acid Nutrition 0.000 description 58
- 230000027455 binding Effects 0.000 description 48
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 41
- 206010028980 Neoplasm Diseases 0.000 description 39
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 38
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 36
- 239000000427 antigen Substances 0.000 description 32
- 102000036639 antigens Human genes 0.000 description 32
- 108091007433 antigens Proteins 0.000 description 32
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 31
- 210000004027 cell Anatomy 0.000 description 31
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 23
- 238000004458 analytical method Methods 0.000 description 23
- 230000008859 change Effects 0.000 description 23
- 201000011510 cancer Diseases 0.000 description 18
- 108090000623 proteins and genes Proteins 0.000 description 18
- 229940024606 amino acid Drugs 0.000 description 17
- 150000001413 amino acids Chemical class 0.000 description 17
- 230000004048 modification Effects 0.000 description 17
- 238000012986 modification Methods 0.000 description 17
- 230000035772 mutation Effects 0.000 description 17
- 102220497604 Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1_S71E_mutation Human genes 0.000 description 15
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 15
- 235000018102 proteins Nutrition 0.000 description 14
- 102000004169 proteins and genes Human genes 0.000 description 14
- 238000002474 experimental method Methods 0.000 description 13
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 12
- 238000000533 capillary isoelectric focusing Methods 0.000 description 12
- 102220010920 rs397507455 Human genes 0.000 description 11
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 9
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 9
- 238000012512 characterization method Methods 0.000 description 9
- 239000012634 fragment Substances 0.000 description 9
- 230000028993 immune response Effects 0.000 description 9
- 230000001965 increasing effect Effects 0.000 description 9
- 239000000178 monomer Substances 0.000 description 9
- 102000039446 nucleic acids Human genes 0.000 description 9
- 108020004707 nucleic acids Proteins 0.000 description 9
- 150000007523 nucleic acids Chemical class 0.000 description 9
- 238000000746 purification Methods 0.000 description 9
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 8
- 108010032595 Antibody Binding Sites Proteins 0.000 description 8
- 206010035226 Plasma cell myeloma Diseases 0.000 description 8
- 238000012217 deletion Methods 0.000 description 8
- 230000037430 deletion Effects 0.000 description 8
- 208000035475 disorder Diseases 0.000 description 8
- 239000000203 mixture Substances 0.000 description 8
- 241000894007 species Species 0.000 description 8
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 7
- 210000001744 T-lymphocyte Anatomy 0.000 description 7
- 230000003247 decreasing effect Effects 0.000 description 7
- 201000010099 disease Diseases 0.000 description 7
- 238000004519 manufacturing process Methods 0.000 description 7
- 239000008194 pharmaceutical composition Substances 0.000 description 7
- 230000002829 reductive effect Effects 0.000 description 7
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 6
- 239000000872 buffer Substances 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 108010074708 B7-H1 Antigen Proteins 0.000 description 5
- 208000034578 Multiple myelomas Diseases 0.000 description 5
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 230000003042 antagnostic effect Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 239000013642 negative control Substances 0.000 description 5
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 5
- 206010041823 squamous cell carcinoma Diseases 0.000 description 5
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 4
- 206010025323 Lymphomas Diseases 0.000 description 4
- 208000036142 Viral infection Diseases 0.000 description 4
- 208000009956 adenocarcinoma Diseases 0.000 description 4
- 239000005557 antagonist Substances 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 238000013357 binding ELISA Methods 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 238000005341 cation exchange Methods 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 239000003446 ligand Substances 0.000 description 4
- 230000036210 malignancy Effects 0.000 description 4
- 201000001441 melanoma Diseases 0.000 description 4
- 230000001394 metastastic effect Effects 0.000 description 4
- 206010061289 metastatic neoplasm Diseases 0.000 description 4
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 230000009385 viral infection Effects 0.000 description 4
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 3
- 208000023761 AL amyloidosis Diseases 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- 201000009030 Carcinoma Diseases 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 3
- 108010087819 Fc receptors Proteins 0.000 description 3
- 102000009109 Fc receptors Human genes 0.000 description 3
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 3
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 3
- 208000015634 Rectal Neoplasms Diseases 0.000 description 3
- 206010039491 Sarcoma Diseases 0.000 description 3
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 3
- 102100040247 Tumor necrosis factor Human genes 0.000 description 3
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 3
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 3
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 3
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 3
- 210000000887 face Anatomy 0.000 description 3
- 201000003444 follicular lymphoma Diseases 0.000 description 3
- 238000005734 heterodimerization reaction Methods 0.000 description 3
- 102000057041 human TNF Human genes 0.000 description 3
- 238000001155 isoelectric focusing Methods 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 239000012160 loading buffer Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 229960003151 mercaptamine Drugs 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 206010038038 rectal cancer Diseases 0.000 description 3
- 201000001275 rectum cancer Diseases 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 238000013207 serial dilution Methods 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- 206010073478 Anaplastic large-cell lymphoma Diseases 0.000 description 2
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 208000011691 Burkitt lymphomas Diseases 0.000 description 2
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 241000283074 Equus asinus Species 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 206010066476 Haematological malignancy Diseases 0.000 description 2
- 102220511148 Histone H3.3_G35W_mutation Human genes 0.000 description 2
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 2
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 description 2
- 208000032004 Large-Cell Anaplastic Lymphoma Diseases 0.000 description 2
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 208000021161 Plasma cell disease Diseases 0.000 description 2
- 208000008691 Precursor B-Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 208000006265 Renal cell carcinoma Diseases 0.000 description 2
- 206010068771 Soft tissue neoplasm Diseases 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 230000006044 T cell activation Effects 0.000 description 2
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 2
- 201000003761 Vaginal carcinoma Diseases 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 2
- 238000000149 argon plasma sintering Methods 0.000 description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- 239000006227 byproduct Substances 0.000 description 2
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 230000016396 cytokine production Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- VHJLVAABSRFDPM-ZXZARUISSA-N dithioerythritol Chemical compound SC[C@H](O)[C@H](O)CS VHJLVAABSRFDPM-ZXZARUISSA-N 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 201000004101 esophageal cancer Diseases 0.000 description 2
- 210000003238 esophagus Anatomy 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 201000001343 fallopian tube carcinoma Diseases 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 2
- 102000048362 human PDCD1 Human genes 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000005342 ion exchange Methods 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- 238000006317 isomerization reaction Methods 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 210000000214 mouth Anatomy 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 210000003800 pharynx Anatomy 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 230000006432 protein unfolding Effects 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 239000012146 running buffer Substances 0.000 description 2
- 210000000813 small intestine Anatomy 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 208000013013 vulvar carcinoma Diseases 0.000 description 2
- 239000003643 water by type Substances 0.000 description 2
- 230000036642 wellbeing Effects 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- IPDRTIBDOPMMIQ-VAOFZXAKSA-N 1-[(2r,4s,5r)-4-hydroxy-5-(hydroxymethyl)-2-methyloxolan-2-yl]-5-methylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(C)=CN1[C@]1(C)O[C@H](CO)[C@@H](O)C1 IPDRTIBDOPMMIQ-VAOFZXAKSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 208000036762 Acute promyelocytic leukaemia Diseases 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 206010002412 Angiocentric lymphomas Diseases 0.000 description 1
- 244000303258 Annona diversifolia Species 0.000 description 1
- 235000002198 Annona diversifolia Nutrition 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 208000006400 Arbovirus Encephalitis Diseases 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 208000036170 B-Cell Marginal Zone Lymphoma Diseases 0.000 description 1
- 208000025324 B-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000032568 B-cell prolymphocytic leukaemia Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006143 Brain stem glioma Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 208000009458 Carcinoma in Situ Diseases 0.000 description 1
- 208000017897 Carcinoma of esophagus Diseases 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 241000283153 Cetacea Species 0.000 description 1
- 241000251730 Chondrichthyes Species 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 241000709687 Coxsackievirus Species 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 101100421450 Drosophila melanogaster Shark gene Proteins 0.000 description 1
- 241001466953 Echovirus Species 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 241000709661 Enterovirus Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 108091029865 Exogenous DNA Proteins 0.000 description 1
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 1
- 108010021472 Fc gamma receptor IIB Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 241000710831 Flavivirus Species 0.000 description 1
- 102100031351 Galectin-9 Human genes 0.000 description 1
- 101710121810 Galectin-9 Proteins 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 208000005531 Immunoglobulin Light-chain Amyloidosis Diseases 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 102100030703 Interleukin-22 Human genes 0.000 description 1
- 102000013264 Interleukin-23 Human genes 0.000 description 1
- 108010065637 Interleukin-23 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 241000701460 JC polyomavirus Species 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- 239000004201 L-cysteine Substances 0.000 description 1
- 235000013878 L-cysteine Nutrition 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 208000002030 Merkel cell carcinoma Diseases 0.000 description 1
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 206010028811 Natural killer-cell leukaemia Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 1
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 1
- 201000005746 Pituitary adenoma Diseases 0.000 description 1
- 206010061538 Pituitary tumour benign Diseases 0.000 description 1
- 208000007452 Plasmacytoma Diseases 0.000 description 1
- 208000009052 Precursor T-Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 206010065857 Primary Effusion Lymphoma Diseases 0.000 description 1
- 208000024588 Primary cutaneous follicle center lymphoma Diseases 0.000 description 1
- 206010036711 Primary mediastinal large B-cell lymphomas Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 208000035416 Prolymphocytic B-Cell Leukemia Diseases 0.000 description 1
- 208000033766 Prolymphocytic Leukemia Diseases 0.000 description 1
- 208000033826 Promyelocytic Acute Leukemia Diseases 0.000 description 1
- 241000125945 Protoparvovirus Species 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 208000029052 T-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- 102220483110 TLC domain-containing protein 4_N75D_mutation Human genes 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 208000024447 adrenal gland neoplasm Diseases 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 208000015230 aggressive NK-cell leukemia Diseases 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 230000006229 amino acid addition Effects 0.000 description 1
- 238000012436 analytical size exclusion chromatography Methods 0.000 description 1
- 238000005349 anion exchange Methods 0.000 description 1
- 210000000436 anus Anatomy 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 239000010425 asbestos Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 229960003852 atezolizumab Drugs 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 229950002916 avelumab Drugs 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 201000009036 biliary tract cancer Diseases 0.000 description 1
- 208000020790 biliary tract neoplasm Diseases 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 229960001714 calcium phosphate Drugs 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000012832 cell culture technique Methods 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000005889 cellular cytotoxicity Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 201000007455 central nervous system cancer Diseases 0.000 description 1
- 208000025997 central nervous system neoplasm Diseases 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 208000009060 clear cell adenocarcinoma Diseases 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 201000010918 connective tissue cancer Diseases 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 208000017763 cutaneous neuroendocrine carcinoma Diseases 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 150000001945 cysteines Chemical class 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 229950009791 durvalumab Drugs 0.000 description 1
- -1 e.g. Proteins 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 210000000750 endocrine system Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 1
- 208000024519 eye neoplasm Diseases 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 238000001641 gel filtration chromatography Methods 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 229960001743 golimumab Drugs 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000025750 heavy chain disease Diseases 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 102000049109 human HAVCR2 Human genes 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000003463 hyperproliferative effect Effects 0.000 description 1
- 230000003100 immobilizing effect Effects 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000012482 interaction analysis Methods 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 108010074109 interleukin-22 Proteins 0.000 description 1
- 230000009878 intermolecular interaction Effects 0.000 description 1
- 208000020082 intraepithelial neoplasia Diseases 0.000 description 1
- 208000026876 intravascular large B-cell lymphoma Diseases 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 201000004962 larynx cancer Diseases 0.000 description 1
- 230000021633 leukocyte mediated immunity Effects 0.000 description 1
- 210000000088 lip Anatomy 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 230000001050 lubricating effect Effects 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 201000008443 lung non-squamous non-small cell carcinoma Diseases 0.000 description 1
- 230000000527 lymphocytic effect Effects 0.000 description 1
- 208000006116 lymphomatoid granulomatosis Diseases 0.000 description 1
- 201000007919 lymphoplasmacytic lymphoma Diseases 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 201000007924 marginal zone B-cell lymphoma Diseases 0.000 description 1
- 208000021937 marginal zone lymphoma Diseases 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- 208000021039 metastatic melanoma Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000007837 multiplex assay Methods 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 201000005443 oral cavity cancer Diseases 0.000 description 1
- 210000004789 organ system Anatomy 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 239000003002 pH adjusting agent Substances 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 210000002990 parathyroid gland Anatomy 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000013618 particulate matter Substances 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 208000021310 pituitary gland adenoma Diseases 0.000 description 1
- 208000031223 plasma cell leukemia Diseases 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 208000017805 post-transplant lymphoproliferative disease Diseases 0.000 description 1
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 1
- 208000022256 primary systemic amyloidosis Diseases 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 201000005825 prostate adenocarcinoma Diseases 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000000306 recurrent effect Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 229910052895 riebeckite Inorganic materials 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 235000004400 serine Nutrition 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 230000003393 splenic effect Effects 0.000 description 1
- 208000017572 squamous cell neoplasm Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 235000008521 threonine Nutrition 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 210000002105 tongue Anatomy 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 230000005747 tumor angiogenesis Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000013060 ultrafiltration and diafiltration Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2875—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/06—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies from serum
- C07K16/065—Purification, fragmentation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2839—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily
- C07K16/2848—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the integrin superfamily against integrin beta3-subunit-containing molecules, e.g. CD41, CD51, CD61
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/567—Framework region [FR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present disclosure relates to methods of engineering surface charge to enhance bispecific antibody production.
- Antibody-based therapeutics have been used successfully to treat a variety of diseases, including cancer and autoimmune/inflammatory disorders. Yet improvements to this class of drugs are still needed, particularly with respect to enhancing their clinical efficacy.
- One avenue being explored is the engineering of additional and novel antigen binding sites into antibody-based drugs such that a single immunoglobulin molecule co-engages two different antigens. Such alternate antibody formats that engage two different antigens are often referred to as bispecific antibodies.
- bispecific antibodies Due to their unique mechanisms of action, bispecific antibodies have received increasing attention as biotherapeutic candidates.
- production of IgG type bispecific antibodies involved the introduction of four nucleic acid molecules into cells, e.g., nucleic acid molecules encoding the heavy and light chain polypeptides of a first antibody specific to a given antigen, and nucleic acid molecules encoding the heavy and light chain polypeptides of a second antibody specific to a different antigen.
- expression of nucleic acid molecules encoding the two heavy chains and two light chains, and the generally random association between the two different heavy chains, and the heavy and light chains resulted in a small proportion of the antibodies produced having the desired combination of heavy and light chains.
- the change in pI is engineered by the introduction of one or more specific amino acid substitutions in the constant and/or variable regions of the antibody.
- the desired bispecific antibody can be more readily purified from the parental monospecific homodimeric antibodies using cation exchange.
- U.S. Patent Publication No. 20140294823 to Moore et al. describes a similar approach where specific amino acid substitutions in the heavy chain constant region of one of the parental antibodies creates a heterodimeric antibody where the two heavy chains have a different isoelectric point (pI).
- One aspect of the disclosure is directed to a method of modifying the isoelectric point of an antibody.
- the method involves providing an antibody comprising a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, and substituting, in at least one of the first and second polypeptides of the antibody, one or more amino acid residues of the heavy chain variable region (V H ) at positions 7, 9, 11, 14, 41, 70, 74, 82a, 84, and 113, according to the Kabat numbering system, wherein the substituting increases or decreases the isoelectric point of the antibody.
- V H heavy chain variable region
- a second aspect of the disclosure is directed to an antibody having a modified isoelectric point produced by the methods described herein.
- a third aspect of the disclosure is directed to a method of enhancing separation of a bispecific antibody from its two parental antibodies.
- This method includes providing a first and second parental antibody, each parental antibody comprising a heavy chain variable region, and substituting, in at least one of the first and second parental antibodies, one or more amino acid residues in the heavy chain variable region (VH) at positions 7, 9, 11, 14, 41, 70, 74, 82a, 84, and 113, according to the Kabat numbering system, where the substituting increases or decreases the isoelectric point of the first parental antibody relative to the second parental antibody.
- This method further involves producing the bispecific antibody from the two parental antibodies after the substituting, and separating the produced bispecific antibody from its two parental antibodies, where the separation of the bispecific antibody is enhanced as a result of the substitutions.
- a fourth aspect of the disclosure is directed to a multi-specific antibody that includes a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is less than the isoelectric point of the second polypeptide.
- one or more amino acid residues at positions 9, 70, 74, 82a, and 84 (Kabat numbering) of the heavy chain variable region of the first polypeptide comprise a neutral or negatively charged amino acid residue and one or more amino acid residues at the corresponding positions of the heavy chain variable region of the second polypeptide comprise a differentially charged amino acid residue when compared to the first polypeptide.
- a fifth aspect of the disclosure is directed to a multi-specific antibody that includes a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is higher than the isoelectric point of the second polypeptide.
- one or more amino acid residues at positions 7, 9, 11, 14, 41, 74, 84, and 113 (Kabat numbering) of the heavy chain variable region of the first polypeptide comprise a neutral or positively charged amino acid residue and one or more amino acid residues at the corresponding positions of the heavy chain variable region of the second polypeptide comprise a differentially charged amino acid residue when compared to the first polypeptide.
- FIGS. 1A-1C are graphs of human TNF ⁇ binding ELISA of CNTO148 antibody single substitution variants.
- FIG. 1A shows TNF ⁇ binding of the S75D and N84D antibody variants as compared to wildtype (148 WT and CNTO148).
- FIG. 1B shows TNF ⁇ binding of the A88D antibody variant compared to wildtype.
- FIG. 1C shows TNF ⁇ binding of the G9E and S71E antibody variants compared to wildtype.
- CNTO95 antibody binding to TNF ⁇ is shown as a negative control.
- FIGS. 2A-2C shows analytical size exclusion high performance liquid chromatography (SE-HPLC) analysis of CNTO148 single substitution variants.
- FIG. 2A shows the SE-HPLC profile of the CNTO148 wildtype antibody
- FIG. 2B shows the SE-HPLC profile of the N84D variant
- FIG. 2C shows the SE-HPLC profile of the S75D variant.
- FIGS. 3A-3B shows analytical SE-HPLC analysis of CNTO148 wildtype and A88D variant.
- FIG. 3A shows the SE-HPLC profile of the CNTO148 wildtype antibody
- FIG. 2B shows the SE-HPLC profile of the A88D variant.
- FIGS. 4A-4C shows analytical SE-HPLC analysis of CNTO148 wildtype, G9E, and S71E variants.
- FIG. 4A shows the SE-HPLC profile of the CNTO148 wildtype antibody
- FIG. 4B shows the SE-HPLC profile of the G9E variant
- FIG. 4C shows the SE-HPLC profile for the S71E variant.
- FIGS. 5A-5C are graphs showing onset of aggregation (colloidal stability) analysis of CNTO148 single substitution variants.
- FIG. 5A shows the onset of aggregation for the CNTO148 wildtype occurring at 63.9° C.
- FIG. 5B shows the onset of aggregation for the S75D variant antibody occurring at 66.8° C.
- FIG. 5C shows the onset of aggregation for the N84D variant occurring at 65.8° C.
- FIGS. 6A and 6B are graphs showing onset of aggregation (colloidal stability) analysis of CNTO148 wildtype and A88D variant.
- FIG. 6A shows that the onset of aggregation for the wildtype occurs at 67.6° C.
- FIG. 6B shows the onset of aggregation for the A88D variant occurs at 66.9° C.
- FIGS. 7A-7C are graphs showing onset of aggregation (colloidal stability) analysis of CNTO148 wildtype, G9E, and S71E variants.
- FIG. 7A shows that the onset of aggregation for the wildtype occurs at 68.6° C.
- FIG. 7B shows the onset of aggregation for the G9E variant occurs at 65.7° C.
- FIG. 7C shows the onset of aggregation for the S71E variant occurs at 69.5° C.
- FIGS. 8A-8C are graphs showing temperature of unfolding (conformational stability) analysis of CNTO148 single substitution variants.
- FIG. 8A shows the unfolding temperature for the wildtype occurs at 63.9° C.
- FIG. 8B shows the unfolding temperature for the S75D variant occurs at 67.3° C.
- FIG. 8C shows the unfolding temperature for the N84D variant occurs at 65.3° C.
- FIGS. 9A and 9B are graphs showing the temperature of unfolding (conformational stability) analysis of CNTO148 wildtype and A88D variant.
- FIG. 9A shows the unfolding temperature for the wildtype occurs at 67.3° C.
- FIG. 9B shows the unfolding temperature for the A88D variant occurs at 66.9° C.
- FIGS. 10A-10C are graphs showing the temperature of unfolding (conformational stability) analysis of CNTO148 wildtype, G9E, and S71E variants.
- FIG. 10A shows the unfolding temperature for the wildtype occurs at 68.8° C.
- FIG. 10B shows the unfolding temperature for the G9E variant occurs at 65.8° C.
- FIG. 10C shows the unfolding temperature for the S71E variant occurs at 69.5° C.
- FIG. 11 is a graph of human ⁇ V ⁇ 3 binding ELISA of CNTO95 antibody single substitution variants.
- FIG. 11 shows ⁇ V ⁇ 3 binding of the S7R, G9R, V11R, P14R, P41R, S71K, A88R, and S119R antibody variants compared to CNTO95 wildtype.
- CNTO148 antibody binding to ⁇ V ⁇ 3 is shown as a negative control.
- FIGS. 12A-12I shows analytical size exclusion high performance liquid chromatography (SE-HPLC) analysis of CNTO95 single substitution variants.
- FIG. 12A shows the SE-HPLC profile of the CNTO95 wildtype antibody
- FIG. 12B shows the SE-HPLC profile of the S7R variant
- FIG. 12C shows the SE-HPLC profile of the G9R variant
- FIG. 12D shows the SE-HPLC profile of the V11R variant
- FIG. 12E shows the SE-HPLC profile of the P14R variant
- FIG. 12F shows the SE-HPLC profile of the P41R variant
- FIG. 12G shows the SE-HPLC profile of the S71K variant
- FIG. 12H shows the SE-HPLC profile of the A88R variant
- FIG. 12I shows the SE-HPLC variant of the S119R variant.
- FIGS. 13A-13I are graphs showing onset of aggregation (colloidal stability) analysis of CNTO95 single substitution variants.
- FIG. 13A shows the onset of aggregation for the CNTO95 wildtype occurring at 68.2° C.
- FIG. 13B shows the onset of aggregation for the S7R variant antibody occurring at 67.2° C.
- FIG. 13C shows the onset of aggregation for the G9R variant occurring at 57.9° C.
- FIG. 13D shows the onset of aggregation for the V11R variant occurring at 63.9° C.
- FIG. 13E shows the onset of aggregation for the P14R variant occurring at 63.5° C.
- FIG. 13A shows the onset of aggregation for the CNTO95 wildtype occurring at 68.2° C.
- FIG. 13B shows the onset of aggregation for the S7R variant antibody occurring at 67.2° C.
- FIG. 13C shows the onset of
- FIG. 13F shows the onset of aggregation for the P41R variant occurring at 66.4° C.
- FIG. 13G shows the onset of aggregation for the S71K variant occurring at 64.9° C.
- FIG. 13H shows the onset of aggregation for the A88R variant occurring at 67.6° C.
- FIG. 13I shows the onset of aggregation for the S119R variant occurring at 66.7° C.
- FIGS. 14A-14I are graphs showing the temperature of unfolding (conformational stability) analysis of CNTO95 single substitution variants.
- FIG. 14A shows the unfolding temperature for the wildtype occurs at 68.8° C.
- FIG. 14B shows the unfolding temperature for the S7R variant occurs at 67.9° C.
- FIG. 14C shows the unfolding temperature for the G9R variant occurs at 59.4° C.
- FIG. 14D shows the unfolding temperature for the V11R variant occurs at 64.8° C.
- FIG. 14E shows the unfolding temperature for the P14R variant occurs at 64.3° C.
- FIG. 14F shows the unfolding temperature for the P41R variant occurs at 66.8° C.
- FIG. 14A shows the unfolding temperature for the wildtype occurs at 68.8° C.
- FIG. 14B shows the unfolding temperature for the S7R variant occurs at 67.9° C.
- FIG. 14C shows the unfolding temperature for the G9R variant occurs at 59
- FIG. 14G shows the unfolding temperature for the S71K variant occurs at 65.8° C.
- FIG. 14H shows the unfolding temperature for the A88R variant occurs at 68.0° C.
- FIG. 14I shows the unfolding temperature for the S119R variant occurs at 67.6° C.
- FIG. 15 shows human TIM3 binding ELISA of anti-TIM3 antibody single substitution variants.
- FIGS. 16A-16D shows analytical SE-HPLC analysis of anti-TIM3 single substitution variants.
- FIG. 16A shows the SE-HPLC profile of the TIM3 S75D variant
- FIG. 16B shows the SE-HPLC profile of the TIM3 wildtype
- FIG. 16C shows the SE-HPLC profile of the TIM3 N84D variant
- FIG. 16D shows the SE-HPLC variant of the TIM3 A88D variant.
- FIGS. 17A-17D shows onset of aggregation (colloidal stability) analysis of anti-TIM3 single substitution variants.
- FIG. 17A shows the onset of aggregation for the S75D variant occurs at 67.5° C.
- FIG. 17B shows the onset of aggregation for the N84D variant occurs at 68.2° C.
- FIG. 17C shows the onset of aggregation for the A88D variant occurs at 66.7° C.
- FIG. 17D shows the onset of aggregation for the wildtype occurs at 68.5° C.
- FIG. 18 shows PD1 binding kinetics for anti-PD1 single substitution variants as determined by SPR.
- FIGS. 19A-19D show analytical SE-HPLC analysis of anti-PD1 antibody single substitution variants.
- FIG. 19A shows the SE-HPLC profile of the PD1 S75D variant
- FIG. 19B shows the SE-HPLC profile of the PD1 wildtype
- FIG. 19C shows the SE-HPLC profile of the PD1 S84D variant
- FIG. 19D shows the SE-HPLC variant of the PD1 S88D variant.
- FIGS. 20A-20D show onset of aggregation (colloidal stability) analysis of anti-PD1 single substitution variants.
- FIG. 20A shows the onset of aggregation for the S75D variant occurs at 66.6° C.
- FIG. 20B shows the onset of aggregation for the S84D variant occurs at 66.1° C.
- FIG. 20C shows the onset of aggregation for the S88D variant occurs at 66.5° C.
- FIG. 20D shows the onset of aggregation for the wildtype occurs at 65.7° C.
- FIG. 21 shows human TNF binding ELISA of CNTO148 antibody substitution combination variants.
- FIGS. 22A-22E show analytical size exclusion chromatography analysis of CNTO148 combination variants.
- FIG. 22A shows the SE-HPLC profile of the CNTO148 wildtype
- FIG. 22B shows the SE-HPLC profile of the CNTO148 N84D/A88D variant
- FIG. 22C shows the SE-HPLC profile of the CNTO148 S75D/A88D variant
- FIG. 22D shows the SE-HPLC variant of the CNTO148 N75D/N84D/A88D variant
- FIG. 22E shows the SE-HPLC profile of the CNTO148 S75D/N84D variant.
- FIGS. 23A-23E show onset of aggregation (colloidal stability) analysis of a CNTO148 combination variants.
- FIG. 23A shows the onset of aggregation for the CNTO148 N84D/A88D variant occurs at 66.8° C.
- FIG. 23B shows the onset of aggregation for the CNTO148 S75D/A88D variant occurs at 66.8° C.
- FIG. 23C shows the onset of aggregation for the S75D/N84D/A88D variant occurs at 67.2° C.
- FIG. 23D shows the onset of aggregation for the S75D/N84D variant occurs at 67.1° C.
- FIG. 23E shows the onset of aggregation for wildtype occurs at 66.5° C.
- FIGS. 24A-24E are graphs showing temperature of unfolding (conformational stability) analysis of CNTO148 multiple substitution variants.
- FIG. 24A shows the unfolding temperature for the wildtype occurs at 66.4° C.
- FIG. 24B shows the unfolding temperature for the N84D/A88D variant occurs at 67.1° C.
- FIG. 24C shows the unfolding temperature for the S75D/A88D variant occurs at 66.8° C.
- FIG. 24D shows the unfolding temperature for the S75D/N84D/A88D variant occurs at 66.9° C.
- FIG. 24E shows the unfolding temperature for the S75D/N84D variant occurs at 67.3° C.
- the present disclosure generally relates to methods of engineering surface charge to enhance multi-specific antibody production and purification.
- the present disclosure also relates to antibodies generated using the methods of the invention.
- the present disclosure also relates to anti-PD1 and anti-TIM3 antibodies and bispecific PD-1 ⁇ TIM3 antibodies generated herein, and to methods of making and using them.
- the generated anti-PD-1, anti-TIM3 and the bispecific PD-1 ⁇ TIM3 antibodies are useful as diagnostic and therapeutic agents.
- one aspect of the present invention is directed to a method of modifying the isoelectric point of an antibody.
- This method involves providing an antibody comprising a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region.
- the method further involves substituting, in at least one of the first and second polypeptides of the antibody, one or more amino acid residues of the heavy chain variable region (V H ) at positions 7, 9, 11, 14, 41, 70, 74, 82a, 84, and 113, according to the Kabat numbering system, where the substituting increases or decreases the isoelectric point of the antibody.
- antibody is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies and smaller molecules derived therefrom) and polyclonal antibodies.
- the term “antibody” also encompasses monovalent and multi-valent antibodies, e.g., bivalent antibodies, trivalent antibodies, and tetravalent antibodies.
- the term “antibody” also encompasses monospecific and multispecific antibodies, e.g., bispecific antibodies, trispecific antibodies, tetraspecific antibodies.
- a multi-specific antibody is an antibody capable of binding to two or more different antigens or two different epitopes of the same antigen. Accordingly, the method of modifying the isoelectric point of an antibody as described herein is applicable to a broad variety of antibodies
- the antibody modified in accordance with the method described herein is an immunoglobulin (Ig) molecule and comprises at least two polypeptide chains, i.e., two heavy (H) chains.
- Ig heavy chains Five types of mammalian Ig heavy chains are known: ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , wherein the type of heavy chain defines the class (isotype) of the antibody.
- Antibodies of the disclosure can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA), and subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2).
- the heavy chain may comprise the variable region (V H ) alone, or the variable region and the constant region (C H ).
- the antibody modified in accordance with the method described herein may further comprise two light (L) chains.
- a light chain i.e., lambda ( ⁇ ) and kappa ( ⁇ ) light chains
- V L variable region
- C L constant region
- the antibody comprises heavy chain and light chain variable regions fused together to form a single-chain variable domain antibody (scFv) or a single-chain variable domain with an Fc portion (i.e., a scFv-Fc, e.g., a minibody).
- the antibody fragment is a divalent or bivalent single-chain variable fragment, engineered by linking two scFvs together either in tandem (i.e., tandem scFv), or such that they dimerize to form diabodies.
- the antibody is a trivalent single chain variable fragment, engineered by linking three scFvs together, either in tandem or in a trimer formation to form triabodies.
- the antibody is a tetrabody single chain variable fragment.
- the antibody is a “linear antibody” which is an antibody comprising a pair of tandem Fd segments (V H -C H 1-V H -C H 1) that form a pair of antigen binding regions (see Zapata et al. Protein Eng. 8(10):1057-1062 (1995), which is hereby incorporated by reference in its entirety).
- the method described herein is also suitable for modifying the isoelectric point of chimeric antibodies (i.e., an antibody where one portion of the amino acid sequence of each of the heavy and light chains is homologous to corresponding sequences in an antibody derived from a particular species or belonging to a particular class, while the remaining segment of each chain is homologous to corresponding sequences in another species or class), CDR-grafted antibodies (i.e., antibodies which comprise heavy and light chain variable region sequences of one species, where one or more of the CDR regions are replaced with CDR regions of another species), and humanized antibodies.
- chimeric antibodies i.e., an antibody where one portion of the amino acid sequence of each of the heavy and light chains is homologous to corresponding sequences in an antibody derived from a particular species or belonging to a particular class, while the remaining segment of each chain is homologous to corresponding sequences in another species or class
- CDR-grafted antibodies i.e., antibodies which comprise heavy and light chain variable region sequences of one species, where one
- Antibodies suitable for modification in accordance with the methods disclosed herein are preferably human antibodies or humanized antibodies (fully or partially humanized) as described supra.
- the antibodies can be animal antibodies such as, but not limited to, a bird antibody, a shark antibody, a whale antibody, or a mammal, including a non-primate antibody (for example, a cow, a pig, a camel, a llama, a horse, a goat, a rabbit, a sheep, a hamster, a guinea pig, a cat, a dog, a rat, a mouse, etc.) or a non-human primate antibody (for example, a monkey, a chimpanzee, etc.).
- a non-primate antibody for example, a cow, a pig, a camel, a llama, a horse, a goat, a rabbit, a sheep, a hamster, a guinea pig, a cat,
- the methods described herein involve modifying the isoelectric point of an antibody.
- the isoelectric point (pI) of an antibody is the pH at which the antibody carries no net electrical charge.
- the isoelectric point of an antibody or any polypeptide is determined by its amino acid composition. For example, a polypeptide having a high number of basic amino acid residues will have a high pI, whereas a polypeptide having a high number of acidic amino acid residues will have a low pI.
- the methods of the present invention involve modifying the amino acid composition of the antibody to modify its pI. More specifically, the methods described herein involve modifying one or more amino acid residues within at least one heavy chain variable region of the antibody to modify the pI of the antibody.
- amino acid composition of a heavy chain variable region of an antibody can be modified by amino acid insertion, deletion, or substitution.
- An amino acid “substitution” encompasses the replacement of an amino acid residue at a particular position in a polypeptide sequence with a different amino acid.
- the substitution involves substitution of amino acid residue that is not naturally occurring at the particular position, either not naturally occurring within the organism or in any organism.
- the one or more substitutions may be amino acid residues that are frequently occurring residues in sequences of similar related polypeptides in the same organism, e.g., conserved amino acid residues that occur frequently in sequences from other antibodies from the same species.
- Substitutions with conserved residues from naturally occurring sequences from the same species, e.g., human sequences, can reduce the chances of increased antigenicity for the polypeptides harboring the one or more substitutions.
- conservation of charge e.g., relatively higher frequency of the same positively charged, negatively charged, or uncharged species
- sequences from related polypeptides in the same organism is also considered in making the amino acid residue selections for substitution.
- charge considerations can have an impact on maintaining the structure and/or stability of the antibody that comprises the one or more amino acid substitutions.
- the amino acid substitutions involve substituting an amino acid residue having a positive or negative charge with an amino acid residue having a neutral charge or vice versa.
- substitutions include, but are not limited to: (1) substitution of a neutrally charged amino acid for a positively charged amino acid to increase the pI; (2) substitution of a negatively charged amino acid for a neutral or positively charged amino acid to increase the pI; (3) substitution of a neutrally charged amino acid for a negatively charged amino acid to decrease the pI; and (4) substitution of a positively charged amino acid with a neutral or negatively charged amino acid to decrease the pI.
- An amino acid “deletion” includes the removal of one or more amino acid residues to modify the isoelectric point of the antibody, whereas an amino acid “insertion” involves the addition of one or more amino acid residues to modify the isoelectric point of the antibody.
- Exemplary deletions include, but are not limited to, deletion of a negatively charge amino acid residue to increase the pI or deletion of a positively charge amino acid residue to decrease the pI.
- Suitable amino acid additions include, but are not limited to, addition of a positive amino acid residue to increase the pI of the antibody or an addition of a negative amino acid residue to decrease the pI of the antibody.
- Amino acid residues known in the art to possess a positive charge include, without limitation, those having a basic side chain, e.g., lysine (K), arginine (R), and histidine (H).
- Amino acid residues known in the art to possess a negative charge include, without limitation, those having an acidic side chain, e.g., glutamic acid (E) and aspartic acid (D).
- Amino acid residues having uncharged side chains are considered neutral, e.g., serine, threonine, asparagine, glutamine, cysteine, glycine, proline, alanine, valine, isoleucine, leucine, methionine, phenylalanine, tyrosine, and tryptophan.
- substitutions, insertion, or deletions often involve gene manipulation or mutagenesis that modifies the original nucleic acid molecule encoding the polypeptide to be modified by inserting, deleting, or substituting at least one nucleotide, to produce a codon that encodes an amino acid residue of interest. More specifically, a codon encoding the original amino acid residue is replaced by a codon encoding the amino acid residue to be introduced by the modification.
- nucleic acid modifications can be carried out by those of skill in the art using well known techniques such as site-directed mutagenesis or PCR mutagenesis.
- the amino acid substitutions, insertions, or deletions are introduced into one or more of the heavy chain polypeptides of the antibody of interest.
- the amino acid substitutions, insertions, or deletions are introduced in the heavy chain variable region of the antibody of interest.
- the variable region of the heavy chain is subdivided into regions of hypervariability, termed complementarity determining regions (CDR).
- CDR complementarity determining regions
- the three CDRs in the variable regions of the heavy chain are designated CDR1, CDR2 and CDR3 for each of the variable regions.
- the CDRs are interspersed with more conserved regions termed framework regions (FR).
- Each V H is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md.
- the isoelectric point of an antibody is modified by substituting, in at least one of the antibody's heavy chain variable regions, at least one amino acid residue where the amino acid residue is at position 7, 9, 11, 14, 41, 70, 74, 82a, 84, and/or 113, Kabat numbering, in the heavy chain variable region.
- the number of amino acid residues that undergo modification is not particularly limited.
- one amino acid substitution sufficiently modifies the isoelectric point of the antibody.
- two amino acid substitutions sufficiently modify the isoelectric point of the antibody.
- three, or four, or five, or six, or seven, or eight, or nine, or ten amino acid substitutions are required to sufficiently modify the isoelectric point of the antibody.
- the one or more amino acid residues of the V H at positions 7, 9, 11, 14, 41, 74, 84, and/or 113 are neutrally charged amino acid residues
- the substitution step comprises exchanging the one or more neutrally charged amino acid residues with one or more positively charged amino acid residues. This substitution will increase the isoelectric point of the antibody relative to the antibody in its unmodified state (i.e., the parental or wildtype antibody).
- the one or more amino acid residues of the V H at positions 7, 9, 11, 14, 41, 74, 84, and/or 113 are negatively charged amino acid residues
- the substitution step comprises exchanging said one or more negatively charged amino acid residues with one or more neutral or positively charged amino acid residues. This substitution will also increase the isoelectric point of the antibody relative to the isoelectric point of the antibody in its unmodified state.
- the one or more amino acid residues of the V H at positions 9, 70, 74, 82a, and 84 are neutrally charged amino acid residues
- the substitution step comprises exchanging said one or more neutrally charged amino acid residues with one or more negatively charged amino acid residues. This substitution will decrease the isoelectric point of the antibody relative to the isoelectric point of the unmodified, parental antibody.
- the one or more amino acid residues of the V H at positions 9, 70, 74, 82a and 84 are positively charged amino acid residues
- the substituting comprises exchanging said one or more positively charged amino acid residues with one or more neutral or negatively charged amino acid residues. This substitution will decrease the isoelectric point of the antibody relative to the isoelectric point of the unmodified, parental antibody.
- amino acid substitutions can be introduced at 1, 2, 3, 4, 6, 7, 8, 9, or 10 of the identified residues within the heavy chain variable region.
- the number of amino acid substitutions introduced is dependent on the magnitude of change or difference in isoelectric point that is desired, i.e., 0.1 pH unit change, 0.2 pH unit change, 0.3 pH unit change, 0.4 pH unit change, 0.5 pH unit change, 0.6 pH unit change, 0.7 pH unit change, 0.8 pH unit change, 0.9 pH unit change, 1.0 pH unit change, or greater than 1.0 pH unit change.
- a change or difference in the isoelectric point of the modified antibody can be observed using isoelectric focusing.
- Isoelectric focusing is an electrophoretic technique that separates proteins by their isoelectric point.
- Proteins can be applied to a polyacrylamide gel (IEF gels) or immobilized pH gradient (IPG) strips containing a fixed pH gradient.
- IPF gels polyacrylamide gel
- IPG immobilized pH gradient
- An electrical field is applied and the protein migrates through the pH gradient, becoming immobilized in the pH gradient as they approach their specific pI.
- a theoretical isoelectric point can be determined using gene and amino acid sequence analysis software (GENETYX and the like). This is useful when considerable modification of the isoelectric point is necessary, for example, for sufficient separation of bispecific antibodies from parental antibodies.
- the substitution comprises exchanging the V H amino acid residue at position 74 (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- the substitution comprises exchanging the V H amino acid residue at position 82a (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- the substitution comprises exchanging the V H amino acid residue at position 84 (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- the substitution comprises exchanging the V H amino acid residue at at least two of the positions selected from positions 74, 82a, and 84 (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- the substitution comprises exchanging the V H amino acid residue at all three positions 74, 82a, and 84 (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- the amino acid substitutions made to an antibody to modify its isoelectric point do not alter its antigen binding capacity, i.e., the modified antibody retains the antigen-binding activity of the unmodified wildtype or parental antibody.
- “retains the antigen-binding activity” means the antibody maintains at least 75%, at least 80% or more, 85% or more, 90% or more, 95% or more, i.e., 96%, 97%, 98%, 99%, or 100% of the antigen binding activity of the antibody before modification. As long as sufficient binding activity for binding to the antigen can be retained for the antibody to exert its function, the affinity determined at 37° C.
- a polypeptide comprising an antibody variable region with a modified isoelectric point obtained by the methods described herein retains the antigen-binding activity can be tested using methods that are well known to those of skill in the art, such as, but not limited to, Biacore (intermolecular interaction analysis), cell proliferation assay, ELISA (enzyme-linked immunosorbent assay), EIA (enzyme immunoassay), RIA (radioimmunoassay), and fluorescence immunoassay.
- the amino acid substitutions made to an antibody to modify its isoelectric point do not alter the antibody's stability, e.g., its conformation stability.
- the modified antibody exhibits substantially the same stability of the unmodified wildtype or parental antibody.
- substantially the same stability means that the modified protein has a less than 25% change in stability, less than 20% change in stability, less 15% change in stability, less than 10% change in stability, less than 5%, 4%, 3%, 2%, or 1% change in stability.
- Parameters that can be measured as indicators of antibody stability include, but are not limited to, unfolding transition temperature, aggregation onset temperature, and rates of aggregation.
- Other parameters of antibody stability that can be measured include in vitro serum stability, degradation levels, biological activity, pH, color, clarity, chemical stability, and physical stability.
- the antibody having a modified isoelectric point is a monospecific antibody.
- the first and second polypeptides, each comprising a heavy chain variable region of the parental monospecific antibody are the same, and the same substitutions to the one or more identified amino acid residue positions (i.e., residues 7, 9, 11, 14, 41, 70, 74, 82a, 84, and/or 113) are made in both the first and second heavy chain polypeptides to generate a variant antibody having an isoelectric point that is different than the isoelectric point of the parental antibody.
- CNTO148 the monoclonal antibody that binds TNF ⁇ known as CNTO148.
- the heavy chain variable region of the CNTO148 antibody was modified at Kabat residues 74, 82a, and 84, which correspond to residues 75, 84, and 88, respectively of the SEQ ID NO: 1 (shown below) to decrease its isoelectric point.
- CNT0148 heavy chain variable region (C14F1)- SEQ ID NO: 1 QVQLVESGGGVVQPGRSLRLSCAASGFIFSSYAMEIWVRQAPGNGLEWV AFMSYDGSNKKYADSVKGRFTISRDN[ S / D ]KNTLYLQM[ N / D ]SLR [ A / D ]EDTAVYYCARDRGIAAGGNYYYYGMDVWGQGTTVTVSS
- the serine residue at position 75 of SEQ ID NO: 1 was substituted with an aspartic acid residue (S75D)
- the asparagine residue at position 84 of SEQ ID NO: 1 was substituted with an aspartic acid residue (N84D)
- the alanine residue at position 88 of SEQ ID NO: 1 was substituted with an aspartic acid residue (A88D) to decrease the isoelectric point of the CNTO148 antibody.
- These amino acid substitutions had no effect on antigen binding capabilities of the CNTO148 antibody (see FIGS. 1A, 1B and 1C ).
- TIMB337 Another monospecific antibody that has been modified using the methods described herein is the monoclonal antibody that binds TIM3 (CD366) known as TIMB337.
- CD366 the monoclonal antibody that binds TIM3
- TIMB337 antibody T3H24 HC
- TM3H24 HC the heavy chain variable region of the TIMB337 antibody
- TIMB337 comprises a light chain variable region of SEQ ID NO: 5.
- TIMB377 heavy chain variable region (TM3H24)- SEQ ID NO: 2 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAM SWVRQAPGKGLEWV SAISGSGGSTYYADSVKGRFTISRDN[ S / D ]KNTLYLQM[ N / D ]SLR [ A / D ]EDTAVYYCAKSPYAPLDYWGQGTLVTVSS, TIMB377 light chain variable region- SEQ ID NO: 5 EIVLTQSPATLSLSPGERATLSCRASQSVNDYLAWYQQKPGQAPRLLIY DASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQGGHAPITF GQGTKVEIK
- the serine residue at position 75 of SEQ ID NO: 2 was substituted with an aspartic acid residue (S75D)
- the asparagine residue at position 84 of SEQ ID NO: 2 was substituted with an aspartic acid residue (N84D)
- the alanine residue at position 88 of SEQ ID NO: 2 was substituted with an aspartic acid residue (A88D) to decrease the isoelectric point of the TIMB337 antibody.
- These amino acid substitutions had no effect on antigen binding capabilities of the TIMB337 antibody (see FIG. 15 ).
- the amino acid sequences of TIMB337 VH variants are shown below.
- SEQ ID NO: 6 S75D variant of TM3B337 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS AISGSGGSTYYADSVKGRFTISRDN D KNTLYLQM N SLR A EDTAVYYCAK SPYAPLDYWGQGTLVTVSS N84D variant of TM3B337 VH SEQ ID NO: 7 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQM D SLR A EDTAVYYCAK SPYAPLDYWGQGTLVTVSS A88D variant of TM3B337 VH SEQ ID NO: 8 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQM N SLR D EDTAVYYCAK SPYA
- PD1B244 Another monospecific antibody that has been modified using the methods described herein is the monoclonal antibody that binds PD-1 (CD279) known as PD1B244.
- the heavy chain variable region of the PD1B244 antibody (PD1H170 HC) was modified at Kabat residues 74, 82a, and 84, which correspond to residues 75, 84, and 88, respectively of the SEQ ID NO: 3 (shown below) to decrease its isoelectric point.
- PD1B2244 comprises a light chain variable region of SEQ ID NO: 9.
- PD1B244 heavy chain variable region PD1H170- SEQ ID NO: 3 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMG GIIPIFDTANYAQKFQGRVTITADE[ S / D ]TSTAYMEL[ S / D ]SLR [ S / D ]EDTAVYYCARPGLAAAYDTGSLDYWGQGTLVTVSS PD1B244 light chain variable region- SEQ ID NO: 9 EIVLTQSPATLSLSPGERATLSCRASQSVRSYLAWYQQKPGQAPRLLIY DASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRNYWPLTF GQGTKVEIK
- the serine residue at position 75 of SEQ ID NO: 3 was substituted with an aspartic acid residue (S75D)
- the serine residue at position 84 of SEQ ID NO: 3 was substituted with an aspartic acid residue (S84D)
- the serine residue at position 88 of SEQ ID NO: 3 was substituted with an aspartic acid residue (S88D) to decrease the isoelectric point of the PD1B244 antibody.
- These amino acid substitutions had no effect on antigen binding capabilities of the PD1B244 antibody (see FIG. 18 ).
- the amino acid sequences of PD1B244 VH variants are shown below.
- the antibody having a modified isoelectric point is a multispecific antibody, e.g., a bispecific antibody.
- the first and second polypeptides comprising the heavy chain variable region of the multispecific antibody are different.
- the amino acid substitutions disclosed herein may be present in only one of the heavy chain variable regions.
- amino acid substitutions may be made in both heavy chain variable regions, these substitutions may be the same or different depending on the purpose of the modification. For example, if the isoelectric modification is made to alter the half life/clearance rate of the multispecific antibody, then similar substitutions in both heavy chain variable regions may be made to increase or decrease the pI of the antibody. Alternatively, different amino acid substitutions may be made in both heavy chain variable regions to increase or decrease the pI of the antibody.
- the amino acid substitutions are present in only one heavy chain variable region of a multispecific antibody, e.g., a bispecific antibody.
- a bispecific antibody is generated from two parental antibodies having similar pIs.
- two parental antibodies having the same or similar isoelectric points are utilized to generate a bispecific antibody, the separation and purification of the bispecific antibody produced therefrom using the standard cell recombination and expression techniques is severely hampered. Accordingly, modification of the parental antibodies to increase the difference in pIs between them will result in the production of a bispecific antibody that can be more readily separated and distinguished from its parental antibodies, thereby increasing the yield and purity of bispecific antibody production.
- another aspect of the present disclosure is directed to a method of enhancing separation of a bispecific antibody from its two parental antibodies.
- This method includes providing a first and second parental antibody, each parental antibody comprising a heavy chain variable region.
- the method further includes substituting, in at least one of the first and second parental antibodies, one or more amino acid residues in the heavy chain variable region (VH) at positions 7, 9, 11, 14, 41, 70, 74, 82a, 84, and 113, according to Kabat numbering system, wherein the substituting increases or decreases the isoelectric point of the first parental antibody relative to the second parental antibody.
- the method further involves producing the bispecific antibody from the two parental antibodies after said substituting, and separating the bispecific antibody produced from its two parental antibodies, where the separation of the bispecific antibody from its two parental antibodies is enhanced as a result of said substituting.
- one or more amino acid residues of the V H region at positions 7, 9, 11, 14, 41, 74, 84, and 113 (Kabat numbering) of the first parental antibody are neutrally charged amino acid residues
- one or more of these amino acid residues may be substituted with one or more positively charged amino acid residues. This substitution will increase the isoelectric point of the first parental antibody relative to the isoelectric point of the second parental antibody.
- the amino acid residues of the V H region at positions 7, 9, 11, 14, 41, 74, 84, and 113 (Kabat numbering) of the first parental antibody are negatively charged amino acid residues
- the amino acid residues may be substituted by exchanging the one or more negatively charged amino acid residues with one or more neutral or positively charged amino acid residues. This substitution will also increase the isoelectric point of the first parental antibody relative to the second parental antibody.
- one or more amino acid residues of the V H region at positions 9, 70, 74, 82a, and 84 (Kabat numbering) of the first parental antibody are neutrally charged amino acid residues
- one or more of these amino acid residues may be substituted by exchanging said one or more neutrally charged amino acid residues with one or more negatively charged amino acid residues. This substitution will to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- one or more amino acid residues of the V H region at positions 9, 70, 74, 82a, and 84 (Kabat numbering) of the first parental antibody are positively charged amino acid residues
- one or more of these amino acid residues may be substituted by exchanging said one or more positively charged amino acid residues with one or more neutral or negatively charged amino acid residues. This substitution will also decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- the number of amino acid residues that are modified or substituted in the first or second parental antibody are not limited.
- the substitutions that create a 0.1 pH unit, 0.2 pH unit, 0.3 pH unit, 0.4 pH unit, or 0.5 pH unit, 0.6 pH unit, 0.7 pH unit, 0.8 pH unit, 0.9 pH unit, 1.0 pH unit change in the isoelectric point of the first parental antibody relative to the second parental antibody are made.
- substitution that create a >1.0 pH unit change in the isoelectric point of the first parental antibody relative to the second parental antibody are made. These changes can be achieved with 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions.
- amino acid residue substitutions described above may be carried out in the V H region of either one of the first or second parental antibodies or, alternatively, in both of the first or second parental antibodies.
- amino acid substitutions are made to both the first and second parental antibodies, the one or more amino acid substitutions in the V H region of the first parental antibody will decrease the isoelectric point of the first parental antibody, while the one or more amino acid substitutions in the V H region of the second parental antibody will increase the isoelectric point of the second parental antibody.
- the amino acid substitutions made to both the first and second parental antibodies may be made at the same amino acid residue position (albeit be different substitutions) or be made at different amino acid residue positions.
- the V H amino acid residue at position 74 (Kabat numbering) in the first parental antibody is exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- V H amino acid residue at position 82a (Kabat numbering) in the first parental antibody is exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- V H amino acid residue at position 84 (Kabat numbering) in the first parental antibody is exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- V H amino acid residue at at least two of the positions selected from positions 74, 82a, and 84 (Kabat numbering) in the first parental antibody are exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- V H amino acid residue at all three positions 74, 82a, and 84 (Kabat numbering) in the first parental antibody are exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- the modification of the isoelectric points of the first and second parental antibodies results in the production of a bispecific antibody having an isoelectric point that is different from each of the parental antibodies. Therefore, separation and ultimately the recovery of the bispecific antibody of interest is significantly enhanced using ion exchange chromatography methods.
- bispecific antibodies are known in the art, and the method of the present disclosure can generally be incorporated into any of these known methods to enhance the separation and purification of the bispecific antibodies.
- Traditional production of full length bispecific antibodies is based on the coexpression of two immunoglobulin heavy chain-light chain pairs, where the two chains have different specificities (Millstein et al., Nature 305:537-539 (1983), which is hereby incorporated by reference in its entirety).
- these hybridomas quadromas
- Using the methods disclosed herein to increase the difference in the isoelectric points of the parental antibodies will significantly enhance the separation and purification of the desired bispecific antibody form the parental antibodies and other byproducts.
- bispecific antibodies include, without limitation, the “knobs and holes” technique, which involves amino acid engineering that creates steric influences to favor heterodimeric formation and disfavor homodimeric formation, as described in U.S. Pat. No. 8,216,805 to Carter, see also Ridgway et al., Protein Engineering 9(7):617 (1996); and Atwell et al., J. Mol. Biol. 1997 270:26 all of which are hereby incorporated by reference in their entirety.
- these “knobs and holes” mutations can be combined with disulfide bonds to skew formation to heterodimerization.
- electrostatic steering or “charge pairs” as described in Gunasekaran et al., J. Biol. Chem. 285(25):19637 (2010), which is hereby incorporated by reference in its entirety.
- electrostatics are used to skew the formation towards the desired heterodimerization.
- Separating the bispecific antibody from the parental antibodies is done using standard separation techniques known in the art. For example, ion-exchange chromatography, is commonly used to separate a bispecific antibody from its parental antibodies. Briefly, the mixture of parental and bispecific antibodies are bound to a cation exchange material (or, alternatively, an anion exchange material) using a loading buffer, wherein the loading buffer is at a first conductivity and pH. The cation exchange material is washed with an intermediate buffer at a second conductivity and/or pH which is greater than that of the loading buffer so as to elute the contaminant (i.e., parental antibodies) from the ion exchange material.
- a cation exchange material or, alternatively, an anion exchange material
- the cation exchange material is washed with a wash buffer which is at a third conductivity and/or pH which is less than that of the intermediate buffer and then washed with an elution buffer at a fourth conductivity and/or pH which is greater than that of the intermediate buffer so as to elute the desired bi-specific antibody from the ion exchange material.
- Separation and purification of bispecific antibodies can also be achieved using other chromatographic techniques such as hydrophobic interaction chromatography, affinity chromatography, size exclusion/gel filtration chromatography, and reversed-phase chromatography carried out at atmospheric pressure or at high pressure using systems such as FPLC and HPLC.
- Purification methods also include electrophoretic, isoelectric focusing, immunological, precipitation, dialysis, and chromatofocusing techniques. Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful.
- suitable purification techniques see e.g. R OBERT S COPES , Protein Purification: Principles and Practice, 3rd Ed (Springer-Verlag 1994), which is hereby incorporated by reference in its entirety.
- the antibodies described herein containing the one or more amino acid substitutions suitable for increasing or decreasing the pI of the antibody may further comprise one or more additional amino acid substitutions previously identified as being useful for modifying the surface charge and pI of an antibody, including, but not limited to amino acid substitutions identified in U.S. Patent Application Publication No. 20140294823 to Moore and U.S. Patent Application Publication No. 20090263392 to Igawa et al., which are hereby incorporated by reference in their entirety.
- the antibodies described herein may further comprise additional amino acid substitutions in the Fc region known to alter a variety of additional functionalities such as Fc ⁇ R binding and/or FcRn binding.
- Optimized Fc variants are known in the art, see e.g., U.S. Pat. No. 8,188,231 to Lazar, U.S. Pat. No. 9,040,041 to Desjarlais et al., and U.S. Pat. No. 8,802,820 to Chamberlain et al., all of which are hereby incorporated by reference in their entirety.
- antibodies described herein can be prepared by any of a variety of techniques using isolated polynucleotides, vectors, and host cells.
- antibodies can be produced by cell culture techniques, including the generation of monoclonal antibodies via conventional techniques, or via transfection of antibody genes, heavy chains and/or light chains into suitable bacterial or mammalian cell hosts, in order to allow for the production of antibodies, wherein the antibodies may be recombinant.
- Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the antibody from the culture medium.
- Transfecting the host cell can be carried out using a variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., by electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like.
- a prokaryotic or eukaryotic host cell e.g., by electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like.
- expression of antibodies in eukaryotic cells is sometimes preferable, and sometimes preferable in mammalian host cells, because such eukaryotic cells (and in particular mammalian cells) are more likely than prokaryotic cells to assemble and secrete a properly folded and immunologically active antibody.
- Exemplary mammalian host cells for expressing the recombinant antibodies of the invention include Chinese Hamster Ovary (CHO cells) (including dhfr-CHO cells, described in Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77: 4216-4220 (1980), which is hereby incorporated by reference in its entirety).
- Other suitable mammalian host cells include, without limitation, NS0 myeloma cells, COS cells, and SP2 cells.
- the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown.
- the present disclosure is also directed to an antibody having a modified isoelectric point produced by the methods described herein.
- the isoelectric point of virtually any antibody can be modified using the methods described herein, so long as the antibody contains a variable heavy region.
- a fourth aspect of the disclosure is directed to a multi-specific antibody that includes a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is less than the isoelectric point of the second polypeptide as a result of one or more amino acid residues at positions 9, 70, 74, 82a, and 84 (Kabat numbering) of the heavy chain variable region of the first polypeptide comprising a neutral or negatively charged amino acid residue and one or more amino acid residues at the corresponding positions of the heavy chain variable region of the second polypeptide comprising a differentially charged amino acid residue when compared to the first polypeptide.
- the neutral or negatively charged amino acid residues at positions 9, 70, 74, 82a and 84 of the first polypeptide are introduced into the first polypeptide by way of amino acid substitution.
- an exemplary bi-specific antibody disclosed herein is an antibody that binds TNF ⁇ and ⁇ V ⁇ 3.
- This antibody has a first polypeptide comprising a heavy chain variable region that, together with its light chain bind TNF ⁇ (CNTO148).
- the isoelectric point of this first heavy chain polypeptide is less than the isoelectric point of the second heavy chain polypeptide of the antibody, which, together with its light chain bind ⁇ V ⁇ 3.
- the first polypeptide heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, where the residue at position 75 (corresponding to Kabat residue 74) is a negatively charged amino acid residue, such as an aspartic acid residue (CNTO148 S75D).
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, where the amino acid residue at position 84 (corresponding to Kabat residue 82a) is a negatively charged amino acid residue, such as an aspartic acid residue (CNTO148 N84D).
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, where the amino acid residue at position 88 (corresponding to Kabat residue 84) is a negatively charged amino acid residue, such as an aspartic acid residue (CNTO148 A88D).
- the heavy chain variable region comprises more than one amino acid substitution that decreases the pI of the bispecific antibody.
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residues as positions 84 and 88 (corresponding to Kabat residues 82a and 84) are negatively charged amino acid residues, such as aspartic acid residues (CNTO148 N84D and A88D).
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residues as positions 75 and 88 (corresponding to Kabat residues 74 and 84) are negatively charged amino acid residues, such as aspartic acid residues (CNTO148 S75D and A88D).
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residues as positions 75 and 84 (corresponding to Kabat residues 74 and 82a) are negatively charged amino acid residues, such as aspartic acid residues (CNTO148 S75D and N84D).
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residues as positions 75, 84, and 88 (corresponding to Kabat residues 74, 82a, and 84) are negatively charged amino acid residues, such as aspartic acid residues (CNTO148 S75D, N84D, and A88D).
- this exemplary bispecific antibody has a second polypeptide comprising a heavy chain variable region that, together with its light chain bind ⁇ V ⁇ 3.
- This second polypeptide comprises the heavy chain variable region of the CNTO95 antibody, having the amino acid sequence of SEQ ID NO: 4 (shown below).
- one or more amino acid residues at positions 7, 9, 11, 14, 41, 74, 84, and 113 of this heavy chain variable region are substituted to comprise a neutral or positively charged amino acid residue.
- CNTO95 heavy chain variable region (C95H22)- SEQ ID NO: 4 QVQLVESGGGVVQPGRSRRLSCAASGFTFSRYTMHWVRQAPGKGLEWVAV ISFDGSNKYYVDSVKGRFTISRDNSENTLYLQVNILRAEDTAVYYCAREA RGSYAFDIWGQGTMVTVSS
- Another exemplary bi-specific antibody disclosed herein is an antibody that binds TIM3 (CD366) and PD-1 (CD279).
- This antibody has a first polypeptide comprising a heavy chain (TM3H24) having a variable region that, together with its light chain, bind TIM3.
- the isoelectric point of this first heavy chain polypeptide is less than the isoelectric point of the second heavy chain polypeptide of the antibody, which, together with its light chain, bind PD-1.
- this heavy chain variable region of comprises the amino acid sequence of SEQ ID NO: 2, where the residue at position 75 (corresponding to Kabat residue 74) is a negatively charged amino acid residue, such as an aspartic acid residue (TM3H24 S75D).
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 2, where the amino acid residue at position 84 (corresponding to Kabat residue 82a) is a negatively charged amino acid residue, such as an aspartic acid residue (TM3H24 N84D).
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 2, where the amino acid residue at position 88 (corresponding to Kabat residue 84) is a negatively charged amino acid residue, such as an aspartic acid residue (TM3H24 A88D).
- the second polypeptide comprising a heavy chain having a variable region (PD1H170), which, together with its light chain, bind PD-1, is modified to lower its pI relative to the pI of the TM3H24 heavy chain, and the over pI of the bispecific antibody.
- the PD1H170 heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 3, where the residue at position 75 (corresponding to Kabat residue 74) is a negatively charged amino acid residue, such as an aspartic acid residue (PD1H170 S75D).
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 3, where the amino acid residue at position 84 (corresponding to Kabat residue 82a) is a negatively charged amino acid residue, such as an aspartic acid residue (PD1H170 S84D).
- the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 3, where the amino acid residue at position 88 (corresponding to Kabat residue 84) is a negatively charged amino acid residue, such as an aspartic acid residue (PD1H170 S88D).
- Another aspect of the present disclosure is directed to a multi-specific antibody that includes a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is higher than the isoelectric point of the second polypeptide as a result of one or more amino acid residues at positions 7, 9, 11, 14, 41, 74, 84, and 113 (Kabat numbering) of the heavy chain variable region of the first polypeptide comprising a neutral or positively charged amino acid residue, and one or more amino acid residues at the corresponding positions of the heavy chain variable region of the second polypeptide comprise a differentially charged amino acid residue (i.e., a negatively or neutrally charged amino acid residue, respectively) when compared to the first polypeptide.
- a differentially charged amino acid residue i.e., a negatively or neutrally charged amino acid residue, respectively
- the one or more amino acid residues at positions 9, 70, 74, 82a, and 84 (Kabat numbering) of the heavy chain variable region of the second polypeptide comprise a neutral or negatively charged amino acid residue
- one or more amino acid residues at the corresponding positions of the heavy chain variable region of the first polypeptide comprise a differentially charged amino acid residue (i.e., a negatively or neutrally charged residue, respectively) when compared to the first polypeptide.
- the neutral or positively charged amino acid residues at the one or more positions of 7, 9, 11, 14, 41, 74, 84, and 113 of the first heavy chain polypeptide are introduced into the first polypeptide by way of amino acid substitution.
- the one or more neutral or negatively charged amino acid residues in the second heavy chain polypeptide are introduced into the second polypeptide by way of amino acid substitution.
- the invention also provides an anti-TIM3 antibody comprising a heavy chain variable region (VH) of SEQ ID NOs: 6, 7 or 8 and a light chain variable region (VL) of SEQ ID NO: 5.
- the invention also provides an anti-TIM3 antibody comprising the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5.
- the invention also provides an anti-TIM3 antibody comprising the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5.
- the invention also provides an anti-TIM3 antibody comprising the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5.
- the invention also provides an anti-PD-1 antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 10, 11 or 12 and a light chain variable region (VL) of SEQ ID NO: 9.
- the invention also provides an anti-PD-1 antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 10 and a light chain variable region (VL) of SEQ ID NO: 9.
- the invention also provides an anti-PD-1 antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 11 and a light chain variable region (VL) of SEQ ID NO: 9.
- the invention also provides an anti-PD-1 antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 12 and a light chain variable region (VL) of SEQ ID NO: 9.
- the invention also provides a bispecific PD1 ⁇ TIM3 antibody comprising a first domain that binds PD-1 and a second domain that binds TIM3, wherein the first domain comprises a VH of SEQ ID NOs: 10, 11 or 12 and a VL of SEQ ID NO: 9, and the second domain comprises the VH of SEQ ID NOs: 6, 7 or 8 and the VL of SEQ ID NO: 5.
- the anti-PD-1, the anti-TIM3 or the bispecific PD-1 ⁇ TIM3 antibodies are an IgG1 isotype. In some embodiments, the anti-PD-1, the anti-TIM3 or the bispecific PD-1 ⁇ TIM3 antibodies are an IgG2 isotype. In some embodiments, the anti-PD-1, the anti-TIM3 or the bispecific PD-1 ⁇ TIM3 antibodies are an IgG3 isotype. In some embodiments, the anti-PD-1, the anti-TIM3 or the bispecific PD-1 ⁇ TIM3 antibodies are an IgG4 isotype.
- the antibody provided herein comprises at least one mutation in an antibody Fc that modulates antibody binding to an Fc receptor (FcR).
- FcR is Fc ⁇ R1, Fc ⁇ RIIa, Fc ⁇ RIIb, Fc ⁇ RIII or FcRn.
- the antibody provided herein comprises a S228P mutation.
- IgG4 constant domain is show in SEQ ID NO: 13 (IgG4 with S228P mutation).
- the bispecific PD-1/TIM3 antibodies may be generated in vitro in a cell-free environment by introducing asymmetrical mutations in the CH3 regions of two monospecific homodimeric antibodies and forming the bispecific heterodimeric antibody from two parent monospecific homodimeric antibodies in reducing conditions to allow disulfide bond isomerization according to methods described in Int. Patent Publ. No. WO2011/131746.
- the first monospecific bivalent antibody and the second monospecific bivalent antibody are engineered to have certain substitutions at the C H 3 domain that promoter heterodimer stability; the antibodies are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the bispecific antibody by Fab arm exchange.
- Substitutions that may be used are F405L in one heavy chain and K409R in the other heavy chain in IgG1 antibodies.
- IgG4 antibodies one wild-type heavy chain and F405L/R409K mutation in the other heavy chain may be used. The incubation conditions may optimally be restored to non-reducing.
- Exemplary reducing agents that may be used are 2-mercaptoethylamine (2-MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione, tris(2-carboxyethyl)phosphine (TCEP), L-cysteine and beta-mercaptoethanol.
- 2-MEA 2-mercaptoethylamine
- DTT dithiothreitol
- DTE dithioerythritol
- glutathione glutathione
- tris(2-carboxyethyl)phosphine (TCEP) tris(2-carboxyethyl)phosphine
- L-cysteine beta-mercaptoethanol
- the anti-PD-1, the anti-TIM3 and the bispecific PD-1 ⁇ TIM3 antibodies are antagonistic antibodies.
- a typical biological activity induced by the antagonistic antibodies provided herein is activation of antigen-specific CD4′′ or CD8′′ T cells.
- Various readouts may be used to assess the antagonistic nature of the antibodies provided herein, such as enhanced proliferation or enhanced production of interferon- ⁇ (IFN- ⁇ ), IL-17 IL-2, IL-6, IL-22, IL-23 or GM-CSF by antigen-specific CD4′′ or CD8′′ T cells.
- IFN- ⁇ interferon- ⁇
- the effect of antibodies on T cells from normal donor that are stimulated by allogeneic dendritic cells or specific antigens, such as Tetanus toxoid or CMV are used.
- changes in T cell function with antibody treatment can be detected by measuring supernatant cytokine levels or markers of T cell activation.
- PBMCs determined to be reactive to CMV antigens are used as source of antigen-specific CD4 + or CD8 + T cells.
- 1.5 ⁇ 10 6 cells/ml or 2 ⁇ 10 6 cells/ml of CMV-reactive PBMCs are plated onto culture plates and 0.1-0.2 ⁇ g/ml CMV peptides added to cultures.
- CMV peptides may be purchased for example from JPT Technologies. Test antibodies are added at singe dose of 10 ⁇ g/ml, plates incubated for 6 days, and cell proliferation assessed by addition of 1 ⁇ Ci/well methyl-3H-thymidine (PerkinElmer) for 6 hours and radioactivity measured in each sample. Alternatively, cytokine production by cells is measured using ELISA or known multiplex assays.
- Antagonist or “antagonistic” refers to an antibody which upon binding to PD-1, TIM-3 or both suppresses at least one biological activity that is mediated by PD-1 and/or TIM-3 ligand.
- the antibody is an antagonist when the at least one biological activity is suppressed by at least about 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% greater than in the absence of the antagonist (e.g., negative control), or when the suppression is statistically significant when compared to the suppression in the absence of the antagonist.
- An exemplary TIM-3 ligand is galectin-9.
- PD-L1 is a ligand for PD-1.
- the invention also provides a pharmaceutical composition
- a pharmaceutical composition comprising the anti-PD-1, the anti-TIM3 and the bispecific PD-1 ⁇ TIM3 antibodies of the invention and a pharmaceutically acceptable carrier.
- the antibodies of the invention may be prepared as pharmaceutical compositions containing an effective amount of the antibodies as an active ingredient in a pharmaceutically acceptable carrier.
- Carrier refers to a diluent, adjuvant, excipient, or vehicle with which the antibody of the invention is administered.
- Such vehicles may be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. For example, 0.4% saline and 0.3% glycine may be used.
- compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, stabilizing, thickening, lubricating and coloring agents, etc.
- concentration of the antibodies or the antigen-binding fragments thereof of the invention in such pharmaceutical formulation may vary, from less than about 0.5%, usually to at least about 1% to as much as 15 or 20% by weight and may be selected primarily based on required dose, fluid volumes, viscosities, etc., according to the particular mode of administration selected.
- Suitable vehicles and formulations, inclusive of other human proteins, e.g., human serum albumin, are described, for example, in e.g. Remington: The Science and Practice of Pharmacy, 21 st Edition, Troy, D. B. ed., Lipincott Williams and Wilkins, Philadelphia, Pa. 2006, Part 5, Pharmaceutical Manufacturing pp 691-1092, See especially pp. 958-989.
- the antibodies of the invention have in vitro and in vivo diagnostic, as well as therapeutic and prophylactic utilities.
- the antibodies of the invention may be administered to cells in culture, in vitro or ex vivo, or to a subject to treat, prevent, and/or diagnose a variety of disorders, such as cancers and infectious disorders.
- the invention provides a method of enhancing an immune response in a subject, comprising administering to the subject the antibody or the antigen binding fragment thereof of the invention for a time sufficient to modify the immune response.
- Immuno response includes T cell mediated and/or B cell mediated immune responses.
- Exemplary immune responses include T cell responses, e.g., cytokine production and cellular cytotoxicity.
- immune response includes immune responses that are indirectly affected by T cell activation, e.g., antibody production (humoral responses) and activation of cytokine responsive cells, e.g., macrophages.
- Enhance or “enhancing” or “upmodulate” or “upmodulating” refers to a detectable increase in the level of an immune response in a subject compared with the level of a response in the subject in the absence of a treatment or compound, and/or compared with the level of a response in an otherwise identical but untreated subject.
- the subject is a human patient.
- the antibodies of the invention are suitable for treating a subject having a disorder that may be treated by augmenting immune responses, such as T-cell mediated immune responses.
- the subject has cancer or a viral infection.
- the invention also provides a method of treating cancer comprising administering to the subject in need thereof a therapeutically effective amount of the isolated antibody or the antigen binding fragment provided herein for a time sufficient to treat cancer.
- Treatment refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder.
- Beneficial or desired clinical results include alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- Treatment can also mean prolonging survival as compared to expected survival if a subject was not receiving treatment.
- Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
- “Therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result.
- a therapeutically effective amount may vary depending on factors such as the disease state, age, sex, and weight of the individual, and the ability of a therapeutic or a combination of therapeutics to elicit a desired response in the individual. Exemplary indicators of an effective therapeutic or combination of therapeutics that include, for example, improved well-being of the patient.
- Cancer may be a hyperproliferative condition or disorder, a solid tumor, a hematological malignancy, a soft tissue tumor, or a metastatic lesion.
- Cancer is meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathology type or stage of invasiveness.
- cancers include solid tumors, hematological malignancies, soft tissue tumors, and metastatic lesions.
- Exemplary solid tumors include malignancies, e.g., sarcomas, and carcinomas (including adenocarcinomas and squamous cell carcinomas) of the various organ systems, such as those affecting liver, lung, breast, lymphoid, gastrointestinal (e.g., colon), genitourinary tract (e.g., renal, urothelial cells), prostate and pharynx.
- Adenocarcinomas include malignancies such as most colon cancers, a rectal cancer, a renal-cell carcinoma, a liver cancer, a non-small cell carcinoma of the lung, a cancer of the small intestine and a cancer of the esophagus.
- Squamous cell carcinomas include malignancies, e.g., in the lung, esophagus, skin, head and neck region, oral cavity, anus, and cervix.
- cancer is a melanoma.
- Metastatic lesions of cancers may also be treated or prevented using the methods and antibodies of the invention described herein.
- Exemplary cancers whose growth may be inhibited or reduced using the antibodies of the invention include cancers that may be responsive to immunotherapy.
- Exemplary such cancers include a melanoma, a renal cancer, a prostate cancer, a breast cancer, a colon cancer, a gastrointestinal cancer, a stomach cancer, an esophageal cancer, a lung cancer, a metastatic malignant melanoma, a clear cell carcinoma, a hormone refractory prostate adenocarcinoma, a non-small cell lung cancer or cancer of the head and neck.
- Refractory or recurrent malignancies may be treated using the antibodies of the invention described herein.
- Exemplary other cancers that may be treated with the antibodies of the invention ae an anal cancer, a basal cell carcinoma, a biliary tract cancer, a bladder cancer, a bone cancer, brain and CNS cancers, a carcinoma of the fallopian tubes, carcinoma of the vagina, a carcinoma of the vulva, a cutaneous or intraocular malignant melanoma, a astro-esophageal cancer, a testicular cancer, an ovarian cancer, a pancreatic cancer, a rectal cancer, an uterine cancer, a primary CNS lymphoma; a neoplasm of the central nervous system (CNS), a cervical cancer, a choriocarcinoma, a rectum cancer, a connective tissue cancer, a cancer of the digestive system, an endometrial cancer, an eye cancer; an intra-epithelial neoplasm, a kidney cancer, a larynx cancer, a liver cancer; a small cell lung cancer
- Exemplary hematological malignancies that may be treated with the antibodies of the invention include leukemias, lymphomas and myeloma, such as a precursor B-cell lymphoblastic leukemia/lymphoma and a B-cell non-Hodgkin's lymphoma, an acute promyelocytic leukemia, an acute lymphoblastic leukemia (ALL), a B-cell chronic lymphocytic leukemia (CLL)/small lymphocytic lymphoma (SLL), a B-cell acute lymphocytic leukemia, a B-cell prolymphocytic leukemia, a lymphoplasmacytic lymphoma, a mantle cell lymphoma (MCL), a follicular lymphoma (FL), including low-grade, intermediate-grade and high-grade FL, a cutaneous follicle center lymphoma, a marginal zone B-cell lymphoma (MALT type, nodal and splenic type
- a pro-lymphocytic/myelocytic leukemia an acute myeloid leukemia (AML), a chronic myeloid leukemia (CML), a large granular lymphocytic (LGL) leukemia, a NK-cell leukemia and Hodgkin's lymphoma.
- AML acute myeloid leukemia
- CML chronic myeloid leukemia
- LGL large granular lymphocytic leukemia
- NK-cell leukemia Hodgkin's lymphoma.
- “Plasma cell disorder” refers to disorders characterized by clonal plasma cells, and includes a multiple myeloma, a light chain amyloidosis and Waldenstrom's macroglobulinemia. Light chain amyloidosis and Waldenstrom's macroglobulinemia can arise independently from multiple myeloma. They may also present simultaneously with multiple myeloma, and develop either before or after the development of multiple myeloma.
- Exemplary B-cell non-Hodgkin's lymphomas are a lymphomatoid granulomatosis, a primary effusion lymphoma, an intravascular large B-cell lymphoma, a mediastinal large B-cell lymphoma, heavy chain diseases (including ⁇ , ⁇ , and a disease), lymphomas induced by therapy with immunosuppressive agents, such as cyclosporine-induced lymphoma, and methotrexate-induced lymphoma.
- the cancer may be a melanoma, a renal cell carcinoma, a squamous non-small cell lung cancer (NSCLC), a non-squamous NSCLC, a colorectal cancer, a castration-resistant prostate cancer, an ovarian cancer, a gastric cancer, an adenocarcinoma (ACA), a squamous cell carcinoma (SCC), a hepatocellular carcinoma (HCC), a pancreatic carcinoma, a squamous cell carcinoma of the head and neck, carcinomas of the esophagus, gastrointestinal tract and breast.
- NSCLC non-small cell lung cancer
- NSCLC non-squamous NSCLC
- colorectal cancer a castration-resistant prostate cancer
- an ovarian cancer a gastric cancer
- an adenocarcinoma (ACA) a squamous cell carcinoma (SCC), a hepatocellular carcinoma (HCC)
- ACA adenocarcino
- the subject has a tumor that expresses PD-L1.
- the subject is refractory and/or relapsed after treatment with the PD-L1 antibody.
- the PD-L1 antibody is avelumab, durvalumab or atezolizumab.
- Various qualitative and/or quantitative methods may be used to determine relapse or refractory nature of the disease. Symptoms that may be associated with relapse or resistance are, for example, a decline or plateau of the well-being of the patient or re-establishment or worsening of various symptoms associated with solid tumors, and/or the spread of cancerous cells in the body from one location to other organs, tissues or cells.
- the invention also provides a method of treating a viral infection comprising administering to the subject in need thereof a therapeutically effective amount of the isolated antibody or the antigen binding fragment provided herein for a time sufficient to treat viral infection.
- Exemplary viral infections that may be treatable by the antibodies of the invention include HIV, hepatitis (A, B, or C), herpes virus (e.g., VZV, HSV-1, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, cornovirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus and arboviral encephalitis virus.
- herpes virus e.g., VZV, HSV-1, HAV-6, HSV-II, and CMV, Epstein Barr virus
- adenovirus e.g., influenza virus, flaviviruses, echovirus, rhinovirus, coxsack
- Embodiment 1 An anti-TIM3 antibody comprising a heavy chain variable region (VH) of SEQ ID NOs: 6, 7 or 8 and a light chain variable region (VL) of SEQ ID NO: 5.
- VH heavy chain variable region
- VL light chain variable region
- Embodiment 2 An anti-TIM3 antibody comprising the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5.
- Embodiment 3 An anti-TIM3 antibody comprising the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5.
- Embodiment 4 An anti-TIM3 antibody comprising the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5.
- Embodiment 5 An anti-PD-1 antibody comprising the VH of SEQ ID NO: 10, 11 or 12 and the VL of SEQ ID NO: 9.
- Embodiment 6 An anti-PD-1 antibody comprising the VH of SEQ ID NO: 10 and the VL of SEQ ID NO: 9.
- Embodiment 9 An anti-PD-1 antibody comprising the VH of SEQ ID NO: 11 and the VL of SEQ ID NO: 9.
- Embodiment 10 An anti-PD-1 antibody comprising the VH of SEQ ID NO: 12 and the VL of SEQ ID NO: 9.
- Embodiment 11 A bispecific PD-1 ⁇ TIM3 antibody comprising a first domain that binds PD-1 and a second domain that binds TIM3, wherein the first domain comprises the VH of SEQ ID NOs: 10, 11 or 12 and the VL of SEQ ID NO: 9, and the second domain comprises the VH of SEQ ID NOs: 6, 7 or 8 and the VL of SEQ ID NO: 5.
- Embodiment 12 The bispecific PD-1 ⁇ TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:10 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5.
- Embodiment 13 The bispecific PD-1 ⁇ TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:11 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5.
- Embodiment 14 The bispecific PD-1 ⁇ TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:12 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5.
- Embodiment 15 The bispecific PD-1 ⁇ TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:10 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5.
- Embodiment 16 The bispecific PD-1 ⁇ TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:11 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5.
- Embodiment 17 The bispecific PD-1 ⁇ TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:12 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5.
- Embodiment 18 The bispecific PD-1 ⁇ TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:10 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5.
- Embodiment 19 The bispecific PD-1 ⁇ TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:11 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5.
- Embodiment 20 The bispecific PD-1 ⁇ TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:12 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5.
- Embodiment 21 The antibody according to any one of Embodiments 1-20, wherein the antibody is an IgG4 isotype.
- Embodiment 22 The antibody according to any one of Embodiments 1-21, comprising a S228P mutation when compared to the wild-type IgG4 of SEQ ID NO: 13.
- Embodiment 23 The antibody according to any one of Embodiments 1-22, wherein the antibody is an antagonistic antibody.
- Embodiment 24 A pharmaceutical composition comprising the antibody of any one of Embodiments 1-23.
- Embodiment 25 The antibody of any one of Embodiments 1-23 or the pharmaceutical composition of Embodiment 24 for use in therapy.
- Embodiment 24 The antibody of any one of Embodiments 1-23 or the pharmaceutical composition of Embodiment 24 for use in treating a subject having cancer.
- Embodiment 25 The antibody or the pharmaceutical composition for use according to Embodiment 24, wherein cancer is a solid tumor or a hematological malignancy.
- CNTO148 is a monoclonal antibody that binds TNF ⁇ .
- the antibody crystal structures are available.
- the isoelectric point of the CNTO148 antibody is ⁇ 9.
- Amino acid substitutions in the variable heavy region at positions 9, 70, 74, 82a, and 84 (Kabat numbering) (corresponding to amino acid positions 9, 71, 75, 84, and 88 of SEQ ID NO: 1) were initially tested to determine their ability to decrease the isoelectric point (pI) of the CNTO148 antibody. These substitutions were introduced either singly or in combination (see Example 4) via modification of the nucleic acid molecule encoding the heavy chain variable region. The variants were expressed using Expi293 cells.
- cIEF capillary isoelectric focusing
- cSDS capillary sodium dodecyl sulfate electrophoresis
- SDS-PAGE sodium dodecyl sulfate-polyacrylamide gel electrophoresis
- SE-HPLC size exclusion high performance liquid chromatography
- the variants were also characterized for changes in antigen binding. Antigen binding was measured using Maxisorp plates (Nunc) coated with F(ab′)2 fragment donkey anti-human Fc from Jackson Immunoresearch and blocked with Superblock (Pierce). Serial dilutions of the variants were then added to the plate and allowed to bind. For measuring CNTO148 binding to TNF, biotinylated human TNF was added, followed by streptavidin-HRP (Jackson Immunoresearch), and bound TNF was detected using TMB substrate (Fitzgerald).
- the temperature of unfolding (To and temperature of aggregation onset (T agg ) of the samples were also analyzed using either the Activa Optim 2, or the updated UNCLE instrument. These instruments measure intrinsic fluorescence with increasing temperature as an indication of protein unfolding and light scattering with increasing temperature as an indication of aggregation onset.
- the temperature at which a protein begins to unfold or aggregate can indicate its structural stability. For this analysis, temperature steps from 20° C. to 85° C. at 0.3° C. per minute were used.
- the characterization of CNTO148 variants is summarized in Table 2 below.
- the experimentally measured pIs of the CNTO148 S75D and N84D variants was 8.9 and 9.0, respectively, compared to the wildtype (WT) with a pI of 9.1.
- the pI of the CNTO148 A88D variant was 9.1 compared to the WT with a pI of 9.2.
- the pI of the CNTO148 G9E and S71E variants were 8.7 and 8.7 respectively, compared to the WT with a pI of 8.9.
- the differences in the pI of WT CNTO148 between experiments were likely due normal day-to-day variability and minor changes in the composition of electrolytes.
- FIG. 1A shows binding of the of S75D and N84D variants compared to wildtype (148 WT and CNTO148), FIG. 1B compares the A88D variant to wildtype CNTO148, and FIG. 1C compares the binding of the G9E and S71E variants, to WT CNTO148.
- CNTO95 was used a negative control.
- the variants also gave an SE-HPLC profile that was very similar to the WT.
- FIGS. 2A-2C show the SE-HPLC profiles for CNTO148 wildtype ( FIG. 2A ), N84D ( FIG.
- FIGS. 3A-3B show a comparison of the SE-HPLC profiles for CNTO148 wildtype ( FIG. 3A ) and the A88D variant ( FIG. 3B ).
- FIGS. 4A-4C show a comparison of the SE-HPLC profiles for CNTO148 wildtype ( FIG. 4A ), G9E ( FIG. 4B ), and S71E ( FIG. 4C ).
- the temperature at onset of aggregation was measured as an indication of colloidal stability.
- the onset of aggregation (T agg ) for the S75D and N84D variants occurred at 66.8° C. and 65.8° C. (see FIGS. 5B and 5C , respectively), which was similar if not somewhat higher than the onset of aggregation for wildtype CNTO148 which occurred at 63.9° C. (see FIG. 5A ) in this experiment.
- the onset of aggregation for the A88D variant was found to occur at 66.9° C. ( FIG. 6B ), which was similar to the wildtype construct at 67.6° C. ( FIG. 6A ).
- the temperature of unfolding was measured as an indication of conformational stability.
- the unfolding temperature (T m ) of the S75D and N84D variants occurred at 67.3° C. ( FIG. 8B ) and 65.3° C. ( FIG. 8C ), respectively, which was similar to the unfolding temperature of the wildtype CNTO148 which occurred at 63.9° C. ( FIG. 8A ).
- the unfolding temperature for the A88D variant occurred at 66.9° C. ( FIG. 9B ), which was similar to the wildtype construct in the experiment which occurred at 67.3° C. ( FIG. 9A ).
- the unfolding temperature for the G9E and S71E variants were found to occur at 65.8° C. ( FIG.
- CNTO95 is a monoclonal antibody that binds ⁇ V ⁇ 3.
- the crystal structures are available.
- the isoelectric point of the CNTO95 antibody is ⁇ 9.
- Amino acid substitutions in the variable heavy region at positions 7, 9, 11, 14, 41, 74, 84, and 113 (Kabat numbering) (corresponding to amino acid positions 7, 9, 11, 14, 41, 71, 88, and 119 of SEQ ID NO: 4) were initially tested to determine their ability to decrease the isoelectric point (pI) of the CNTO95 antibody. These substitutions were introduced either singly or in combination via modification of the nucleic acid molecule encoding the heavy chain variable region. The variants were expressed using Expi293.
- the variants were characterized using capillary isoelectric focusing (cIEF), sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), and size exclusion high performance liquid chromatography (SE-HPLC).
- cIEF was done using the iCE3 analyzer from Protein Simple according to the manufacturer's protocol with pH 3-10 and pH 8-10.5 ampholytes.
- SDS-PAGE was done using a Novex NuPAGE 1-12% Bis-Tris Gel, Invitrogen SeeBlue Plus2 Prestained Standard (1 ⁇ ), and 1 ⁇ MES Running Buffer.
- SE-HPLC was done on a Waters Alliance using a TOSOH Bioscience Bioassist G35W, 7.8 mm ID, 30 cm column.
- the variants were also characterized for changes in antigen binding. Antigen binding was measured using Maxisorp plates (Nunc) coated with F(ab′)2 fragment donkey anti-human Fc from Jackson Immunoresearch and blocked with Superblock (Pierce). Serial dilutions of the variants were then added to the plate and allowed to bind. For measuring CNTO95 binding to ⁇ V ⁇ 3, biotinylated human ⁇ V ⁇ 3 was added, followed by streptavidin-HRP (Jackson Immunoresearch), and bound ⁇ V ⁇ 3 was detected using TMB substrate (Fitzgerald).
- the samples were also analyzed using the updated UNCLE instrument.
- This instrument measures intrinsic fluorescence with increasing temperature as an indication of protein unfolding and light scattering with increasing temperature as an indication of aggregation onset.
- the temperature at which a protein begins to unfold or aggregate can indicate its structural stability. For this analysis, temperature steps from 20° C. to 85° C. at 0.3° C. per minute were used.
- CNTO95 variants The characterization of CNTO95 variants is summarized in Table 4 below.
- the pIs of CNTO95 S7R, G9R, V11R, P14R, P41R, S71K, A88R, and S119R variants were 9.2, 9.2, 9.2, 9.2, 9.2, 9.1, 9.2, and 9.2, respectively, compared to the CNTO95 wildtype with a pI of 9.05. All the variants bound ⁇ V ⁇ 3 at least as well as the WT control.
- FIG. 11 shows binding of the above variants compared to wildtype (CNTO95).
- CNTO148 was used as a negative control.
- the variants also gave an SE-HPLC profile that was very similar to the WT.
- FIG. 12A-12I show the SE-HPLC profiles for CNTO95 wildtype ( FIG. 12A ), S7R ( FIG. 12B ), G9R ( FIG. 12C ), V11R ( FIG. 12D ), P14R ( FIG. 12E ), P41R ( FIG. 12F ), S71K ( FIG. 12G ), A88R ( FIG. 12H ) and S119R ( FIG. 12I ).
- T agg The onset of aggregation (T agg ) for the S7R, G9R, V11R, P14R, P41R, S71K, A88R, and S119R variants occurred at 67.2° C. ( FIG. 13B ), 57.9° C. ( FIG. 13C ), 63.9° C. ( FIG. 13D ), 63.5° C. ( FIG. 13E ), 66.4° C. ( FIG. 13F ), 64.9° C. ( FIG. 13G ), 67.6° C. ( FIG. 13H ), and 66.7° C. ( FIG. 13I ), compared to the onset of aggregation for wildtype CNTO95 which occurred at 68.2° C. (see FIG. 13A ).
- the unfolding temperature (T m ) of the S7R, G9R, V11R, P14R, P41R, S71K, A88R, and S119R variants occurred at 67.9° C. ( FIG. 14B ), 59.4° C. ( FIG. 14C ), 64.8° C. ( FIG. 14D ), 64.3° C. ( FIG. 14E ), 66.8° C. ( FIG. 14F ), 65.8° C. ( FIG. 14G ), 68.0° C. ( FIG. 14H ), and 67.6° C. ( FIG. 14I ), respectively, compared to the unfolding temperature of the wildtype CNTO95 which occurred at 68.8° C. ( FIG. 14A ).
- Variants that demonstrated a greater than 2° C. reduction in T m and T agg were regarded as having reduced stability and those that demonstrated a reduction greater than 5° C. were regarded as having greatly reduced stability.
- the G9R variant demonstrated greatly reduced stability; it had a lower T m by 9.4° C. and a lower onset of aggregation by 10.3° C.
- the V11R, P14R, P41R, and S71K variants demonstrated reduced stability. They had a lower T m by 4° C., 4.5° C., 2° C., and 3° C., respectively, and a lower T agg by 4.3° C., 4.7° C., 1.8° C., and 3.2° C., respectively.
- TIMB337 is a monoclonal antibody that binds TIM3 (CD366)
- PD1B244 is a monoclonal antibody that binds PD-1 (CD279).
- the pIs of TIMB337 and PD1B244 are 7.26 and 7.06 (for the IgG4 version); therefore, the difference in pI between these two homodimers and a bispecific formed by combining the two is less than 0.1 units. This was reflected on a CEX column where the resolution was observed to be 0.1.
- Amino acid substitutions in the heavy chain variable regions of TIM337 and PD1B244 at positions 74, 82a, and 84 were initially tested to determine their ability to decrease the isoelectric point (pI) of these antibodies (see Tables 5 and 6). These substitutions were introduced either singly or in combination via modification of the nucleic acid molecule encoding the heavy chain variable region. The variants were expressed using Expi293 cells in 24-well plates.
- the TIMB377 and PD1B244 variants were expressed in 24 well plates and purified.
- the same panel of methods used for the characterization of the CNTO148 variants was used to analyze the TIMB377 and PD1B244 variants, including cSDS, SE-HPLC, cIEF.
- cIEF was done with pH 3-10 and pH 5-8 ampholytes. Stability was measured using the Activa Optim2 as before. Antigen binding was also measured for each of the POC antibodies.
- An ELISA was used to measure TIM3 binding. Briefly, Maxisorp plates (Nunc) were coated with Streptavidin, and then blocked with PBS with 0.4% BSA.
- a GLC type sensor chip was prepared by covalently immobilizing goat anti-human/anti-mouse Fc antibody (in Na acetate pH 4.5) over flow cells of all 6 channels ( ⁇ 5000 RU).
- anti-PD1 mAbs were diluted to 0.001 mg/ml in PBSTE and captured over all ligand channels ( ⁇ 180 RU).
- human PD1 antigen 100 nM-0.4 nM at 4-fold dilutions in PB STE
- PD1B244 single-substitution variant characterization results are shown in Table 8 below.
- wildtype anti-PD1 showed a tendency to aggregate as evidenced by SE-HPLC, which made it difficult to determine if the substitutions had an effect on aggregation.
- the wildtype purity by SE-HPLC was 78% monomer, while the single mutants ranged from 51% to 95% monomeric.
- Previous experiments characterizing the PD-1 antibody showed that aggregation of this antibody is sensitive to temperature and pH, therefore, variability in the proportion of monomer could be attributed to differences in experimental conditions during the processing of the samples.
- variable proportion of monomer seen in some of the variants was not considered a valid basis on which to exclude these substitutions from further evaluation and % monomer was not included in the final analysis of the PD-1 antibody mutants. It should be noted, however, that further studies demonstrated that through process optimization such aggregation can be minimized significantly and the experiments currently described were performed in PBS without such optimization.
- the pIs of the S75D, S84D, and S88D variants were 8.6, 8.6 and 8.7 compared to the WT with a pI of 8.9. All three variants bound human PD1 with a KD that was similar to WT ( FIG. 18 ). They also gave an SE-HPLC profile that was very similar to the WT. In this case, the SE-HPLC profile of the WT anti-PD1 antibody included several bands that eluted earlier than the presumptive monomer peak. The number and appearance of these peaks was not affected by the charge substitutions ( FIGS. 19A-19D ). In addition, the onset of aggregation for the S75D, S84D and S88D variants at 66.6° C., 66.1° C.
Abstract
The present disclosure relates to methods of modifying the isoelectric point of an antibody. The method includes providing an antibody comprising a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising heavy chain variable region and substituting, in at least one of the first and second polypeptides of the antibody, one or more amino acid residues of the heavy chain variable region (VH) at positions 7, 9, 11, 14, 41, 70, 74, 82a, 84, and 113, according to the Kabat numbering system, wherein the substituting increases or decreases the isoelectric point of the antibody.
Description
- This application is a divisional of U.S. application Ser. No. 15/997,318, filed 4 Jun. 2018, currently allowed, which claims the benefit of U.S. Provisional Application Ser. No. 62/515,297, filed 5 Jun. 2017, the entire contents of which are incorporated herein by reference.
- This application contains a Sequence Listing submitted via EFS-Web, the entire content incorporated herein by reference in its entirety. The ASCII text file, created on 9 Nov. 2021, is named JBI5100USDIV1SEQLIST.TXT and is 18 kilobytes in size.
- The present disclosure relates to methods of engineering surface charge to enhance bispecific antibody production.
- Antibody-based therapeutics have been used successfully to treat a variety of diseases, including cancer and autoimmune/inflammatory disorders. Yet improvements to this class of drugs are still needed, particularly with respect to enhancing their clinical efficacy. One avenue being explored is the engineering of additional and novel antigen binding sites into antibody-based drugs such that a single immunoglobulin molecule co-engages two different antigens. Such alternate antibody formats that engage two different antigens are often referred to as bispecific antibodies.
- Due to their unique mechanisms of action, bispecific antibodies have received increasing attention as biotherapeutic candidates. Historically, production of IgG type bispecific antibodies involved the introduction of four nucleic acid molecules into cells, e.g., nucleic acid molecules encoding the heavy and light chain polypeptides of a first antibody specific to a given antigen, and nucleic acid molecules encoding the heavy and light chain polypeptides of a second antibody specific to a different antigen. In this system, expression of nucleic acid molecules encoding the two heavy chains and two light chains, and the generally random association between the two different heavy chains, and the heavy and light chains, resulted in a small proportion of the antibodies produced having the desired combination of heavy and light chains. Only one out of ten antibodies produced in this way achieves the proper HC and LC pairing to generate the bispecific antibody of interest. To address this issue, engineering strategies that encourage the heterodimerization of the two different HCs and proper pairing of HC with their LC partner to form the desired bispecific were conceived. Such strategies introduced mutations that disfavored undesired pairing as a result of introducing charge, hydrophobicity, steric hindrance, or a combination thereof. While these types of approaches greatly increased the proportion of bispecific antibody, other unwanted antibody species remained. Because these unwanted impurities are closely related to the desired product, they can be difficult to remove.
- Mar. 16, 2006, Huang et al. (International Patent Publication No. WO 2006/028936) suggested that to facilitate purification of a desired antibody heteromultimer it may be desirable to manipulate the differential in the isoelectric points (pI) between a first polypeptide pair and a second polypeptide pair by making selective substitutions in the CDR or framework of one or more of the antibodies. Subsequent work by Igawa et al. (U.S. Patent Application Publication Nos. 20090263392 and 20110076275), disclosed methods to enhance the removal of unwanted monospecific homodimeric byproducts formed during the course of bispecific antibody production that involved engineering one or both of the half-antibodies comprising the bispecific to have a different pI. The change in pI is engineered by the introduction of one or more specific amino acid substitutions in the constant and/or variable regions of the antibody. As a result of the change in pI of one or both of the half antibodies, the desired bispecific antibody can be more readily purified from the parental monospecific homodimeric antibodies using cation exchange. Likewise, U.S. Patent Publication No. 20140294823 to Moore et al. describes a similar approach where specific amino acid substitutions in the heavy chain constant region of one of the parental antibodies creates a heterodimeric antibody where the two heavy chains have a different isoelectric point (pI).
- Despite these efforts, additional methods for the purification of bispecific antibodies are still needed.
- One aspect of the disclosure is directed to a method of modifying the isoelectric point of an antibody. The method involves providing an antibody comprising a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, and substituting, in at least one of the first and second polypeptides of the antibody, one or more amino acid residues of the heavy chain variable region (VH) at
positions - A second aspect of the disclosure is directed to an antibody having a modified isoelectric point produced by the methods described herein.
- A third aspect of the disclosure is directed to a method of enhancing separation of a bispecific antibody from its two parental antibodies. This method includes providing a first and second parental antibody, each parental antibody comprising a heavy chain variable region, and substituting, in at least one of the first and second parental antibodies, one or more amino acid residues in the heavy chain variable region (VH) at
positions - A fourth aspect of the disclosure is directed to a multi-specific antibody that includes a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is less than the isoelectric point of the second polypeptide. In accordance with this aspect, one or more amino acid residues at
positions - A fifth aspect of the disclosure is directed to a multi-specific antibody that includes a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is higher than the isoelectric point of the second polypeptide. In accordance with this aspect, one or more amino acid residues at
positions -
FIGS. 1A-1C are graphs of human TNFα binding ELISA of CNTO148 antibody single substitution variants.FIG. 1A shows TNFα binding of the S75D and N84D antibody variants as compared to wildtype (148 WT and CNTO148).FIG. 1B shows TNFα binding of the A88D antibody variant compared to wildtype.FIG. 1C shows TNFα binding of the G9E and S71E antibody variants compared to wildtype. CNTO95 antibody binding to TNFα is shown as a negative control. -
FIGS. 2A-2C shows analytical size exclusion high performance liquid chromatography (SE-HPLC) analysis of CNTO148 single substitution variants. In particular,FIG. 2A shows the SE-HPLC profile of the CNTO148 wildtype antibody,FIG. 2B shows the SE-HPLC profile of the N84D variant, andFIG. 2C shows the SE-HPLC profile of the S75D variant. -
FIGS. 3A-3B shows analytical SE-HPLC analysis of CNTO148 wildtype and A88D variant. In particular,FIG. 3A shows the SE-HPLC profile of the CNTO148 wildtype antibody, andFIG. 2B shows the SE-HPLC profile of the A88D variant. -
FIGS. 4A-4C shows analytical SE-HPLC analysis of CNTO148 wildtype, G9E, and S71E variants. In particular,FIG. 4A shows the SE-HPLC profile of the CNTO148 wildtype antibody,FIG. 4B shows the SE-HPLC profile of the G9E variant,FIG. 4C shows the SE-HPLC profile for the S71E variant. -
FIGS. 5A-5C are graphs showing onset of aggregation (colloidal stability) analysis of CNTO148 single substitution variants.FIG. 5A shows the onset of aggregation for the CNTO148 wildtype occurring at 63.9° C.,FIG. 5B shows the onset of aggregation for the S75D variant antibody occurring at 66.8° C., andFIG. 5C shows the onset of aggregation for the N84D variant occurring at 65.8° C. -
FIGS. 6A and 6B are graphs showing onset of aggregation (colloidal stability) analysis of CNTO148 wildtype and A88D variant.FIG. 6A shows that the onset of aggregation for the wildtype occurs at 67.6° C., andFIG. 6B shows the onset of aggregation for the A88D variant occurs at 66.9° C. -
FIGS. 7A-7C are graphs showing onset of aggregation (colloidal stability) analysis of CNTO148 wildtype, G9E, and S71E variants.FIG. 7A shows that the onset of aggregation for the wildtype occurs at 68.6° C.,FIG. 7B shows the onset of aggregation for the G9E variant occurs at 65.7° C., andFIG. 7C shows the onset of aggregation for the S71E variant occurs at 69.5° C. -
FIGS. 8A-8C are graphs showing temperature of unfolding (conformational stability) analysis of CNTO148 single substitution variants.FIG. 8A shows the unfolding temperature for the wildtype occurs at 63.9° C.,FIG. 8B shows the unfolding temperature for the S75D variant occurs at 67.3° C., andFIG. 8C shows the unfolding temperature for the N84D variant occurs at 65.3° C. -
FIGS. 9A and 9B are graphs showing the temperature of unfolding (conformational stability) analysis of CNTO148 wildtype and A88D variant.FIG. 9A shows the unfolding temperature for the wildtype occurs at 67.3° C., andFIG. 9B shows the unfolding temperature for the A88D variant occurs at 66.9° C. -
FIGS. 10A-10C are graphs showing the temperature of unfolding (conformational stability) analysis of CNTO148 wildtype, G9E, and S71E variants.FIG. 10A shows the unfolding temperature for the wildtype occurs at 68.8° C.,FIG. 10B shows the unfolding temperature for the G9E variant occurs at 65.8° C., andFIG. 10C shows the unfolding temperature for the S71E variant occurs at 69.5° C. -
FIG. 11 is a graph of human αVβ3 binding ELISA of CNTO95 antibody single substitution variants.FIG. 11 shows αVβ3 binding of the S7R, G9R, V11R, P14R, P41R, S71K, A88R, and S119R antibody variants compared to CNTO95 wildtype. CNTO148 antibody binding to αVβ3 is shown as a negative control. -
FIGS. 12A-12I shows analytical size exclusion high performance liquid chromatography (SE-HPLC) analysis of CNTO95 single substitution variants. In particular,FIG. 12A shows the SE-HPLC profile of the CNTO95 wildtype antibody,FIG. 12B shows the SE-HPLC profile of the S7R variant,FIG. 12C shows the SE-HPLC profile of the G9R variant,FIG. 12D shows the SE-HPLC profile of the V11R variant,FIG. 12E shows the SE-HPLC profile of the P14R variant,FIG. 12F shows the SE-HPLC profile of the P41R variant,FIG. 12G shows the SE-HPLC profile of the S71K variant,FIG. 12H shows the SE-HPLC profile of the A88R variant, andFIG. 12I shows the SE-HPLC variant of the S119R variant. -
FIGS. 13A-13I are graphs showing onset of aggregation (colloidal stability) analysis of CNTO95 single substitution variants.FIG. 13A shows the onset of aggregation for the CNTO95 wildtype occurring at 68.2° C.,FIG. 13B shows the onset of aggregation for the S7R variant antibody occurring at 67.2° C.,FIG. 13C shows the onset of aggregation for the G9R variant occurring at 57.9° C.,FIG. 13D shows the onset of aggregation for the V11R variant occurring at 63.9° C.,FIG. 13E shows the onset of aggregation for the P14R variant occurring at 63.5° C.,FIG. 13F shows the onset of aggregation for the P41R variant occurring at 66.4° C.,FIG. 13G shows the onset of aggregation for the S71K variant occurring at 64.9° C.,FIG. 13H shows the onset of aggregation for the A88R variant occurring at 67.6° C., andFIG. 13I shows the onset of aggregation for the S119R variant occurring at 66.7° C. -
FIGS. 14A-14I are graphs showing the temperature of unfolding (conformational stability) analysis of CNTO95 single substitution variants.FIG. 14A shows the unfolding temperature for the wildtype occurs at 68.8° C.,FIG. 14B shows the unfolding temperature for the S7R variant occurs at 67.9° C.,FIG. 14C shows the unfolding temperature for the G9R variant occurs at 59.4° C.,FIG. 14D shows the unfolding temperature for the V11R variant occurs at 64.8° C.,FIG. 14E shows the unfolding temperature for the P14R variant occurs at 64.3° C.,FIG. 14F shows the unfolding temperature for the P41R variant occurs at 66.8° C.,FIG. 14G shows the unfolding temperature for the S71K variant occurs at 65.8° C.,FIG. 14H shows the unfolding temperature for the A88R variant occurs at 68.0° C., andFIG. 14I shows the unfolding temperature for the S119R variant occurs at 67.6° C. -
FIG. 15 shows human TIM3 binding ELISA of anti-TIM3 antibody single substitution variants. -
FIGS. 16A-16D shows analytical SE-HPLC analysis of anti-TIM3 single substitution variants.FIG. 16A shows the SE-HPLC profile of the TIM3 S75D variant,FIG. 16B shows the SE-HPLC profile of the TIM3 wildtype,FIG. 16C shows the SE-HPLC profile of the TIM3 N84D variant, andFIG. 16D shows the SE-HPLC variant of the TIM3 A88D variant. -
FIGS. 17A-17D shows onset of aggregation (colloidal stability) analysis of anti-TIM3 single substitution variants.FIG. 17A shows the onset of aggregation for the S75D variant occurs at 67.5° C.,FIG. 17B shows the onset of aggregation for the N84D variant occurs at 68.2° C.,FIG. 17C shows the onset of aggregation for the A88D variant occurs at 66.7° C.,FIG. 17D shows the onset of aggregation for the wildtype occurs at 68.5° C. -
FIG. 18 shows PD1 binding kinetics for anti-PD1 single substitution variants as determined by SPR. -
FIGS. 19A-19D show analytical SE-HPLC analysis of anti-PD1 antibody single substitution variants.FIG. 19A shows the SE-HPLC profile of the PD1 S75D variant,FIG. 19B shows the SE-HPLC profile of the PD1 wildtype,FIG. 19C shows the SE-HPLC profile of the PD1 S84D variant, andFIG. 19D shows the SE-HPLC variant of the PD1 S88D variant. -
FIGS. 20A-20D show onset of aggregation (colloidal stability) analysis of anti-PD1 single substitution variants.FIG. 20A shows the onset of aggregation for the S75D variant occurs at 66.6° C.,FIG. 20B shows the onset of aggregation for the S84D variant occurs at 66.1° C.,FIG. 20C shows the onset of aggregation for the S88D variant occurs at 66.5° C.,FIG. 20D shows the onset of aggregation for the wildtype occurs at 65.7° C. -
FIG. 21 shows human TNF binding ELISA of CNTO148 antibody substitution combination variants. -
FIGS. 22A-22E show analytical size exclusion chromatography analysis of CNTO148 combination variants.FIG. 22A shows the SE-HPLC profile of the CNTO148 wildtype,FIG. 22B shows the SE-HPLC profile of the CNTO148 N84D/A88D variant,FIG. 22C shows the SE-HPLC profile of the CNTO148 S75D/A88D variant,FIG. 22D shows the SE-HPLC variant of the CNTO148 N75D/N84D/A88D variant,FIG. 22E shows the SE-HPLC profile of the CNTO148 S75D/N84D variant. -
FIGS. 23A-23E show onset of aggregation (colloidal stability) analysis of a CNTO148 combination variants.FIG. 23A shows the onset of aggregation for the CNTO148 N84D/A88D variant occurs at 66.8° C.,FIG. 23B shows the onset of aggregation for the CNTO148 S75D/A88D variant occurs at 66.8° C.,FIG. 23C shows the onset of aggregation for the S75D/N84D/A88D variant occurs at 67.2° C.,FIG. 23D shows the onset of aggregation for the S75D/N84D variant occurs at 67.1° C.FIG. 23E shows the onset of aggregation for wildtype occurs at 66.5° C. -
FIGS. 24A-24E are graphs showing temperature of unfolding (conformational stability) analysis of CNTO148 multiple substitution variants.FIG. 24A shows the unfolding temperature for the wildtype occurs at 66.4° C.,FIG. 24B shows the unfolding temperature for the N84D/A88D variant occurs at 67.1° C.,FIG. 24C shows the unfolding temperature for the S75D/A88D variant occurs at 66.8° C.,FIG. 24D shows the unfolding temperature for the S75D/N84D/A88D variant occurs at 66.9° C., andFIG. 24E shows the unfolding temperature for the S75D/N84D variant occurs at 67.3° C. - The present disclosure generally relates to methods of engineering surface charge to enhance multi-specific antibody production and purification.
- The present disclosure also relates to antibodies generated using the methods of the invention. The present disclosure also relates to anti-PD1 and anti-TIM3 antibodies and bispecific PD-1×TIM3 antibodies generated herein, and to methods of making and using them. The generated anti-PD-1, anti-TIM3 and the bispecific PD-1×TIM3 antibodies are useful as diagnostic and therapeutic agents.
- Accordingly, one aspect of the present invention is directed to a method of modifying the isoelectric point of an antibody. This method involves providing an antibody comprising a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region. The method further involves substituting, in at least one of the first and second polypeptides of the antibody, one or more amino acid residues of the heavy chain variable region (VH) at
positions - The term “antibody” is used in the broadest sense and specifically covers monoclonal antibodies (including full length monoclonal antibodies and smaller molecules derived therefrom) and polyclonal antibodies. The term “antibody” also encompasses monovalent and multi-valent antibodies, e.g., bivalent antibodies, trivalent antibodies, and tetravalent antibodies. The term “antibody” also encompasses monospecific and multispecific antibodies, e.g., bispecific antibodies, trispecific antibodies, tetraspecific antibodies. A multi-specific antibody is an antibody capable of binding to two or more different antigens or two different epitopes of the same antigen. Accordingly, the method of modifying the isoelectric point of an antibody as described herein is applicable to a broad variety of antibodies
- In one embodiment, the antibody modified in accordance with the method described herein is an immunoglobulin (Ig) molecule and comprises at least two polypeptide chains, i.e., two heavy (H) chains. Five types of mammalian Ig heavy chains are known: α, δ, ε, γ, and μ, wherein the type of heavy chain defines the class (isotype) of the antibody. Antibodies of the disclosure can be of any class (e.g., IgG, IgE, IgM, IgD, and IgA), and subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2). The heavy chain may comprise the variable region (VH) alone, or the variable region and the constant region (CH).
- The antibody modified in accordance with the method described herein may further comprise two light (L) chains. Like the heavy chain, a light chain (i.e., lambda (λ) and kappa (κ) light chains) may comprise the variable region (VL) alone, or the variable region and the constant region (CL).
- In another embodiment, the antibody comprises heavy chain and light chain variable regions fused together to form a single-chain variable domain antibody (scFv) or a single-chain variable domain with an Fc portion (i.e., a scFv-Fc, e.g., a minibody). In another embodiment, the antibody fragment is a divalent or bivalent single-chain variable fragment, engineered by linking two scFvs together either in tandem (i.e., tandem scFv), or such that they dimerize to form diabodies. In yet another embodiment, the antibody is a trivalent single chain variable fragment, engineered by linking three scFvs together, either in tandem or in a trimer formation to form triabodies. In another embodiment, the antibody is a tetrabody single chain variable fragment. In another embodiment, the antibody is a “linear antibody” which is an antibody comprising a pair of tandem Fd segments (VH-CH1-VH-CH1) that form a pair of antigen binding regions (see Zapata et al. Protein Eng. 8(10):1057-1062 (1995), which is hereby incorporated by reference in its entirety).
- The method described herein is also suitable for modifying the isoelectric point of chimeric antibodies (i.e., an antibody where one portion of the amino acid sequence of each of the heavy and light chains is homologous to corresponding sequences in an antibody derived from a particular species or belonging to a particular class, while the remaining segment of each chain is homologous to corresponding sequences in another species or class), CDR-grafted antibodies (i.e., antibodies which comprise heavy and light chain variable region sequences of one species, where one or more of the CDR regions are replaced with CDR regions of another species), and humanized antibodies.
- Antibodies suitable for modification in accordance with the methods disclosed herein are preferably human antibodies or humanized antibodies (fully or partially humanized) as described supra. Alternatively, the antibodies can be animal antibodies such as, but not limited to, a bird antibody, a shark antibody, a whale antibody, or a mammal, including a non-primate antibody (for example, a cow, a pig, a camel, a llama, a horse, a goat, a rabbit, a sheep, a hamster, a guinea pig, a cat, a dog, a rat, a mouse, etc.) or a non-human primate antibody (for example, a monkey, a chimpanzee, etc.).
- The methods described herein involve modifying the isoelectric point of an antibody. The isoelectric point (pI) of an antibody is the pH at which the antibody carries no net electrical charge. The isoelectric point of an antibody or any polypeptide is determined by its amino acid composition. For example, a polypeptide having a high number of basic amino acid residues will have a high pI, whereas a polypeptide having a high number of acidic amino acid residues will have a low pI. Accordingly, the methods of the present invention involve modifying the amino acid composition of the antibody to modify its pI. More specifically, the methods described herein involve modifying one or more amino acid residues within at least one heavy chain variable region of the antibody to modify the pI of the antibody.
- The amino acid composition of a heavy chain variable region of an antibody can be modified by amino acid insertion, deletion, or substitution. An amino acid “substitution” encompasses the replacement of an amino acid residue at a particular position in a polypeptide sequence with a different amino acid. In one embodiment, the substitution involves substitution of amino acid residue that is not naturally occurring at the particular position, either not naturally occurring within the organism or in any organism. Alternatively, the one or more substitutions may be amino acid residues that are frequently occurring residues in sequences of similar related polypeptides in the same organism, e.g., conserved amino acid residues that occur frequently in sequences from other antibodies from the same species. Substitutions with conserved residues from naturally occurring sequences from the same species, e.g., human sequences, can reduce the chances of increased antigenicity for the polypeptides harboring the one or more substitutions. In addition, conservation of charge (e.g., relatively higher frequency of the same positively charged, negatively charged, or uncharged species) compared to sequences from related polypeptides in the same organism is also considered in making the amino acid residue selections for substitution. These charge considerations can have an impact on maintaining the structure and/or stability of the antibody that comprises the one or more amino acid substitutions. For purposes of modifying the pI of the antibody, the amino acid substitutions involve substituting an amino acid residue having a positive or negative charge with an amino acid residue having a neutral charge or vice versa. Exemplary substitutions include, but are not limited to: (1) substitution of a neutrally charged amino acid for a positively charged amino acid to increase the pI; (2) substitution of a negatively charged amino acid for a neutral or positively charged amino acid to increase the pI; (3) substitution of a neutrally charged amino acid for a negatively charged amino acid to decrease the pI; and (4) substitution of a positively charged amino acid with a neutral or negatively charged amino acid to decrease the pI.
- An amino acid “deletion” includes the removal of one or more amino acid residues to modify the isoelectric point of the antibody, whereas an amino acid “insertion” involves the addition of one or more amino acid residues to modify the isoelectric point of the antibody. Exemplary deletions include, but are not limited to, deletion of a negatively charge amino acid residue to increase the pI or deletion of a positively charge amino acid residue to decrease the pI. Suitable amino acid additions include, but are not limited to, addition of a positive amino acid residue to increase the pI of the antibody or an addition of a negative amino acid residue to decrease the pI of the antibody.
- Amino acid residues known in the art to possess a positive charge include, without limitation, those having a basic side chain, e.g., lysine (K), arginine (R), and histidine (H). Amino acid residues known in the art to possess a negative charge include, without limitation, those having an acidic side chain, e.g., glutamic acid (E) and aspartic acid (D). Amino acid residues having uncharged side chains are considered neutral, e.g., serine, threonine, asparagine, glutamine, cysteine, glycine, proline, alanine, valine, isoleucine, leucine, methionine, phenylalanine, tyrosine, and tryptophan.
- Such substitutions, insertion, or deletions often involve gene manipulation or mutagenesis that modifies the original nucleic acid molecule encoding the polypeptide to be modified by inserting, deleting, or substituting at least one nucleotide, to produce a codon that encodes an amino acid residue of interest. More specifically, a codon encoding the original amino acid residue is replaced by a codon encoding the amino acid residue to be introduced by the modification. Such nucleic acid modifications can be carried out by those of skill in the art using well known techniques such as site-directed mutagenesis or PCR mutagenesis.
- In accordance with the methods described herein, the amino acid substitutions, insertions, or deletions, are introduced into one or more of the heavy chain polypeptides of the antibody of interest. In particular, the amino acid substitutions, insertions, or deletions are introduced in the heavy chain variable region of the antibody of interest. The variable region of the heavy chain is subdivided into regions of hypervariability, termed complementarity determining regions (CDR). The three CDRs in the variable regions of the heavy chain are designated CDR1, CDR2 and CDR3 for each of the variable regions. The CDRs are interspersed with more conserved regions termed framework regions (FR). These FR regions are specific to place in the proper spatial configuration the contact amino acid residues of the CDRs that are responsible for most of the binding capacity of the antibody. Each VH is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The exact boundaries of these CDRs have been defined differently according to different systems. The system described by Kabat (Kabat et al., Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987) and (1991), which is hereby incorporated by reference in its entirety), which is used herein when referencing residues of the heavy chain variable region, not only provides an unambiguous residue numbering system applicable to any variable region of an antibody, but also provides precise residue boundaries defining the three CDRs. These CDRs are referred to as Kabat CDRs.
- In accordance with the methods described herein, the isoelectric point of an antibody is modified by substituting, in at least one of the antibody's heavy chain variable regions, at least one amino acid residue where the amino acid residue is at
position - In one embodiment, the one or more amino acid residues of the VH at
positions - In another embodiment, the one or more amino acid residues of the VH at
positions - In a further embodiment, the one or more amino acid residues of the VH at
positions - In yet another embodiment, the one or more amino acid residues of the VH at
positions - It is not necessary to exchange all of the amino acid residues described above. As noted above, amino acid substitutions can be introduced at 1, 2, 3, 4, 6, 7, 8, 9, or 10 of the identified residues within the heavy chain variable region. The number of amino acid substitutions introduced is dependent on the magnitude of change or difference in isoelectric point that is desired, i.e., 0.1 pH unit change, 0.2 pH unit change, 0.3 pH unit change, 0.4 pH unit change, 0.5 pH unit change, 0.6 pH unit change, 0.7 pH unit change, 0.8 pH unit change, 0.9 pH unit change, 1.0 pH unit change, or greater than 1.0 pH unit change. A change or difference in the isoelectric point of the modified antibody can be observed using isoelectric focusing. Isoelectric focusing is an electrophoretic technique that separates proteins by their isoelectric point. Proteins can be applied to a polyacrylamide gel (IEF gels) or immobilized pH gradient (IPG) strips containing a fixed pH gradient. An electrical field is applied and the protein migrates through the pH gradient, becoming immobilized in the pH gradient as they approach their specific pI. Alternatively, a theoretical isoelectric point can be determined using gene and amino acid sequence analysis software (GENETYX and the like). This is useful when considerable modification of the isoelectric point is necessary, for example, for sufficient separation of bispecific antibodies from parental antibodies.
- In one embodiment, the substitution comprises exchanging the VH amino acid residue at position 74 (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- In another embodiment, the substitution comprises exchanging the VH amino acid residue at position 82a (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- In a further embodiment, the substitution comprises exchanging the VH amino acid residue at position 84 (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- In yet another embodiment, the substitution comprises exchanging the VH amino acid residue at at least two of the positions selected from positions 74, 82a, and 84 (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- In another embodiment, the substitution comprises exchanging the VH amino acid residue at all three positions 74, 82a, and 84 (Kabat numbering) in at least one of the first or second heavy chain polypeptides of an antibody with a negatively charged amino acid residue.
- In carrying out the methods described herein, the amino acid substitutions made to an antibody to modify its isoelectric point do not alter its antigen binding capacity, i.e., the modified antibody retains the antigen-binding activity of the unmodified wildtype or parental antibody. As used herein, “retains the antigen-binding activity” means the antibody maintains at least 75%, at least 80% or more, 85% or more, 90% or more, 95% or more, i.e., 96%, 97%, 98%, 99%, or 100% of the antigen binding activity of the antibody before modification. As long as sufficient binding activity for binding to the antigen can be retained for the antibody to exert its function, the affinity determined at 37° C. under physiological conditions may be, for example, 100 nM or less, preferably 50 nM or less, more preferably 10 nM or less, and still more preferably 1 nM or less. Whether a polypeptide comprising an antibody variable region with a modified isoelectric point obtained by the methods described herein retains the antigen-binding activity can be tested using methods that are well known to those of skill in the art, such as, but not limited to, Biacore (intermolecular interaction analysis), cell proliferation assay, ELISA (enzyme-linked immunosorbent assay), EIA (enzyme immunoassay), RIA (radioimmunoassay), and fluorescence immunoassay.
- In carrying out the methods described herein, the amino acid substitutions made to an antibody to modify its isoelectric point do not alter the antibody's stability, e.g., its conformation stability. In other words, the modified antibody exhibits substantially the same stability of the unmodified wildtype or parental antibody. As used herein, “substantially the same stability” means that the modified protein has a less than 25% change in stability, less than 20% change in stability, less 15% change in stability, less than 10% change in stability, less than 5%, 4%, 3%, 2%, or 1% change in stability. Parameters that can be measured as indicators of antibody stability include, but are not limited to, unfolding transition temperature, aggregation onset temperature, and rates of aggregation. Other parameters of antibody stability that can be measured include in vitro serum stability, degradation levels, biological activity, pH, color, clarity, chemical stability, and physical stability.
- In one embodiment, the antibody having a modified isoelectric point is a monospecific antibody. In accordance with this embodiment, the first and second polypeptides, each comprising a heavy chain variable region of the parental monospecific antibody are the same, and the same substitutions to the one or more identified amino acid residue positions (i.e.,
residues - The methods described herein can be utilized to modify the isoelectric point of virtually any monospecific antibody previously known in the art or to be developed. By way of example only, a monospecific antibody that has been modified using the methods described herein is the monoclonal antibody that binds TNFα known as CNTO148. As described herein the heavy chain variable region of the CNTO148 antibody was modified at Kabat residues 74, 82a, and 84, which correspond to residues 75, 84, and 88, respectively of the SEQ ID NO: 1 (shown below) to decrease its isoelectric point.
-
CNT0148 heavy chain variable region (C14F1)- SEQ ID NO: 1 QVQLVESGGGVVQPGRSLRLSCAASGFIFSSYAMEIWVRQAPGNGLEWV AFMSYDGSNKKYADSVKGRFTISRDN[S/D]KNTLYLQM[N/D]SLR [A/D]EDTAVYYCARDRGIAAGGNYYYYGMDVWGQGTTVTVSS - In particular, the serine residue at position 75 of SEQ ID NO: 1 was substituted with an aspartic acid residue (S75D), the asparagine residue at position 84 of SEQ ID NO: 1 was substituted with an aspartic acid residue (N84D), and the alanine residue at position 88 of SEQ ID NO: 1 was substituted with an aspartic acid residue (A88D) to decrease the isoelectric point of the CNTO148 antibody. These amino acid substitutions had no effect on antigen binding capabilities of the CNTO148 antibody (see
FIGS. 1A, 1B and 1C ). - Another monospecific antibody that has been modified using the methods described herein is the monoclonal antibody that binds TIM3 (CD366) known as TIMB337. As described herein the heavy chain variable region of the TIMB337 antibody (TM3H24 HC) was modified at Kabat residues 74, 82a, and 84, which correspond to residues 75, 84, and 88, respectively of the SEQ ID NO: 2 (shown below) to decrease its isoelectric point. TIMB337 comprises a light chain variable region of SEQ ID NO: 5.
-
TIMB377 heavy chain variable region (TM3H24)- SEQ ID NO: 2 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAM SWVRQAPGKGLEWV SAISGSGGSTYYADSVKGRFTISRDN[S/D]KNTLYLQM[N/D]SLR [A/D]EDTAVYYCAKSPYAPLDYWGQGTLVTVSS, TIMB377 light chain variable region- SEQ ID NO: 5 EIVLTQSPATLSLSPGERATLSCRASQSVNDYLAWYQQKPGQAPRLLIY DASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQGGHAPITF GQGTKVEIK - In particular, the serine residue at position 75 of SEQ ID NO: 2 was substituted with an aspartic acid residue (S75D), the asparagine residue at position 84 of SEQ ID NO: 2 was substituted with an aspartic acid residue (N84D), and the alanine residue at position 88 of SEQ ID NO: 2 was substituted with an aspartic acid residue (A88D) to decrease the isoelectric point of the TIMB337 antibody. These amino acid substitutions had no effect on antigen binding capabilities of the TIMB337 antibody (see
FIG. 15 ). The amino acid sequences of TIMB337 VH variants are shown below. -
SEQ ID NO: 6 S75D variant of TM3B337 VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS AISGSGGSTYYADSVKGRFTISRDNDKNTLYLQMNSLRAEDTAVYYCAK SPYAPLDYWGQGTLVTVSS N84D variant of TM3B337 VH SEQ ID NO: 7 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMDSLRAEDTAVYYCAK SPYAPLDYWGQGTLVTVSS A88D variant of TM3B337 VH SEQ ID NO: 8 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS AISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRDEDTAVYYCAK SPYAPLDYWGQGTLVTVSS - Another monospecific antibody that has been modified using the methods described herein is the monoclonal antibody that binds PD-1 (CD279) known as PD1B244. As described herein the heavy chain variable region of the PD1B244 antibody (PD1H170 HC) was modified at Kabat residues 74, 82a, and 84, which correspond to residues 75, 84, and 88, respectively of the SEQ ID NO: 3 (shown below) to decrease its isoelectric point. PD1B2244 comprises a light chain variable region of SEQ ID NO: 9.
-
PD1B244 heavy chain variable region PD1H170- SEQ ID NO: 3 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMG GIIPIFDTANYAQKFQGRVTITADE[S/D]TSTAYMEL[S/D]SLR [S/D]EDTAVYYCARPGLAAAYDTGSLDYWGQGTLVTVSS PD1B244 light chain variable region- SEQ ID NO: 9 EIVLTQSPATLSLSPGERATLSCRASQSVRSYLAWYQQKPGQAPRLLIY DASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRNYWPLTF GQGTKVEIK - In particular, the serine residue at position 75 of SEQ ID NO: 3 was substituted with an aspartic acid residue (S75D), the serine residue at position 84 of SEQ ID NO: 3 was substituted with an aspartic acid residue (S84D), and the serine residue at position 88 of SEQ ID NO: 3 was substituted with an aspartic acid residue (S88D) to decrease the isoelectric point of the PD1B244 antibody. These amino acid substitutions had no effect on antigen binding capabilities of the PD1B244 antibody (see
FIG. 18 ). The amino acid sequences of PD1B244 VH variants are shown below. -
S75D variant of PD1B244 VH SEQ ID NO: 10 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGG IIPIFDTANYAQKFQGRVTITADEDTSTAYMELSSLRSEDTAVYYCARPG LAAAYDTGSLDYWGQGTLVTVSS S84D variant of PD1B244 VH SEQ ID NO: 11 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGG IIPIFDTANYAQKFQGRVTITADESTSTAYMELDSLRSEDTAVYYCARPG LAAAYDTGSLDYWGQGTLVTVSS S88D variant of PD1B244 VH SEQ ID NO: 12 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGG IIPIFDTANYAQKFQGRVTITADESTSTAYMELSSLRDEDTAVYYCARPG LAAAYDTGSLDYWGQGTLVTVSS - In another embodiment, the antibody having a modified isoelectric point is a multispecific antibody, e.g., a bispecific antibody. In accordance with this embodiment, the first and second polypeptides comprising the heavy chain variable region of the multispecific antibody are different. In accordance with this embodiment, the amino acid substitutions disclosed herein may be present in only one of the heavy chain variable regions. Alternatively, amino acid substitutions may be made in both heavy chain variable regions, these substitutions may be the same or different depending on the purpose of the modification. For example, if the isoelectric modification is made to alter the half life/clearance rate of the multispecific antibody, then similar substitutions in both heavy chain variable regions may be made to increase or decrease the pI of the antibody. Alternatively, different amino acid substitutions may be made in both heavy chain variable regions to increase or decrease the pI of the antibody.
- In another embodiment, the amino acid substitutions are present in only one heavy chain variable region of a multispecific antibody, e.g., a bispecific antibody. This is approach is desired when the bispecific antibody is generated from two parental antibodies having similar pIs. When two parental antibodies having the same or similar isoelectric points are utilized to generate a bispecific antibody, the separation and purification of the bispecific antibody produced therefrom using the standard cell recombination and expression techniques is severely hampered. Accordingly, modification of the parental antibodies to increase the difference in pIs between them will result in the production of a bispecific antibody that can be more readily separated and distinguished from its parental antibodies, thereby increasing the yield and purity of bispecific antibody production.
- Accordingly, another aspect of the present disclosure is directed to a method of enhancing separation of a bispecific antibody from its two parental antibodies. This method includes providing a first and second parental antibody, each parental antibody comprising a heavy chain variable region. The method further includes substituting, in at least one of the first and second parental antibodies, one or more amino acid residues in the heavy chain variable region (VH) at
positions - In accordance with this aspect, when one or more amino acid residues of the VH region at
positions positions - In another embodiment, when the one or more amino acid residues of the VH region at
positions positions - As described above, the number of amino acid residues that are modified or substituted in the first or second parental antibody are not limited. In one embodiment, the substitutions that create a 0.1 pH unit, 0.2 pH unit, 0.3 pH unit, 0.4 pH unit, or 0.5 pH unit, 0.6 pH unit, 0.7 pH unit, 0.8 pH unit, 0.9 pH unit, 1.0 pH unit change in the isoelectric point of the first parental antibody relative to the second parental antibody are made. In another embodiment, substitution that create a >1.0 pH unit change in the isoelectric point of the first parental antibody relative to the second parental antibody are made. These changes can be achieved with 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid substitutions. The amino acid residue substitutions described above may be carried out in the VH region of either one of the first or second parental antibodies or, alternatively, in both of the first or second parental antibodies. When amino acid substitutions are made to both the first and second parental antibodies, the one or more amino acid substitutions in the VH region of the first parental antibody will decrease the isoelectric point of the first parental antibody, while the one or more amino acid substitutions in the VH region of the second parental antibody will increase the isoelectric point of the second parental antibody. The amino acid substitutions made to both the first and second parental antibodies may be made at the same amino acid residue position (albeit be different substitutions) or be made at different amino acid residue positions.
- In one embodiment, the VH amino acid residue at position 74 (Kabat numbering) in the first parental antibody is exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- In another embodiment, the VH amino acid residue at position 82a (Kabat numbering) in the first parental antibody is exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- In another embodiment, the VH amino acid residue at position 84 (Kabat numbering) in the first parental antibody is exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- In a further embodiment, the VH amino acid residue at at least two of the positions selected from positions 74, 82a, and 84 (Kabat numbering) in the first parental antibody are exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- In yet another embodiment, the VH amino acid residue at all three positions 74, 82a, and 84 (Kabat numbering) in the first parental antibody are exchanged with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody relative to the second parental antibody.
- As described above, the modification of the isoelectric points of the first and second parental antibodies results in the production of a bispecific antibody having an isoelectric point that is different from each of the parental antibodies. Therefore, separation and ultimately the recovery of the bispecific antibody of interest is significantly enhanced using ion exchange chromatography methods.
- Methods of making bispecific antibodies are known in the art, and the method of the present disclosure can generally be incorporated into any of these known methods to enhance the separation and purification of the bispecific antibodies. Traditional production of full length bispecific antibodies is based on the coexpression of two immunoglobulin heavy chain-light chain pairs, where the two chains have different specificities (Millstein et al., Nature 305:537-539 (1983), which is hereby incorporated by reference in its entirety). As a result of the random assortment and recombination of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of 10 different antibody molecules, of which only one has the correct bispecific structure. Using the methods disclosed herein to increase the difference in the isoelectric points of the parental antibodies will significantly enhance the separation and purification of the desired bispecific antibody form the parental antibodies and other byproducts.
- Other methods for making bispecific antibodies include, without limitation, the “knobs and holes” technique, which involves amino acid engineering that creates steric influences to favor heterodimeric formation and disfavor homodimeric formation, as described in U.S. Pat. No. 8,216,805 to Carter, see also Ridgway et al., Protein Engineering 9(7):617 (1996); and Atwell et al., J. Mol. Biol. 1997 270:26 all of which are hereby incorporated by reference in their entirety. In addition, as described in Merchant et al., Nature Biotech. 16:677 (1998), which is hereby incorporated by reference in its entirety, these “knobs and holes” mutations can be combined with disulfide bonds to skew formation to heterodimerization.
- An additional technique used to generate bispecific antibodies is often referred to as “electrostatic steering” or “charge pairs” as described in Gunasekaran et al., J. Biol. Chem. 285(25):19637 (2010), which is hereby incorporated by reference in its entirety. In this method, electrostatics are used to skew the formation towards the desired heterodimerization.
- Separating the bispecific antibody from the parental antibodies is done using standard separation techniques known in the art. For example, ion-exchange chromatography, is commonly used to separate a bispecific antibody from its parental antibodies. Briefly, the mixture of parental and bispecific antibodies are bound to a cation exchange material (or, alternatively, an anion exchange material) using a loading buffer, wherein the loading buffer is at a first conductivity and pH. The cation exchange material is washed with an intermediate buffer at a second conductivity and/or pH which is greater than that of the loading buffer so as to elute the contaminant (i.e., parental antibodies) from the ion exchange material. The cation exchange material is washed with a wash buffer which is at a third conductivity and/or pH which is less than that of the intermediate buffer and then washed with an elution buffer at a fourth conductivity and/or pH which is greater than that of the intermediate buffer so as to elute the desired bi-specific antibody from the ion exchange material.
- Separation and purification of bispecific antibodies can also be achieved using other chromatographic techniques such as hydrophobic interaction chromatography, affinity chromatography, size exclusion/gel filtration chromatography, and reversed-phase chromatography carried out at atmospheric pressure or at high pressure using systems such as FPLC and HPLC. Purification methods also include electrophoretic, isoelectric focusing, immunological, precipitation, dialysis, and chromatofocusing techniques. Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. For general guidance in suitable purification techniques, see e.g. R
OBERT SCOPES , Protein Purification: Principles and Practice, 3rd Ed (Springer-Verlag 1994), which is hereby incorporated by reference in its entirety. - The antibodies described herein containing the one or more amino acid substitutions suitable for increasing or decreasing the pI of the antibody, may further comprise one or more additional amino acid substitutions previously identified as being useful for modifying the surface charge and pI of an antibody, including, but not limited to amino acid substitutions identified in U.S. Patent Application Publication No. 20140294823 to Moore and U.S. Patent Application Publication No. 20090263392 to Igawa et al., which are hereby incorporated by reference in their entirety. Likewise, the antibodies described herein may further comprise additional amino acid substitutions in the Fc region known to alter a variety of additional functionalities such as FcγR binding and/or FcRn binding. Optimized Fc variants are known in the art, see e.g., U.S. Pat. No. 8,188,231 to Lazar, U.S. Pat. No. 9,040,041 to Desjarlais et al., and U.S. Pat. No. 8,802,820 to Chamberlain et al., all of which are hereby incorporated by reference in their entirety.
- As described above, the antibodies described herein can be prepared by any of a variety of techniques using isolated polynucleotides, vectors, and host cells. In general, antibodies can be produced by cell culture techniques, including the generation of monoclonal antibodies via conventional techniques, or via transfection of antibody genes, heavy chains and/or light chains into suitable bacterial or mammalian cell hosts, in order to allow for the production of antibodies, wherein the antibodies may be recombinant. Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells and recover the antibody from the culture medium. Transfecting the host cell can be carried out using a variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., by electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like. Although it is possible to express the antibodies described herein in either prokaryotic or eukaryotic host cells, expression of antibodies in eukaryotic cells is sometimes preferable, and sometimes preferable in mammalian host cells, because such eukaryotic cells (and in particular mammalian cells) are more likely than prokaryotic cells to assemble and secrete a properly folded and immunologically active antibody.
- Exemplary mammalian host cells for expressing the recombinant antibodies of the invention include Chinese Hamster Ovary (CHO cells) (including dhfr-CHO cells, described in Urlaub and Chasin, Proc. Natl. Acad. Sci. USA, 77: 4216-4220 (1980), which is hereby incorporated by reference in its entirety). Other suitable mammalian host cells include, without limitation, NS0 myeloma cells, COS cells, and SP2 cells. When recombinant expression vectors encoding antibody genes are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown.
- The present disclosure is also directed to an antibody having a modified isoelectric point produced by the methods described herein. As described supra, the isoelectric point of virtually any antibody can be modified using the methods described herein, so long as the antibody contains a variable heavy region.
- A fourth aspect of the disclosure is directed to a multi-specific antibody that includes a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is less than the isoelectric point of the second polypeptide as a result of one or more amino acid residues at
positions - Methods of producing antibodies as well as modes of making amino acid substitutions are described above. In one embodiment, the neutral or negatively charged amino acid residues at
positions - In accordance with this aspect of the disclosure, an exemplary bi-specific antibody disclosed herein is an antibody that binds TNFα and αVβ3. This antibody has a first polypeptide comprising a heavy chain variable region that, together with its light chain bind TNFα (CNTO148). The isoelectric point of this first heavy chain polypeptide is less than the isoelectric point of the second heavy chain polypeptide of the antibody, which, together with its light chain bind αVβ3.
- In one embodiment, the first polypeptide heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, where the residue at position 75 (corresponding to Kabat residue 74) is a negatively charged amino acid residue, such as an aspartic acid residue (CNTO148 S75D). Alternatively, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, where the amino acid residue at position 84 (corresponding to Kabat residue 82a) is a negatively charged amino acid residue, such as an aspartic acid residue (CNTO148 N84D). In yet another embodiment, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, where the amino acid residue at position 88 (corresponding to Kabat residue 84) is a negatively charged amino acid residue, such as an aspartic acid residue (CNTO148 A88D).
- In yet another embodiment, the heavy chain variable region comprises more than one amino acid substitution that decreases the pI of the bispecific antibody. In particular, in one embodiment, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residues as positions 84 and 88 (corresponding to Kabat residues 82a and 84) are negatively charged amino acid residues, such as aspartic acid residues (CNTO148 N84D and A88D). In another embodiment, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residues as positions 75 and 88 (corresponding to Kabat residues 74 and 84) are negatively charged amino acid residues, such as aspartic acid residues (CNTO148 S75D and A88D). In another embodiment, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residues as positions 75 and 84 (corresponding to Kabat residues 74 and 82a) are negatively charged amino acid residues, such as aspartic acid residues (CNTO148 S75D and N84D). In yet another embodiment, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 1, wherein the amino acid residues as positions 75, 84, and 88 (corresponding to Kabat residues 74, 82a, and 84) are negatively charged amino acid residues, such as aspartic acid residues (CNTO148 S75D, N84D, and A88D).
- As indicated above, this exemplary bispecific antibody has a second polypeptide comprising a heavy chain variable region that, together with its light chain bind αVβ3. This second polypeptide comprises the heavy chain variable region of the CNTO95 antibody, having the amino acid sequence of SEQ ID NO: 4 (shown below). In one embodiment, one or more amino acid residues at
positions -
CNTO95 heavy chain variable region (C95H22)- SEQ ID NO: 4 QVQLVESGGGVVQPGRSRRLSCAASGFTFSRYTMHWVRQAPGKGLEWVAV ISFDGSNKYYVDSVKGRFTISRDNSENTLYLQVNILRAEDTAVYYCAREA RGSYAFDIWGQGTMVTVSS - Another exemplary bi-specific antibody disclosed herein is an antibody that binds TIM3 (CD366) and PD-1 (CD279). This antibody has a first polypeptide comprising a heavy chain (TM3H24) having a variable region that, together with its light chain, bind TIM3. In one embodiment, the isoelectric point of this first heavy chain polypeptide is less than the isoelectric point of the second heavy chain polypeptide of the antibody, which, together with its light chain, bind PD-1. In accordance with this embodiment, this heavy chain variable region of comprises the amino acid sequence of SEQ ID NO: 2, where the residue at position 75 (corresponding to Kabat residue 74) is a negatively charged amino acid residue, such as an aspartic acid residue (TM3H24 S75D). Alternatively, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 2, where the amino acid residue at position 84 (corresponding to Kabat residue 82a) is a negatively charged amino acid residue, such as an aspartic acid residue (TM3H24 N84D). In yet another embodiment, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 2, where the amino acid residue at position 88 (corresponding to Kabat residue 84) is a negatively charged amino acid residue, such as an aspartic acid residue (TM3H24 A88D).
- Alternatively, the second polypeptide comprising a heavy chain having a variable region (PD1H170), which, together with its light chain, bind PD-1, is modified to lower its pI relative to the pI of the TM3H24 heavy chain, and the over pI of the bispecific antibody. In accordance with this embodiment, the PD1H170 heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 3, where the residue at position 75 (corresponding to Kabat residue 74) is a negatively charged amino acid residue, such as an aspartic acid residue (PD1H170 S75D). Alternatively, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 3, where the amino acid residue at position 84 (corresponding to Kabat residue 82a) is a negatively charged amino acid residue, such as an aspartic acid residue (PD1H170 S84D). In yet another embodiment, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 3, where the amino acid residue at position 88 (corresponding to Kabat residue 84) is a negatively charged amino acid residue, such as an aspartic acid residue (PD1H170 S88D).
- Another aspect of the present disclosure is directed to a multi-specific antibody that includes a first polypeptide comprising a heavy chain variable region and a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is higher than the isoelectric point of the second polypeptide as a result of one or more amino acid residues at
positions - In one embodiment, the one or more amino acid residues at
positions - In one embodiment, the neutral or positively charged amino acid residues at the one or more positions of 7, 9, 11, 14, 41, 74, 84, and 113 of the first heavy chain polypeptide are introduced into the first polypeptide by way of amino acid substitution. Likewise, the one or more neutral or negatively charged amino acid residues in the second heavy chain polypeptide are introduced into the second polypeptide by way of amino acid substitution.
- The invention also provides an anti-TIM3 antibody comprising a heavy chain variable region (VH) of SEQ ID NOs: 6, 7 or 8 and a light chain variable region (VL) of SEQ ID NO: 5. The invention also provides an anti-TIM3 antibody comprising the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5. The invention also provides an anti-TIM3 antibody comprising the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5. The invention also provides an anti-TIM3 antibody comprising the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5.
- The invention also provides an anti-PD-1 antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 10, 11 or 12 and a light chain variable region (VL) of SEQ ID NO: 9. The invention also provides an anti-PD-1 antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 10 and a light chain variable region (VL) of SEQ ID NO: 9. The invention also provides an anti-PD-1 antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 11 and a light chain variable region (VL) of SEQ ID NO: 9. The invention also provides an anti-PD-1 antibody comprising a heavy chain variable region (VH) of SEQ ID NO: 12 and a light chain variable region (VL) of SEQ ID NO: 9.
- The invention also provides a bispecific PD1×TIM3 antibody comprising a first domain that binds PD-1 and a second domain that binds TIM3, wherein the first domain comprises a VH of SEQ ID NOs: 10, 11 or 12 and a VL of SEQ ID NO: 9, and the second domain comprises the VH of SEQ ID NOs: 6, 7 or 8 and the VL of SEQ ID NO: 5.
- In some embodiments, the anti-PD-1, the anti-TIM3 or the bispecific PD-1×TIM3 antibodies are an IgG1 isotype. In some embodiments, the anti-PD-1, the anti-TIM3 or the bispecific PD-1×TIM3 antibodies are an IgG2 isotype. In some embodiments, the anti-PD-1, the anti-TIM3 or the bispecific PD-1×TIM3 antibodies are an IgG3 isotype. In some embodiments, the anti-PD-1, the anti-TIM3 or the bispecific PD-1×TIM3 antibodies are an IgG4 isotype.
- In some embodiments, the antibody provided herein comprises at least one mutation in an antibody Fc that modulates antibody binding to an Fc receptor (FcR). In some embodiments, the FcR is FcγR1, FcγRIIa, FcγRIIb, FcγRIII or FcRn. In some embodiments, the antibody provided herein comprises a S228P mutation.
- An exemplary IgG4 constant domain is show in SEQ ID NO: 13 (IgG4 with S228P mutation).
-
SEQ ID NO: 13 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSG VHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRV ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS QEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK - The bispecific PD-1/TIM3 antibodies may be generated in vitro in a cell-free environment by introducing asymmetrical mutations in the CH3 regions of two monospecific homodimeric antibodies and forming the bispecific heterodimeric antibody from two parent monospecific homodimeric antibodies in reducing conditions to allow disulfide bond isomerization according to methods described in Int. Patent Publ. No. WO2011/131746. In the methods, the first monospecific bivalent antibody and the second monospecific bivalent antibody are engineered to have certain substitutions at the
C H3 domain that promoter heterodimer stability; the antibodies are incubated together under reducing conditions sufficient to allow the cysteines in the hinge region to undergo disulfide bond isomerization; thereby generating the bispecific antibody by Fab arm exchange. Substitutions that may be used are F405L in one heavy chain and K409R in the other heavy chain in IgG1 antibodies. In IgG4 antibodies, one wild-type heavy chain and F405L/R409K mutation in the other heavy chain may be used. The incubation conditions may optimally be restored to non-reducing. Exemplary reducing agents that may be used are 2-mercaptoethylamine (2-MEA), dithiothreitol (DTT), dithioerythritol (DTE), glutathione, tris(2-carboxyethyl)phosphine (TCEP), L-cysteine and beta-mercaptoethanol. For example, incubation for at least 90 min at a temperature of at least 20° C. in the presence of at least 25 mM 2-MEA or in the presence of at least 0.5 mM dithiothreitol at a pH of from 5-8, for example at pH of 7.0 or at pH of 7.4 may be used. - In some embodiments, the anti-PD-1, the anti-TIM3 and the bispecific PD-1×TIM3 antibodies are antagonistic antibodies. A typical biological activity induced by the antagonistic antibodies provided herein is activation of antigen-specific CD4″ or CD8″ T cells. Various readouts may be used to assess the antagonistic nature of the antibodies provided herein, such as enhanced proliferation or enhanced production of interferon-γ (IFN-γ), IL-17 IL-2, IL-6, IL-22, IL-23 or GM-CSF by antigen-specific CD4″ or CD8″ T cells. In an exemplary assay, the effect of antibodies on T cells from normal donor that are stimulated by allogeneic dendritic cells or specific antigens, such as Tetanus toxoid or CMV are used. In this setting, changes in T cell function with antibody treatment can be detected by measuring supernatant cytokine levels or markers of T cell activation. In an exemplary assay, PBMCs determined to be reactive to CMV antigens are used as source of antigen-specific CD4+ or CD8+ T cells. 1.5×106 cells/ml or 2×106 cells/ml of CMV-reactive PBMCs are plated onto culture plates and 0.1-0.2 μg/ml CMV peptides added to cultures. CMV peptides may be purchased for example from JPT Technologies. Test antibodies are added at singe dose of 10 μg/ml, plates incubated for 6 days, and cell proliferation assessed by addition of 1 μCi/well methyl-3H-thymidine (PerkinElmer) for 6 hours and radioactivity measured in each sample. Alternatively, cytokine production by cells is measured using ELISA or known multiplex assays. “Antagonist” or “antagonistic” refers to an antibody which upon binding to PD-1, TIM-3 or both suppresses at least one biological activity that is mediated by PD-1 and/or TIM-3 ligand. The antibody is an antagonist when the at least one biological activity is suppressed by at least about 20%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% greater than in the absence of the antagonist (e.g., negative control), or when the suppression is statistically significant when compared to the suppression in the absence of the antagonist. An exemplary TIM-3 ligand is galectin-9. PD-L1 is a ligand for PD-1.
- The invention also provides a pharmaceutical composition comprising the anti-PD-1, the anti-TIM3 and the bispecific PD-1×TIM3 antibodies of the invention and a pharmaceutically acceptable carrier. For therapeutic use, the antibodies of the invention may be prepared as pharmaceutical compositions containing an effective amount of the antibodies as an active ingredient in a pharmaceutically acceptable carrier. “Carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the antibody of the invention is administered. Such vehicles may be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. For example, 0.4% saline and 0.3% glycine may be used. These solutions are sterile and generally free of particulate matter. They may be sterilized by conventional, well-known sterilization techniques (e.g., filtration). The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, stabilizing, thickening, lubricating and coloring agents, etc. The concentration of the antibodies or the antigen-binding fragments thereof of the invention in such pharmaceutical formulation may vary, from less than about 0.5%, usually to at least about 1% to as much as 15 or 20% by weight and may be selected primarily based on required dose, fluid volumes, viscosities, etc., according to the particular mode of administration selected. Suitable vehicles and formulations, inclusive of other human proteins, e.g., human serum albumin, are described, for example, in e.g. Remington: The Science and Practice of Pharmacy, 21st Edition, Troy, D. B. ed., Lipincott Williams and Wilkins, Philadelphia, Pa. 2006, Part 5, Pharmaceutical Manufacturing pp 691-1092, See especially pp. 958-989.
- The antibodies of the invention have in vitro and in vivo diagnostic, as well as therapeutic and prophylactic utilities. For example, the antibodies of the invention may be administered to cells in culture, in vitro or ex vivo, or to a subject to treat, prevent, and/or diagnose a variety of disorders, such as cancers and infectious disorders.
- The invention provides a method of enhancing an immune response in a subject, comprising administering to the subject the antibody or the antigen binding fragment thereof of the invention for a time sufficient to modify the immune response.
- “Immune response” includes T cell mediated and/or B cell mediated immune responses. Exemplary immune responses include T cell responses, e.g., cytokine production and cellular cytotoxicity. In addition, the term immune response includes immune responses that are indirectly affected by T cell activation, e.g., antibody production (humoral responses) and activation of cytokine responsive cells, e.g., macrophages.
- “Enhance” or “enhancing” or “upmodulate” or “upmodulating” refers to a detectable increase in the level of an immune response in a subject compared with the level of a response in the subject in the absence of a treatment or compound, and/or compared with the level of a response in an otherwise identical but untreated subject.
- In some embodiments, the subject is a human patient.
- The antibodies of the invention are suitable for treating a subject having a disorder that may be treated by augmenting immune responses, such as T-cell mediated immune responses.
- In some embodiments, the subject has cancer or a viral infection.
- The invention also provides a method of treating cancer comprising administering to the subject in need thereof a therapeutically effective amount of the isolated antibody or the antigen binding fragment provided herein for a time sufficient to treat cancer.
- “Treat” or “treatment” refers to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder. Beneficial or desired clinical results include alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. “Treatment” can also mean prolonging survival as compared to expected survival if a subject was not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
- “Therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result. A therapeutically effective amount may vary depending on factors such as the disease state, age, sex, and weight of the individual, and the ability of a therapeutic or a combination of therapeutics to elicit a desired response in the individual. Exemplary indicators of an effective therapeutic or combination of therapeutics that include, for example, improved well-being of the patient.
- Cancer may be a hyperproliferative condition or disorder, a solid tumor, a hematological malignancy, a soft tissue tumor, or a metastatic lesion.
- “Cancer” is meant to include all types of cancerous growths or oncogenic processes, metastatic tissues or malignantly transformed cells, tissues, or organs, irrespective of histopathology type or stage of invasiveness. Examples of cancers include solid tumors, hematological malignancies, soft tissue tumors, and metastatic lesions. Exemplary solid tumors include malignancies, e.g., sarcomas, and carcinomas (including adenocarcinomas and squamous cell carcinomas) of the various organ systems, such as those affecting liver, lung, breast, lymphoid, gastrointestinal (e.g., colon), genitourinary tract (e.g., renal, urothelial cells), prostate and pharynx. Adenocarcinomas include malignancies such as most colon cancers, a rectal cancer, a renal-cell carcinoma, a liver cancer, a non-small cell carcinoma of the lung, a cancer of the small intestine and a cancer of the esophagus. Squamous cell carcinomas include malignancies, e.g., in the lung, esophagus, skin, head and neck region, oral cavity, anus, and cervix.
- In some embodiments, cancer is a melanoma.
- Metastatic lesions of cancers may also be treated or prevented using the methods and antibodies of the invention described herein.
- Exemplary cancers whose growth may be inhibited or reduced using the antibodies of the invention include cancers that may be responsive to immunotherapy. Exemplary such cancers include a melanoma, a renal cancer, a prostate cancer, a breast cancer, a colon cancer, a gastrointestinal cancer, a stomach cancer, an esophageal cancer, a lung cancer, a metastatic malignant melanoma, a clear cell carcinoma, a hormone refractory prostate adenocarcinoma, a non-small cell lung cancer or cancer of the head and neck. Refractory or recurrent malignancies may be treated using the antibodies of the invention described herein.
- Exemplary other cancers that may be treated with the antibodies of the invention ae an anal cancer, a basal cell carcinoma, a biliary tract cancer, a bladder cancer, a bone cancer, brain and CNS cancers, a carcinoma of the fallopian tubes, carcinoma of the vagina, a carcinoma of the vulva, a cutaneous or intraocular malignant melanoma, a astro-esophageal cancer, a testicular cancer, an ovarian cancer, a pancreatic cancer, a rectal cancer, an uterine cancer, a primary CNS lymphoma; a neoplasm of the central nervous system (CNS), a cervical cancer, a choriocarcinoma, a rectum cancer, a connective tissue cancer, a cancer of the digestive system, an endometrial cancer, an eye cancer; an intra-epithelial neoplasm, a kidney cancer, a larynx cancer, a liver cancer; a small cell lung cancer, a neuroblastoma, an oral cavity cancer (e.g., lip, tongue, mouth, and pharynx), a nasopharyngeal cancer, a retinoblastoma, a rhabdomyosarcoma, a cancer of the respiratory system, a sarcoma, a thyroid cancer, a cancer of the urinary system, a hepatocarcinoma, a cancer of the anal region, a carcinoma of the fallopian tubes, a carcinoma of the vagina, a carcinoma of the vulva, a cancer of the small intestine, a cancer of the endocrine system, a cancer of the parathyroid gland, a cancer of the adrenal gland, a sarcoma of soft tissue, a cancer of the urethra, a cancer of the penis, solid tumors of childhood, a tumor angiogenesis, a spinal axis tumor, a brain stem glioma, a pituitary adenoma, Kaposi's sarcoma, Merkel cell cancer, an epidermoid cancer, a squamous cell cancer, an environmentally induced cancers including those induced by asbestos, as well as other carcinomas and sarcomas, and combinations of said cancers.
- Exemplary hematological malignancies that may be treated with the antibodies of the invention include leukemias, lymphomas and myeloma, such as a precursor B-cell lymphoblastic leukemia/lymphoma and a B-cell non-Hodgkin's lymphoma, an acute promyelocytic leukemia, an acute lymphoblastic leukemia (ALL), a B-cell chronic lymphocytic leukemia (CLL)/small lymphocytic lymphoma (SLL), a B-cell acute lymphocytic leukemia, a B-cell prolymphocytic leukemia, a lymphoplasmacytic lymphoma, a mantle cell lymphoma (MCL), a follicular lymphoma (FL), including low-grade, intermediate-grade and high-grade FL, a cutaneous follicle center lymphoma, a marginal zone B-cell lymphoma (MALT type, nodal and splenic type), a hairy cell leukemia, a diffuse large B-cell lymphoma (DLBCL), Burkitt's lymphoma (BL), a plasmacytoma, a multiple myeloma (MM), a plasma cell leukemia, a post-transplant lymphoproliferative disorder, Waldenstrom's macroglobulinemia, plasma cell disorders, an anaplastic large-cell lymphoma (ALCL), a T-cell acute lymphocytic leukemia, a primary systemic amyloidosis (e.g. light chain amyloidosis), a pro-lymphocytic/myelocytic leukemia, an acute myeloid leukemia (AML), a chronic myeloid leukemia (CML), a large granular lymphocytic (LGL) leukemia, a NK-cell leukemia and Hodgkin's lymphoma.
- “Plasma cell disorder” refers to disorders characterized by clonal plasma cells, and includes a multiple myeloma, a light chain amyloidosis and Waldenstrom's macroglobulinemia. Light chain amyloidosis and Waldenstrom's macroglobulinemia can arise independently from multiple myeloma. They may also present simultaneously with multiple myeloma, and develop either before or after the development of multiple myeloma.
- Exemplary B-cell non-Hodgkin's lymphomas are a lymphomatoid granulomatosis, a primary effusion lymphoma, an intravascular large B-cell lymphoma, a mediastinal large B-cell lymphoma, heavy chain diseases (including γ, μ, and a disease), lymphomas induced by therapy with immunosuppressive agents, such as cyclosporine-induced lymphoma, and methotrexate-induced lymphoma.
- Patients having cancer including metastatic cancer that express PD-L1 may be treated with the antibodies of the invention. The cancer may be a melanoma, a renal cell carcinoma, a squamous non-small cell lung cancer (NSCLC), a non-squamous NSCLC, a colorectal cancer, a castration-resistant prostate cancer, an ovarian cancer, a gastric cancer, an adenocarcinoma (ACA), a squamous cell carcinoma (SCC), a hepatocellular carcinoma (HCC), a pancreatic carcinoma, a squamous cell carcinoma of the head and neck, carcinomas of the esophagus, gastrointestinal tract and breast.
- In some embodiments, the subject has a tumor that expresses PD-L1.
- In some embodiments, the subject is refractory and/or relapsed after treatment with the PD-L1 antibody. in some embodiments, the PD-L1 antibody is avelumab, durvalumab or atezolizumab. Various qualitative and/or quantitative methods may be used to determine relapse or refractory nature of the disease. Symptoms that may be associated with relapse or resistance are, for example, a decline or plateau of the well-being of the patient or re-establishment or worsening of various symptoms associated with solid tumors, and/or the spread of cancerous cells in the body from one location to other organs, tissues or cells.
- The invention also provides a method of treating a viral infection comprising administering to the subject in need thereof a therapeutically effective amount of the isolated antibody or the antigen binding fragment provided herein for a time sufficient to treat viral infection.
- Exemplary viral infections that may be treatable by the antibodies of the invention include HIV, hepatitis (A, B, or C), herpes virus (e.g., VZV, HSV-1, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, cornovirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus and arboviral encephalitis virus.
- Set out below are certain further embodiments of the invention according to the disclosures elsewhere herein. Features from embodiments of the invention set out above described as relating to the invention disclosed herein also relate to each and every one of these further numbered embodiments.
-
Embodiment 1. An anti-TIM3 antibody comprising a heavy chain variable region (VH) of SEQ ID NOs: 6, 7 or 8 and a light chain variable region (VL) of SEQ ID NO: 5. -
Embodiment 2. An anti-TIM3 antibody comprising the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5. -
Embodiment 3. An anti-TIM3 antibody comprising the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5. -
Embodiment 4. An anti-TIM3 antibody comprising the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5. - Embodiment 5. An anti-PD-1 antibody comprising the VH of SEQ ID NO: 10, 11 or 12 and the VL of SEQ ID NO: 9.
-
Embodiment 6. An anti-PD-1 antibody comprising the VH of SEQ ID NO: 10 and the VL of SEQ ID NO: 9. -
Embodiment 9. An anti-PD-1 antibody comprising the VH of SEQ ID NO: 11 and the VL of SEQ ID NO: 9. -
Embodiment 10. An anti-PD-1 antibody comprising the VH of SEQ ID NO: 12 and the VL of SEQ ID NO: 9. - Embodiment 11. A bispecific PD-1×TIM3 antibody comprising a first domain that binds PD-1 and a second domain that binds TIM3, wherein the first domain comprises the VH of SEQ ID NOs: 10, 11 or 12 and the VL of SEQ ID NO: 9, and the second domain comprises the VH of SEQ ID NOs: 6, 7 or 8 and the VL of SEQ ID NO: 5.
-
Embodiment 12. The bispecific PD-1×TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:10 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5. - Embodiment 13. The bispecific PD-1×TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:11 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5.
-
Embodiment 14. The bispecific PD-1×TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:12 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 6 and the VL of SEQ ID NO: 5. - Embodiment 15. The bispecific PD-1×TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:10 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5.
-
Embodiment 16. The bispecific PD-1×TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:11 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5. - Embodiment 17. The bispecific PD-1×TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:12 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 7 and the VL of SEQ ID NO: 5.
-
Embodiment 18. The bispecific PD-1×TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:10 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5. - Embodiment 19. The bispecific PD-1×TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:11 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5.
-
Embodiment 20. The bispecific PD-1×TIM3 antibody according to Embodiment 11, wherein the first domain comprises the VH of SEQ ID NO:12 and the VL of SEQ ID NO: 9 and the second domain comprises the VH of SEQ ID NO: 8 and the VL of SEQ ID NO: 5. - Embodiment 21. The antibody according to any one of Embodiments 1-20, wherein the antibody is an IgG4 isotype.
- Embodiment 22. The antibody according to any one of Embodiments 1-21, comprising a S228P mutation when compared to the wild-type IgG4 of SEQ ID NO: 13.
- Embodiment 23. The antibody according to any one of Embodiments 1-22, wherein the antibody is an antagonistic antibody.
- Embodiment 24. A pharmaceutical composition comprising the antibody of any one of Embodiments 1-23.
- Embodiment 25. The antibody of any one of Embodiments 1-23 or the pharmaceutical composition of Embodiment 24 for use in therapy.
- Embodiment 24. The antibody of any one of Embodiments 1-23 or the pharmaceutical composition of Embodiment 24 for use in treating a subject having cancer.
- Embodiment 25. The antibody or the pharmaceutical composition for use according to Embodiment 24, wherein cancer is a solid tumor or a hematological malignancy.
- The following examples are provided to illustrate embodiments of the present invention but are by no means intended to limit its scope.
- To identify amino acid residues within the surface of the variable region which could be substituted to increase or decrease surface charge, the CNTO148 antibody was employed. CNTO148 is a monoclonal antibody that binds TNFα. The antibody crystal structures are available. The isoelectric point of the CNTO148 antibody is ˜9. Amino acid substitutions in the variable heavy region at
positions amino acid positions 9, 71, 75, 84, and 88 of SEQ ID NO: 1) were initially tested to determine their ability to decrease the isoelectric point (pI) of the CNTO148 antibody. These substitutions were introduced either singly or in combination (see Example 4) via modification of the nucleic acid molecule encoding the heavy chain variable region. The variants were expressed using Expi293 cells. -
TABLE 1 CNTO148 Antibody Variants Kabat Surface Structure position Mutation exposure (%) Location Comment 9 G9E 29 Opposite On surface paratope 70 S71E 22 Side outside the On surface paratope 74 S75D 76 Side outside the On surface paratope 82a N84D 31 Opposite On surface paratope 84 A88D 29 Opposite Protrudes in paratope a pocket - The variants were characterized using capillary isoelectric focusing (cIEF), capillary sodium dodecyl sulfate electrophoresis (cSDS) or sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), and size exclusion high performance liquid chromatography (SE-HPLC). cIEF was done using the iCE3 analyzer from Protein Simple according to the manufacturer's protocol with either, pH 5-8 or pH 3-10, combined with pH 8-10.5 ampholytes. cSDS was done with the Lab Chip GXII from Caliper, using a Protein Express chip and the HT Protein Express Reagent Kit. SDS-PAGE was done using a Novex NuPAGE 1-12% Bis-Tris Gel, Invitrogen SeeBlue Plus2 Prestained Standard (1×), and 1×MES Running Buffer. SE-HPLC was done on a Waters Alliance using a TOSOH Bioscience Bioassist G35W, 7.8 mm ID, 30 cm column.
- The variants were also characterized for changes in antigen binding. Antigen binding was measured using Maxisorp plates (Nunc) coated with F(ab′)2 fragment donkey anti-human Fc from Jackson Immunoresearch and blocked with Superblock (Pierce). Serial dilutions of the variants were then added to the plate and allowed to bind. For measuring CNTO148 binding to TNF, biotinylated human TNF was added, followed by streptavidin-HRP (Jackson Immunoresearch), and bound TNF was detected using TMB substrate (Fitzgerald).
- The temperature of unfolding (To and temperature of aggregation onset (Tagg) of the samples were also analyzed using either the
Activa Optim 2, or the updated UNCLE instrument. These instruments measure intrinsic fluorescence with increasing temperature as an indication of protein unfolding and light scattering with increasing temperature as an indication of aggregation onset. The temperature at which a protein begins to unfold or aggregate can indicate its structural stability. For this analysis, temperature steps from 20° C. to 85° C. at 0.3° C. per minute were used. - The characterization of CNTO148 variants is summarized in Table 2 below. The experimentally measured pIs of the CNTO148 S75D and N84D variants was 8.9 and 9.0, respectively, compared to the wildtype (WT) with a pI of 9.1. In a separate experiment the pI of the CNTO148 A88D variant was 9.1 compared to the WT with a pI of 9.2. In yet another experiment the pI of the CNTO148 G9E and S71E variants were 8.7 and 8.7 respectively, compared to the WT with a pI of 8.9. The differences in the pI of WT CNTO148 between experiments were likely due normal day-to-day variability and minor changes in the composition of electrolytes. The S75D, N84D, A88D, G9E, and S71E variants bound TNFα at least as well as the WT control
FIG. 1A shows binding of the of S75D and N84D variants compared to wildtype (148 WT and CNTO148),FIG. 1B compares the A88D variant to wildtype CNTO148, andFIG. 1C compares the binding of the G9E and S71E variants, to WT CNTO148. CNTO95 was used a negative control. The variants also gave an SE-HPLC profile that was very similar to the WT.FIGS. 2A-2C show the SE-HPLC profiles for CNTO148 wildtype (FIG. 2A ), N84D (FIG. 2B ), and S75D (FIG. 2C ), andFIGS. 3A-3B show a comparison of the SE-HPLC profiles for CNTO148 wildtype (FIG. 3A ) and the A88D variant (FIG. 3B ).FIGS. 4A-4C show a comparison of the SE-HPLC profiles for CNTO148 wildtype (FIG. 4A ), G9E (FIG. 4B ), and S71E (FIG. 4C ). -
TABLE 2 CNTO148 Variant Characterization Summary cIEF Stability Kabat Banding % Charge Ag (Tm and position Mutation Pattern monomer Profile Binding Tagg) 9 G9E WT-like WT-like WT-like WT-like Decreased 70 S71E WT-like WT-like WT-like WT-like WT-like 74 S75D WT-like WT-like WT-like WT-like WT-like 82a N84D WT-like WT-like WT-like WT-like WT-like 84 A88D WT-like WT-like WT-like WT-like WT-like - The temperature at onset of aggregation was measured as an indication of colloidal stability. The onset of aggregation (Tagg) for the S75D and N84D variants occurred at 66.8° C. and 65.8° C. (see
FIGS. 5B and 5C , respectively), which was similar if not somewhat higher than the onset of aggregation for wildtype CNTO148 which occurred at 63.9° C. (seeFIG. 5A ) in this experiment. In a separate experiment the onset of aggregation for the A88D variant was found to occur at 66.9° C. (FIG. 6B ), which was similar to the wildtype construct at 67.6° C. (FIG. 6A ). In another experiment the onset of aggregation for the G9E and S71E variants was found to occur at 65.7° C. (FIG. 7B ) and 69.5° C. (FIG. 7C ) respectively, compared to the wildtype CNTO148 at 68.6° C. (FIG. 7A ). - The temperature of unfolding was measured as an indication of conformational stability. The unfolding temperature (Tm) of the S75D and N84D variants occurred at 67.3° C. (
FIG. 8B ) and 65.3° C. (FIG. 8C ), respectively, which was similar to the unfolding temperature of the wildtype CNTO148 which occurred at 63.9° C. (FIG. 8A ). In a separate experiment the unfolding temperature for the A88D variant occurred at 66.9° C. (FIG. 9B ), which was similar to the wildtype construct in the experiment which occurred at 67.3° C. (FIG. 9A ). In yet another experiment the unfolding temperature for the G9E and S71E variants were found to occur at 65.8° C. (FIG. 10B ) and 69.6° C. (FIG. 10C ) respectively, compared to the wildtype CNTO148 in this experiment which occurred at 68.8° C. (FIG. 10A ). Variants that demonstrated a greater than 2° C. reduction in Tm and Tagg were regarded as having reduced stability. Of these variants, only the G9E variant demonstrated reduced binding compared to the WT; it had a lower Tm by 3° C. and a lower onset of aggregation by 2.9° C. - To identify amino acid residues within the surface of the variable region which could be substituted to increase or decrease surface charge, the CNTO95 antibody was employed. CNTO95 is a monoclonal antibody that binds αVβ3. The crystal structures are available. The isoelectric point of the CNTO95 antibody is ˜9. Amino acid substitutions in the variable heavy region at
positions amino acid positions -
TABLE 3 CNTO95 Antibody Variants Kabat Surface Structure position Mutation exposure (%) Location Comment 7 S7R 42 Side outside the On surface paratope 9 G9R 41 Side outside the On surface paratope 11 V11R 30 Faces CH1 On surface 14 P14R 29 On the bottom On surface 41 P41R 48 Faces CH1 On surface 74 S71K 29 Side outside the On surface paratope 84 A88R 52 Faces CH1 On surface 113 S119R 58 Part of V-CH1 On surface elbow - The variants were characterized using capillary isoelectric focusing (cIEF), sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), and size exclusion high performance liquid chromatography (SE-HPLC). cIEF was done using the iCE3 analyzer from Protein Simple according to the manufacturer's protocol with pH 3-10 and pH 8-10.5 ampholytes. SDS-PAGE was done using a Novex NuPAGE 1-12% Bis-Tris Gel, Invitrogen SeeBlue Plus2 Prestained Standard (1×), and 1×MES Running Buffer. SE-HPLC was done on a Waters Alliance using a TOSOH Bioscience Bioassist G35W, 7.8 mm ID, 30 cm column.
- The variants were also characterized for changes in antigen binding. Antigen binding was measured using Maxisorp plates (Nunc) coated with F(ab′)2 fragment donkey anti-human Fc from Jackson Immunoresearch and blocked with Superblock (Pierce). Serial dilutions of the variants were then added to the plate and allowed to bind. For measuring CNTO95 binding to αVβ3, biotinylated human αVβ3 was added, followed by streptavidin-HRP (Jackson Immunoresearch), and bound αVβ3 was detected using TMB substrate (Fitzgerald).
- The samples were also analyzed using the updated UNCLE instrument. This instrument measures intrinsic fluorescence with increasing temperature as an indication of protein unfolding and light scattering with increasing temperature as an indication of aggregation onset. The temperature at which a protein begins to unfold or aggregate can indicate its structural stability. For this analysis, temperature steps from 20° C. to 85° C. at 0.3° C. per minute were used.
- The characterization of CNTO95 variants is summarized in Table 4 below. The pIs of CNTO95 S7R, G9R, V11R, P14R, P41R, S71K, A88R, and S119R variants were 9.2, 9.2, 9.2, 9.2, 9.2, 9.1, 9.2, and 9.2, respectively, compared to the CNTO95 wildtype with a pI of 9.05. All the variants bound αVβ3 at least as well as the WT control.
FIG. 11 shows binding of the above variants compared to wildtype (CNTO95). CNTO148 was used as a negative control. The variants also gave an SE-HPLC profile that was very similar to the WT.FIGS. 12A-12I show the SE-HPLC profiles for CNTO95 wildtype (FIG. 12A ), S7R (FIG. 12B ), G9R (FIG. 12C ), V11R (FIG. 12D ), P14R (FIG. 12E ), P41R (FIG. 12F ), S71K (FIG. 12G ), A88R (FIG. 12H ) and S119R (FIG. 12I ). -
TABLE 4 CNTO95 Variant Characterization Summary cIEF Stability Kabat Banding % Charge Ag (Tm and position Mutation Pattern monomer Profile Binding Tagg) 7 S7R WT-like WT-like WT-like WT-like WT-like 9 G9R WT-like WT-like WT-like WT-like Greatly Decreased 11 V11R WT-like WT-like WT-like WT-like Decreased 14 P14R WT-like Slight WT-like WT-like Decreased Aggregation 41 P41R WT-like Slight WT-like WT-like Decreased Aggregation 74 S71K WT-like WT-like WT-like WT-like Decreased 84 A88R WT-like WT-like WT-like WT-like WT-like 113 S119R WT-like WT-like WT-like WT-like WT-like - The onset of aggregation (Tagg) for the S7R, G9R, V11R, P14R, P41R, S71K, A88R, and S119R variants occurred at 67.2° C. (
FIG. 13B ), 57.9° C. (FIG. 13C ), 63.9° C. (FIG. 13D ), 63.5° C. (FIG. 13E ), 66.4° C. (FIG. 13F ), 64.9° C. (FIG. 13G ), 67.6° C. (FIG. 13H ), and 66.7° C. (FIG. 13I ), compared to the onset of aggregation for wildtype CNTO95 which occurred at 68.2° C. (seeFIG. 13A ). - The unfolding temperature (Tm) of the S7R, G9R, V11R, P14R, P41R, S71K, A88R, and S119R variants occurred at 67.9° C. (
FIG. 14B ), 59.4° C. (FIG. 14C ), 64.8° C. (FIG. 14D ), 64.3° C. (FIG. 14E ), 66.8° C. (FIG. 14F ), 65.8° C. (FIG. 14G ), 68.0° C. (FIG. 14H ), and 67.6° C. (FIG. 14I ), respectively, compared to the unfolding temperature of the wildtype CNTO95 which occurred at 68.8° C. (FIG. 14A ). Variants that demonstrated a greater than 2° C. reduction in Tm and Tagg were regarded as having reduced stability and those that demonstrated a reduction greater than 5° C. were regarded as having greatly reduced stability. Of these variants, only the G9R variant demonstrated greatly reduced stability; it had a lower Tm by 9.4° C. and a lower onset of aggregation by 10.3° C. The V11R, P14R, P41R, and S71K variants demonstrated reduced stability. They had a lower Tm by 4° C., 4.5° C., 2° C., and 3° C., respectively, and a lower Tagg by 4.3° C., 4.7° C., 1.8° C., and 3.2° C., respectively. - To further examine the utility of amino acid substitutions at Kabat positions 74, 82a, and 84 in the heavy chain variable region to modify isoelectric point, variants of two additional antibodies, anti-TIM3 and anti-PD1 antibodies, were tested. TIMB337 is a monoclonal antibody that binds TIM3 (CD366), and PD1B244 is a monoclonal antibody that binds PD-1 (CD279). The pIs of TIMB337 and PD1B244 are 7.26 and 7.06 (for the IgG4 version); therefore, the difference in pI between these two homodimers and a bispecific formed by combining the two is less than 0.1 units. This was reflected on a CEX column where the resolution was observed to be 0.1.
- Amino acid substitutions in the heavy chain variable regions of TIM337 and PD1B244 at positions 74, 82a, and 84 (Kabat numbering) (corresponding to amino acid positions 75, 84, and 88 of SEQ ID NO: 2 and SEQ ID NO: 3, respectively) were initially tested to determine their ability to decrease the isoelectric point (pI) of these antibodies (see Tables 5 and 6). These substitutions were introduced either singly or in combination via modification of the nucleic acid molecule encoding the heavy chain variable region. The variants were expressed using Expi293 cells in 24-well plates.
-
TABLE 5 TIMB337 Antibody Variants Kabat Surface Structure position Mutation exposure (%) Location Comment 74 S75D 86 Near CDR protrudes 82a N84D 33 Near bottom On surface loop 84 A88D 45 Bottom loop On surface -
TABLE 6 PD1B244 Antibody Variants Kabat Surface Structure position Mutation exposure (%) Location Comment 74 S75D 78 Near CDR Mostly exposed 82a S84D 27 Near bottom Only the hydroxyl loop exposed 84 S88D 33 Bottom loop On surface - The TIMB377 and PD1B244 variants were expressed in 24 well plates and purified. The same panel of methods used for the characterization of the CNTO148 variants was used to analyze the TIMB377 and PD1B244 variants, including cSDS, SE-HPLC, cIEF. In this case cIEF was done with pH 3-10 and pH 5-8 ampholytes. Stability was measured using the Activa Optim2 as before. Antigen binding was also measured for each of the POC antibodies. An ELISA was used to measure TIM3 binding. Briefly, Maxisorp plates (Nunc) were coated with Streptavidin, and then blocked with PBS with 0.4% BSA. Biotinylated human TIM3-Fc fusion from R&D systems at a concentration of 1 ug/mL in PBS, 0.4% BSA was then bound. Serial dilutions of the variants were then added and allowed to bind. Next, peroxidase conjugated goat anti-human kappa (Southern Biotech) at a dilution of 1:5000 into PBS, 0.4% BSA was added (anti-FC was not used to avoid binding the TIM3-Fc fusion). Finally, TMB substrate (Fitzgerald) was used to for detection.
- To measure the binding of charge variants to PD1 the Proteon SPR instrument was used. For this, a GLC type sensor chip was prepared by covalently immobilizing goat anti-human/anti-mouse Fc antibody (in Na acetate pH 4.5) over flow cells of all 6 channels (˜5000 RU). Next, anti-PD1 mAbs were diluted to 0.001 mg/ml in PBSTE and captured over all ligand channels (˜180 RU). Finally, human PD1 antigen (100 nM-0.4 nM at 4-fold dilutions in PB STE) was injected over the anti-PD1 mAb captured channels and the association/dissociation profiles were monitored for 4 and 30 minutes, respectively. Regeneration was performed at the end of each titration cycle using 0.85% H3PO4. Data was analyzed to check for capture and binding interactions.
- Analysis of the TIMB377 variants showed they all behaved similarly to the wildtype (see Table 7). The pI of all three S75D N84D and A88D variants was 8.5 compared to the WT with a pI of 8.7. All three variants bound TIM3 at least as well as the WT (
FIG. 15 ), and they each gave an SE-HPLC profile that was very similar to the WT (FIGS. 16A-16D ). In addition, the onset of aggregation for the S75D, N84D and A88D variants at 67.5° C., 68.2° C. and 66.7° C., was similar to the WT onset at 68.5° C. (FIGS. 17A-17D ). -
TABLE 7 TIMB377 Substitution Variant Characterization cSDS cIEF Kabat banding % Charge Ag Stability position Mutation pattern monomer Profile Binding (Optim2) 74 S75D WT-like WT-like WT-like WT-like WT-like 82a N84D WT-like WT-like WT-like WT-like WT-like 84 A88D WT-like WT-like WT-like WT-like WT-like - PD1B244 single-substitution variant characterization results are shown in Table 8 below. In these experiments wildtype anti-PD1 showed a tendency to aggregate as evidenced by SE-HPLC, which made it difficult to determine if the substitutions had an effect on aggregation. The wildtype purity by SE-HPLC was 78% monomer, while the single mutants ranged from 51% to 95% monomeric. Previous experiments characterizing the PD-1 antibody showed that aggregation of this antibody is sensitive to temperature and pH, therefore, variability in the proportion of monomer could be attributed to differences in experimental conditions during the processing of the samples. For this reason, the variable proportion of monomer seen in some of the variants was not considered a valid basis on which to exclude these substitutions from further evaluation and % monomer was not included in the final analysis of the PD-1 antibody mutants. It should be noted, however, that further studies demonstrated that through process optimization such aggregation can be minimized significantly and the experiments currently described were performed in PBS without such optimization.
- The pIs of the S75D, S84D, and S88D variants were 8.6, 8.6 and 8.7 compared to the WT with a pI of 8.9. All three variants bound human PD1 with a KD that was similar to WT (
FIG. 18 ). They also gave an SE-HPLC profile that was very similar to the WT. In this case, the SE-HPLC profile of the WT anti-PD1 antibody included several bands that eluted earlier than the presumptive monomer peak. The number and appearance of these peaks was not affected by the charge substitutions (FIGS. 19A-19D ). In addition, the onset of aggregation for the S75D, S84D and S88D variants at 66.6° C., 66.1° C. & 66.5° C. were similar to the WT onset at 65.7° C. (FIGS. 20A-20D ). Aside from the variable SE-HPLC results for % monomer, all other data demonstrate that the 3 single mutations tested were all WT-like. -
TABLE 8 PD1B244 Substitution Variant Characterization cSDS cIEF Kabat banding SE-HPLC Charge Ag Stability position Mutation pattern profile Profile Binding (Optim2) 74 S75D WT-like WT-like WT-like WT-like WT-like 82a S84D WT-like WT-like WT-like WT-like WT-like 84 S88D WT-like WT-like WT-like WT-like WT-like - The pIs of four multiple substitution CNTO148 variants composed of S75D, N84D or A88D are shown in the Table 9 below. For the CNTO148 antibody, combining two of the substitutions gave a reduction in pI of between 0.25 and 0.31 pH units. Combining all three resulted in a decrease of 0.45 pH units.
-
TABLE 9 Isoelectric Point of CNTO148 Combination Variants Position (sequential) pl by dEF pl decrease WT 9.22 N84D A88D 8.97 0.25 S75D A88D 8.93 0.29 S75D N84D A88D 8.77 0.45 S75D N84D 8.91 0.31 - As shown in
FIG. 21 , all of the combination variants bound TNF similarly to the wildtype CNTO148. They also gave an SE-HPLC profile that was very similar to the WT (FIGS. 22A-22E ). In addition, both the conformational and colloidal stability of the variants was similar to the WT (Table 10 below,FIGS. 23A-23E andFIGS. 24A-24E ). The conformational stability of the variants (Tm) was within 0.5° C. of the WT and the colloidal stability (onset of aggregation) was within 0.7° C. of the WT. -
TABLE 10 Protein Stability of CNTO148 Combination Variants Conformational Colloidal Stability Stability WT 66.8° C. 66.5° C. N84D A88D 67.1° C. 66.8° C. S75D A88D 66.8° C. 66.8° C. S75D N84D 67.3° C. 67.1° C. S75D N84D A88D 66.9° C. 67.2° C. - Although preferred embodiments are depicted and described in detail herein, it will be apparent to those skilled in the relevant art that various modifications, additions, substitutions, and the like can be made without departing from the spirit of the invention and these are therefore considered to be within the scope of the invention as defined in the claims which follow.
Claims (17)
1. A method of enhancing separation of a bispecific antibody from its two parental antibodies, said method comprising:
providing a first and second parental antibody, each parental antibody comprising a heavy chain variable region;
substituting, in at least one of the first and second parental antibodies, one or more amino acid residues in the heavy chain variable region (VH) at positions 7, 9, 11, 14, 41, 70, 74, 82a, 84, and 113, according to the Kabat numbering system, wherein said substituting increases or decreases the isoelectric point of the first parental antibody relative to the second parental antibody;
producing the bispecific antibody from the two parental antibodies after said substituting;
separating the produced bispecific antibody from its two parental antibodies, wherein said separating is enhanced as a result of said substituting.
2. The method of claim 1 , wherein when the one or more amino acid residues of the VH at positions 7, 9, 11, 14, 41, 74, 84, and 113 (Kabat numbering) of the first parental antibody are neutrally charged amino acid residues, said substituting comprises:
exchanging said one or more neutrally charged amino acid residues with one or more positively charged amino acid residues to increase the isoelectric point of the first parental antibody.
3. The method of claim 1 , wherein when the one or more amino acid residues of the VH at positions 7, 9, 11, 14, 41, 74, 84, and 113 (Kabat numbering) of the first parental antibody are negatively charged amino acid residues, said substituting comprises:
exchanging said one or more negatively charged amino acid residues with one or more neutral or positively charged amino acid residues to increase the isoelectric point of the first parental antibody.
4. The method of claim 1 , wherein when the one or more amino acid residues of the VH at positions 9, 70, 74, 82a, and 84 (Kabat numbering) of the first parental antibody are neutrally charged amino acid residues, said substituting comprises:
exchanging said one or more neutrally charged amino acid residues with one or more negatively charged amino acid residues to decrease the isoelectric point of the first parental antibody.
5. The method of claim 1 , wherein when the one or more amino acid residues of the VH at positions 9, 70, 74, 82a, and 84 (Kabat numbering) of the first parental antibody are positively charged amino acid residues, said substituting comprises:
exchanging said one or more positively charged amino acid residues with one or more neutral or negatively charged amino acid residues to decrease the isoelectric point of the first parental antibody.
6. The method of claim 1 , wherein said substituting comprises:
exchanging the VH amino acid residue at position 74 (Kabat numbering) in the first parental antibody with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody.
7. The method of claim 1 , wherein said substituting comprises:
exchanging the VH amino acid residue at position 82a (Kabat numbering) in the first parental antibody with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody.
8. The method of claim 1 , wherein said substituting comprises:
exchanging the VH amino acid residue at position 84 (Kabat numbering) in the first parental antibody with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody.
9. The method of claim 1 , wherein said substituting comprises:
exchanging the VH amino acid residue at at least two of the positions selected from positions 74, 82a, and 84 (Kabat numbering) in the first parental antibody with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody.
10. The method of claim 1 , wherein said substituting comprises:
exchanging the VH amino acid residue at all three positions 74, 82a, and 84 (Kabat numbering) in the first parental antibody with a negatively charged amino acid residue to decrease the isoelectric point of the first parental antibody.
11. A multi-specific antibody comprising:
a first polypeptide comprising a heavy chain variable region and
a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is less than the isoelectric point of the second polypeptide and one or more amino acid residues at positions 9, 70, 74, 82a, and 84 (Kabat numbering) of the heavy chain variable region of the first polypeptide comprise a neutral or negatively charged amino acid residue and one or more amino acid residues at the corresponding positions of the heavy chain variable region of the second polypeptide comprise a differentially charged amino acid residue when compared to the first polypeptide.
12. The multi-specific antibody of claim 11 , wherein one or more amino acid residues at positions 7, 9, 11, 14, 41, 74, 84, and 113 of the heavy chain variable region of the second polypeptide comprise a neutral or positively charged amino acid residue, and one or more amino acid residues at the corresponding positions of the heavy chain variable region of the first polypeptide comprise a differentially charged amino acid residue when compared to the second polypeptide.
13. The multi-specific antibody of claim 11 , wherein the neutral or negatively charged amino acid residues at one or more positions 9, 70, 74, 82a, and 84 (Kabat numbering) are amino acid substitutions.
14. A multi-specific antibody comprising:
a first polypeptide comprising a heavy chain variable region and
a second polypeptide comprising a heavy chain variable region, wherein the isoelectric point of the first polypeptide is higher than the isoelectric point of the second polypeptide and one or more amino acid residues at positions 7, 9, 11, 14, 41, 74, 84, and 113 (Kabat numbering) of the heavy chain variable region of the first polypeptide comprise a neutral or positively charged amino acid residue and one or more amino acid residues at the corresponding positions of the heavy chain variable region of the second polypeptide comprise a differentially charged amino acid residue when compared to the first polypeptide.
15. The multi-specific antibody of claim 14 , wherein one or more amino acid residues at positions 9, 70, 74, 82a, and 84 (Kabat numbering) of the heavy chain variable region of the second polypeptide comprise a neutral or negatively charged amino acid residue and one or more amino acid residues at the corresponding positions of the heavy chain variable region of the first polypeptide comprise a differentially charged amino acid residue when compared to the second polypeptide.
16. The multi-specific antibody of claim 14 , wherein the neutral or positively charged amino acid residues at one or more positions 7, 9, 11, 14, 41, 74, 84, and 113 (Kabat numbering) are amino acid substitutions.
17. The multi-specific antibody of any one of claims 11 -16 , wherein said multi-specific antibody is a bi-specific antibody.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/523,058 US20220169741A1 (en) | 2017-06-05 | 2021-11-10 | Methods of Engineering Surface Charge for Bispecific Antibody Production |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201762515297P | 2017-06-05 | 2017-06-05 | |
US15/997,318 US11192951B2 (en) | 2017-06-05 | 2018-06-04 | Methods of engineering surface charge for bispecific antibody production |
US17/523,058 US20220169741A1 (en) | 2017-06-05 | 2021-11-10 | Methods of Engineering Surface Charge for Bispecific Antibody Production |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/997,318 Division US11192951B2 (en) | 2017-06-05 | 2018-06-04 | Methods of engineering surface charge for bispecific antibody production |
Publications (1)
Publication Number | Publication Date |
---|---|
US20220169741A1 true US20220169741A1 (en) | 2022-06-02 |
Family
ID=64566522
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/997,318 Active US11192951B2 (en) | 2017-06-05 | 2018-06-04 | Methods of engineering surface charge for bispecific antibody production |
US17/523,058 Pending US20220169741A1 (en) | 2017-06-05 | 2021-11-10 | Methods of Engineering Surface Charge for Bispecific Antibody Production |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/997,318 Active US11192951B2 (en) | 2017-06-05 | 2018-06-04 | Methods of engineering surface charge for bispecific antibody production |
Country Status (10)
Country | Link |
---|---|
US (2) | US11192951B2 (en) |
EP (1) | EP3634994A4 (en) |
JP (1) | JP7268011B2 (en) |
KR (1) | KR20200014385A (en) |
CN (1) | CN110959012A (en) |
AU (1) | AU2018279278A1 (en) |
BR (1) | BR112019025612A2 (en) |
CA (1) | CA3065447A1 (en) |
MX (1) | MX2019014572A (en) |
WO (1) | WO2018224950A1 (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP7375027B2 (en) * | 2019-02-14 | 2023-11-07 | メルス ナムローゼ フェンノートシャップ | Production of compositions containing two or more antibodies |
WO2021194839A1 (en) * | 2020-03-25 | 2021-09-30 | Eli Lilly And Company | Multispecific binding proteins and methods of developing the same |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20150285806A1 (en) * | 2012-12-21 | 2015-10-08 | Chugai Seiyaku Kabushiki Kaisha | Gpc3-targeting drug which is administered to patient responsive to gpc3-targeting drug therapy |
US20160229908A1 (en) * | 2015-02-05 | 2016-08-11 | Chugai Seiyaku Kabushiki Kaisha | Antibodies Comprising an Ion Concentration Dependent Antigen-Binding Domain, Fc Region Variants, IL-8-Binding Antibodies, and Uses Thereof |
US20170096479A1 (en) * | 2015-09-23 | 2017-04-06 | Genentech, Inc. | Optimized variants of anti-vegf antibodies |
Family Cites Families (20)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
US7879328B2 (en) | 2000-06-16 | 2011-02-01 | Human Genome Sciences, Inc. | Antibodies that immunospecifically bind to B lymphocyte stimulator |
US8188231B2 (en) | 2002-09-27 | 2012-05-29 | Xencor, Inc. | Optimized FC variants |
WO2006028936A2 (en) | 2004-09-02 | 2006-03-16 | Genentech, Inc. | Heteromultimeric molecules |
US8802820B2 (en) | 2004-11-12 | 2014-08-12 | Xencor, Inc. | Fc variants with altered binding to FcRn |
WO2006124269A2 (en) * | 2005-05-16 | 2006-11-23 | Amgen Fremont Inc. | Human monoclonal antibodies that bind to very late antigen-1 for the treatment of inflammation and other disorders |
DK1931709T3 (en) | 2005-10-03 | 2017-03-13 | Xencor Inc | FC VARIETIES WITH OPTIMIZED FC RECEPTOR BINDING PROPERTIES |
EP2009101B1 (en) | 2006-03-31 | 2017-10-25 | Chugai Seiyaku Kabushiki Kaisha | Antibody modification method for purifying bispecific antibody |
JP5334319B2 (en) | 2007-09-26 | 2013-11-06 | 中外製薬株式会社 | Method for modifying isoelectric point of antibody by amino acid substitution of CDR |
EP2318436A4 (en) * | 2008-08-14 | 2012-12-19 | Cephalon Australia Pty Ltd | Variant domain antibodies |
PE20120562A1 (en) * | 2009-05-15 | 2012-06-06 | Chugai Pharmaceutical Co Ltd | ANTI-AXL ANTIBODY |
GB201003701D0 (en) * | 2010-03-05 | 2010-04-21 | Cilian Ag | System for the expression of a protein |
NZ701825A (en) | 2010-04-20 | 2016-06-24 | Genmab As | Heterodimeric antibody fc-containing proteins and methods for production thereof |
AU2013326901B2 (en) * | 2012-10-04 | 2018-05-31 | Dana-Farber Cancer Institute, Inc. | Human monoclonal anti-PD-L1 antibodies and methods of use |
US9605084B2 (en) | 2013-03-15 | 2017-03-28 | Xencor, Inc. | Heterodimeric proteins |
AU2014244444A1 (en) * | 2013-03-14 | 2015-09-24 | Amgen Inc. | CHRDL-1 antigen binding proteins and methods of treatment |
EP3288975A1 (en) * | 2015-04-29 | 2018-03-07 | Institute for Research in Biomedicine | Ultra-potent neutralization of cytokines by multispecific antibodies and uses thereof |
WO2016207278A1 (en) | 2015-06-23 | 2016-12-29 | Innate Pharma | Multispecific nk engager proteins |
JP6266164B2 (en) * | 2015-09-18 | 2018-01-31 | 中外製薬株式会社 | Antibodies that bind to IL-8 and uses thereof |
ES2847155T3 (en) | 2016-01-21 | 2021-08-02 | Novartis Ag | Multispecific molecules targeting CLL-1 |
-
2018
- 2018-06-04 EP EP18813385.4A patent/EP3634994A4/en active Pending
- 2018-06-04 CA CA3065447A patent/CA3065447A1/en active Pending
- 2018-06-04 KR KR1020197038976A patent/KR20200014385A/en active IP Right Grant
- 2018-06-04 US US15/997,318 patent/US11192951B2/en active Active
- 2018-06-04 BR BR112019025612-1A patent/BR112019025612A2/en unknown
- 2018-06-04 MX MX2019014572A patent/MX2019014572A/en unknown
- 2018-06-04 JP JP2020516972A patent/JP7268011B2/en active Active
- 2018-06-04 CN CN201880050468.8A patent/CN110959012A/en active Pending
- 2018-06-04 AU AU2018279278A patent/AU2018279278A1/en active Pending
- 2018-06-04 WO PCT/IB2018/053996 patent/WO2018224950A1/en unknown
-
2021
- 2021-11-10 US US17/523,058 patent/US20220169741A1/en active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20150285806A1 (en) * | 2012-12-21 | 2015-10-08 | Chugai Seiyaku Kabushiki Kaisha | Gpc3-targeting drug which is administered to patient responsive to gpc3-targeting drug therapy |
US20160229908A1 (en) * | 2015-02-05 | 2016-08-11 | Chugai Seiyaku Kabushiki Kaisha | Antibodies Comprising an Ion Concentration Dependent Antigen-Binding Domain, Fc Region Variants, IL-8-Binding Antibodies, and Uses Thereof |
US20170096479A1 (en) * | 2015-09-23 | 2017-04-06 | Genentech, Inc. | Optimized variants of anti-vegf antibodies |
Non-Patent Citations (3)
Title |
---|
Lloyd et al. Protein Engineering, Design & Selection 22:159-168 (Year: 2009) * |
Piche-Nicholas et al MABS 10(1): 81-94 (Year: 2018) * |
Wu et al., J. Mol. Biol. 294: 151-162 (Year: 1999) * |
Also Published As
Publication number | Publication date |
---|---|
RU2019143638A (en) | 2021-07-09 |
CN110959012A (en) | 2020-04-03 |
CA3065447A1 (en) | 2018-12-13 |
US11192951B2 (en) | 2021-12-07 |
BR112019025612A2 (en) | 2020-06-16 |
AU2018279278A1 (en) | 2019-12-19 |
JP7268011B2 (en) | 2023-05-02 |
EP3634994A4 (en) | 2021-06-30 |
RU2019143638A3 (en) | 2022-02-10 |
JP2020522573A (en) | 2020-07-30 |
US20190031764A1 (en) | 2019-01-31 |
EP3634994A1 (en) | 2020-04-15 |
KR20200014385A (en) | 2020-02-10 |
WO2018224950A1 (en) | 2018-12-13 |
MX2019014572A (en) | 2020-07-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
TWI754800B (en) | Novel anti-ox40/pd-l1 bispecific antibody molecule, novel anti-vegf/gitr bispecific antibody molecule and use thereof | |
JP2022536898A (en) | NOVEL IL-15 PRODRUGS AND METHODS OF USE THEREOF | |
EP3551662A1 (en) | Anti-tim-3 antibodies for combination with anti-pd-1 antibodies | |
CA3081117A1 (en) | Triple-chain antibody, method for preparation and use thereof | |
US20170058033A1 (en) | PD-L1 Antibodies | |
US20220169741A1 (en) | Methods of Engineering Surface Charge for Bispecific Antibody Production | |
WO2019184909A1 (en) | Novel antibody molecule, and preparation method and use thereof | |
EP2994490A1 (en) | Bispecific constructs and their use in the treatment of various diseases | |
JP2020511997A (en) | Tumor antigen presentation inducer construct and use thereof | |
WO2021218684A1 (en) | Tetravalent bispecific antibody, preparation method therefor, and use thereof | |
CN114401997A (en) | Cytokine prodrugs and dual prodrugs | |
JP2019534044A (en) | Anti-PD1 and anti-CTLA4 antibodies | |
CA3173519A1 (en) | Method for producing multispecific antigen-binding molecules | |
WO2016031932A1 (en) | METHOD FOR PRODUCING PROTEIN HAVING Fc REGION BY ALKALI WASHING | |
RU2803096C2 (en) | Methods of surface charge modification to obtain bispecific antibodies | |
JP7292526B2 (en) | Engineered anti-IL-2 antibodies | |
JP2019516785A (en) | Affinity engineered serum protein carrier binding domain | |
KR20240056666A (en) | Methods of engineering surface charge for bispecific antibody production | |
TW202128758A (en) | Multispecific fusion protein and use thereof | |
US20220127360A1 (en) | Tetravalent bispecific antibody against pd-1 and vegf, preparation method therefor, and use thereof | |
RU2021112298A (en) | NEW PROTEIN COMPOSITIONS OBTAINED BY RATIONAL DESIGN | |
KR20240049318A (en) | FAP/CD40 binding molecules and their medical uses |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |