US20210355209A1 - Multi-specific binding molecules targeting aberrant cells - Google Patents
Multi-specific binding molecules targeting aberrant cells Download PDFInfo
- Publication number
- US20210355209A1 US20210355209A1 US17/379,822 US202117379822A US2021355209A1 US 20210355209 A1 US20210355209 A1 US 20210355209A1 US 202117379822 A US202117379822 A US 202117379822A US 2021355209 A1 US2021355209 A1 US 2021355209A1
- Authority
- US
- United States
- Prior art keywords
- binding
- disclosure
- molecules
- domains
- proteinaceous
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 230000009870 specific binding Effects 0.000 title claims abstract description 47
- 230000001594 aberrant effect Effects 0.000 title abstract description 79
- 230000008685 targeting Effects 0.000 title description 21
- 230000027455 binding Effects 0.000 claims abstract description 333
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 8
- 230000014509 gene expression Effects 0.000 claims description 30
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 30
- 239000012636 effector Substances 0.000 claims description 26
- 108020004707 nucleic acids Proteins 0.000 claims description 24
- 102000039446 nucleic acids Human genes 0.000 claims description 24
- 150000007523 nucleic acids Chemical class 0.000 claims description 24
- 102000005962 receptors Human genes 0.000 claims description 23
- 108020003175 receptors Proteins 0.000 claims description 23
- 239000012634 fragment Substances 0.000 claims description 20
- 238000000034 method Methods 0.000 claims description 18
- 239000000178 monomer Substances 0.000 claims description 16
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 16
- 239000003446 ligand Substances 0.000 claims description 15
- 229920001184 polypeptide Polymers 0.000 claims description 12
- 239000013598 vector Substances 0.000 claims description 11
- 238000004519 manufacturing process Methods 0.000 claims description 10
- 238000012258 culturing Methods 0.000 claims description 2
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 2
- 206010028980 Neoplasm Diseases 0.000 abstract description 58
- 238000011282 treatment Methods 0.000 abstract description 55
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 11
- 201000010099 disease Diseases 0.000 abstract description 10
- 230000031018 biological processes and functions Effects 0.000 abstract description 8
- 230000001413 cellular effect Effects 0.000 abstract description 7
- 208000023275 Autoimmune disease Diseases 0.000 abstract description 6
- 210000004027 cell Anatomy 0.000 description 186
- 241000282414 Homo sapiens Species 0.000 description 61
- 108091008874 T cell receptors Proteins 0.000 description 48
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 47
- 239000000427 antigen Substances 0.000 description 34
- 102000036639 antigens Human genes 0.000 description 34
- 108091007433 antigens Proteins 0.000 description 34
- 108090000623 proteins and genes Proteins 0.000 description 34
- 210000001744 T-lymphocyte Anatomy 0.000 description 30
- 102000004169 proteins and genes Human genes 0.000 description 24
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 23
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 23
- 210000004881 tumor cell Anatomy 0.000 description 18
- 201000011510 cancer Diseases 0.000 description 16
- 230000000694 effects Effects 0.000 description 16
- 230000001225 therapeutic effect Effects 0.000 description 14
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 13
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 13
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 12
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 12
- 108060003951 Immunoglobulin Proteins 0.000 description 12
- 102000018358 immunoglobulin Human genes 0.000 description 12
- 201000001441 melanoma Diseases 0.000 description 12
- 235000002198 Annona diversifolia Nutrition 0.000 description 11
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 10
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 10
- 125000003275 alpha amino acid group Chemical group 0.000 description 10
- 230000008901 benefit Effects 0.000 description 10
- 239000013615 primer Substances 0.000 description 10
- 244000303258 Annona diversifolia Species 0.000 description 9
- 241000894006 Bacteria Species 0.000 description 9
- 108010035452 HLA-A1 Antigen Proteins 0.000 description 9
- 102000008100 Human Serum Albumin Human genes 0.000 description 9
- 108091006905 Human Serum Albumin Proteins 0.000 description 9
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 9
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 9
- 102100034256 Mucin-1 Human genes 0.000 description 9
- 108010008707 Mucin-1 Proteins 0.000 description 9
- 102100035703 Prostatic acid phosphatase Human genes 0.000 description 9
- 238000010367 cloning Methods 0.000 description 9
- 230000003993 interaction Effects 0.000 description 9
- 230000001404 mediated effect Effects 0.000 description 9
- 239000000203 mixture Substances 0.000 description 9
- 108020004414 DNA Proteins 0.000 description 8
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 8
- 102100038358 Prostate-specific antigen Human genes 0.000 description 8
- 125000000539 amino acid group Chemical group 0.000 description 8
- 238000010276 construction Methods 0.000 description 8
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 8
- 239000002953 phosphate buffered saline Substances 0.000 description 8
- 239000011324 bead Substances 0.000 description 7
- 239000002299 complementary DNA Substances 0.000 description 7
- 230000001965 increasing effect Effects 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 108010043671 prostatic acid phosphatase Proteins 0.000 description 7
- 238000002560 therapeutic procedure Methods 0.000 description 7
- 230000006907 apoptotic process Effects 0.000 description 6
- 230000001976 improved effect Effects 0.000 description 6
- 206010006187 Breast cancer Diseases 0.000 description 5
- 208000026310 Breast neoplasm Diseases 0.000 description 5
- 206010009944 Colon cancer Diseases 0.000 description 5
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 5
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 5
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 5
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 5
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 5
- 230000001270 agonistic effect Effects 0.000 description 5
- 150000001413 amino acids Chemical class 0.000 description 5
- 230000003321 amplification Effects 0.000 description 5
- 229940072221 immunoglobulins Drugs 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- 210000002752 melanocyte Anatomy 0.000 description 5
- 238000003199 nucleic acid amplification method Methods 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 4
- 102000004506 Blood Proteins Human genes 0.000 description 4
- 108010017384 Blood Proteins Proteins 0.000 description 4
- 101100123850 Caenorhabditis elegans her-1 gene Proteins 0.000 description 4
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 description 4
- 102000001301 EGF receptor Human genes 0.000 description 4
- 108060006698 EGF receptor Proteins 0.000 description 4
- 101150029707 ERBB2 gene Proteins 0.000 description 4
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 4
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 4
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 206010033128 Ovarian cancer Diseases 0.000 description 4
- 206010061535 Ovarian neoplasm Diseases 0.000 description 4
- 108010076504 Protein Sorting Signals Proteins 0.000 description 4
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 4
- 108010060804 Toll-Like Receptor 4 Proteins 0.000 description 4
- 102000008228 Toll-like receptor 2 Human genes 0.000 description 4
- 108010060888 Toll-like receptor 2 Proteins 0.000 description 4
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 4
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 4
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 4
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 210000001072 colon Anatomy 0.000 description 4
- 238000004132 cross linking Methods 0.000 description 4
- 231100000433 cytotoxic Toxicity 0.000 description 4
- 230000001472 cytotoxic effect Effects 0.000 description 4
- 238000013461 design Methods 0.000 description 4
- 239000000539 dimer Substances 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 239000000833 heterodimer Substances 0.000 description 4
- 206010039073 rheumatoid arthritis Diseases 0.000 description 4
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 3
- 102100022089 Acyl-[acyl-carrier-protein] hydrolase Human genes 0.000 description 3
- 101710094856 Apoptin Proteins 0.000 description 3
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 238000001712 DNA sequencing Methods 0.000 description 3
- 241000206602 Eukaryota Species 0.000 description 3
- 108010088729 HLA-A*02:01 antigen Proteins 0.000 description 3
- 108010013476 HLA-A24 Antigen Proteins 0.000 description 3
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 3
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 3
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 3
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 3
- 101000874179 Homo sapiens Syndecan-1 Proteins 0.000 description 3
- 102100034872 Kallikrein-4 Human genes 0.000 description 3
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 3
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 3
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 3
- 102000003735 Mesothelin Human genes 0.000 description 3
- 108090000015 Mesothelin Proteins 0.000 description 3
- 102100023123 Mucin-16 Human genes 0.000 description 3
- 208000034578 Multiple myelomas Diseases 0.000 description 3
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 3
- 206010057249 Phagocytosis Diseases 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 102100035721 Syndecan-1 Human genes 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- 230000003281 allosteric effect Effects 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 230000004186 co-expression Effects 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 230000002939 deleterious effect Effects 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 230000013595 glycosylation Effects 0.000 description 3
- 238000006206 glycosylation reaction Methods 0.000 description 3
- 229940088597 hormone Drugs 0.000 description 3
- 239000005556 hormone Substances 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 108010024383 kallikrein 4 Proteins 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 238000012737 microarray-based gene expression Methods 0.000 description 3
- 108091005763 multidomain proteins Proteins 0.000 description 3
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 3
- 210000000822 natural killer cell Anatomy 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 230000008782 phagocytosis Effects 0.000 description 3
- 230000012846 protein folding Effects 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- LOGFVTREOLYCPF-KXNHARMFSA-N (2s,3r)-2-[[(2r)-1-[(2s)-2,6-diaminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxybutanoic acid Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]1CCCN1C(=O)[C@@H](N)CCCCN LOGFVTREOLYCPF-KXNHARMFSA-N 0.000 description 2
- 108091071247 Beta family Proteins 0.000 description 2
- 102100032912 CD44 antigen Human genes 0.000 description 2
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 2
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 2
- 102000019034 Chemokines Human genes 0.000 description 2
- 108010012236 Chemokines Proteins 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- 241000699802 Cricetulus griseus Species 0.000 description 2
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 2
- 239000003155 DNA primer Substances 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 101150084967 EPCAM gene Proteins 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108010087819 Fc receptors Proteins 0.000 description 2
- 102000009109 Fc receptors Human genes 0.000 description 2
- 239000013637 GPCR dimer Substances 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 2
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 2
- 101001057612 Homo sapiens Dual specificity protein phosphatase 5 Proteins 0.000 description 2
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 2
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 2
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 2
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 2
- 101001100327 Homo sapiens RNA-binding protein 45 Proteins 0.000 description 2
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 2
- 102000006992 Interferon-alpha Human genes 0.000 description 2
- 108010047761 Interferon-alpha Proteins 0.000 description 2
- 102000008070 Interferon-gamma Human genes 0.000 description 2
- 108010074328 Interferon-gamma Proteins 0.000 description 2
- 102000003777 Interleukin-1 beta Human genes 0.000 description 2
- 108090000193 Interleukin-1 beta Proteins 0.000 description 2
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 2
- 108010038501 Interleukin-6 Receptors Proteins 0.000 description 2
- 241000282838 Lama Species 0.000 description 2
- 206010025323 Lymphomas Diseases 0.000 description 2
- 102100022430 Melanocyte protein PMEL Human genes 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 2
- 102000008730 Nestin Human genes 0.000 description 2
- 108010088225 Nestin Proteins 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 229930040373 Paraformaldehyde Natural products 0.000 description 2
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 2
- 102100038823 RNA-binding protein 45 Human genes 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- 101800001271 Surface protein Proteins 0.000 description 2
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 2
- 102000002689 Toll-like receptor Human genes 0.000 description 2
- 108020000411 Toll-like receptor Proteins 0.000 description 2
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 2
- 101710202239 Tubulin beta-3 chain Proteins 0.000 description 2
- 102000003425 Tyrosinase Human genes 0.000 description 2
- 108060008724 Tyrosinase Proteins 0.000 description 2
- 108091008605 VEGF receptors Proteins 0.000 description 2
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 2
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 239000002771 cell marker Substances 0.000 description 2
- -1 cell surface markers Proteins 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 230000001332 colony forming effect Effects 0.000 description 2
- 230000024203 complement activation Effects 0.000 description 2
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000006471 dimerization reaction Methods 0.000 description 2
- 230000003292 diminished effect Effects 0.000 description 2
- 230000008029 eradication Effects 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 229940044627 gamma-interferon Drugs 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 208000005017 glioblastoma Diseases 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 210000005055 nestin Anatomy 0.000 description 2
- 230000001537 neural effect Effects 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 229920002866 paraformaldehyde Polymers 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 230000035515 penetration Effects 0.000 description 2
- 230000000861 pro-apoptotic effect Effects 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000003252 repetitive effect Effects 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 230000011664 signaling Effects 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 230000002195 synergetic effect Effects 0.000 description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 2
- 210000001550 testis Anatomy 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 239000000439 tumor marker Substances 0.000 description 2
- SSOORFWOBGFTHL-OTEJMHTDSA-N (4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-[[(2S)-5-carbamimidamido-1-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-1-oxopentan-2-yl]amino]-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SSOORFWOBGFTHL-OTEJMHTDSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 102100035248 Alpha-(1,3)-fucosyltransferase 4 Human genes 0.000 description 1
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 1
- 102220486094 Alpha-galactosidase A_W47G_mutation Human genes 0.000 description 1
- 102100034668 Alpha-lactalbumin Human genes 0.000 description 1
- 102100022749 Aminopeptidase N Human genes 0.000 description 1
- 101100136076 Aspergillus oryzae (strain ATCC 42149 / RIB 40) pel1 gene Proteins 0.000 description 1
- 208000025324 B-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 238000000035 BCA protein assay Methods 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 102100030802 Beta-2-glycoprotein 1 Human genes 0.000 description 1
- 101710180007 Beta-2-glycoprotein 1 Proteins 0.000 description 1
- 101100263837 Bovine ephemeral fever virus (strain BB7721) beta gene Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 108700012439 CA9 Proteins 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 241001429175 Colitis phage Species 0.000 description 1
- 102000016550 Complement Factor H Human genes 0.000 description 1
- 108010053085 Complement Factor H Proteins 0.000 description 1
- 102000000989 Complement System Proteins Human genes 0.000 description 1
- 108010069112 Complement System Proteins Proteins 0.000 description 1
- 241000186031 Corynebacteriaceae Species 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 102220520397 DNA polymerase beta_R83K_mutation Human genes 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 101100316840 Enterobacteria phage P4 Beta gene Proteins 0.000 description 1
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 1
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 102220548181 F-box-like/WD repeat-containing protein TBL1X_L108Q_mutation Human genes 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- 108010080865 Factor XII Proteins 0.000 description 1
- 102000000429 Factor XII Human genes 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 201000003741 Gastrointestinal carcinoma Diseases 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- 201000010915 Glioblastoma multiforme Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108010086377 HLA-A3 Antigen Proteins 0.000 description 1
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101001022185 Homo sapiens Alpha-(1,3)-fucosyltransferase 4 Proteins 0.000 description 1
- 101000946384 Homo sapiens Alpha-lactalbumin Proteins 0.000 description 1
- 101000757160 Homo sapiens Aminopeptidase N Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101001034314 Homo sapiens Lactadherin Proteins 0.000 description 1
- 101001008874 Homo sapiens Mast/stem cell growth factor receptor Kit Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 1
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101100369992 Homo sapiens TNFSF10 gene Proteins 0.000 description 1
- 102000009438 IgE Receptors Human genes 0.000 description 1
- 108010073816 IgE Receptors Proteins 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100022338 Integrin alpha-M Human genes 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 102000004556 Interleukin-15 Receptors Human genes 0.000 description 1
- 108010017535 Interleukin-15 Receptors Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000010787 Interleukin-4 Receptors Human genes 0.000 description 1
- 108010038486 Interleukin-4 Receptors Proteins 0.000 description 1
- 102000010781 Interleukin-6 Receptors Human genes 0.000 description 1
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 102100039648 Lactadherin Human genes 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 108010010995 MART-1 Antigen Proteins 0.000 description 1
- 102100027754 Mast/stem cell growth factor receptor Kit Human genes 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 102000013760 Microphthalmia-Associated Transcription Factor Human genes 0.000 description 1
- 108010050345 Microphthalmia-Associated Transcription Factor Proteins 0.000 description 1
- 108010008705 Mucin-2 Proteins 0.000 description 1
- 102100034263 Mucin-2 Human genes 0.000 description 1
- 102000015728 Mucins Human genes 0.000 description 1
- 108010063954 Mucins Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101500027988 Mus musculus ADGRV1 subunit beta Proteins 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 1
- 102000003729 Neprilysin Human genes 0.000 description 1
- 108090000028 Neprilysin Proteins 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108091008606 PDGF receptors Proteins 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 102100036899 Parathyroid hormone-related protein Human genes 0.000 description 1
- 101710123753 Parathyroid hormone-related protein Proteins 0.000 description 1
- 102000013566 Plasminogen Human genes 0.000 description 1
- 108010051456 Plasminogen Proteins 0.000 description 1
- 102000011653 Platelet-Derived Growth Factor Receptors Human genes 0.000 description 1
- 101710120463 Prostate stem cell antigen Proteins 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101710100968 Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 102100037253 Solute carrier family 45 member 3 Human genes 0.000 description 1
- 102000004584 Somatomedin Receptors Human genes 0.000 description 1
- 108010017622 Somatomedin Receptors Proteins 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 108700042077 T-Cell Receptor beta Genes Proteins 0.000 description 1
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 108700012411 TNFSF10 Proteins 0.000 description 1
- 108010033576 Transferrin Receptors Proteins 0.000 description 1
- 102100026144 Transferrin receptor protein 1 Human genes 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 102100024598 Tumor necrosis factor ligand superfamily member 10 Human genes 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 108010031318 Vitronectin Proteins 0.000 description 1
- 102100035140 Vitronectin Human genes 0.000 description 1
- 102220494535 Zinc finger protein 106_W103R_mutation Human genes 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 238000009098 adjuvant therapy Methods 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 230000008856 allosteric binding Effects 0.000 description 1
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 1
- SRHNADOZAAWYLV-XLMUYGLTSA-N alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@H]1O[C@H]1[C@H](O[C@H]2[C@@H]([C@@H](NC(C)=O)[C@H](O)O[C@@H]2CO)O[C@H]2[C@H]([C@H](O)[C@H](O)[C@H](C)O2)O)O[C@H](CO)[C@H](O)[C@@H]1O SRHNADOZAAWYLV-XLMUYGLTSA-N 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 102000015736 beta 2-Microglobulin Human genes 0.000 description 1
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 229960001714 calcium phosphate Drugs 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 230000004709 cell invasion Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000005889 cellular cytotoxicity Effects 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000009096 combination chemotherapy Methods 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 102220481545 eIF5-mimic protein 2_E6A_mutation Human genes 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000012407 engineering method Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 229960000301 factor viii Drugs 0.000 description 1
- 235000013861 fat-free Nutrition 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 102000006815 folate receptor Human genes 0.000 description 1
- 108020005243 folate receptor Proteins 0.000 description 1
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 230000024924 glomerular filtration Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000002962 histologic effect Effects 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 239000002471 hydroxymethylglutaryl coenzyme A reductase inhibitor Substances 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 229940027941 immunoglobulin g Drugs 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 239000002054 inoculum Substances 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 229940117681 interleukin-12 Drugs 0.000 description 1
- 102000003898 interleukin-24 Human genes 0.000 description 1
- 108090000237 interleukin-24 Proteins 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 229940051875 mucins Drugs 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 238000006384 oligomerization reaction Methods 0.000 description 1
- 230000000771 oncological effect Effects 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 101150040383 pel2 gene Proteins 0.000 description 1
- 101150050446 pelB gene Proteins 0.000 description 1
- 230000007903 penetration ability Effects 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000002987 primer (paints) Substances 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000000135 prohibitive effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 108010079891 prostein Proteins 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000002702 ribosome display Methods 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 102220283785 rs1344101243 Human genes 0.000 description 1
- 102220039281 rs199473357 Human genes 0.000 description 1
- 102220054109 rs72474224 Human genes 0.000 description 1
- 102220188446 rs767659113 Human genes 0.000 description 1
- 102220201545 rs886041401 Human genes 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 229940053191 simply saline Drugs 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 230000009258 tissue cross reactivity Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 229940086542 triethylamine Drugs 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 230000002476 tumorcidal effect Effects 0.000 description 1
- 239000007160 ty medium Substances 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 108010047303 von Willebrand Factor Proteins 0.000 description 1
- 102100036537 von Willebrand factor Human genes 0.000 description 1
- 229960001134 von willebrand factor Drugs 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- the disclosure relates to the field of antibody-like molecules targeted at aberrant cells in autoimmune diseases and cancers.
- the disclosure also relates to such proteinaceous molecules targeting aberrant cells, while leaving normal cells essentially unaffected. More in particular, the disclosure relates to (single-chain) proteinaceous molecules comprising binding domains specific for at least two different binding sites on aberrant cells.
- the major challenge for today's drug discovery community is the design of therapeutic molecules that are sufficiently specific for aberrant cells related to malignancies, such as cancers and autoimmune diseases. Such specificity is required to attain acceptable low drug-related adverse reactions for healthy cells.
- the major hurdle to overcome is the presence of target molecules, not only on/at aberrant cells, but also on healthy cells, albeit at lower frequency. Truly tumor-specific targets or aberrant cell-specific targets are very rare.
- proteinaceous binding molecules with improved specificity for targeting aberrant cells, accompanied by a reduced risk for unwanted side effects induced by unintentionally targeting normal cells.
- a proteinaceous molecule comprising at least two different specific binding domains for different binding sites separated by at least one linker, wherein the proteinaceous molecule comprises a single polypeptide chain.
- proteinaceous molecules are molecules comprising at least a string of amino acid residues that can be obtained as an expression product from a single messenger RNA molecule.
- the proteinaceous molecules may comprise carbohydrates, disulphide bonds, phosphorylations, sulphatations, etc., as a result of any post-translational modification, and/or any other modification such as those resulting from chemical modifications (e.g., linking of effector moieties).
- the proteinaceous molecules comprise a single polypeptide chain comprising at least two specific binding domains.
- the proteinaceous molecules of the disclosure comprise binding domains separated by at least one linker.
- the proteinaceous molecules of the disclosure can also comprise other functionalities, for example, provided with protein domains or amino acid sequences, linked through peptide bonds or through any linker chemistry known in the art.
- a “polypeptide chain” is defined as a string of amino acid residues.
- “Specific binding domains” are domains that preferentially bind to binding sites on molecules, such as epitopes, with a higher binding affinity than background interactions between molecules.
- background interactions are interactions with an affinity lower than a K D of 10E-4 M.
- specific binding domains bind with an affinity higher than a K D of about 10E-5 M.
- Specific binding domains in the proteinaceous molecules of the disclosure have at least a molecular size allowing their folding into a binding site. At the upper size limit, the binding domains have a size still allowing proper and stable folding and expression.
- domains meeting these size requirements are approximately 25 up to 500 amino acid residues in length, and preferred domains are 40 to 200 amino acid residues in length, and, more preferably, domains are about the size of a variable domain of a heavy chain of an immunoglobulin (“Vh”).
- Vh immunoglobulin
- specific binding domains present in immune molecules such as those present in T-cell receptors and immunoglobulins.
- a Vh sequence is a preferred specific binding domain in the proteinaceous molecules of the disclosure.
- Vh domains are especially suitable for use as a specific binding domain.
- Vh domains are relatively stable and easy to obtain via various expression systems.
- engineering methods to further improve, for example, domain stability or solubility are readily available.
- An available good source for such binding domains consisting of Vh sequences are phage display libraries.
- a good source for such binding domains are natural libraries, synthetic libraries and semi-synthetic libraries.
- the specific binding domains in the proteinaceous molecules of the disclosure are separated by at least one linker.
- these linkers are connected with binding domains through peptide bonds.
- a simple Gly-Ser linker of 4-15 amino-acid residues may suffice, but if greater flexibility of the amino-acid chain is desired and/or when greater spacing between consecutive domains is desired, longer or more complex linkers may be used.
- Preferred linkers are (Gly 4 Ser) n (SEQ ID. NO:11), (GlySerThrSerGlySer) n (SEQ ID.
- linker any other linker that provides flexibility for protein folding and flexibility for the polypeptide to exhibit its dual or multiple activity, i.e., binding to two or more different binding sites.
- linker sequences connecting domains in human multi-domain plasma proteins.
- linker sequences adapted from multi-domain plasma proteins including immunoglobulins has several advantages. Use of these human amino-acid sequences that are exposed in plasma in the molecules of the disclosure may lower the risk for adverse immune responses.
- linker sequences are optimized by natural selection to provide multi-domain proteins required inter-domain flexibility for exerting several protein-target interactions simultaneously, involving two or more domains in the multi-domain protein.
- Examples of such multi-domain plasma proteins comprising inter-domain linkers are vitronectin, fibrinogen, factor VIII, fibronectin, von Willebrand factor, factor XII, plasminogen, factor H, factor I, C1, C3, beta2-glycoprotein 1, immunoglobulin M, and immunoglobulin G.
- Examples of linkers particularly suitable for covalently connecting domains in the single-chain molecules of the disclosure are linkers based on amino-acid sequences of hinge regions in immunoglobulins of preferably human origin.
- the at least two specific binding domains of the proteinaceous molecules of the disclosure are different binding domains, endowed with binding affinity for at least two different binding sites.
- binding sites are (parts of) molecules associated with the cell surface of aberrant cells. It is part of the disclosure that the different binding sites are part of different molecules, or are located on the same molecule, or any combination thereof.
- the at least two different binding sites targeted by the at least two different specific binding domains of the proteinaceous molecules of the disclosure are associated with the cell surface of aberrant cells.
- the different binding sites are co-located at the surface of the same aberrant cell.
- Preferred binding sites are binding sites located at aberrant cell surface molecules. Examples of such cell surface molecules are integrins, cell surface receptors, cell surface markers, and major histocompatibility complex molecules complexed with T-cell epitopes.
- aberrant cell is defined as a cell that deviates from its healthy normal counterparts. Aberrant cells are, for example, tumor cells and autoimmune cells.
- proteinaceous molecules comprising at least two different specific binding domains that are particularly suitable for binding to at least two different binding sites associated with the cell surface of aberrant cells.
- multi-specific proteinaceous molecules By targeting with a single binding molecule two or more target binding sites on an aberrant cell such as a tumor cell, the risk that both targets are also present on one healthy cell is significantly diminished.
- the affinity of the binding molecules for the different target binding sites separately preferably is designed such that Kon and Koff are very much skewed towards binding with all different binding sites simultaneously.
- normal cells having only one of the different target binding sites are not bound for a time long enough, if at all, thereby reducing the occurrence of any deleterious effects.
- the specificity of the proteinaceous molecules of the disclosure is increased by increasing their avidity for binding to multiple binding sites on aberrant cells.
- the avidity is preferably increased by incorporating multiple copies, preferably two to six copies, of at least one of the at least two different binding domains in the proteinaceous molecules (“multi-valent” proteinaceous molecules).
- FIGS. 1 and 2 give a number of possible preferred molecular designs. It is appreciated that at least one copy of each of the at least two different specific binding domains of the proteinaceous molecules of the disclosure must bind to their respective binding sites. Of course, it is preferred that two or more of the copies bind simultaneously, and most preferably, all copies of a binding domain present in the proteinaceous molecule bind simultaneously.
- a proteinaceous molecule comprising at least three specific binding domains for different binding sites separated from each other by at least one linker.
- proteinaceous molecules of the disclosure comprise the minimal number of different specific binding domains providing the specificity for aberrant cells over normal cells. It is then also preferred that the proteinaceous molecules of the disclosure comprise the minimal number of copies of each of the different specific binding domains required for providing the desired specificity.
- These optimal proteinaceous molecules of the disclosure regarding specificity are selected from possible proteinaceous molecules with varying numbers of different binding domains, varying numbers of copies of each of the different domains, and different domain topologies possible with the varying numbers of different domains and copies.
- proteinaceous molecules of the disclosure comprise two or three different binding domains.
- proteinaceous molecules of the disclosure comprise one to six copies of each of the different domains.
- a typical proteinaceous molecule of the disclosure comprises two different binding domains A, B with four copies of each domain, with domain topology A-B-A-B-A-B-A-B. See FIGS. 1 and 2 for some typical examples of preferred proteinaceous molecules regarding number of different domains, copies of domains and topologies.
- an example of a typically preferred molecule of the disclosure has the following structure: A-linker1-B′-linker2-A′′-linker3-B-linker1-A′-linker2-B′′.
- proteinaceous molecules comprising at least three different specific binding domains that are particularly suitable for binding to at least three different binding sites associated with the cell surface of aberrant cells.
- the proteinaceous molecules of the disclosure comprise specific binding domains comprising at least one Vh domain. More preferably, all two, three or more specific binding domains in the proteinaceous molecules of the disclosure are Vh domains.
- a proteinaceous molecule is a proteinaceous molecule wherein at least one specific binding domain is a Vh domain.
- Vh domains are human Vh domains.
- the different binding sites targeted by the proteinaceous molecules of the disclosure are located at the surface of the same aberrant cell. It is preferred that the molecules comprising the binding sites are internalized into the tumor cell together with the binding molecule of the disclosure. In a preferred embodiment, the cells go into apoptosis as a result of internalization. Also incorporated in the disclosure are proteinaceous molecules that, upon binding to target aberrant cells, mediate target aberrant cell lysis or phagocytosis. Thus, the disclosure provides a proteinaceous molecule wherein at least one binding domain is a ligand for a receptor, or a receptor binding fragment and/or derivative of such a ligand.
- binding of such binding domains to the target receptor on the tumor cell induces internalization of the bound proteinaceous molecules of the disclosure.
- Preferred suitable ligands for receptors are growth factors, lectins, kinases, hormones, cytokines, chemokines, Toll-like receptor ligands and T-cell epitopes, to name a few.
- the proteinaceous molecules of the disclosure further comprise at least one effector moiety, linked to the polypeptide chain comprising the specific binding domains. Effector moieties preferably improve the potency of a therapeutic molecule and/or increase the efficacy of a therapeutic molecule. It is part of the current disclosure that effector moieties are covalently bound to proteinaceous molecules of the disclosure via peptide bonds, and preferably via a linker. Alternatively, as part of the disclosure, effector moieties are linked to the proteinaceous molecules applying any other suitable linker chemistry known in the art. Yet in another embodiment, the proteinaceous molecules of the disclosure comprise specific binding domains for binding sites on effector moieties.
- binding molecules of the disclosure is the provided flexibility in the order of binding events.
- Proteinaceous molecules of the disclosure can first bind to target binding sites on aberrant cells, followed by binding to an effector moiety exposed to the proteinaceous molecules localized on the aberrant cells.
- Such a proteinaceous molecule of the disclosure is, for example, used for the treatment of cancer.
- An advantage of such proteinaceous molecules is the possibility of specific delivery of the effector moiety at aberrant cells, preventing normal cells from being exposed to the deleterious effects of the effector moiety.
- Preferred effector moieties are numerous, e.g., toxins, statins, apoptin, chelated radioactive metal ions, and radioactive iodine.
- Other suitable effector moieties are ricin A, gelonin, saporin, interleukin-2, interleukin-12, viral proteins E4orf4 and NS1, and non-viral cellular proteins HAMLET, TRAIL and mda-7 of which the latter five can, like apoptin, specifically induce apoptosis in aberrant cells after internalization of the proteinaceous molecules of the disclosure comprising at least one of such effector moieties.
- the effector moiety When proteinaceous molecules of the disclosure are designed to first bind to a target aberrant cell, followed by internalization, the effector moiety can then subsequently have its intracellular (cytotoxic) function. It is preferred that such an effector moiety has a contribution to the specificity of the cytotoxic effect. Therefore, it is preferred to use as an effector moiety a molecule that induces cell death in aberrant cells, but not in normal cells.
- An example of such a specific effector moiety is apoptin.
- the disclosure provides a proteinaceous molecule, further comprising an effector moiety.
- preferred proteinaceous molecules of the disclosure comprise at least two different specific binding domains.
- Particularly suitable and preferred specific binding domains are domains based on Vh sequences.
- the disclosure also provides a proteinaceous molecule comprising at least two Vh domains.
- FIGS. 1 and 2 A few examples of such molecules of the disclosure are provided in FIGS. 1 and 2 .
- these Vh domains are derived from human Vh sequences. It is appreciated that Vh domains, as such, are already relatively stable. Still, stability and solubility of human Vh domains can be further improved by engineering approaches known in the art. Particularly suitable for the purpose is applying a process referred to as “camelization” of the human Vh sequence.
- amino acid residues in the human Vh sequence are replaced for amino acid residues present at the corresponding sites of llama Vh domains.
- Preferred amino acid substitutions contributing to improved stability/solubility are Glu6Ala, Ala33Cys, Val37Phe, Gly44Glu, Leu45Arg, Trp47Gly, Ser74Ala, Arg83Lys, Ala84Pro, Trp103Arg or Leu108Gln.
- the disclosure also provides a proteinaceous molecule comprising camelized human Vh domains with improved stability and/or solubility.
- HSA human serum albumin
- Fc monomer of immunoglobulins can be included; in this case the molecules, according to the disclosure, may dimerize.
- Other functionalities that can be incorporated are cytokines, hormones, Toll-like receptor ligands, (activated) complement proteins, etc.
- the disclosure provides a proteinaceous molecule comprising at least two Vh domains specific for different binding sites and an Fc monomer. And, thus, the disclosure also provides a dimeric proteinaceous molecule, comprising two proteinaceous molecules dimerized through two Fc monomers. Proteinaceous molecules comprising immunoglobulin CH3 domains are also part of the disclosure. Similar to Fc monomers, the CH3 domain can serve as a dimerization domain. Homo-dimeric as well as hetero-dimeric proteinaceous molecules are part of the disclosure. Homo-dimeric binding molecules comprise dimerized Fc monomers with identical arms.
- heterogeneity of hetero-dimeric proteinaceous molecules of the disclosure originates from the two Fc monomers in the hetero-dimer, differing in the type, number and/or topology of their respective specific binding domains, linkers and/or effector moieties.
- the disclosure provides a hetero-dimeric molecule comprising two different proteinaceous molecules.
- the two different proteinaceous molecules are then dimerized through their respective Fc monomers.
- hetero-dimers are preferentially formed over homo-dimers.
- two different Fc monomers are subject to forced pairing upon applying the “knobs-into-holes” CH3 domain engineering technology as described (Ridgway et al., Protein Engineering, 1996).
- An advantage of the proteinaceous molecules of the disclosure comprising dimerized Fc monomers is the localization of phagocytosis and/or cell lytic activity at the surface of aberrant cells to which these proteinaceous molecules bind. These activities can enhance the deleterious effects on aberrant cells, induced by the proteinaceous molecules of the disclosure specifically bound to these aberrant cells.
- An advantage of such hetero-dimeric proteinaceous molecules of the disclosure is their increased spatial flexibility regarding the different/differently located specific binding domains in the two arms.
- binding molecules comprising one or multiple copies of each of at least two different binding domains specific for at least two different binding sites on aberrant cells.
- Cellular aberrancies such as cancers and autoimmune diseases, are manifested by the presence of unique combinations of surface molecules on the aberrant cell surface and/or by the relatively high cell-surface density of the surface molecules. It is thus one of the preferred embodiments that the at least two different binding sites targeted by proteinaceous molecules of the disclosure are located on aberrant cells. It is even more preferred that these at least two different binding sites are not all present on normal cells, and/or are present at lower numbers on normal cells.
- proteinaceous molecules comprising at least one copy of a specific binding domain for a binding site in carcinoembryonic antigen (CEA) and at least one copy of a specific binding domain for a binding site in MUC-1 with altered glycosylation pattern, expressed in aberrant cells of the colon during colorectal cancer.
- Altered MUC-1 is not expressed in normal cells of the colon; CEA is over-expressed on tumor cells in the colon. It is thus most preferred that all of the at least two different binding sites are unique to aberrant cells and not present at all on normal cells. Examples of such combinations of binding sites are T-cell epitopes derived from tumor-specific markers, complexed with HLA.
- a proteinaceous molecule is provided for use in the treatment of a disease related to aberrant cells.
- the proteinaceous molecules For administration to subjects, the proteinaceous molecules, according to the disclosure, must be formulated. Typically, these proteinaceous molecules will be given parentally. For formulation, simply saline for injection may suffice. For stability reasons, more complex formulations may be necessary.
- the disclosure contemplates lyophilized compositions as well as liquid compositions, provided with the usual additives.
- the disclosure provides a pharmaceutical composition comprising a proteinaceous molecule, according to any of the embodiments of the disclosure and suitable excipients.
- the dosage of the proteinaceous molecules, according to the disclosure must be established through animal studies and clinical studies in so-called rising-dose experiments. Typically, the doses will be comparable with present-day antibody dosages (at the molar level, the weight of the molecules may differ from that of antibodies). Typically, such dosages are 3 to 15 mg/kg body weight, or 25 to 1000 mg per dose.
- the proteinaceous molecules of the disclosure will replace current single agents binding to a single binding site.
- the first applications of the proteinaceous molecules, according to the disclosure will (at least initially) probably take place in combination with other treatments (standard care).
- the disclosure also provides proteinaceous molecules for use in novel or first treatments of any other tumor, for which current treatments are not efficient enough or for which no treatment options are currently available.
- the disclosure also provides a pharmaceutical composition comprising a proteinaceous molecule and a conventional cytostatic and/or tumoricidal agent.
- the current disclosure also provides a pharmaceutical composition comprising a proteinaceous molecule for use in an adjuvant treatment of cancer.
- the current disclosure also provides a pharmaceutical composition comprising a proteinaceous molecule for use in a combination chemotherapy treatment of cancer.
- chemotherapeutical treatments that are combined with the pharmaceutical composition of the current disclosure are etoposide, paclitaxel, doxorubicin and methotrexate.
- compositions will typically find their use in the treatment of cancer, particularly in forms of cancer where the at least two different binding sites of the preferred proteinaceous molecules of the disclosure are present on tumor cells. It is easy using binding domains, according to the disclosure, to identify tumors that present tumor-specific antigen(s). This can be done in vitro or in vivo (imaging).
- the disclosure also comprises a nucleic acid molecule encoding a proteinaceous molecule according to any of the embodiments of the disclosure.
- the molecules, according to the disclosure can be produced in prokaryotes as well as eukaryotes.
- the codon usage of prokaryotes may be different from that in eukaryotes.
- the nucleic acids, according to the disclosure can be adapted in these respects.
- elements that are necessary for secretion may be added, as well as promoters, terminators, enhancers, etc.
- elements that are necessary and/or beneficial for the isolation and/or purification of the proteinaceous molecules may be added.
- the nucleic acids are provided in an expression vector suitable for the host in which they are to be produced.
- Choice of a production platform will depend on the size of the molecule, the expected issues around protein folding, whether additional sequences are present that require glycosylation, expected issues around isolation and/or purification, etc. For example, whether or not specific binding domains of the disclosure comprise disulphide bonds will guide the selection of the preferred production platform.
- nucleic acids, according to the disclosure are typically adapted to the production and purification platform in which the proteinaceous molecules, according to the disclosure, are to be produced.
- the disclosure provides a vector comprising a nucleic acid molecule encoding a proteinaceous molecule, according to the disclosure.
- the nucleic acid encoding the proteinaceous molecule, according to the disclosure is integrated in the host cell genome (at a suitable site that is not silenced).
- the disclosure therefore, comprises a vector comprising means for integrating the nucleic acid in the genome of a host cell.
- the disclosure further comprises the host cell or the organism in which the proteinaceous molecule encoding nucleic acid molecule is present and which is thus capable of producing the proteinaceous molecule, according to the disclosure.
- the disclosure comprises a cell comprising a nucleic acid molecule, according to the disclosure, preferably integrated in its genome and/or a vector, according to the disclosure, comprising a nucleic acid molecule encoding a proteinaceous molecule, according to the disclosure.
- Included in the present disclosure is also a method for producing a proteinaceous molecule, according to the disclosure, comprising culturing a cell, according to the disclosure, comprising a nucleic acid molecule encoding a proteinaceous molecule, according to the disclosure, preferably integrated in the cell's genome and/or a vector, according to the disclosure, comprising a nucleic acid molecule encoding a proteinaceous molecule, according to the disclosure, allowing for expression of the proteinaceous molecule and separating the proteinaceous molecule from the culture.
- Typical proteinaceous molecules of the disclosure are provided and exemplified by the binding molecules outlined in this section, in FIG. 1 and FIG. 2 , and by the examples provided below and in the Examples section.
- the disclosure provides a proteinaceous molecule, according to FIG. 1 or FIG. 2 .
- Ab antibody
- ADCC antibody-dependent cell-mediated cytotoxicity
- CDC complement-dependent cytotoxicity
- CDR complementarity-determining region
- CH constant domain of the heavy chain of an antibody
- CHO Chinese hamster ovary
- DAMPs damage associated molecular patterns
- HEK human embryonic kidney
- IEP iso-electric point
- Ig immunoglobulin
- MAGE melanoma-associated antigen
- MHC major histocompatibility complex
- PAMPs pathogen associated molecular patterns
- RA rheumatoid arthritis
- sc-Fv single-chain variable fragment
- SLE systemic lupus erythematosis
- V HH or sdAb single domain antibodies
- TCR T-cell receptor
- FIG. 1 Exemplified topologies of binding molecules comprising one or more copies each of two or more different binding domains, each binding to a different binding site, according to the disclosure, and in one embodiment comprising effector moieties as part of the disclosure.
- Topologies of binding molecule comprising two different binding domains “D1” and “D2,” and divalent for a binding site 1 and monovalent for a binding site 2.
- Binding molecule comprising two different binding domains and monovalent for a binding site 1 and multivalent for a binding site 2 (multi-valency is, for example, three to six). Shown are two examples of many possible single-chain polypeptides according to the disclosure. All possible permutations regarding the position of the single binding domain and the multiple copies of the second binding domain are also part of the disclosure, and are visualized by the ensemble of different domains and number of domains between accolades.
- Binding molecule comprising two different binding domains, each binding to a different binding site and with two to six copies of a first binding domain and with two to six copies of a second binding domain, providing multi-valency for both binding sites.
- a binding molecule is shown in which binding domains binding to the same binding site are linked in consecutive order. All possible domain topologies obtained by permutations regarding domain positions in the single chain binding molecule of all binding domains of both kinds, are also part of the disclosure.
- Binding molecule comprising three, four, five or six different binding domains, thus binding to three, four, five or six different binding sites, respectively, and monovalent or multivalent for a binding site 1, monovalent or multivalent for a binding site 2, etc., (the valencies for the three to six different binding sites are, for example, one to six).
- four binding molecules are shown in which one to six clustered identical binding domains are linked in consecutive order, with three, four, five and six different binding domains in the binding molecules, respectively. All possible domain topologies obtainable by permutations regarding domain positions in the single chain binding molecule, of all one to six copies of the three to six different binding domains, are also part of the disclosure.
- Binding molecule comprising two different binding domains, each binding to a separate binding site and with one binding domain monovalent or multivalent for a binding site 1 and the second binding domain monovalent or multivalent for a binding site 2 (both valencies are, for example, one to six), and with one or more effector moieties (covalently) bound to the binding molecule.
- a binding molecule is shown in which the two sets of one to six binding domains are linked in consecutive order, with the effector moiety covalently linked to the C-terminus of the binding molecule. All possible domain topologies obtainable by permutations regarding each domain position in the single chain binding molecule are also part of the disclosure.
- FIG. 2 Cartoon displaying examples of preferred domain topologies of proteinaceous molecules of the disclosure. Examples are provided of possible combinations of VH domains and distinct linker sequences for the construction of multi-domain proteins that are multi-specific.
- Lanes a through h various examples are provided of proteinaceous molecules of the disclosure, comprising two or three different binding domains, and comprising one, two, three or four copies of the various binding domains, each, all linked with two or three different linkers (see, also, FIG. 1 , example 1 through 4, for additional preferred domain topologies of the disclosure).
- the exemplified preferred proteinaceous molecules of the disclosure further comprise an effector moiety linked to the single-chain polypeptide comprising different binding domains (additional preferred proteinaceous molecules of the disclosure comprising at least one effector moiety are provided in examples 5 and 6 in FIG. 1 ).
- the exemplified preferred proteinaceous molecules of the disclosure further comprise an Fc monomer linked to the different binding domains.
- FIG. 3 is a schematic presentation of the bispecific scFv anti-CD3 ⁇ scTCR ß ⁇ with HLA-A1/MAGE-A1 specificity.
- FIG. 4 shows the binding of the bispecific scFv anti-CD3 ⁇ scTCR ß ⁇ to primary human T-lymphocytes. Binding of the bispecific scFv anti-CD3 ⁇ scTCRß ⁇ to primary human T-lymphocytes was verified by flow-cytometry using FITC-labelled anti-V ⁇ -12.1 specific mAb. In short, 0.5 ⁇ 10 6 primary human T-lymphocytes were incubated for 30 minutes (on ice) with supernatant from 293T cells expressing the bispecific scFv ⁇ scTCR. Next, 1 ⁇ g FITC-labelled anti-V ⁇ -12.1 was added and incubated for 30 minutes. Shown are cells bound by the bispecific scFv ⁇ scTCR stained with an irrelevant FITC labelled antibody (negative control; white) and cells bound by the scFv ⁇ scTCR labelled with V ⁇ -12.1.
- FIG. 5 shows that primary human T-lymphocytes specifically kill HLA-A1/MAGE-A1 positive tumor cells.
- X-axis Effector (:) Target-cell ratios 10(:)1, 3(:)1, 1(:)1, 0.3(:)1.
- the _.._.._ line depicts T-lymphocytes with melanoma cell-specific antigen 2G12-specific bispecific molecule, the straight line (-) depicts T-lymphocytes plus HLA-A1-MAGE-A1 specific bispecific molecule, the - - - line depicts T-lymphocytes without bispecific molecule.
- T-lymphocytes Primary human T-lymphocytes were labelled with either the HLA-A1/MAGE-A1 bispecific scFv ⁇ scTCR or with an 2G12 antigen specific scFv ⁇ scFv. These T-lymphocytes were incubated for 4 hours with 51Cr labelled HLA-A1/MAGE-A1, and 2G12 antigen-positive melanoma cells MZ2 MEL3 0 As a negative control MZ2-MEL 2 2 cells that have lost expression of MAGE-A1, but still have 2G12 expression, were used. As shown, the 51Cr-release assay demonstrates specific tumor cell kill by scFv ⁇ scTCR labelled human T-lymphocytes.
- a further aspect of the disclosure relates to a method for providing the binding molecules, according to the disclosure.
- it typically involves providing a nucleic acid construct encoding the desired binding molecule.
- the nucleic acid construct can be introduced, preferably via a plasmid or expression vector, into a prokaryotic host cell and/or in a plant cell and/or in a eukaryotic host cell capable of expressing the construct.
- a method of the disclosure to provide a binding molecule comprises the steps of providing a host cell with one or more nucleic acid(s) encoding the binding molecule, and allowing the expression of the nucleic acids by the host cell.
- Binding molecules of the disclosure are, for example, expressed in plant cells, eukaryotic cells or in prokaryotic cells.
- suitable expression systems are tobacco plants, Pichia pastoris, Saccharomyces cerevisiae.
- cell-free recombinant protein production platforms are suitable.
- Preferred host cells are bacteria, like, for example, bacterial strain BL21 or strain SE1, or mammalian host cells, more preferably, human host cells.
- Suitable mammalian host cells include human embryonic kidney (HEK-293) cells or Chinese hamster ovary (CHO) cells, which can be commercially obtained.
- Insect cells such as S2 or S9 cells, may also be used using baculovirus or insect cell expression vectors, although they are less suitable when the polypeptides, according to the disclosure, include elements that involve glycosylation.
- the produced binding molecules, according to the disclosure can be extracted or isolated from the host cell or, if they are secreted, from the culture medium of the host cell.
- a method of the disclosure comprises providing a host cell with one or more nucleic acid(s) encoding the binding molecule, allowing the expression of the nucleic acids by the host cell.
- a method of the disclosure comprises providing a host cell with one or more nucleic acid(s) encoding two or more different binding molecules allowing the expression of the nucleic acids by the host cell.
- nucleic acids encoding for two or more different binding molecules, all comprising an Fc monomer are provided, enabling isolation of multiple single-chain binding molecules, and/or enabling isolation of homo-dimers and/or hetero-dimers formed through Fc dimerization.
- a binding molecule of the disclosure finds its use in many therapeutic applications and non-therapeutic applications, e.g., diagnostics, or scientific applications.
- Proteinaceous molecules of the disclosure suitable for diagnostic purposes are of particular use for monitoring the expression levels of molecules exposing binding sites on aberrant cells that are targeted by proteinaceous molecules of the disclosure applied for their therapeutic benefit. In this way, it is monitored, whether the therapy remains efficacious or whether other proteinaceous molecules of the disclosure targeting one or more different binding sites on the aberrant cells should be applied instead. This is beneficial when the expression levels of the first targeted binding site(s) are below a certain threshold, whereas other or new binding sites (still) can serve as newly targeted binding sites for proteinaceous molecules of the disclosure comprising the appropriate specific binding domains for these alternative binding sites.
- Binding molecules of the disclosure may also be used for the detection of (circulating) tumor cells, for the target cell-specific delivery of cytotoxic compounds or for the delivery of immune-stimulatory molecules.
- the modulating effect or combined modulating effects is/are agonistic, or stimulatory, or activating in nature, or the effect(s) is/are interfering, or antagonistic in nature, or any combination thereof.
- the modulating effect(s) is/are additive or synergistic in nature for different binding domains in the binding molecules, or combinations thereof.
- the binding molecule is used for a modulating effect on a biological process of aberrant cells in a subject, more preferably a human subject.
- a binding molecule does not contain amino acid sequences of non-mammalian origin. More preferred are binding molecules that only contain human amino acid sequences. Therefore, a therapeutically effective amount of a binding molecule capable of recognizing and binding to one or more disease-specific binding sites and subsequently inducing a modulating effect on a biological process at the cell surface or in the cell, can be administered to a patient to stimulate eradication of diseased cells expressing the binding sites without affecting the viability of (normal) cells not expressing the disease-specific binding sites. The killing of diseased cells, while minimizing or even totally avoiding the deterioration or even death of normal cells, will generally improve the therapeutic outcome of a patient after administration of the binding molecule.
- a binding molecule for the manufacture of a medicament for the treatment of cancer, autoimmune disease or any other disease of which the symptoms are reduced upon targeting cells expressing one or more disease-specific binding sites with proteinaceous molecules of the disclosure.
- a binding molecule is advantageously used for the manufacture of a medicament for the treatment of various cancers (e.g., solid tumors, hematologic malignancies).
- Antibody fragments of human origin can be isolated from large antibody repertoires displayed by phages.
- One aspect of the disclosure known by the art, is the use of human antibody phage display libraries for the selection of two or more human antibody fragments specific for two or more selected different binding sites, e.g., epitopes. These antibody fragments usually display low affinity.
- a method is provided that allows the generation of high avidity antibody chains able to bind and exert the modulating biological activity in a specific and efficient manner.
- An aspect of the present disclosure is the development of a binding molecule comprising multiple binding domains.
- a human Vh domain capable of binding to a certain binding site combined with a second, third, fourth, and so on, copy of an identical binding domain (multi-valency), and at least one copy of one or more different human Vh domains with each different human Vh domain capable of binding to a separate binding site (multi-specificity).
- a proteinaceous molecule comprising at least two copies of a binding domain specific for a binding site functionally connected with at least one copy of a different binding domain specific for a different binding site.
- these different binding domains are functionally connected to each other via peptide bonds between amino acid residues flanking the binding domains, providing a continuous single chain proteinaceous molecule ( FIGS. 1 and 2 ).
- the binding domains are linked together via bonds and/or binding interactions other than peptide bonds.
- Alternative methods for linking proteinaceous molecules to each other are numerous and well known to those skilled in the art of protein linkage chemistry. Protein linkage chemistry not based on peptide bonds can be based on covalent interactions and/or on non-covalent interactions.
- a multi-specific proteinaceous molecule in a mono-valent or multi-valent binding molecule form of the disclosure capable of modulating a biological process is, for example, composed of at least copies of two different human Vh domains, which are multimerized at the DNA level in order to obtain a single-chain polypeptide construct upon expression.
- Human Vh domains usually do not meet the standards for stability and efficient expression that are required by the field. They tend to be unstable, poorly soluble and poorly expressed. A process called “camelization” may be used to convert human Vh into more stable antibody fragments.
- the human antibody germline region Vh-3 displays high homology with antibody Vh fragments of llamas.
- Llamas have two types of antibodies, those composed of heavy and light chains, and antibodies that only contain heavy chains. These heavy-chain only antibodies bind antigens similar to classical antibodies composed of heavy and light chains.
- the smallest functional llama antibody binding domain, the Vhh domain, also called (single) domain antibodies ((s)dAb) have been shown to be expressed well and may bind antigen with high affinity.
- some of the characteristics, such as ease of expression and stability, of llama sdAb can be transferred to, e.g., human Vh by replacing a few amino acids in the human Vh for those of llama Vhh.
- Antibody molecules with multi-specificity can then be generated by ligation of one or more copies of several different “camelized” human Vh domains, each with affinity for different binding sites, into one single molecule. Moreover, high avidity antibody molecules can then be generated by ligation of several of the camelized human Vh domains binding to the same binding site, into one single molecule.
- the proteinaceous molecules of the disclosure comprise one to twelve and, more preferably, one to six and, even more preferably, one to three camelized human Vh domains interspersed by short linkers, for example, short Gly-Ser linkers, and connected through peptide bonds to the camelized human Vh domains interspersed by short linkers, specific for the other target binding sites of the binding molecules.
- the proteinaceous molecules of the disclosure comprise preferably four to six camelized human Vh domains interspersed by short linkers, herewith providing the molecules with the capacity to cross-link four to six target molecules exposing this targeted binding site.
- this cross-linking of molecules induces apoptosis in cells expressing surface molecules exposing the targeted binding site for the four to six binding domains.
- the proteinaceous molecules of the disclosure Compared to binding molecules specific for a single binding site, the proteinaceous molecules of the disclosure have, amongst others, the following advantages regarding efficacy and specificity.
- the proteinaceous binding molecules of the disclosure have an increased specificity for aberrant cells by targeting multiple binding sites specific for the aberrant cell simultaneously and/or by targeting combinations of binding sites unique to the aberrant cell simultaneously. In this way, aberrant cells are targeted more efficiently, avoiding (excessive) targeting of healthy cells, and thus lowering the risk for toxic and undesired side-effects significantly.
- binding sites that provide suitable therapeutic targets for the molecules of the disclosure.
- difficult to target and/or difficult to reach aberrant cells have a higher chance of being “hit” by at least one of the binding domains, thereby providing, at least in part, the therapeutic activity and increasing the success rate when compared to single molecule/single target therapies.
- high specificity for aberrant cells is achieved when one or more copies of different binding domains are combined in binding molecules of the disclosure, with the different binding domains individually having relatively low affinity for their respective binding sites, though in combination having relatively high avidity for aberrant cells, either uniquely expressing the combination of binding sites or highly expressing the binding sites relative to healthy cells, or any combination thereof.
- FIG. 1 and in FIG. 2 Examples of various possible domain topologies in the proteinaceous molecules of the disclosure, as exemplified below, are provided in FIG. 1 and in FIG. 2 .
- combining two or more different low-affinity binding domains specific for surface markers present on both healthy cells and aberrant cells still provides for proteinaceous molecules of the disclosure highly specific for the aberrant cells, when the surface markers are highly expressed on the aberrant cells, compared to expression levels on healthy cells. Therefore, in a preferred embodiment, the desired high specificity for aberrant cells and concomitant high efficacy regarding aberrant cell eradication, leaving healthy cells in essence unaltered, of the proteinaceous molecules of the disclosure, are tunable (“mix and match” approach) by selecting for, for example:
- use of the multi-specific proteinaceous molecules of the disclosure now provides for methods to lower the risk for immune escape by aberrant cells.
- applying a single target binding site therapy bears the risk for unwanted immune escape by the aberrant cell, rendering the therapy ineffective.
- binding sites on the aberrant cell may eventually mutate.
- effective binding to at least one or to several binding sites remains, even after occurrence of mutations in one or several of the other binding sites targeted by the proteinaceous molecules of the disclosure. In this way, at least part of the desired therapeutic effect is maintained.
- This improved therapeutic efficacy over existing therapies under development or on the market is one of the many advantages provided by the embodiments of the current disclosure.
- DAMPs damage associated molecular patterns
- binding molecules are, for example, exposed upon ischemia and inflammation and, for example, by aberrant cells such as cancer cells. It is part of the disclosure that the multi-specific binding molecules of the disclosure have the capacity to cross-link cellular proteins, with subsequent induction of biological processes upon activation of pathways mediated by these cross-linked proteins.
- Fc receptor mediated processes such as Fc receptor mediated uptake of complexes comprising Fc fragments and bound molecules, and the complement pathway(s) of the immune system.
- Fc receptor mediated processes such as Fc receptor mediated uptake of complexes comprising Fc fragments and bound molecules
- complement pathway(s) of the immune system is Another example.
- Cross-linking of CD30 on Hodgkin's lymphoma cells by a proteinaceous molecule of the disclosure binding to multiple binding sites on CD30 overexpressed by Hodgkin/Reed-Stenberg cells. Cross-linking of CD30 results amongst others in pro-apoptotic signaling and in anti-proliferative signaling in the aberrant cells.
- Targeting and inducing clustering of MHC 1-MAGE 1 peptide complex on melanoma cells by proteinaceous molecules of the disclosure comprising at least four, and preferably four to six domains specific for the MHC 1-MAGE 1 peptide complex, induces apoptosis of the targeted aberrant cells.
- Increased specificity and efficacy of these molecules of the disclosure is, for example, achieved by introducing one or more low-affinity binding domains specific for an epitope on the MHC 1 molecule.
- a class of molecules specifically suitable for targeting by the proteinaceous molecules of the disclosure are cellular receptors and their ligands and (proteinaceous) binding partners.
- cellular receptors and their ligands are the class of G-protein coupled receptors (GPCRs) and, for example, hormones and neurotransmitters.
- GPCRs play a role in amongst others cancer. GPCRs act in an activated monomeric form and/or GPCRs act in an activated homodimer or heterodimer form. GPCRs active as higher order multimers exist as well. It is clear that GPCR homomers and heteromers can have different activities and roles in, for example, disease processes compared to the same GPCR in monomeric form.
- a binding molecule of the disclosure with an agonistic effect comprises two different binding domains binding to the two different GPCRs forming an active GPCR heterodimer, thereby facilitating the complex formation.
- blocking binding molecules are designed, according to the disclosure, preventing GPCR dimer formation, and thereby GPCR dimer—mediated activation.
- any receptor mosaic is targeted in either an inhibitory, or stimulatory fashion by binding molecules of the disclosure. It is appreciated that intervening in receptor—receptor contacts is preferably addressed at the extracellular site of cells.
- the binding molecules act as allosteric molecules and/or as orthosteric ligand molecules for monomeric receptors, homomers, or heteromers, by targeting one or more allosteric binding sites and/or one or more ligand binding sites on the receptors, simultaneously. These binding sites are then located on the same receptor molecule or on different receptor molecules.
- the binding molecules of the disclosure can also have agonistic activity, synergistic activity and/or co-stimulatory activity. Of course, inhibiting allosteric effects resulting, for example, in receptor oligomerization as part of their activation, is also established by yet different binding molecules of the disclosure, that prevent binding of ligands with an allosteric effect to their binding sites on the receptors.
- Non-exhaustive examples of proteinaceous molecules of the disclosure comprising binding domains binding to at least two different binding sites which are each targeted in a monovalent or multivalent manner by the two or more different binding domains, with binding domain topologies as outlined, for example, in FIG. 1 and FIG. 2 , are:
- Proteinaceous molecules of the disclosure comprising binding domains binding to:
- CEA carcinoembryonic antigen
- CEA colon-specific antigen
- MUC-1 mucin-1
- one or more different epitopes preferably three to five different epitopes in the Her-2/neu receptor, for the treatment of breast cancer, by, for example, preventing tumor outgrowth;
- the antigen is, for example, CD19, CD20, CD22, CD25, CD33, interleukin-4 receptor, prostate-specific antigen, Lewis(y) carbohydrate, mesothelin, mucin-1, transferrin receptor, prostate-specific membrane antigen, vascular endothelial growth factor, vascular endothelial growth factor receptors, epcam, CTLA-4, for the treatment of oncological diseases;
- TLR2 one or more epitopes in TLR2 and to one or more epitopes in TLR4, resulting in an agonistic effect on TLR2/TLR4 activity, for apoptosis mediated anti-tumor therapy after chemotherapy or radiotherapy;
- one or two binding sites in CD20 and/or CD30 and/or CD25 combined with at least two binding domains for a binding site on CD16 and/or on CD64, resulting in cross-linking of CD16 on natural killer cells and subsequently lysis of cells bound to natural killer cells, and/or phagocytosis and cellular cytotoxicity exerted on bound cells by CD64-positive cells, respectively, for the treatment of Hodgkin's lymphoma;
- one or two binding sites on tumor necrosis factor a and to one or two binding sites on CD20 resulting in complement and/or cell mediated lysis when bound to cells, and/or to one or two binding sites on CD80 and/or on CD86, thereby acting as cytotoxic T-lymphocyte associated antigen-4 antagonist, thereby preventing a positive T-cell signal, for the treatment of rheumatoid arthritis;
- cytotoxic triggering receptors such as T-cell receptors complexed with CD3 on T-cells and/or Fc ⁇ RIIIa (CD16) on natural killer cells and/or FC ⁇ RI (CD64) and FCAR (CD89) on granulocytes, monocytes and macrophages, for the treatment of non-Hodgkin's lymphoma;
- MHC 1 ⁇ -chain domain ⁇ 1 and/or domain ⁇ 2 and/or domain ⁇ 3 and/or ⁇ 2 microglobulin binding sites on MHC 1 ⁇ -chain domain ⁇ 1 and/or domain ⁇ 2 and/or domain ⁇ 3 and/or ⁇ 2 microglobulin, and binding to an MHC 1-peptide complex, for the treatment of tumors presenting the peptides in the context of MHC 1 in a tumor-specific manner;
- prostate cancer related antigens prostate-specific antigen (PSA, also referred to as kallikrein 3 (KLK3)), Thomsen-Friedenreich (TF) antigen, prostate stem cell antigen, prostatic acid phosphatase (PAP, also prostatic-specific acid phosphatase (PSAP)), human HLA-A2 restricted CD8 + T-cell epitopes, e.g., nonamer peptides FLFLLFFWL (SEQ ID NO:13) (from prostatic acid phosphatase), (SEQ ID NO:14) TLMSAMTNL (from prostatic acid phosphatase), ALDVYNGLL (SEQ ID NO:15) (from prostatic acid phosphatase), human HLA-A2.1-restricted CTL epitope ILLWQPIPV (SEQ ID NO:16) (from prostatic acid phosphatase-3), six-trans
- T-cell epitopes selected from 146-KLQCVDLHV-154 (SEQ ID NO:19), 141-FLTPKKLQCV-150 (SEQ ID NO:20), 154-VISNDVCAQV-163 (SEQ ID NO:21), 154-YISNDVCAQV-163 (SEQ ID NO:22) of PSA, presented by HLA-A2 and/or 162-QVHPQKVTK-170 (SEQ ID NO:23) of PSA, presented by HLA-A3, and/or 152-CYASGWGSI-160 (SEQ ID NO:24), 248-HYRKWIKDTI-257 (SEQ ID NO:25) of PSA, presented by HLA-A24, and/or 4-LLHETDSAV-12 (SEQ ID NO:26), 711-ALFDIESKV-719 (SEQ ID NO:27), 27-VLAGGFFLL-35 (SEQ ID NO:28) of PSMA, presented by HLA-A2, and/
- CD44 splice variants known as CD44,-v6, CD44-v9, CD44-v10 and/or to one or two epitopes in CD38 and in CD138, for the treatment of multiple myeloma;
- Such molecules of the disclosure provide even an higher specificity than molecules of the disclosure targeting two different antigens which are co-expressed on aberrant cells, with one of the two, or both antigens also (moderately) expressed on healthy cells.
- An example is the co-expression on melanoma cells of two T-cell receptor epitopes unique to the aberrant cell, i.e., the MAGE-A peptide YLEYRQVPG (SEQ ID NO:43) presented by MHC 1 HLA-A0201 and the MAGE-A peptide EGDCAPEEK (SEQ ID NO:44) presented by MHC-1 HLA-CW7.
- MAGE-A peptide YLEYRQVPG SEQ ID NO:43
- EGDCAPEEK SEQ ID NO:44
- efficacious proteinaceous molecules of the disclosure comprise, for example, two or three different binding domains specific for that complex, and binding domains binding to the specific type of MHC 1 HLA-molecule.
- binding domains binding to the MHC-peptide complex are linked to binding domains binding to cell-surface proteins specifically expressed by the melanocyte lineage, such as MART-1, gp100 and tyrosinase.
- cell-surface proteins specifically expressed by the melanocyte lineage such as MART-1, gp100 and tyrosinase.
- binding domains with high affinity for tumor cell-specific antigens i.e., MHC-MAGE peptide complex
- binding domains with low affinity for surface markers of the melanocyte lineage further improves the specificity of the proteinaceous molecules of the disclosure for the aberrant cells.
- the affinity for the surface markers of the melanocyte lineage is below a certain threshold prohibitive for binding of the proteinaceous molecules of the disclosure to healthy cells in the melanocyte lineage.
- proteinaceous molecules of the disclosure comprising at least two different specific binding domains that target binding sites on surface molecules expressed by aberrant cells and not/hardly by healthy cells are proteinaceous molecules binding to A33 and to fibroblast activation protein, for the treatment of colorectal cancer.
- proteinaceous molecules binding to A33 and to fibroblast activation protein for the treatment of colorectal cancer.
- Another example of two different target binding sites on tumor cells, suitable for targeting by multi-specific proteinaceous molecules of the disclosure are Das-1 and CEA. Binding molecules targeting both Das-1 and CEA are, for example, suitable for the treatment of esophageal cancer.
- the proteinaceous molecules of the disclosure comprise different binding domains binding to at least one binding site on a tumor marker and binding to at least one binding site on a cell-surface molecule specific for the tissue associated with the tumor.
- T-cell defined tumor antigens (Van den Eynde et al., Curr. Opin. Immunol. 1997; Houghton et al., Curr. Opin. Immunol. 2001; van der Bruggen et al., Immunol. Rev. 2002; Policyani et al., J. Immunol. 2007; On the World Wide Web at cancerimmunity.org/peptidedatabase/Tcellepitopes.htm).
- the database provides combinations of antigen peptides complexed with MHC molecules comprising the indicated class of HLA, unique to tumor cells or over-expressed by tumor cells.
- Multi-specific proteins are built from any antigen binding domain, such as, but not limited to, antibodies, alpha-helices and T-cell receptors.
- Antibody Vh fragments specific for tumor associated surface antigens and MHC-restricted antigens are derived from hybridoma cells producing mouse, rat, rabbit, llama or human antibodies. Antibody fragments can also be obtained after immunization of animals with (partly) purified antigen, tumor cells or tumor cell lysate. Alternatively, antibody fragments of human, mouse, rat or llama origin can be obtained from antibody phage, yeast, lymphocyte or ribosome display libraries. Such antibody libraries (scFv, Fab, Vh or Vhh) may be constructed from non-immunized species as well as immunized species.
- Human antibody fragments specific for, e.g., MHC presented epitopes a Human antibody Fab, VHCH or Vh phage display library will be used for selections essentially as described by Chames et al.
- Human Fab phages (10 13 colony forming units) are first pre-incubated for one hour at room temperature in PBS containing 2% non-fat dry milk (PBSM).
- PBSM PBS containing 2% non-fat dry milk
- 200 ⁇ l Streptavidin-coated beads (Dynal) are equilibrated for one hour in PBSM. For subsequent rounds, 100 ⁇ l beads are used.
- a pan-MHC class I binding soluble Fab (D3) is added to the phage-MHC-p complex mixture (50, 10, and 5 ⁇ g for rounds 1-3, respectively).
- Equilibrated streptavidin-coated beads are added, and the mixture incubated for 15 minutes under rotation. Phages are selected by magnetic force. Non-bound phages will be removed by five washing steps with PBSM, five steps with PBS containing 0.1% Tween, and five steps with PBS. Phages are eluted from the beads by ten minutes incubation with 500 ⁇ l freshly prepared tri-ethylamine (100 mM). The pH of the solution is then neutralized by the addition of 500 ⁇ l 1 M Tris (pH 7.5).
- the eluted phages are incubated with logarithmic growing E. coli TG1 cells (OD 600 nm of 0.5) for 30 minutes at 37° C. Bacteria are grown overnight on 2 ⁇ TYAG plates. Next day, colonies are harvested, and a 10 ⁇ l inoculum is used in 50 ml 2 ⁇ TYAG. Cells are grown until an OD 600 nm of 0.5, and 5 ml of this suspension is infected with M13k07 helper phage (5 ⁇ 10 11 colony forming units). After 30 minutes incubation at 37° C., the cells are centrifuged, resuspended in 25 ml 2 ⁇ TYAK, and grown overnight at 30° C.
- Phages are collected from the culture supernatant as described previously, and used for the next round panning. After two, three or four selection rounds enrichment of specific binders is obtained, and individual clones are analyzed for binding to specific peptide/MHC complexes by ELISA.
- Selected Fab phages are then analyzed for their capacity to bind MHC-positive EBV-transformed B-LCL loaded with the peptide epitopes.
- B-LCL line BSM 0.5 ⁇ 10 6
- peptide epitopes 10 ⁇ g in 100 ⁇ l PBS
- Phages are then used to stain tumor cell lines of distinct histologic origin and analyzed by flow cytometry.
- Human antibody germline gene VH3 demonstrates high homology to llama single domains VHH.
- Exchange of amino acids 44, 45 and 47 in the human VH3 genes by amino acids present in llama VHH at these positions has shown to enhance stability and expression of the human VH3 genes (Riechmann, Muyldermans, 199).
- many of the selected human Vh might benefit from the exchange of amino acids 44, 45 and 47 by llama VHH amino acids, a process called camelization.
- a gene comprising at least two distinct human Vh domains binding to at least two distinct MHC/peptide epitopes will be compiled such that upon expression it would comprise six Vh domains.
- a gene will be designed comprising the pelB secretion signal, which will be operatively linked to six codon-optimized, camelized Vh domains with linkers ((Gly 4 Ser) n (SEQ ID NO:45), (GSTSGS) n (SEQ ID NO:46), GSTSGSGKPGSGEGSTKG (SEQ ID NO:47), EFAKTTAPSVYPLAPVLESSGSG (SEQ ID NO:48) or any other linker that provides flexibility for protein folding, or, EPKSCDKTHT (SEQ ID NO:49) (IgG1), ELKTPLGDTTHT (SEQ ID NO:50) (IgG3), or ESKYGPP (SEQ ID NO:51) (IgG4)) between each Vh domain.
- This gene will, for example, be synthesized by Geneart (Regensburg, Germany) and cloned into the pStaby 1.2 vector (Delphi genetics, Belgium) for expression in E. coli.
- Multi-specific Vh proteins will be isolated from media and bacteria using Ni-affinity purification. To this end medium will be incubated with Ni-coupled Sepharose-beads and incubated overnight while stirring gently. To obtain intracellular proteins bacteria will be lysed and cellular debris removed by centrifugation. After overnight dialysis with PBS multi-specific Vh proteins will be purified with Ni-Sepharose. Purity of the multi-specific Vh proteins will be analyzed by SDS-PAGE and protein concentration determined by BCA protein assay (Pierce).
- the pharmacokinetic properties of therapeutic proteins are dependent on factors such as shape, charge and size.
- Most small plasma molecules possess very short half-life, whereas larger plasma proteins such as human serum albumin (HSA) and immunoglobulins (Ig) have very long half-lives (19 days for HSA, one to four weeks for Ig).
- HSA human serum albumin
- Ig immunoglobulins
- addition of IgG-Fc or Human serum albumin has shown to extend circulation time, tumor penetration and antitumor effects when linked to therapeutic proteins.
- the coupling of IgG-Fc to the multi-specific proteins will allow recruitment of immune cells to the tumor site allowing immune-specific responses against the cancerous tissue.
- the multi-specific construct will be linked to the IgG1-Fc region or to human serum albumin, codon optimized for expression in eukaryotic cells and cloned into the pcDNA-3.1+ vector (Geneart, Regensburg, Germany).
- the TCR is a heterodimer which consists of an ⁇ and a ⁇ chain.
- the TCR ⁇ and ⁇ chains are members of the immunoglobulin gene superfamily and are generated by combined associations of V, J, D and C genes.
- the TCR polypeptides are disulfide linked, highly polymorphic in their N-terminal, variable domains and responsible for antigen recognition.
- TCR ⁇ and ⁇ chain from T cell clone 82/30 were unknown, a PCR method, referred to as RACE (rapid amplification of cDNA ends) was used to amplify the TCR ⁇ chain.
- RACE rapid amplification of cDNA ends
- the TCR ⁇ chain was amplified by RACE-PCR using primers described in Table 2.
- Oligonucleotide primers used to synthesize the ⁇ and ⁇ chain cDNA and amplify the V ⁇ , V ⁇ and C ⁇ gene segments (Table 2)
- a fragment of about 350-450 base pairs was isolated from the agarose gel, purified and ligated into pBluescript (Stratagene, USA). The ligation mixture was introduced into bacteria which were selected and expanded. DNA was isolated from these selected bacterial colonies and analyzed by restriction enzyme digestion to confirm the presence of the amplified TCR ⁇ fragment.
- the DNA was subjected to “direct sequencing,” Analysis of the obtained sequence showed 100% homology of the amplified TCR ⁇ fragment to the signal sequence and major part of the variable region of the TCR ⁇ chains from the TCR ⁇ family 1. Based on this sequence primers were designed that allowed cloning of the TCR variable ⁇ chains in a single chain TCR construct.
- TCR V ⁇ chain For cloning of the TCR ⁇ chain, a different approach was followed. First, to determine to which family the TCR V ⁇ chain belongs, a family typing PCR was performed. Twenty-one different TCR variable ⁇ chains have been described. In a family typing PCR, the template cDNA was divided into separate samples that are each individually amplified with a family specific 5′ primer and a constant primer. Multiple PCR reactions had yielded amplified fragments. In order to determine which fragment corresponded to the TCR V ⁇ fragment, a Southern blot was performed with a 32 P-labelled C ⁇ probe. A positive signal was observed only in the PCR reaction which was performed with the TCR ⁇ primer corresponding to family number 12.
- a cloning vector was designed that allows easy construction of single chain molecules.
- the vector was made by replacement of the multiple cloning sites in pBluescript (Stratagene) by a specially designed polylinker (Table 3).
- primers were designed that allowed cloning of these fragments in front of the flexible linker sequence or after the linker sequences.
- TCR V ⁇ and TCR V ⁇ fragments For amplification of the TCR V ⁇ and TCR V ⁇ fragments, two separate PCR reactions were performed to generate fragments that include the signal sequence of the V region and fragments that start practically at the beginning of the mature protein.
- the DNA fragments were digested with restriction enzymes that allow cloning next to the flexible linker. Positive bacterial colonies were grown for DNA purification and DNA was subj ected to DNA sequencing. DNA clones with the correct sequence were used to construct the chimeric single chain TCR constructs.
- the clones containing either the TCR V ⁇ or the TCR V ⁇ fragments in front of the flexible linker sequence were then ligated to the TCR V ⁇ and TCR V ⁇ fragments which lack the signal sequence.
- three different single chain TCRs were constructed (V ⁇ -212 linker-V ⁇ , V ⁇ -212 linker-V ⁇ and V ⁇ -(Gly 4 Ser) 3 , linker-V ⁇ ).
- the scTCR ß ⁇ was cloned next to the anti-CD3 specific scFv obtained from OKT-3 cells and introduced into the pBullet retroviral vector.
- a schematic presentation of the scFv ⁇ scTCR is given in FIG. 3 .
- the pBullet retroviral vector was introduced into HEK 293T cells by calcium-phosphate transfection. Supernatant from these cells was harvested 4 days after transfection and used for diverse experiments.
- a gene was composed from the camelized human AH5 VH and camelized mouse anti-CD3 VH (obtained from OKT-3).
- the resulting sequence of the sdAb AH5 ⁇ CD3 was compiled by gene synthesis by GeneArt (Regensburg, Germany), and cloned into the pStaby 1.2 expression vector. See SEQ ID NO:3 for the DNA sequence of this bispecific single domain antibody (BsdAB) AH5 ⁇ CD3, and SEQ ID NO:4 for the amino-acid sequence of BsdAB AH5 ⁇ CD3.
- SEQ ID NO: 2 DNA sequences of the HLA-A1/MAGE-A1 specific TCR variable region Vbeta obtained from CTL 82/30 ATG GGC TTC AGG CTG CTC TGC TGT GTG GCC TTT TGT CTC CTG GGA GCA GGC CCA GTG GAT TCT GGA GTC ACA CAA ACC CCA AAG CAC CTG ATC ACA GCA ACT GGA CAG CGA GTG ACG CTG AGATGC TCC CCT AGG TCT GGA GAC CTC TCT GTG TAC TGG TAC CAA CAG AGC CTG GAC CAG GGC CTC CAG TTC CTC ATT CAC TAT TAT AAT GGA GAA GAG AGA GCA AAA GGA AAC ATT CTT GAA CGA TTC TCC GCA CAA CAG TTC CCT GAC TTG CAC TCT GAA CTA AAC CTG AGC TCT CTG GAG CTG GGG GAC TCA GCT TTG TTG TTG
- SEQ ID. NO: 3 DNA sequence of bispecific single domain antibody (BsdAB) AH5 ⁇ CD3 ATGAAATACCTATTGCCTACGGCAGCCGCTGGATTGTTATTACTCGCGGC CCAGCCGGCCATGGCCCAGCTGCAGCTGCAGGAGTCCGGGGGAGGCGTGG TCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACC TTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGAGAG AGAGGGGGTGGCAGTTATATCATATGATGGGAGTAATAAATACTATGCAG ACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACG CTGTATCTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTA CTGTGCCGGTGGGAGCTACTACGTCCCGGACTACTGGGGCCAGGGAACCC TGGTCACCGTCTCAAGCGCGCGCAGGTGGCGGAGGGTCTGGTGGCGGAGGTCCAGTGG
- SEQ ID NO: 4 Amino acid sequence of bispecific single domain antibody (BsdAB) AH5 ⁇ CD MKYLLPTAAAGLLLLAAQPAMAQLQLQESGGGVVQPGRSLRLSCAASGFT FSSYGMHWVRQAPGKEREGVAVISYDGSNKYYADSVKGRFTISRDNSKNT LYLQMNSLRAEDTAVYYCAGGSYYVPDWGQGTLVTVSSAAAGGGGSGGGG SGGGGSQVQLQQSGAELARPGASVKMSCKASGYTFTRYTMEIWVKQRPGQ GLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAV YYCARYYDDHYCLDWGQGTTLTVSSGAAEQKLISEEDLNGAHREIHHH (SEQ ID NO: 4)
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Described are proteinaceous molecules comprising at least two, preferably three to six, binding domains that bind specifically to at least two different binding sites on aberrant cells. These multi-domain and multi-specific binding molecules are preferably used in selectively modulating biological processes. The provided binding molecules are of particular use in pharmaceutical compositions for the treatment of diseases related to cellular aberrancies, such as cancers and autoimmune diseases.
Description
- This application is a divisional of U.S. patent application Ser. No. 14/348,465, filed Mar. 28, 2014, which is a national phase entry under 35 U.S.C. § 371 of International Patent Application PCT/NL2012/050675, filed Sep. 26, 2012, designating the United States of America and published in English as International Patent Publication W02013/048243 A1 on Apr. 4, 2013, which claims the benefit under Article 8 of the Patent Cooperation Treaty to U.S. Application Ser. No. 61/540,920, filed Sep. 29, 2011, the disclosure of each of which is hereby incorporated herein in its entirety by this reference.
- The disclosure relates to the field of antibody-like molecules targeted at aberrant cells in autoimmune diseases and cancers. The disclosure also relates to such proteinaceous molecules targeting aberrant cells, while leaving normal cells essentially unaffected. More in particular, the disclosure relates to (single-chain) proteinaceous molecules comprising binding domains specific for at least two different binding sites on aberrant cells.
- The major challenge for today's drug discovery community is the design of therapeutic molecules that are sufficiently specific for aberrant cells related to malignancies, such as cancers and autoimmune diseases. Such specificity is required to attain acceptable low drug-related adverse reactions for healthy cells. The major hurdle to overcome is the presence of target molecules, not only on/at aberrant cells, but also on healthy cells, albeit at lower frequency. Truly tumor-specific targets or aberrant cell-specific targets are very rare.
- Provided are proteinaceous binding molecules with improved specificity for targeting aberrant cells, accompanied by a reduced risk for unwanted side effects induced by unintentionally targeting normal cells.
- Thus, provided is a proteinaceous molecule comprising at least two different specific binding domains for different binding sites separated by at least one linker, wherein the proteinaceous molecule comprises a single polypeptide chain.
- As used herein, “proteinaceous molecules” are molecules comprising at least a string of amino acid residues that can be obtained as an expression product from a single messenger RNA molecule. In addition, according to the disclosure, the proteinaceous molecules may comprise carbohydrates, disulphide bonds, phosphorylations, sulphatations, etc., as a result of any post-translational modification, and/or any other modification such as those resulting from chemical modifications (e.g., linking of effector moieties). In one embodiment, the proteinaceous molecules comprise a single polypeptide chain comprising at least two specific binding domains. In a preferred embodiment, the proteinaceous molecules of the disclosure comprise binding domains separated by at least one linker. Of course, the proteinaceous molecules of the disclosure can also comprise other functionalities, for example, provided with protein domains or amino acid sequences, linked through peptide bonds or through any linker chemistry known in the art.
- A “polypeptide chain” is defined as a string of amino acid residues. “Specific binding domains” are domains that preferentially bind to binding sites on molecules, such as epitopes, with a higher binding affinity than background interactions between molecules. In the context of the disclosure, “background interactions” are interactions with an affinity lower than a KD of 10E-4 M. Preferably, specific binding domains bind with an affinity higher than a KD of about 10E-5 M. Specific binding domains in the proteinaceous molecules of the disclosure have at least a molecular size allowing their folding into a binding site. At the upper size limit, the binding domains have a size still allowing proper and stable folding and expression. Typically, domains meeting these size requirements are approximately 25 up to 500 amino acid residues in length, and preferred domains are 40 to 200 amino acid residues in length, and, more preferably, domains are about the size of a variable domain of a heavy chain of an immunoglobulin (“Vh”). For the proteinaceous molecules of the disclosure, of particular use are specific binding domains present in immune molecules, such as those present in T-cell receptors and immunoglobulins. Especially, a Vh sequence is a preferred specific binding domain in the proteinaceous molecules of the disclosure. Vh domains are especially suitable for use as a specific binding domain. Vh domains are relatively stable and easy to obtain via various expression systems. Moreover, engineering methods to further improve, for example, domain stability or solubility are readily available. An available good source for such binding domains consisting of Vh sequences are phage display libraries. Also, a good source for such binding domains are natural libraries, synthetic libraries and semi-synthetic libraries.
- As said, the specific binding domains in the proteinaceous molecules of the disclosure are separated by at least one linker. Preferably, these linkers are connected with binding domains through peptide bonds. In many instances, a simple Gly-Ser linker of 4-15 amino-acid residues may suffice, but if greater flexibility of the amino-acid chain is desired and/or when greater spacing between consecutive domains is desired, longer or more complex linkers may be used. Preferred linkers are (Gly4Ser)n(SEQ ID. NO:11), (GlySerThrSerGlySer)n (SEQ ID. NO:12) or any other linker that provides flexibility for protein folding and flexibility for the polypeptide to exhibit its dual or multiple activity, i.e., binding to two or more different binding sites. Additional examples of suitable linkers are the linker sequences connecting domains in human multi-domain plasma proteins. Using linker sequences adapted from multi-domain plasma proteins including immunoglobulins has several advantages. Use of these human amino-acid sequences that are exposed in plasma in the molecules of the disclosure may lower the risk for adverse immune responses. Moreover, these linker sequences are optimized by natural selection to provide multi-domain proteins required inter-domain flexibility for exerting several protein-target interactions simultaneously, involving two or more domains in the multi-domain protein. Examples of such multi-domain plasma proteins comprising inter-domain linkers are vitronectin, fibrinogen, factor VIII, fibronectin, von Willebrand factor, factor XII, plasminogen, factor H, factor I, C1, C3, beta2-
glycoprotein 1, immunoglobulin M, and immunoglobulin G. Examples of linkers particularly suitable for covalently connecting domains in the single-chain molecules of the disclosure are linkers based on amino-acid sequences of hinge regions in immunoglobulins of preferably human origin. - According to the disclosure, the at least two specific binding domains of the proteinaceous molecules of the disclosure are different binding domains, endowed with binding affinity for at least two different binding sites. It is appreciated that within the context of the current disclosure, binding sites are (parts of) molecules associated with the cell surface of aberrant cells. It is part of the disclosure that the different binding sites are part of different molecules, or are located on the same molecule, or any combination thereof. Thus, according to the disclosure, the at least two different binding sites targeted by the at least two different specific binding domains of the proteinaceous molecules of the disclosure are associated with the cell surface of aberrant cells. In a preferred embodiment of the disclosure, the different binding sites are co-located at the surface of the same aberrant cell. Preferred binding sites are binding sites located at aberrant cell surface molecules. Examples of such cell surface molecules are integrins, cell surface receptors, cell surface markers, and major histocompatibility complex molecules complexed with T-cell epitopes.
- An “aberrant cell” is defined as a cell that deviates from its healthy normal counterparts. Aberrant cells are, for example, tumor cells and autoimmune cells.
- Thus, according to the disclosure, proteinaceous molecules comprising at least two different specific binding domains are provided (“multi-specific” proteinaceous molecules) that are particularly suitable for binding to at least two different binding sites associated with the cell surface of aberrant cells. By targeting with a single binding molecule two or more target binding sites on an aberrant cell such as a tumor cell, the risk that both targets are also present on one healthy cell is significantly diminished. The affinity of the binding molecules for the different target binding sites separately, preferably is designed such that Kon and Koff are very much skewed towards binding with all different binding sites simultaneously. Preferably, normal cells having only one of the different target binding sites are not bound for a time long enough, if at all, thereby reducing the occurrence of any deleterious effects. Thus, the specificity of the proteinaceous molecules of the disclosure is increased by increasing their avidity for binding to multiple binding sites on aberrant cells. The avidity is preferably increased by incorporating multiple copies, preferably two to six copies, of at least one of the at least two different binding domains in the proteinaceous molecules (“multi-valent” proteinaceous molecules).
FIGS. 1 and 2 give a number of possible preferred molecular designs. It is appreciated that at least one copy of each of the at least two different specific binding domains of the proteinaceous molecules of the disclosure must bind to their respective binding sites. Of course, it is preferred that two or more of the copies bind simultaneously, and most preferably, all copies of a binding domain present in the proteinaceous molecule bind simultaneously. - In an additional embodiment of the disclosure, a proteinaceous molecule is provided, comprising at least three specific binding domains for different binding sites separated from each other by at least one linker.
- It is preferred that proteinaceous molecules of the disclosure comprise the minimal number of different specific binding domains providing the specificity for aberrant cells over normal cells. It is then also preferred that the proteinaceous molecules of the disclosure comprise the minimal number of copies of each of the different specific binding domains required for providing the desired specificity. These optimal proteinaceous molecules of the disclosure regarding specificity are selected from possible proteinaceous molecules with varying numbers of different binding domains, varying numbers of copies of each of the different domains, and different domain topologies possible with the varying numbers of different domains and copies. Preferably, proteinaceous molecules of the disclosure comprise two or three different binding domains. Preferably, proteinaceous molecules of the disclosure comprise one to six copies of each of the different domains. Thus, a typical proteinaceous molecule of the disclosure comprises two different binding domains A, B with four copies of each domain, with domain topology A-B-A-B-A-B-A-B. See
FIGS. 1 and 2 for some typical examples of preferred proteinaceous molecules regarding number of different domains, copies of domains and topologies. - Repetitive proteinaceous structures are sometimes difficult to express. By selecting (modestly) different binding domains specific for the same molecule, or even for the same binding site on the molecule, expression issues with repetitive structures are largely diminished. These expression problems are further addressed by selecting different linkers for connecting consecutive domains. Thus, an example of a typically preferred molecule of the disclosure has the following structure: A-linker1-B′-linker2-A″-linker3-B-linker1-A′-linker2-B″.
- Thus, according to the disclosure, proteinaceous molecules comprising at least three different specific binding domains are provided that are particularly suitable for binding to at least three different binding sites associated with the cell surface of aberrant cells. In a preferred embodiment, the proteinaceous molecules of the disclosure comprise specific binding domains comprising at least one Vh domain. More preferably, all two, three or more specific binding domains in the proteinaceous molecules of the disclosure are Vh domains. Thus, a proteinaceous molecule, according to the disclosure, is a proteinaceous molecule wherein at least one specific binding domain is a Vh domain. Preferably, Vh domains are human Vh domains.
- As said, in a preferred embodiment of the disclosure, the different binding sites targeted by the proteinaceous molecules of the disclosure are located at the surface of the same aberrant cell. It is preferred that the molecules comprising the binding sites are internalized into the tumor cell together with the binding molecule of the disclosure. In a preferred embodiment, the cells go into apoptosis as a result of internalization. Also incorporated in the disclosure are proteinaceous molecules that, upon binding to target aberrant cells, mediate target aberrant cell lysis or phagocytosis. Thus, the disclosure provides a proteinaceous molecule wherein at least one binding domain is a ligand for a receptor, or a receptor binding fragment and/or derivative of such a ligand. It is preferred that binding of such binding domains to the target receptor on the tumor cell induces internalization of the bound proteinaceous molecules of the disclosure. Preferred suitable ligands for receptors are growth factors, lectins, kinases, hormones, cytokines, chemokines, Toll-like receptor ligands and T-cell epitopes, to name a few.
- In one preferred embodiment, the proteinaceous molecules of the disclosure further comprise at least one effector moiety, linked to the polypeptide chain comprising the specific binding domains. Effector moieties preferably improve the potency of a therapeutic molecule and/or increase the efficacy of a therapeutic molecule. It is part of the current disclosure that effector moieties are covalently bound to proteinaceous molecules of the disclosure via peptide bonds, and preferably via a linker. Alternatively, as part of the disclosure, effector moieties are linked to the proteinaceous molecules applying any other suitable linker chemistry known in the art. Yet in another embodiment, the proteinaceous molecules of the disclosure comprise specific binding domains for binding sites on effector moieties. An advantage of such binding molecules of the disclosure is the provided flexibility in the order of binding events. Proteinaceous molecules of the disclosure can first bind to target binding sites on aberrant cells, followed by binding to an effector moiety exposed to the proteinaceous molecules localized on the aberrant cells. Such a proteinaceous molecule of the disclosure is, for example, used for the treatment of cancer. An advantage of such proteinaceous molecules is the possibility of specific delivery of the effector moiety at aberrant cells, preventing normal cells from being exposed to the deleterious effects of the effector moiety.
- Preferred effector moieties, according to the disclosure, are numerous, e.g., toxins, statins, apoptin, chelated radioactive metal ions, and radioactive iodine. Other suitable effector moieties, according to the disclosure, are ricin A, gelonin, saporin, interleukin-2, interleukin-12, viral proteins E4orf4 and NS1, and non-viral cellular proteins HAMLET, TRAIL and mda-7 of which the latter five can, like apoptin, specifically induce apoptosis in aberrant cells after internalization of the proteinaceous molecules of the disclosure comprising at least one of such effector moieties.
- When proteinaceous molecules of the disclosure are designed to first bind to a target aberrant cell, followed by internalization, the effector moiety can then subsequently have its intracellular (cytotoxic) function. It is preferred that such an effector moiety has a contribution to the specificity of the cytotoxic effect. Therefore, it is preferred to use as an effector moiety a molecule that induces cell death in aberrant cells, but not in normal cells. An example of such a specific effector moiety is apoptin.
- Thus, the disclosure provides a proteinaceous molecule, further comprising an effector moiety.
- As said, preferred proteinaceous molecules of the disclosure comprise at least two different specific binding domains. Particularly suitable and preferred specific binding domains are domains based on Vh sequences. Thus, the disclosure also provides a proteinaceous molecule comprising at least two Vh domains. A few examples of such molecules of the disclosure are provided in
FIGS. 1 and 2 . In a preferable embodiment, these Vh domains are derived from human Vh sequences. It is appreciated that Vh domains, as such, are already relatively stable. Still, stability and solubility of human Vh domains can be further improved by engineering approaches known in the art. Particularly suitable for the purpose is applying a process referred to as “camelization” of the human Vh sequence. Now, selected amino acid residues in the human Vh sequence, not contributing to the binding specificity and affinity of the domain, are replaced for amino acid residues present at the corresponding sites of llama Vh domains. Preferred amino acid substitutions contributing to improved stability/solubility are Glu6Ala, Ala33Cys, Val37Phe, Gly44Glu, Leu45Arg, Trp47Gly, Ser74Ala, Arg83Lys, Ala84Pro, Trp103Arg or Leu108Gln. Thus, the disclosure also provides a proteinaceous molecule comprising camelized human Vh domains with improved stability and/or solubility. - Other functions that may be introduced in the proteinaceous molecules of the disclosure may have to do with improved half-life (e.g., human serum albumin (HSA) can be included or one or more binding domains binding to a binding site in HSA) or with complement activation (Fc monomer of immunoglobulins can be included; in this case the molecules, according to the disclosure, may dimerize). Other functionalities that can be incorporated are cytokines, hormones, Toll-like receptor ligands, (activated) complement proteins, etc.
- Thus, the disclosure provides a proteinaceous molecule comprising at least two Vh domains specific for different binding sites and an Fc monomer. And, thus, the disclosure also provides a dimeric proteinaceous molecule, comprising two proteinaceous molecules dimerized through two Fc monomers. Proteinaceous molecules comprising immunoglobulin CH3 domains are also part of the disclosure. Similar to Fc monomers, the CH3 domain can serve as a dimerization domain. Homo-dimeric as well as hetero-dimeric proteinaceous molecules are part of the disclosure. Homo-dimeric binding molecules comprise dimerized Fc monomers with identical arms. The heterogeneity of hetero-dimeric proteinaceous molecules of the disclosure originates from the two Fc monomers in the hetero-dimer, differing in the type, number and/or topology of their respective specific binding domains, linkers and/or effector moieties. Thus, in one embodiment, the disclosure provides a hetero-dimeric molecule comprising two different proteinaceous molecules. The two different proteinaceous molecules are then dimerized through their respective Fc monomers. Upon applying preferred pairing biochemistry, hetero-dimers are preferentially formed over homo-dimers. For example, two different Fc monomers are subject to forced pairing upon applying the “knobs-into-holes” CH3 domain engineering technology as described (Ridgway et al., Protein Engineering, 1996). An advantage of the proteinaceous molecules of the disclosure comprising dimerized Fc monomers is the localization of phagocytosis and/or cell lytic activity at the surface of aberrant cells to which these proteinaceous molecules bind. These activities can enhance the deleterious effects on aberrant cells, induced by the proteinaceous molecules of the disclosure specifically bound to these aberrant cells. An advantage of such hetero-dimeric proteinaceous molecules of the disclosure is their increased spatial flexibility regarding the different/differently located specific binding domains in the two arms.
- In one embodiment, binding molecules are provided comprising one or multiple copies of each of at least two different binding domains specific for at least two different binding sites on aberrant cells. Cellular aberrancies, such as cancers and autoimmune diseases, are manifested by the presence of unique combinations of surface molecules on the aberrant cell surface and/or by the relatively high cell-surface density of the surface molecules. It is thus one of the preferred embodiments that the at least two different binding sites targeted by proteinaceous molecules of the disclosure are located on aberrant cells. It is even more preferred that these at least two different binding sites are not all present on normal cells, and/or are present at lower numbers on normal cells. An example are proteinaceous molecules, according to the disclosure, comprising at least one copy of a specific binding domain for a binding site in carcinoembryonic antigen (CEA) and at least one copy of a specific binding domain for a binding site in MUC-1 with altered glycosylation pattern, expressed in aberrant cells of the colon during colorectal cancer. Altered MUC-1 is not expressed in normal cells of the colon; CEA is over-expressed on tumor cells in the colon. It is thus most preferred that all of the at least two different binding sites are unique to aberrant cells and not present at all on normal cells. Examples of such combinations of binding sites are T-cell epitopes derived from tumor-specific markers, complexed with HLA. Thus, in a preferred embodiment, a proteinaceous molecule, according to the disclosure, is provided for use in the treatment of a disease related to aberrant cells.
- For administration to subjects, the proteinaceous molecules, according to the disclosure, must be formulated. Typically, these proteinaceous molecules will be given parentally. For formulation, simply saline for injection may suffice. For stability reasons, more complex formulations may be necessary. The disclosure contemplates lyophilized compositions as well as liquid compositions, provided with the usual additives. Thus, the disclosure provides a pharmaceutical composition comprising a proteinaceous molecule, according to any of the embodiments of the disclosure and suitable excipients.
- The dosage of the proteinaceous molecules, according to the disclosure must be established through animal studies and clinical studies in so-called rising-dose experiments. Typically, the doses will be comparable with present-day antibody dosages (at the molar level, the weight of the molecules may differ from that of antibodies). Typically, such dosages are 3 to 15 mg/kg body weight, or 25 to 1000 mg per dose.
- It is anticipated that in the field of, for example, tumor therapy, the proteinaceous molecules of the disclosure will replace current single agents binding to a single binding site. In addition, especially in the more difficult to treat tumors, the first applications of the proteinaceous molecules, according to the disclosure, will (at least initially) probably take place in combination with other treatments (standard care). Of course, the disclosure also provides proteinaceous molecules for use in novel or first treatments of any other tumor, for which current treatments are not efficient enough or for which no treatment options are currently available. Thus, the disclosure also provides a pharmaceutical composition comprising a proteinaceous molecule and a conventional cytostatic and/or tumoricidal agent. Moreover, the current disclosure also provides a pharmaceutical composition comprising a proteinaceous molecule for use in an adjuvant treatment of cancer. Additionally, the current disclosure also provides a pharmaceutical composition comprising a proteinaceous molecule for use in a combination chemotherapy treatment of cancer. Examples of chemotherapeutical treatments that are combined with the pharmaceutical composition of the current disclosure are etoposide, paclitaxel, doxorubicin and methotrexate.
- The pharmaceutical compositions, according to the disclosure, will typically find their use in the treatment of cancer, particularly in forms of cancer where the at least two different binding sites of the preferred proteinaceous molecules of the disclosure are present on tumor cells. It is easy using binding domains, according to the disclosure, to identify tumors that present tumor-specific antigen(s). This can be done in vitro or in vivo (imaging).
- The disclosure, of course, also comprises a nucleic acid molecule encoding a proteinaceous molecule according to any of the embodiments of the disclosure. The molecules, according to the disclosure, can be produced in prokaryotes as well as eukaryotes. The codon usage of prokaryotes may be different from that in eukaryotes. The nucleic acids, according to the disclosure, can be adapted in these respects. Also, elements that are necessary for secretion may be added, as well as promoters, terminators, enhancers, etc. Also, elements that are necessary and/or beneficial for the isolation and/or purification of the proteinaceous molecules may be added. Typically, the nucleic acids, according to the disclosure, are provided in an expression vector suitable for the host in which they are to be produced. Choice of a production platform will depend on the size of the molecule, the expected issues around protein folding, whether additional sequences are present that require glycosylation, expected issues around isolation and/or purification, etc. For example, whether or not specific binding domains of the disclosure comprise disulphide bonds will guide the selection of the preferred production platform. Thus, nucleic acids, according to the disclosure, are typically adapted to the production and purification platform in which the proteinaceous molecules, according to the disclosure, are to be produced. Thus, the disclosure provides a vector comprising a nucleic acid molecule encoding a proteinaceous molecule, according to the disclosure. For stable expression in a eukaryote, it is preferred that the nucleic acid encoding the proteinaceous molecule, according to the disclosure, is integrated in the host cell genome (at a suitable site that is not silenced).
- In one embodiment, the disclosure, therefore, comprises a vector comprising means for integrating the nucleic acid in the genome of a host cell. The disclosure further comprises the host cell or the organism in which the proteinaceous molecule encoding nucleic acid molecule is present and which is thus capable of producing the proteinaceous molecule, according to the disclosure. Thus, in a preferred embodiment, the disclosure comprises a cell comprising a nucleic acid molecule, according to the disclosure, preferably integrated in its genome and/or a vector, according to the disclosure, comprising a nucleic acid molecule encoding a proteinaceous molecule, according to the disclosure.
- Included in the present disclosure is also a method for producing a proteinaceous molecule, according to the disclosure, comprising culturing a cell, according to the disclosure, comprising a nucleic acid molecule encoding a proteinaceous molecule, according to the disclosure, preferably integrated in the cell's genome and/or a vector, according to the disclosure, comprising a nucleic acid molecule encoding a proteinaceous molecule, according to the disclosure, allowing for expression of the proteinaceous molecule and separating the proteinaceous molecule from the culture.
- Typical proteinaceous molecules of the disclosure, according to any of the aforementioned embodiments, are provided and exemplified by the binding molecules outlined in this section, in
FIG. 1 andFIG. 2 , and by the examples provided below and in the Examples section. Thus, the disclosure provides a proteinaceous molecule, according toFIG. 1 orFIG. 2 . - Abbreviations used: Ab, antibody; ADCC, antibody-dependent cell-mediated cytotoxicity; CDC, complement-dependent cytotoxicity; CDR, complementarity-determining region; CH, constant domain of the heavy chain of an antibody; CHO, Chinese hamster ovary; DAMPs, damage associated molecular patterns; HEK, human embryonic kidney; IEP, iso-electric point; Ig, immunoglobulin; MAGE, melanoma-associated antigen; MHC, major histocompatibility complex; PAMPs, pathogen associated molecular patterns; RA, rheumatoid arthritis; sc-Fv, single-chain variable fragment; SLE, systemic lupus erythematosis; VHH or sdAb, single domain antibodies; TCR, T-cell receptor; VH, Vh or VH, variable amino-acid sequence of an antibody heavy domain.
-
FIG. 1 : Exemplified topologies of binding molecules comprising one or more copies each of two or more different binding domains, each binding to a different binding site, according to the disclosure, and in one embodiment comprising effector moieties as part of the disclosure. - 1. Topologies of binding molecule comprising two different binding domains “D1” and “D2,” and divalent for a
binding site 1 and monovalent for abinding site 2. - 2. Binding molecule comprising two different binding domains and monovalent for a
binding site 1 and multivalent for a binding site 2 (multi-valency is, for example, three to six). Shown are two examples of many possible single-chain polypeptides according to the disclosure. All possible permutations regarding the position of the single binding domain and the multiple copies of the second binding domain are also part of the disclosure, and are visualized by the ensemble of different domains and number of domains between accolades. - 3. Binding molecule comprising two different binding domains, each binding to a different binding site and with two to six copies of a first binding domain and with two to six copies of a second binding domain, providing multi-valency for both binding sites. As an example, a binding molecule is shown in which binding domains binding to the same binding site are linked in consecutive order. All possible domain topologies obtained by permutations regarding domain positions in the single chain binding molecule of all binding domains of both kinds, are also part of the disclosure.
- 4. Binding molecule comprising three, four, five or six different binding domains, thus binding to three, four, five or six different binding sites, respectively, and monovalent or multivalent for a
binding site 1, monovalent or multivalent for abinding site 2, etc., (the valencies for the three to six different binding sites are, for example, one to six). As an example, four binding molecules are shown in which one to six clustered identical binding domains are linked in consecutive order, with three, four, five and six different binding domains in the binding molecules, respectively. All possible domain topologies obtainable by permutations regarding domain positions in the single chain binding molecule, of all one to six copies of the three to six different binding domains, are also part of the disclosure. - 5. Binding molecule comprising two different binding domains, each binding to a separate binding site and with one binding domain monovalent or multivalent for a
binding site 1 and the second binding domain monovalent or multivalent for a binding site 2 (both valencies are, for example, one to six), and with one or more effector moieties (covalently) bound to the binding molecule. As an example, a binding molecule is shown in which the two sets of one to six binding domains are linked in consecutive order, with the effector moiety covalently linked to the C-terminus of the binding molecule. All possible domain topologies obtainable by permutations regarding each domain position in the single chain binding molecule are also part of the disclosure. - 6. Similar to 5, now with three to six different binding domains, for each of which, one to six copies of the unique binding domains are part of the binding molecule.
-
FIG. 2 : Cartoon displaying examples of preferred domain topologies of proteinaceous molecules of the disclosure. Examples are provided of possible combinations of VH domains and distinct linker sequences for the construction of multi-domain proteins that are multi-specific. In Lanes a through h, various examples are provided of proteinaceous molecules of the disclosure, comprising two or three different binding domains, and comprising one, two, three or four copies of the various binding domains, each, all linked with two or three different linkers (see, also,FIG. 1 , example 1 through 4, for additional preferred domain topologies of the disclosure). In Lanes i and k, the exemplified preferred proteinaceous molecules of the disclosure further comprise an effector moiety linked to the single-chain polypeptide comprising different binding domains (additional preferred proteinaceous molecules of the disclosure comprising at least one effector moiety are provided in examples 5 and 6 inFIG. 1 ). In Lanes j and k, the exemplified preferred proteinaceous molecules of the disclosure further comprise an Fc monomer linked to the different binding domains. -
FIG. 3 : is a schematic presentation of the bispecific scFv anti-CD3×scTCR ßα with HLA-A1/MAGE-A1 specificity. -
FIG. 4 : shows the binding of the bispecific scFv anti-CD3×scTCR ßα to primary human T-lymphocytes. Binding of the bispecific scFv anti-CD3×scTCRßα to primary human T-lymphocytes was verified by flow-cytometry using FITC-labelled anti-Vα-12.1 specific mAb. In short, 0.5×106 primary human T-lymphocytes were incubated for 30 minutes (on ice) with supernatant from 293T cells expressing the bispecific scFv×scTCR. Next, 1 μg FITC-labelled anti-Vα-12.1 was added and incubated for 30 minutes. Shown are cells bound by the bispecific scFv×scTCR stained with an irrelevant FITC labelled antibody (negative control; white) and cells bound by the scFv×scTCR labelled with Vα-12.1. -
FIG. 5 : shows that primary human T-lymphocytes specifically kill HLA-A1/MAGE-A1 positive tumor cells. X-axis: Effector (:) Target-cell ratios 10(:)1, 3(:)1, 1(:)1, 0.3(:)1. The _.._.._ line depicts T-lymphocytes with melanoma cell-specific antigen 2G12-specific bispecific molecule, the straight line (-) depicts T-lymphocytes plus HLA-A1-MAGE-A1 specific bispecific molecule, the - - - line depicts T-lymphocytes without bispecific molecule. Primary human T-lymphocytes were labelled with either the HLA-A1/MAGE-A1 bispecific scFv×scTCR or with an 2G12 antigen specific scFv×scFv. These T-lymphocytes were incubated for 4 hours with 51Cr labelled HLA-A1/MAGE-A1, and 2G12 antigen-positive melanomacells MZ2 MEL3 0 As a negative control MZ2-MEL 2 2 cells that have lost expression of MAGE-A1, but still have 2G12 expression, were used. As shown, the 51Cr-release assay demonstrates specific tumor cell kill by scFv×scTCR labelled human T-lymphocytes. - A further aspect of the disclosure relates to a method for providing the binding molecules, according to the disclosure. As described hereinabove, it typically involves providing a nucleic acid construct encoding the desired binding molecule. The nucleic acid construct can be introduced, preferably via a plasmid or expression vector, into a prokaryotic host cell and/or in a plant cell and/or in a eukaryotic host cell capable of expressing the construct. In one embodiment, a method of the disclosure to provide a binding molecule comprises the steps of providing a host cell with one or more nucleic acid(s) encoding the binding molecule, and allowing the expression of the nucleic acids by the host cell.
- Binding molecules of the disclosure are, for example, expressed in plant cells, eukaryotic cells or in prokaryotic cells. Non-limited examples of suitable expression systems are tobacco plants, Pichia pastoris, Saccharomyces cerevisiae. Also, cell-free recombinant protein production platforms are suitable. Preferred host cells are bacteria, like, for example, bacterial strain BL21 or strain SE1, or mammalian host cells, more preferably, human host cells. Suitable mammalian host cells include human embryonic kidney (HEK-293) cells or Chinese hamster ovary (CHO) cells, which can be commercially obtained. Insect cells, such as S2 or S9 cells, may also be used using baculovirus or insect cell expression vectors, although they are less suitable when the polypeptides, according to the disclosure, include elements that involve glycosylation. The produced binding molecules, according to the disclosure, can be extracted or isolated from the host cell or, if they are secreted, from the culture medium of the host cell. Thus, in one embodiment, a method of the disclosure comprises providing a host cell with one or more nucleic acid(s) encoding the binding molecule, allowing the expression of the nucleic acids by the host cell. In another preferred embodiment, a method of the disclosure comprises providing a host cell with one or more nucleic acid(s) encoding two or more different binding molecules allowing the expression of the nucleic acids by the host cell. For example, in one embodiment, nucleic acids encoding for two or more different binding molecules, all comprising an Fc monomer, are provided, enabling isolation of multiple single-chain binding molecules, and/or enabling isolation of homo-dimers and/or hetero-dimers formed through Fc dimerization. Methods for the recombinant expression of (mammalian) proteins in a (mammalian) host cell are well known in the art.
- As will be clear, a binding molecule of the disclosure finds its use in many therapeutic applications and non-therapeutic applications, e.g., diagnostics, or scientific applications. Proteinaceous molecules of the disclosure suitable for diagnostic purposes are of particular use for monitoring the expression levels of molecules exposing binding sites on aberrant cells that are targeted by proteinaceous molecules of the disclosure applied for their therapeutic benefit. In this way, it is monitored, whether the therapy remains efficacious or whether other proteinaceous molecules of the disclosure targeting one or more different binding sites on the aberrant cells should be applied instead. This is beneficial when the expression levels of the first targeted binding site(s) are below a certain threshold, whereas other or new binding sites (still) can serve as newly targeted binding sites for proteinaceous molecules of the disclosure comprising the appropriate specific binding domains for these alternative binding sites. Binding molecules of the disclosure may also be used for the detection of (circulating) tumor cells, for the target cell-specific delivery of cytotoxic compounds or for the delivery of immune-stimulatory molecules.
- Provided herein is a method for inducing, ex vivo or in vivo, a modulating effect on a biological process at or in a target cell, comprising contacting the cell with a binding molecule, according to the disclosure, in an amount that is effective to induce the modulating effect. According to the disclosure, the modulating effect or combined modulating effects is/are agonistic, or stimulatory, or activating in nature, or the effect(s) is/are interfering, or antagonistic in nature, or any combination thereof. In addition, the modulating effect(s) is/are additive or synergistic in nature for different binding domains in the binding molecules, or combinations thereof.
- Preferably, the binding molecule is used for a modulating effect on a biological process of aberrant cells in a subject, more preferably a human subject. For therapeutic applications in humans, it is, of course, preferred that a binding molecule does not contain amino acid sequences of non-mammalian origin. More preferred are binding molecules that only contain human amino acid sequences. Therefore, a therapeutically effective amount of a binding molecule capable of recognizing and binding to one or more disease-specific binding sites and subsequently inducing a modulating effect on a biological process at the cell surface or in the cell, can be administered to a patient to stimulate eradication of diseased cells expressing the binding sites without affecting the viability of (normal) cells not expressing the disease-specific binding sites. The killing of diseased cells, while minimizing or even totally avoiding the deterioration or even death of normal cells, will generally improve the therapeutic outcome of a patient after administration of the binding molecule.
- Accordingly, also provided is the use of a binding molecule, according to the disclosure, as a medicament. In another aspect, the disclosure provides the use of a binding molecule for the manufacture of a medicament for the treatment of cancer, autoimmune disease or any other disease of which the symptoms are reduced upon targeting cells expressing one or more disease-specific binding sites with proteinaceous molecules of the disclosure. For example, a binding molecule is advantageously used for the manufacture of a medicament for the treatment of various cancers (e.g., solid tumors, hematologic malignancies).
- Antibody fragments of human origin can be isolated from large antibody repertoires displayed by phages. One aspect of the disclosure, known by the art, is the use of human antibody phage display libraries for the selection of two or more human antibody fragments specific for two or more selected different binding sites, e.g., epitopes. These antibody fragments usually display low affinity. A method is provided that allows the generation of high avidity antibody chains able to bind and exert the modulating biological activity in a specific and efficient manner. An aspect of the present disclosure is the development of a binding molecule comprising multiple binding domains. That is to say, preferably a human Vh domain, capable of binding to a certain binding site combined with a second, third, fourth, and so on, copy of an identical binding domain (multi-valency), and at least one copy of one or more different human Vh domains with each different human Vh domain capable of binding to a separate binding site (multi-specificity). In this way, avidity regarding the first binding site and, if multiple binding domains are applied specific for a second, third, fourth, and so on binding site, avidity regarding this second, third, fourth, and so on binding site is enhanced.
- Thus, a proteinaceous molecule is provided comprising at least two copies of a binding domain specific for a binding site functionally connected with at least one copy of a different binding domain specific for a different binding site. Preferably, these different binding domains are functionally connected to each other via peptide bonds between amino acid residues flanking the binding domains, providing a continuous single chain proteinaceous molecule (
FIGS. 1 and 2 ). It is also part of the disclosure that the binding domains are linked together via bonds and/or binding interactions other than peptide bonds. Alternative methods for linking proteinaceous molecules to each other are numerous and well known to those skilled in the art of protein linkage chemistry. Protein linkage chemistry not based on peptide bonds can be based on covalent interactions and/or on non-covalent interactions. - A multi-specific proteinaceous molecule in a mono-valent or multi-valent binding molecule form of the disclosure capable of modulating a biological process is, for example, composed of at least copies of two different human Vh domains, which are multimerized at the DNA level in order to obtain a single-chain polypeptide construct upon expression.
- Human Vh domains usually do not meet the standards for stability and efficient expression that are required by the field. They tend to be unstable, poorly soluble and poorly expressed. A process called “camelization” may be used to convert human Vh into more stable antibody fragments.
- The human antibody germline region Vh-3 displays high homology with antibody Vh fragments of llamas. Llamas have two types of antibodies, those composed of heavy and light chains, and antibodies that only contain heavy chains. These heavy-chain only antibodies bind antigens similar to classical antibodies composed of heavy and light chains. The smallest functional llama antibody binding domain, the Vhh domain, also called (single) domain antibodies ((s)dAb), have been shown to be expressed well and may bind antigen with high affinity. In addition, it has been shown that some of the characteristics, such as ease of expression and stability, of llama sdAb can be transferred to, e.g., human Vh by replacing a few amino acids in the human Vh for those of llama Vhh. Antibody molecules with multi-specificity can then be generated by ligation of one or more copies of several different “camelized” human Vh domains, each with affinity for different binding sites, into one single molecule. Moreover, high avidity antibody molecules can then be generated by ligation of several of the camelized human Vh domains binding to the same binding site, into one single molecule.
- For each of the at least two binding sites, the proteinaceous molecules of the disclosure comprise one to twelve and, more preferably, one to six and, even more preferably, one to three camelized human Vh domains interspersed by short linkers, for example, short Gly-Ser linkers, and connected through peptide bonds to the camelized human Vh domains interspersed by short linkers, specific for the other target binding sites of the binding molecules. In another embodiment, for at least one of the at least two different binding sites, the proteinaceous molecules of the disclosure comprise preferably four to six camelized human Vh domains interspersed by short linkers, herewith providing the molecules with the capacity to cross-link four to six target molecules exposing this targeted binding site. In an even more preferred embodiment, this cross-linking of molecules induces apoptosis in cells expressing surface molecules exposing the targeted binding site for the four to six binding domains.
- Compared to binding molecules specific for a single binding site, the proteinaceous molecules of the disclosure have, amongst others, the following advantages regarding efficacy and specificity. The proteinaceous binding molecules of the disclosure have an increased specificity for aberrant cells by targeting multiple binding sites specific for the aberrant cell simultaneously and/or by targeting combinations of binding sites unique to the aberrant cell simultaneously. In this way, aberrant cells are targeted more efficiently, avoiding (excessive) targeting of healthy cells, and thus lowering the risk for toxic and undesired side-effects significantly. This high specificity for aberrant cells is achieved with proteinaceous molecules of the disclosure bearing relatively low affinity for each separate binding site present on aberrant cells and perhaps on healthy cells, while bearing relatively high avidity for aberrant cells exposing a combination of different binding sites unique to the aberrant cells.
- Below, several examples are provided for these combinations of binding sites that provide suitable therapeutic targets for the molecules of the disclosure. Moreover, with the multi-specific proteinaceous molecules of the disclosure, difficult to target and/or difficult to reach aberrant cells have a higher chance of being “hit” by at least one of the binding domains, thereby providing, at least in part, the therapeutic activity and increasing the success rate when compared to single molecule/single target therapies. For example, high specificity for aberrant cells is achieved when one or more copies of different binding domains are combined in binding molecules of the disclosure, with the different binding domains individually having relatively low affinity for their respective binding sites, though in combination having relatively high avidity for aberrant cells, either uniquely expressing the combination of binding sites or highly expressing the binding sites relative to healthy cells, or any combination thereof.
- Examples of various possible domain topologies in the proteinaceous molecules of the disclosure, as exemplified below, are provided in
FIG. 1 and inFIG. 2 . In one example, combining two or more different low-affinity binding domains specific for surface markers present on both healthy cells and aberrant cells still provides for proteinaceous molecules of the disclosure highly specific for the aberrant cells, when the surface markers are highly expressed on the aberrant cells, compared to expression levels on healthy cells. Therefore, in a preferred embodiment, the desired high specificity for aberrant cells and concomitant high efficacy regarding aberrant cell eradication, leaving healthy cells in essence unaltered, of the proteinaceous molecules of the disclosure, are tunable (“mix and match” approach) by selecting for, for example: -
- (i) optimal target binding sites regarding the level of uniqueness compared to normal cells,
- (ii) optimal number of different binding sites (preferably two or three),
- (iii) optimal number of binding domains for each selected binding site (preferably one to six),
- (iv) optimal domain topologies,
- (v) optimal affinity of each binding domain (preferably larger than a KD of 10E-5 M),
- (vi) optimal avidity for the proteinaceous,
- (vii) optimal tumor penetration abilities based on molecular size (preferably larger than 65 kDa to reduce glomerular filtration) and iso-electric point (preferably 5-9),
- (viii) optimally facilitating cellular uptake of the proteinaceous molecules of the disclosure (to allow for, for example, pro-apoptotic activity).
- In one embodiment, use of the multi-specific proteinaceous molecules of the disclosure now provides for methods to lower the risk for immune escape by aberrant cells. Following current practice, applying a single target binding site therapy bears the risk for unwanted immune escape by the aberrant cell, rendering the therapy ineffective. In general, by natural occurring mutation rates and/or under pressure of a selected (immune) therapy, binding sites on the aberrant cell may eventually mutate. Now alternatively, by targeting two or more different binding sites on the aberrant cell with the proteinaceous molecules of the disclosure, effective binding to at least one or to several binding sites remains, even after occurrence of mutations in one or several of the other binding sites targeted by the proteinaceous molecules of the disclosure. In this way, at least part of the desired therapeutic effect is maintained. This improved therapeutic efficacy over existing therapies under development or on the market is one of the many advantages provided by the embodiments of the current disclosure.
- Cells or molecules in a patient that express or expose danger signals are efficiently targeted by binding molecules, according to the disclosure, that are multi-specific, either in a monovalent manner or in a multivalent manner or in any combination thereof, for several damage associated molecular patterns (DAMPs) and/or for several binding sites on one or more DAMPs. DAMPs are, for example, exposed upon ischemia and inflammation and, for example, by aberrant cells such as cancer cells. It is part of the disclosure that the multi-specific binding molecules of the disclosure have the capacity to cross-link cellular proteins, with subsequent induction of biological processes upon activation of pathways mediated by these cross-linked proteins. Examples of such pathways are Fc receptor mediated processes such as Fc receptor mediated uptake of complexes comprising Fc fragments and bound molecules, and the complement pathway(s) of the immune system. Another example is the cross-linking of CD30 on Hodgkin's lymphoma cells by a proteinaceous molecule of the disclosure binding to multiple binding sites on CD30 overexpressed by Hodgkin/Reed-Stenberg cells. Cross-linking of CD30 results amongst others in pro-apoptotic signaling and in anti-proliferative signaling in the aberrant cells. Targeting and inducing clustering of MHC 1-
MAGE 1 peptide complex on melanoma cells by proteinaceous molecules of the disclosure comprising at least four, and preferably four to six domains specific for the MHC 1-MAGE 1 peptide complex, induces apoptosis of the targeted aberrant cells. Increased specificity and efficacy of these molecules of the disclosure is, for example, achieved by introducing one or more low-affinity binding domains specific for an epitope on theMHC 1 molecule. - A class of molecules specifically suitable for targeting by the proteinaceous molecules of the disclosure are cellular receptors and their ligands and (proteinaceous) binding partners. Examples of cellular receptors and their ligands are the class of G-protein coupled receptors (GPCRs) and, for example, hormones and neurotransmitters. GPCRs play a role in amongst others cancer. GPCRs act in an activated monomeric form and/or GPCRs act in an activated homodimer or heterodimer form. GPCRs active as higher order multimers exist as well. It is clear that GPCR homomers and heteromers can have different activities and roles in, for example, disease processes compared to the same GPCR in monomeric form. This provides several ways for intervening in the GPCR mediated biological processes during disease and disorders by binding molecules of the disclosure. By targeting GPCR monomers, and/or homomers, and/or heteromers, and/or GPCR ligands, and/or GPCR—ligand interactions by binding molecules of the disclosure, biological processes contributing to a certain disease can be modulated in a specific and efficient manner. For example, a binding molecule of the disclosure with an agonistic effect comprises two different binding domains binding to the two different GPCRs forming an active GPCR heterodimer, thereby facilitating the complex formation. Alternatively, blocking binding molecules are designed, according to the disclosure, preventing GPCR dimer formation, and thereby GPCR dimer—mediated activation. In general, it is part of the disclosure that any receptor mosaic is targeted in either an inhibitory, or stimulatory fashion by binding molecules of the disclosure. It is appreciated that intervening in receptor—receptor contacts is preferably addressed at the extracellular site of cells.
- It is part of the disclosure that the binding molecules act as allosteric molecules and/or as orthosteric ligand molecules for monomeric receptors, homomers, or heteromers, by targeting one or more allosteric binding sites and/or one or more ligand binding sites on the receptors, simultaneously. These binding sites are then located on the same receptor molecule or on different receptor molecules. The binding molecules of the disclosure can also have agonistic activity, synergistic activity and/or co-stimulatory activity. Of course, inhibiting allosteric effects resulting, for example, in receptor oligomerization as part of their activation, is also established by yet different binding molecules of the disclosure, that prevent binding of ligands with an allosteric effect to their binding sites on the receptors.
- Examples of multiple (preferably two or three) different binding sites each targeted in a monovalent or multivalent (preferably divalent to hexavalent, and even more preferably di-/tri-/tetravalent) manner by proteinaceous molecules of the disclosure comprising at least two different specific binding domains, such as depicted in
FIG. 1 andFIG. 2 , are provided in the specification and in the Examples 1-5, below. - Non-exhaustive examples of proteinaceous molecules of the disclosure comprising binding domains binding to at least two different binding sites which are each targeted in a monovalent or multivalent manner by the two or more different binding domains, with binding domain topologies as outlined, for example, in
FIG. 1 andFIG. 2 , are: - Proteinaceous molecules of the disclosure comprising binding domains binding to:
- 1. one or two epitopes in altered MUC-1 and to one or two epitopes in epithelial tumor antigen and/or to one or two epitopes in carcinoembryonic antigen (CEA) and/or to one or two epitopes in ErbB2 and/or to one or two epitopes in Le(y) hapten, for the targeting of aberrant cells in, for example, breast cancer;
- 2. one or two epitopes in altered MUC-1 and to one or two epitopes in CEA, with one to three copies of the two to four different specific binding domains, for the treatment of gastrointestinal malignancies such as pancreatic cancer, gastric cancer and colorectal cancer;
- 3. one or two epitopes in CEA, colon-specific antigen (CSAp) and mucin-1 (MUC-1), with one to three copies of each of the three different specific binding domains, for the treatment of colorectal cancer;
- 4. one or two epitopes in melanocyte differentiation markers melan-A and/or MITF and/or to one or two epitopes in neuronal markers nestin and/or β3-tubulin, for example, combined with binding domains for binding sites on epithelial markers epithelial membrane antigen and/or epithelial-specific antigen, for the treatment of breast cancer and breast cancer related metastasis;
- 5. two or more epitopes in carcinoembryonic antigen, for the treatment of lung cancer or bowel cancers;
- 6. two or more epitopes in CA-125, for the treatment of ovarian cancer;
- 7. one or more different epitopes, preferably three to five different epitopes in the Her-2/neu receptor, for the treatment of breast cancer, by, for example, preventing tumor outgrowth;
- 8. one or more epitopes in CD20 combined with binding domains binding to one or more epitopes in CD22, for the treatment of non-Hodgkin's lymphoma with B-cell tumors expressing CD20 and CD22;
- 9. two or three epitopes in α-fetoprotein, with two or three copies of each different binding domain, for the treatment of germ cell tumors;
- 10. two or three epitopes in CD52, with two or three copies of each different binding domain, for the treatment of chronic lymphocytic leukemia;
- 11. one or more epitopes in tumor necrosis factor-α and to one or more epitopes in interleukin-1, for the treatment of rheumatoid arthritis or Crohn's disease;
- 12. one or more epitopes in vascular endothelial growth factor and to one or more epitopes in epidermal growth factor receptor, for the treatment of colorectal cancer;
- 13. one or more epitopes in the epidermal growth factor receptor and to the epidermal growth factor receptor mutant form vIII, for the treatment of the brain neoplasm glioblastoma multiforme;
- 14. two or more epitopes in CD33, for the treatment of acute myelogenous leukemia;
- 15. one or more epitopes in neuronal markers nestin and β3-tubulin, for the treatment of glioblastomas;
- 16. one or two epitopes in any selection of B-lymphoid antigens CD10, CD19, CD22, CD34, CD45, and to one or two epitopes in any selection of T-cell markers CD2, CD4, CD5, CD7, CD56, and/or to one or two epitopes in any selection of myeloid markers CD11b, CD13, CD14, CD15, CD33, for the treatment of B acute lymphoblastic leukemia;
- 17. one or more epitopes in CD38 and to one or more epitopes in CD138, for the treatment of multiple myeloma;
- 18. one or two epitopes in two or three of the proteins CD38, CD138, CD20 and CD117, for the treatment of multiple myeloma;
- 19. two or three epitopes in CD20, with two or three copies of each of the different specific binding domains, resulting in clustering of CD20 into multimers comprising three or more CD20 monomers on the surface of lymphoma cells, for the treatment of lymphomas by inhibiting cell proliferation;
- 20. one or two epitopes in two or three antigens, or to two or three binding sites in a single antigen, with one to three copies of each of the different specific binding domains, for which the antigen is, for example, CD19, CD20, CD22, CD25, CD33, interleukin-4 receptor, prostate-specific antigen, Lewis(y) carbohydrate, mesothelin, mucin-1, transferrin receptor, prostate-specific membrane antigen, vascular endothelial growth factor, vascular endothelial growth factor receptors, epcam, CTLA-4, for the treatment of oncological diseases;
- 21. two or three epitopes in cellular death receptor FAS, with two or three copies of each different binding domain, resulting in clustering of four or more FAS molecules into multimers on the surface of targeted cells, resulting in induction of FAS mediated apoptosis, for the treatment of aberrancies comprising FAS expressing aberrant cells;
- 22. one or more epitopes in cancer cell marker and tumor stroma cell marker versican and to one or more epitopes in Toll-like receptor-2 (TLR2) and/or to one or more epitopes in Toll-like receptor-4 (TLR4) and/or to one or more epitopes in CD14, for the inhibition of cancer cell invasion and metastasizing mediated by versican—TLR2 and/or versican—TLR4 and/or versican—CD14 interactions;
- 23. one or more epitopes in TLR2 and to one or more epitopes in TLR4, resulting in an agonistic effect on TLR2/TLR4 activity, for apoptosis mediated anti-tumor therapy after chemotherapy or radiotherapy;
- 24. two or more epitopes in TLR7, resulting in an agonistic effect on TLR7 activity, for the treatment of basal cell carcinoma;
- 25. one or two epitopes in two or three antigens, or two or three binding sites in a single antigen for which the antigen is, for example, selected from in general interferons and/or cytokines and/or interleukins and/or chemokines and/or their receptors, and more specifically, for example, selected from CD2, CD4, α-interferon, α-interferon receptor, tumor necrosis factor-α, tumor necrosis factor-α receptor, γ-interferon, γ-interferon receptor, HLA class II antigen receptor, interleukin-1β, interleukin-1β receptor,
interleukin 6,interleukin 6 receptor, interleukin 15, interleukin 15 receptor, IgE, IgE receptor, ICAM-1, for the treatment of inflammatory diseases and/or autoimmune diseases; - 26. one or two binding sites in CD20 and/or CD30 and/or CD25, combined with at least two binding domains for a binding site on CD16 and/or on CD64, resulting in cross-linking of CD16 on natural killer cells and subsequently lysis of cells bound to natural killer cells, and/or phagocytosis and cellular cytotoxicity exerted on bound cells by CD64-positive cells, respectively, for the treatment of Hodgkin's lymphoma;
- 27. one or two binding sites on epidermal growth factor receptor or variants thereof, and to one or two binding sites on insulin-like growth factor receptor, for the treatment of a variety of cancers;
- 28. one or two binding sites on tumor necrosis factor a and to one or two binding sites on CD20, resulting in complement and/or cell mediated lysis when bound to cells, and/or to one or two binding sites on CD80 and/or on CD86, thereby acting as cytotoxic T-lymphocyte associated antigen-4 antagonist, thereby preventing a positive T-cell signal, for the treatment of rheumatoid arthritis;
- 29. one or more binding sites on human B-cell protein CD19 and/or on CD20 and/or on one or more alternative human B-cell markers, and to epitopes of cytotoxic triggering receptors such as T-cell receptors complexed with CD3 on T-cells and/or FcγRIIIa (CD16) on natural killer cells and/or FCγRI (CD64) and FCAR (CD89) on granulocytes, monocytes and macrophages, for the treatment of non-Hodgkin's lymphoma;
- 30. one or more binding sites on Her2 and to one or more binding sites on Her1, for the treatment of any aberrancy involving Her2/Her1 expressing aberrant cells, such as, for example, breast cancer;
- 31. one or more binding sites on
MHC 1 α-chain domain α1 and/or domain α2 and/or domain α3 and/or β2 microglobulin, and binding to an MHC 1-peptide complex, for the treatment of tumors presenting the peptides in the context ofMHC 1 in a tumor-specific manner; - 32. one or more binding sites on
MHC 2 α-chain domain α1 and/or domain α2 and/or β-chain domain β1 and/or domain β2, and binding to an MHC 2-peptide complex, for the treatment of tumors presenting the peptides in the context ofMHC 2 in a tumor-specific manner; - 33. one or more binding sites on MART-1 and/or on gp100 and/or on tyrosinase, for the treatment of melanomas;
- 34. one or more binding sites in any single molecule or in any combination of two or more molecules selected from the following prostate cancer related antigens, prostate-specific antigen (PSA, also referred to as kallikrein 3 (KLK3)), Thomsen-Friedenreich (TF) antigen, prostate stem cell antigen, prostatic acid phosphatase (PAP, also prostatic-specific acid phosphatase (PSAP)), human HLA-A2 restricted CD8+ T-cell epitopes, e.g., nonamer peptides FLFLLFFWL (SEQ ID NO:13) (from prostatic acid phosphatase), (SEQ ID NO:14) TLMSAMTNL (from prostatic acid phosphatase), ALDVYNGLL (SEQ ID NO:15) (from prostatic acid phosphatase), human HLA-A2.1-restricted CTL epitope ILLWQPIPV (SEQ ID NO:16) (from prostatic acid phosphatase-3), six-transmembrane epithelial antigen of prostate (STEAP), human HLA-A2.1-restricted CTL epitope LLLGTIHAL (SEQ ID NO:17) (from STEAP-3), mucins (MUC-1 and -2), MUC-1-32 mer (CHGVTSAPDTRPAPGSTAPPAHGV TSAPDTRPA) (SEQ ID NO:18), Globo H, Lewisy, Tn(c), TF(c) clusters, GM2, prostate-specific membrane antigen (PSMA), kallikrein 4, prostein, HLA-A2.1-restricted epitopes from BA46, PTH-rP, HER-2/neu, hTERT, and MAGE-A8, for the treatment of prostate cancer
- 35. two or more of the T-cell epitopes selected from 146-KLQCVDLHV-154 (SEQ ID NO:19), 141-FLTPKKLQCV-150 (SEQ ID NO:20), 154-VISNDVCAQV-163 (SEQ ID NO:21), 154-YISNDVCAQV-163 (SEQ ID NO:22) of PSA, presented by HLA-A2 and/or 162-QVHPQKVTK-170 (SEQ ID NO:23) of PSA, presented by HLA-A3, and/or 152-CYASGWGSI-160 (SEQ ID NO:24), 248-HYRKWIKDTI-257 (SEQ ID NO:25) of PSA, presented by HLA-A24, and/or 4-LLHETDSAV-12 (SEQ ID NO:26), 711-ALFDIESKV-719 (SEQ ID NO:27), 27-VLAGGFFLL-35 (SEQ ID NO:28) of PSMA, presented by HLA-A2, and/or 178-NYARTEDFF-186 (SEQ ID NO:29), 227-LYSDPADYF-235 (SEQ ID NO:30), 624-TYSVSFDSL-632 (SEQ ID NO:31) of PSMA, presented by HLA-A24, and/or 299-ALDVYNGLL-307 (SEQ ID NO:32) of PAP, presented by HLA-A2 and/or 213-LYCESVHNF-221 (SEQ ID NO:33) of PAP, presented by HLA-A24 and/or 199-GQDLFGIWSKVYDPL-213 (SEQ ID NO:34), 228-TEDTMTKLRELSELS-242 (SEQ ID NO:35) of PAP, presented by MHC-2 and/or 14-ALQPGTALL-22 (SEQ ID NO:36), 105-AILALLPAL-113 (SEQ ID NO:37), 7-ALLMAGLAL-15 (SEQ ID NO:38), 21-LLCYSCKAQV-30 (SEQ ID NO:39) of PSCA, presented by HLA-A2 and/or 155-LLANGRMPTVLQCVN-169 (SEQ ID NO:40) of Kallikrein 4, presented by DRB1*0404 and/or 160-RMPTVLQCVNVSVVS-174 (SEQ ID NO:41) of Kallikrein 4, presented by DRB1*0701 and/or 125-SVSESDTIRSISIAS-139 (SEQ ID NO:42) of Kallikerein 4, presented by DPB1*0401, preferably combined with binding domains binding to the indicated MHC molecule exposing the listed T-cell epitopes, for the treatment of prostate cancer;
- 36. one or two epitopes in each protein in any combination of two or three of the proteins NY-ESO-1, Her2/neu, Mesothelin, cancer antigen (CA) 15-3, carcinoembryonic antigen and CA-125, with one or two copies of each different binding domain, for the treatment of ovarian cancer;
- 37. one epitope in each of the six proteins NY-ESO-1, Her2/neu, Mesothelin, cancer antigen (CA) 15-3, carcinoembryonic antigen and CA-125, for the treatment of ovarian cancer;
- 38. a binding site in the T-cell epitope peptide 369-376 from human Her-2/neu and/or to a binding site in the MHC-peptide 369-376 complex, and to one or more binding sites in surface expressed Her-2/neu and/or to one or more binding sites in surface expressed Her-1, for the treatment of malignancies related to Her-2 and/or Her-1 over-expression.
- 39. One or two epitopes of the CD44 splice variants known as CD44,-v6, CD44-v9, CD44-v10 and/or to one or two epitopes in CD38 and in CD138, for the treatment of multiple myeloma;
- 40. one or two epitopes of Epcam and/or to one or two epitopes in the folate receptor, for the treatment of various cancers and for the treatment of ovarian cancer, specifically;
- 41. one or two epitopes of CAIX and/or to one or two epitopes in CD70, for the treatment of renal cancer;
- 42. one or more epitopes in PDGF receptor and to one or more epitopes in VEGF receptor, for the treatment of various cancers accompanied by co-expression of the two receptors on the surface of tumor cells;
- 43. one or more epitopes in ErbB1 and to one or more epitopes in ErbB2, with one and more preferably two or three binding domains for each binding site, for the treatment of various cancers accompanied by co-expression of the two surface molecules on tumor cells.
- Of particular interest are of course combinations of surface molecules expressed by aberrant cells, with each individual surface molecule bearing features unique to the aberrant cell. As said, these targets are however rare. Table 1 gives a list of tumors on which targets have been found that are unique to the aberrant cells. These unique targets are T-cell epitopes derived from various Cancer Testis antigens like, but not limited to MAGE variants complexed with MHC molecules. It is easy using a binding domain according to the disclosure to identify tumors that present the target MHC-peptide complexes. This can be done in vitro or in vivo (imaging). Thus, high specificity for aberrant cells is achieved when binding domains are combined in proteinaceous molecules of the disclosure that target binding sites in two or more surface molecules unique to the aberrant cell. Such molecules of the disclosure provide even an higher specificity than molecules of the disclosure targeting two different antigens which are co-expressed on aberrant cells, with one of the two, or both antigens also (moderately) expressed on healthy cells. An example is the co-expression on melanoma cells of two T-cell receptor epitopes unique to the aberrant cell, i.e., the MAGE-A peptide YLEYRQVPG (SEQ ID NO:43) presented by
MHC 1 HLA-A0201 and the MAGE-A peptide EGDCAPEEK (SEQ ID NO:44) presented by MHC-1 HLA-CW7. Targeting these two melanoma cell-specific binding sites by proteinaceous molecules of the disclosure provides highly specific binding. When only one such tumor-specific MHC-peptide complex is present on aberrant cells, efficacious proteinaceous molecules of the disclosure comprise, for example, two or three different binding domains specific for that complex, and binding domains binding to the specific type ofMHC 1 HLA-molecule. - Alternatively or additively, binding domains binding to the MHC-peptide complex are linked to binding domains binding to cell-surface proteins specifically expressed by the melanocyte lineage, such as MART-1, gp100 and tyrosinase. Combining binding domains with high affinity for tumor cell-specific antigens (i.e., MHC-MAGE peptide complex) with binding domains with low affinity for surface markers of the melanocyte lineage further improves the specificity of the proteinaceous molecules of the disclosure for the aberrant cells. Especially when the affinity for the surface markers of the melanocyte lineage is below a certain threshold prohibitive for binding of the proteinaceous molecules of the disclosure to healthy cells in the melanocyte lineage.
- Other examples of proteinaceous molecules of the disclosure comprising at least two different specific binding domains that target binding sites on surface molecules expressed by aberrant cells and not/hardly by healthy cells are proteinaceous molecules binding to A33 and to fibroblast activation protein, for the treatment of colorectal cancer. Yet another example of two different target binding sites on tumor cells, suitable for targeting by multi-specific proteinaceous molecules of the disclosure are Das-1 and CEA. Binding molecules targeting both Das-1 and CEA are, for example, suitable for the treatment of esophageal cancer.
- For some tumors, only one tumor marker on the surface of the aberrant cells has been identified so far. As an example for these occasions, the proteinaceous molecules of the disclosure comprise different binding domains binding to at least one binding site on a tumor marker and binding to at least one binding site on a cell-surface molecule specific for the tissue associated with the tumor.
- A good source for selecting binding sites suitable for specific targeting of aberrant cells by proteinaceous molecules of the disclosure, is the Peptide Database listing T-cell defined tumor antigens (Van den Eynde et al., Curr. Opin. Immunol. 1997; Houghton et al., Curr. Opin. Immunol. 2001; van der Bruggen et al., Immunol. Rev. 2002; Parmiani et al., J. Immunol. 2007; On the World Wide Web at cancerimmunity.org/peptidedatabase/Tcellepitopes.htm). The database provides combinations of antigen peptides complexed with MHC molecules comprising the indicated class of HLA, unique to tumor cells or over-expressed by tumor cells.
- Multi-specific proteins are built from any antigen binding domain, such as, but not limited to, antibodies, alpha-helices and T-cell receptors. Antibody Vh fragments specific for tumor associated surface antigens and MHC-restricted antigens are derived from hybridoma cells producing mouse, rat, rabbit, llama or human antibodies. Antibody fragments can also be obtained after immunization of animals with (partly) purified antigen, tumor cells or tumor cell lysate. Alternatively, antibody fragments of human, mouse, rat or llama origin can be obtained from antibody phage, yeast, lymphocyte or ribosome display libraries. Such antibody libraries (scFv, Fab, Vh or Vhh) may be constructed from non-immunized species as well as immunized species.
- 2.1: Selection of Human Antibody Fragments Specific for MHC-Restricted Cancer Testis Antigens
- To obtain human antibody fragments specific for, e.g., MHC presented epitopes, a Human antibody Fab, VHCH or Vh phage display library will be used for selections essentially as described by Chames et al., Human Fab phages (1013 colony forming units) are first pre-incubated for one hour at room temperature in PBS containing 2% non-fat dry milk (PBSM). In parallel, 200 μl Streptavidin-coated beads (Dynal) are equilibrated for one hour in PBSM. For subsequent rounds, 100 μl beads are used. To deplete for pan-MHC binders, to each selection round, 200 nM of biotinylated MHC class I-peptide (MHC-p) complexes containing an irrelevant peptide (Sanquin, the Netherlands) are added to the phages and incubated for 30 minutes under rotation. Equilibrated beads are added, and the mixture is incubated for 15 minutes under rotation. Beads are drawn to the side of the tube using magnetic force. To the depleted phage fraction, subsequently decreasing amounts of biotinylated MHC-p complexes (200 nM for the first round, and 20 nM for the second and third round) are added and incubated for one hour at room temperature, with continuous rotation. Simultaneously, a pan-MHC class I binding soluble Fab (D3) is added to the phage-MHC-p complex mixture (50, 10, and 5 μg for rounds 1-3, respectively). Equilibrated streptavidin-coated beads are added, and the mixture incubated for 15 minutes under rotation. Phages are selected by magnetic force. Non-bound phages will be removed by five washing steps with PBSM, five steps with PBS containing 0.1% Tween, and five steps with PBS. Phages are eluted from the beads by ten minutes incubation with 500 μl freshly prepared tri-ethylamine (100 mM). The pH of the solution is then neutralized by the addition of 500 μl 1 M Tris (pH 7.5). The eluted phages are incubated with logarithmic growing E. coli TG1 cells (OD600 nm of 0.5) for 30 minutes at 37° C. Bacteria are grown overnight on 2× TYAG plates. Next day, colonies are harvested, and a 10 μl inoculum is used in 50
ml 2× TYAG. Cells are grown until an OD600 nm of 0.5, and 5 ml of this suspension is infected with M13k07 helper phage (5×1011 colony forming units). After 30 minutes incubation at 37° C., the cells are centrifuged, resuspended in 25ml 2× TYAK, and grown overnight at 30° C. Phages are collected from the culture supernatant as described previously, and used for the next round panning. After two, three or four selection rounds enrichment of specific binders is obtained, and individual clones are analyzed for binding to specific peptide/MHC complexes by ELISA. - 2.2: Human Fab Specific for the MHC Presented Peptide Epitopes Bind Antigen Positive Cells
- Selected Fab phages are then analyzed for their capacity to bind MHC-positive EBV-transformed B-LCL loaded with the peptide epitopes. For HLA-A0201 presented epitopes the B-LCL line BSM (0.5×106) is loaded with peptide epitopes (10 μg in 100 μl PBS) for 30 minutes at 37° C., followed by incubation with the Fab phages and analyzed by flow-cytometry.
- Phages are then used to stain tumor cell lines of distinct histologic origin and analyzed by flow cytometry.
- 3.1: Design of Genes for Production of Multi-Specific Vh Proteins
- Human antibody germline gene VH3 demonstrates high homology to llama single domains VHH. Exchange of amino acids 44, 45 and 47 in the human VH3 genes by amino acids present in llama VHH at these positions has shown to enhance stability and expression of the human VH3 genes (Riechmann, Muyldermans, 199). For expression and stability many of the selected human Vh might benefit from the exchange of amino acids 44, 45 and 47 by llama VHH amino acids, a process called camelization. A gene comprising at least two distinct human Vh domains binding to at least two distinct MHC/peptide epitopes will be compiled such that upon expression it would comprise six Vh domains. To this end a gene will be designed comprising the pelB secretion signal, which will be operatively linked to six codon-optimized, camelized Vh domains with linkers ((Gly4Ser)n (SEQ ID NO:45), (GSTSGS)n (SEQ ID NO:46), GSTSGSGKPGSGEGSTKG (SEQ ID NO:47), EFAKTTAPSVYPLAPVLESSGSG (SEQ ID NO:48) or any other linker that provides flexibility for protein folding, or, EPKSCDKTHT (SEQ ID NO:49) (IgG1), ELKTPLGDTTHT (SEQ ID NO:50) (IgG3), or ESKYGPP (SEQ ID NO:51) (IgG4)) between each Vh domain. This gene will, for example, be synthesized by Geneart (Regensburg, Germany) and cloned into the pStaby 1.2 vector (Delphi genetics, Belgium) for expression in E. coli.
- For expression of multi-specific Vh proteins the pStaby-multispecific-protein vectors will be introduced via electroporation into SE1 bacteria. Positive clones will be grown in the presence of 2% glucose at 25° C. to 30° C. until OD600=0.8. Bacterial TYAG medium will then be replaced with TY medium containing 0.1-1 mM IPTG to induce expression. After overnight culture at 25° C. to 30° C., bacteria and medium will be harvested. The periplasm fraction will be collected after incubation of bacteria with PBS/EDTA/NaCl for 30 minutes on ice. Protein expression will then be analyzed by SDS-PAGE.
- Multi-specific Vh proteins will be isolated from media and bacteria using Ni-affinity purification. To this end medium will be incubated with Ni-coupled Sepharose-beads and incubated overnight while stirring gently. To obtain intracellular proteins bacteria will be lysed and cellular debris removed by centrifugation. After overnight dialysis with PBS multi-specific Vh proteins will be purified with Ni-Sepharose. Purity of the multi-specific Vh proteins will be analyzed by SDS-PAGE and protein concentration determined by BCA protein assay (Pierce).
- The pharmacokinetic properties of therapeutic proteins, e.g., their distribution, metabolism and excretion are dependent on factors such as shape, charge and size. Most small plasma molecules (MW<50-60 kDa) possess very short half-life, whereas larger plasma proteins such as human serum albumin (HSA) and immunoglobulins (Ig) have very long half-lives (19 days for HSA, one to four weeks for Ig). Indeed, addition of IgG-Fc or Human serum albumin has shown to extend circulation time, tumor penetration and antitumor effects when linked to therapeutic proteins. In addition the coupling of IgG-Fc to the multi-specific proteins will allow recruitment of immune cells to the tumor site allowing immune-specific responses against the cancerous tissue.
- 5.1: Construction of Multi-Specific Proteins with IgG1-Fc and Human Serum Albumin
- The multi-specific construct will be linked to the IgG1-Fc region or to human serum albumin, codon optimized for expression in eukaryotic cells and cloned into the pcDNA-3.1+ vector (Geneart, Regensburg, Germany).
- Standard cloning techniques were used in the examples below. Techniques are described in: Molecular Cloning; A Laboratory Manual (Cold Spring Harbor Press, Cold Spring Harbor, N.Y.) by Maniatis, T. et al. or in cited publications.
- Cloning of the TCR Vβ
- The TCR is a heterodimer which consists of an α and a β chain. The TCR α and β chains are members of the immunoglobulin gene superfamily and are generated by combined associations of V, J, D and C genes. The TCR polypeptides are disulfide linked, highly polymorphic in their N-terminal, variable domains and responsible for antigen recognition. Obtaining the TCR from the MAGE-1 specific CTL clone 82/30 (Traversari, C. et al., 1992) was achieved by polymerase chain reaction (PCR; Maniatis, T. et al.) amplification of cDNA obtained from this CTL clone.
- To obtain cDNA, total RNA was isolated from T cell clone 82/30 cells according to the method by Chomczynski et al. (Chomczynski, P. and Sacchi, N., 1987) and transferred into cDNA essentially as described by Maniatis et al. Amplification of cDNA sequences by PCR is possible only if the sequence of the gene of interest is known. In general, for PCR, two primers complementary to the 5′ end and the 3′ end of the sequence are used as the initiation point of DNA synthesis. Because the sequence of the 5′ ends of the TCR α and β chain from T cell clone 82/30 were unknown, a PCR method, referred to as RACE (rapid amplification of cDNA ends) was used to amplify the TCR α chain. The TCR β chain was amplified by RACE-PCR using primers described in Table 2.
- Oligonucleotide primers used to synthesize the α and β chain cDNA and amplify the Vα, Vβ and Cβ gene segments (Table 2)
- A fragment of about 350-450 base pairs was isolated from the agarose gel, purified and ligated into pBluescript (Stratagene, USA). The ligation mixture was introduced into bacteria which were selected and expanded. DNA was isolated from these selected bacterial colonies and analyzed by restriction enzyme digestion to confirm the presence of the amplified TCR β fragment.
- Three positive colonies were subjected to DNA sequencing. The sequences of these three individual clones were compared and found to be identical. The sequence obtained from the amplified TCR β fragments however did not include the signal sequence of the TCR β gene. To obtain the complete sequence of the TCR-V β gene, this partial sequence was compared with all known TCR β sequences. Alignment of the sequences showed almost 100% homology to sequences from the TCR β family 1 (TCRβ.1). Based on this sequence homology, a primer was synthesized complementary to the 5′ end of the TCR β.1 and used to amplify the complete TCR variable β.1 domain. The DNA was subjected to “direct sequencing,” Analysis of the obtained sequence showed 100% homology of the amplified TCR β fragment to the signal sequence and major part of the variable region of the TCR β chains from the TCR β
family 1. Based on this sequence primers were designed that allowed cloning of the TCR variable β chains in a single chain TCR construct. - For cloning of the TCR α chain, a different approach was followed. First, to determine to which family the TCR Vα chain belongs, a family typing PCR was performed. Twenty-one different TCR variable α chains have been described. In a family typing PCR, the template cDNA was divided into separate samples that are each individually amplified with a family specific 5′ primer and a constant primer. Multiple PCR reactions had yielded amplified fragments. In order to determine which fragment corresponded to the TCR Vα fragment, a Southern blot was performed with a 32P-labelled Cα probe. A positive signal was observed only in the PCR reaction which was performed with the TCR α primer corresponding to
family number 12. The remaining of the DNA of this PCR reaction was purified with primer removal as described above and subjected to DNA sequencing. The obtained sequence was compared to the TCR α sequence of the only known member offamily number 12. Except for the diversity region, 100% homology was observed. This allowed the design of primers which could be used for the amplification of the complete variable region of the TCR α chain. The sequences of Vα and Vβ of the TCR derived from CTL clone 82/30 are given as SEQ ID. NO:1 and SEQ ID. NO:2, respectively. - 8.1 Construction of Two Domain Single Chain TCR Molecules.
- For construction of single chain TCR molecules, a cloning vector was designed that allows easy construction of single chain molecules. The vector was made by replacement of the multiple cloning sites in pBluescript (Stratagene) by a specially designed polylinker (Table 3). For cloning of the TCR Vα and TCR Vβ fragments, primers were designed that allowed cloning of these fragments in front of the flexible linker sequence or after the linker sequences.
- For amplification of the TCR Vα and TCR Vβ fragments, two separate PCR reactions were performed to generate fragments that include the signal sequence of the V region and fragments that start practically at the beginning of the mature protein. The DNA fragments were digested with restriction enzymes that allow cloning next to the flexible linker. Positive bacterial colonies were grown for DNA purification and DNA was subj ected to DNA sequencing. DNA clones with the correct sequence were used to construct the chimeric single chain TCR constructs. The clones containing either the TCR Vα or the TCR Vβ fragments in front of the flexible linker sequence were then ligated to the TCR Vα and TCR Vβ fragments which lack the signal sequence. In this way, three different single chain TCRs were constructed (Vα-212 linker-Vβ, Vβ-212 linker-Vα and Vα-(Gly4Ser)3, linker-Vβ).
- 8.2 Construction of the Bispecific Anti-CD3×scTCR ßα Molecule.
- The scTCR ßα was cloned next to the anti-CD3 specific scFv obtained from OKT-3 cells and introduced into the pBullet retroviral vector. A schematic presentation of the scFv×scTCR is given in
FIG. 3 . - The pBullet retroviral vector was introduced into HEK 293T cells by calcium-phosphate transfection. Supernatant from these cells was harvested 4 days after transfection and used for diverse experiments.
- 9.1 the scFv×scTCR Binds Primary Human T Lymphocytes.
- Primary human T lymphocytes were isolated from blood by standard fycol separation and incubated with the supernatant of transfected HEK 293T cells. After an incubation period of 30 minutes on ice, the cells were washed and incubated with a Fluorescein isothiocyanate (FITC)-labelled TCR Vα-12.1 specific monoclonal antibody (mAb) or an irrelevant FITC-labelled mAb. After an incubation period of 30 minutes on ice cells were washed, fixed with phosphate-buffered saline (PBS) 1% paraformaldehyde (PFA) and analysed by flow-cytometry. As shown in
FIG. 4 , the bispecific scFv×scTCR binds to the primary human T-lymphocytes. - Primary human T-lymphocytes labelled with the bispecific scFv anti-CD3×scTCR ßα specifically kill HLA-A01/MAGE-A1 positive melanoma cells.
- Primary human T-lymphocytes, activated for two days with immobilised OKT-3 were labelled with the scFv×scTCR and incubated with 51Cr-labelled HLA-A1, MAGE-A1 positive melanoma cells (MZ2-MEL 3.0) and HLA-A1 positive, MAGE-A1 negative melanoma cells (MZ-
MEL 2 2) 51Cr-release was measured after an incubation period of 4 hours and showed that only HLA-A1/MAGE-A1 MZ2-MEL 3 0 melanoma cells were killed by the scFv×scTCR labelled T-lymphocytes (FIG. 5 ). - 11.1 Construction of a Bispecific Single Domain (sd) Ab VH×VH with Specificity for the HLA-A0201 Presented Multi-MAGE-A Peptide and Human CD3.
- A gene was composed from the camelized human AH5 VH and camelized mouse anti-CD3 VH (obtained from OKT-3). The resulting sequence of the sdAb AH5×CD3 was compiled by gene synthesis by GeneArt (Regensburg, Germany), and cloned into the pStaby 1.2 expression vector. See SEQ ID NO:3 for the DNA sequence of this bispecific single domain antibody (BsdAB) AH5×CD3, and SEQ ID NO:4 for the amino-acid sequence of BsdAB AH5×CD3.
-
-
TABLE 1 Examples for the frequency of MAGE-A expression by human cancers. Frequency of expression (%) Cancer MAGE-A1 MAGE-A2 MAGE-A3 MAGE-A4 MAGE-A6 MAGE-A10 MAGE-A11 Melanoma 16 E 36 E 64 E 74 Head and neck 25 42 33 8 N N N Bladder 21 30 35 33 15 N 9 Breast 6 19 10 13 5 N N Colorectal N 5 5 N 5 N N Lung 21 30 46 11 8 N N Gastric 30 22 57 N N N N Ovarian 55 32 20 E 20 N N Osteosarcoma 62 75 62 12 62 N N Hepatocarcinoma 68 30 68 N 30 30 30 Renal cell carcinoma 22 16 76 30 N N N E, expressed but the frequency is not known; N, expression by tumors has never been observed -
TABLE 2 Oligonucleotide Primers Vα-ATG: 5′ GCG AAT TCT ACG TAC CAT GAA CAT GCT GAC TGC CAG C′ (SEQ ID NO: 5) Vα-3′: 5′ CGT CTA GAG GAC AGA AGO TAA CTC AAG CGC AG 3′(SEQ ID NO: 6) Vβ-ATG: 5′ CCG AAT TCT ACG TAC CAT GGG CTT CAG GCT GCT CTG 3′(SEQ ID NO: 7) Vβ-3′: 5′ GCG GAT CCG AGC ACT GTC AGC CGG GTG CC 3′(SEQ ID NO: 8) -
TABLE 3 2 LINKER 5′ GTA CGA ATT CGC AGA TCT GGC TCT ACT TCC GGT AGC AAATCC TCT GAA GGC AAA GGT ACT AGT GCG GAT CCG GCT CGA GCA GCT 3′(SEQ ID NO: 9) (GLY)4SER3 LINKER 5′ GAT CCG GTG GAG GCG GTT CAG GCG GAG GTG GCT CTG GCG GTG GCG GAT CGA 3′(SEQ ID NO: 10) SEQ ID NOs SEQ ID. NO: 1: DNA sequences of the HLA-A1/MAGE-A1 specific TCR variable region Valpha obtained from CTL 82/30 ATG AAC ATG CTG ACT GCC AGC CTG TTG AGG GCA GTC ATA GCC TCC ATC TGT GTT GTA TCC AGC ATG GCT CAG AAG GTA ACT CAA GCG CAG ACT GAA ATT TCT GTG GTG GAG AAG GAG GAT GTG ACC TTG GAC TGT GTG TAT GAA ACC CGT GAT ACT ACT TAT TAC TTA TTC TGG TAC AAG CAA CCA CCA AGT GGA GAA TTG GTT TTC CTT ATT CGT CGG AAC TCT TTT GAT GAG CAA AAT GAA ATA AGT GGT CGG TAT TCT TGG AAC TTC CAG AAA TCC ACC AGT TCC TTC AAC TTC ACC ATC ACA GCC TCA CAA GTC GTG GAC TCA GCA GTA TAC TTC TGT GCT CTG GGA GGG GTG AAT AAT AAT GCA GGC AAC ATG CTC ACC TTT GGA GGG GGA ACA AGG TTA ATG GTC AAA CCC (SEQ ID. NO: 1) SEQ ID NO: 2: DNA sequences of the HLA-A1/MAGE-A1 specific TCR variable region Vbeta obtained from CTL 82/30 ATG GGC TTC AGG CTG CTC TGC TGT GTG GCC TTT TGT CTC CTG GGA GCA GGC CCA GTG GAT TCT GGA GTC ACA CAA ACC CCA AAG CAC CTG ATC ACA GCA ACT GGA CAG CGA GTG ACG CTG AGATGC TCC CCT AGG TCT GGA GAC CTC TCT GTG TAC TGG TAC CAA CAG AGC CTG GAC CAG GGC CTC CAG TTC CTC ATT CAC TAT TAT AAT GGA GAA GAG AGA GCA AAA GGA AAC ATT CTT GAA CGA TTC TCC GCA CAA CAG TTC CCT GAC TTG CAC TCT GAA CTA AAC CTG AGC TCT CTG GAG CTG GGG GAC TCA GCT TTG TAT TTC TGT GCC AGC AAC ATA GCG GGC GGG AGT TAT ACG CAG TAT TTT GGC CCA GGC ACC CGG CTG ACA GTG CTC (SEQ ID. NO: 2) SEQ ID. NO: 3: DNA sequence of bispecific single domain antibody (BsdAB) AH5 × CD3 ATGAAATACCTATTGCCTACGGCAGCCGCTGGATTGTTATTACTCGCGGC CCAGCCGGCCATGGCCCAGCTGCAGCTGCAGGAGTCCGGGGGAGGCGTGG TCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACC TTCAGTAGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGAGAG AGAGGGGGTGGCAGTTATATCATATGATGGGAGTAATAAATACTATGCAG ACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACG CTGTATCTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTA CTGTGCCGGTGGGAGCTACTACGTCCCGGACTACTGGGGCCAGGGAACCC TGGTCACCGTCTCAAGCGCGGCCGCAGGTGGCGGAGGGTCTGGTGGCGGA GGGTCTGGTGGCGGAGGGTCGCAGGTGCAGCTGCAGCAGTCTGGGGCTGA ACTGGCAAGACCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTCTGGCT ACACCTTTACTAGGTACACGATGCACTGGGTAAAACAGAGGCCTGGACAG GGTCTGGAATGGATTGGATACATTAATCCTAGCCGTGGTTATACTAATTA CAATCAGAAGTTCAAGGACAAGGCCACATTGACTACAGACAAATCCTCCA GCACAGCCTACATGCAACTGAGCAGCCTGACATCTGAGGACTCTGCAGTC TATTACTGTGCAAGATATTATGATGATCATTACTGCCTTGACTACTGGGG CCAAGGCACCACTCTCACAGTCTCCTCAGGGGCCGCAGAACAAAAACTCA TCTCAGAAGAGGATCTGAATGGGGCCCATCATCATCATCATCACTAA (SEQ ID. NO: 3) SEQ ID NO: 4: Amino acid sequence of bispecific single domain antibody (BsdAB) AH5 × CD MKYLLPTAAAGLLLLAAQPAMAQLQLQESGGGVVQPGRSLRLSCAASGFT FSSYGMHWVRQAPGKEREGVAVISYDGSNKYYADSVKGRFTISRDNSKNT LYLQMNSLRAEDTAVYYCAGGSYYVPDWGQGTLVTVSSAAAGGGGSGGGG SGGGGSQVQLQQSGAELARPGASVKMSCKASGYTFTRYTMEIWVKQRPGQ GLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAV YYCARYYDDHYCLDWGQGTTLTVSSGAAEQKLISEEDLNGAHREIHHH (SEQ ID NO: 4) -
- Ridgway J. B., L. G. Presta, and P. Carter. “Knobs-into-holes” engineering of antibody CH3 domains for heavy chain heterodimerization. Protein Engineering 1996, 9(7):617-621.
- Van den Eynde B. J., and P. van der Bruggen. T cell-defined tumor antigens. Curr. Opin. Immunol. 1997, 9:684-93.
- Houghton A. N., J. S. Gold, and N. E. Blachere. Immunity against cancer: lessons learned from melanoma. Curr. Opin. Immunol. 2001, 13:134-40.
- van der Bruggen P., Y. Zhang, P. Chaux, V. Stroobant, C. Panichelli, E. S. Schultz, J. Chapiro, B. J. Van den Eynde, F. Brasseur, and T. Boon. Tumor-specific shared antigenic peptides recognized by human T cells. Immunol. Rev. 2002, 188:51-64.
- Parmiani G., A. De Filippo, L. Novellino, and C. Castelli. Unique human tumor antigens: immunobiology and use in clinical trials. J. Immunol. 2007, 178:1975-9.
- Chames P., H. R. Hoogenboom, and P. Henderikx. Selection of antigens against biotinylated antigens. In Antibody phage display, methods and protocols, edited by P. M. O'Brien and R. Aitken. Methods in Molecular Biology 2002, 178:147-159.
- Lutz Riechmann and Serge Muyldermans. Single domain antibodies: comparison of camel VH and camelized human VH domains. Journal of Immunological Methods 1999, 231:25-38.
- Maniatis T., et al. Molecular Cloning; A Laboratory Manual (Cold Spring Harbor Press, Cold Spring Harbor, N.Y.) 1989.
- Traversari, C. et al., J. Exp. Med 1992, 176:1453-1457.
- Chomczynski, P. and Sacchi, N., Anal. Biochem 1987. 162: 156-159.
Claims (19)
1. A proteinaceous molecule comprising at least two different specific binding domains for different binding sites separated by at least one linker wherein the proteinaceous molecule comprises a single polypeptide chain.
2. The proteinaceous molecule of claim 1 , comprising at least three specific binding domains for different binding sites separated from each other by at least one linker.
3. The proteinaceous molecule of claim 1 , wherein at least one such binding domain is a Vh domain.
4. The proteinaceous molecule of claim 1 , wherein at least one such binding domain is a ligand for a receptor, or a receptor binding fragment and/or derivative of such a ligand.
5. The proteinaceous molecule of claim 1 , further comprising an effector moiety.
6. The proteinaceous molecule of claim 1 , comprising at least two Vh domains.
7. The proteinaceous molecule of claim 1 , comprising at least two Vh domains specific for different binding sites and an Fc monomer.
8. A dimeric proteinaceous molecule comprising:
two proteinaceous molecules of claim 7 dimerized through two Fc monomers.
9. A hetero-dimeric molecule comprising:
two different proteinaceous molecules of claim 7 .
10. A pharmaceutical formulation comprising:
the proteinaceous molecule of claim 1 , and
suitable excipient(s).
11. A nucleic acid molecule encoding the proteinaceous molecule of claim 1 .
12. A vector comprising the nucleic acid molecule of claim 11 .
13. A cell comprising the nucleic acid molecule of claim 11 .
14. A method for producing a proteinaceous molecule, the method comprising:
culturing the cell of claim 13 ,
allowing for expression of the proteinaceous molecule, and
separating the proteinaceous molecule from the culture.
15. A proteinaceous molecule according to FIG. 1 or FIG. 2 .
16. A proteinaceous molecule comprising:
at least two different specific binding domains for different binding sites separated by at least one linker,
wherein at least one such binding domain is a Vh domain,
wherein at least one such binding domain is a ligand for a receptor, and
wherein the proteinaceous molecule comprises a single polypeptide chain.
17. The proteinaceous molecule of claim 16 , further comprising an effector moiety.
18. The proteinaceous molecule of claim 17 , comprising at least two Vh domains.
19. The proteinaceous molecule of claim 18 , wherein the at least two Vh domains are specific for different binding sites and an Fc monomer.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/379,822 US20210355209A1 (en) | 2011-09-29 | 2021-07-19 | Multi-specific binding molecules targeting aberrant cells |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201161540920P | 2011-09-29 | 2011-09-29 | |
PCT/NL2012/050675 WO2013048243A1 (en) | 2011-09-29 | 2012-09-26 | Multi-specific binding molecules targeting aberrant cells |
US201414348465A | 2014-03-28 | 2014-03-28 | |
US17/379,822 US20210355209A1 (en) | 2011-09-29 | 2021-07-19 | Multi-specific binding molecules targeting aberrant cells |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/348,465 Division US11098115B2 (en) | 2011-09-29 | 2012-09-26 | Multi-specific binding molecules targeting aberrant cells |
PCT/NL2012/050675 Division WO2013048243A1 (en) | 2011-09-29 | 2012-09-26 | Multi-specific binding molecules targeting aberrant cells |
Publications (1)
Publication Number | Publication Date |
---|---|
US20210355209A1 true US20210355209A1 (en) | 2021-11-18 |
Family
ID=47018432
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/348,465 Active US11098115B2 (en) | 2011-09-29 | 2012-09-26 | Multi-specific binding molecules targeting aberrant cells |
US17/379,822 Pending US20210355209A1 (en) | 2011-09-29 | 2021-07-19 | Multi-specific binding molecules targeting aberrant cells |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/348,465 Active US11098115B2 (en) | 2011-09-29 | 2012-09-26 | Multi-specific binding molecules targeting aberrant cells |
Country Status (6)
Country | Link |
---|---|
US (2) | US11098115B2 (en) |
EP (2) | EP2760892A1 (en) |
JP (3) | JP2014530009A (en) |
AU (3) | AU2012316859A1 (en) |
CA (1) | CA2850291A1 (en) |
WO (1) | WO2013048243A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2024081930A1 (en) * | 2022-10-14 | 2024-04-18 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for targeted delivery of therapeutic agents |
Families Citing this family (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2011353197B2 (en) * | 2010-12-27 | 2017-04-20 | Apo-T B.V. | A cross linking polypeptide comprising an hexameric single chain antibody binding MHC-MAGE complex that induces apoptosis |
JP2014530009A (en) | 2011-09-29 | 2014-11-17 | エーピーオー‐ティー ビー.ヴイ. | Multispecific binding molecules targeting abnormal cells |
CA2860914A1 (en) | 2012-01-13 | 2013-07-18 | Apo-T B.V. | Aberrant cell-restricted immunoglobulins provided with a toxic moiety |
EP2864354A1 (en) * | 2012-06-26 | 2015-04-29 | Apo-T B.V. | Binding molecules targeting pathogens |
WO2016077720A1 (en) * | 2014-11-14 | 2016-05-19 | Protein One, Llc | Binding agents and uses thereof |
WO2017036255A1 (en) * | 2015-09-01 | 2017-03-09 | Tse-Wen Chang | Molecular constructs for preventing the formation of blood clot and/or treating thrombosis |
WO2017124002A1 (en) * | 2016-01-13 | 2017-07-20 | Compass Therapeutics Llc | Multispecific immunomodulatory antigen-binding constructs |
JP2021528382A (en) * | 2018-06-04 | 2021-10-21 | エーピーオー‐ティー ビー.ヴイ. | Methods and means of attracting immune effector cells to tumor cells |
WO2020232247A1 (en) | 2019-05-14 | 2020-11-19 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
WO2022163809A1 (en) * | 2021-01-29 | 2022-08-04 | Chugai Seiyaku Kabushiki Kaisha | Molecule specifically acting in a tissue where a cell death being observed |
KR20230169944A (en) | 2021-03-09 | 2023-12-18 | 씨디알-라이프 아게 | MAGE-A4 peptide-MHC antigen binding protein |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2008119566A2 (en) * | 2007-04-03 | 2008-10-09 | Micromet Ag | Cross-species-specific bispecific binders |
US11098115B2 (en) * | 2011-09-29 | 2021-08-24 | Apo-T B.V. | Multi-specific binding molecules targeting aberrant cells |
Family Cites Families (66)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB601513A (en) | 1946-02-06 | 1948-05-06 | Koray Ltd | Improvements in or relating to coated tissue especially paper and to coating compositions therefor |
DE321017C (en) | 1917-05-15 | 1920-05-11 | Aloysius Petrus Van Leuven | |
US3687370A (en) | 1971-01-18 | 1972-08-29 | Instapak Corp | Liquid mixing and dispensing apparatus |
NL9001639A (en) | 1990-07-19 | 1992-02-17 | Amc Amsterdam | PT-CONTAINING COMPOUND, METHOD FOR PREPARING IT, AND USE OF SUCH COMPOUNDS. |
US5709995A (en) | 1994-03-17 | 1998-01-20 | The Scripps Research Institute | Hepatitis C virus-derived peptides capable of inducing cytotoxic T lymphocyte responses |
ES2205030T3 (en) | 1995-05-09 | 2004-05-01 | Kreatech Biotechnology B.V. | PROCEDURES FOR THE PRODUCTION OF PLATINUM-BASED CONNECTION SEGMENTS BETWEEN BIO-ORGANIC MARKERS AND MOLECULES, FOR THE MARKING OF BIO-ORGANIC MOLECULES, THE DETECTION OF BIOLOGICAL SUBSTANCES TO BE STUDIED. |
EP0973785B1 (en) | 1997-04-10 | 2003-12-03 | Kreatech Biotechnology B.V. | Trans-platinum compound, and diagnostic kit |
KR20010022812A (en) | 1997-08-12 | 2001-03-26 | 리드 비.브이. | Determining the transforming capability of agents |
BR9907950A (en) | 1998-02-19 | 2001-12-18 | Xcyte Therapies Inc | Compositions and processes for regulating lymphocyte activation |
US6534633B1 (en) | 1998-10-21 | 2003-03-18 | Altor Bioscience Corporation | Polyspecific binding molecules and uses thereof |
IL127142A0 (en) | 1998-11-19 | 1999-09-22 | Yeda Res & Dev | Immune cells having predefined biological specificity |
US6737056B1 (en) * | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
DE60229924D1 (en) | 2001-03-30 | 2009-01-02 | Leadd Bv | FUSION PROTEINS FOR THE SPECIFIC TREATMENT OF CANCER AND AUTOIMMUNE DISEASES |
CN1294148C (en) | 2001-04-11 | 2007-01-10 | 中国科学院遗传与发育生物学研究所 | Single-stranded cyctic trispecific antibody |
JP4049297B2 (en) | 2001-06-11 | 2008-02-20 | 株式会社ルネサステクノロジ | Semiconductor memory device |
GB0115841D0 (en) | 2001-06-28 | 2001-08-22 | Medical Res Council | Ligand |
DK1399484T3 (en) | 2001-06-28 | 2010-11-08 | Domantis Ltd | Double-specific ligand and its use |
US20100081792A1 (en) * | 2001-06-28 | 2010-04-01 | Smithkline Beecham Corporation | Ligand |
JP4213586B2 (en) * | 2001-09-13 | 2009-01-21 | 株式会社抗体研究所 | Camel antibody library production method |
WO2005063299A2 (en) | 2003-12-24 | 2005-07-14 | Genentech, Inc. | Compositions and methods for the treatment of tumor of hematopoietic origin |
EP1442301A1 (en) | 2001-11-09 | 2004-08-04 | Kreatech Biotechnology B.V. | Means and methods for the detection of immunoglobulin capable of binding to mycobacterium antigen |
US6992176B2 (en) | 2002-02-13 | 2006-01-31 | Technion Research & Development Foundation Ltd. | Antibody having a T-cell receptor-like specificity, yet higher affinity, and the use of same in the detection and treatment of cancer, viral infection and autoimmune disease |
CA2476625A1 (en) | 2002-02-20 | 2003-08-28 | Dyax Corp. | Mhc-peptide complex binding ligands |
FR2837837B1 (en) | 2002-03-28 | 2006-09-29 | Roussy Inst Gustave | PEPTIDE EPITOPES COMMON TO ANTIGENS OF THE SAME MULTIGENIC FAMILY |
WO2003089467A1 (en) | 2002-04-19 | 2003-10-30 | Leadd B.V. | Fragments of apoptin |
ATE328906T1 (en) | 2002-06-28 | 2006-06-15 | Domantis Ltd | DUAL-SPECIFIC LIGANDS WITH INCREASED HALF-LIFE |
US7820166B2 (en) * | 2002-10-11 | 2010-10-26 | Micromet Ag | Potent T cell modulating molecules |
JP2006523437A (en) | 2002-12-03 | 2006-10-19 | アヴィデックス リミテッド | Receptor complex |
EP1613750B1 (en) * | 2003-03-19 | 2015-10-14 | Amgen Fremont Inc. | Antibodies against t cell immunoglobulin domain and mucin domain 1 (tim-1) antigen and uses thereof |
ATE455127T1 (en) * | 2003-05-31 | 2010-01-15 | Micromet Ag | HUMAN ANTI-HUMAN CD3 BINDING MOLECULES |
EP1629012B1 (en) * | 2003-05-31 | 2018-11-28 | Amgen Research (Munich) GmbH | Pharmaceutical compositions comprising bispecific anti-cd3, anti-cd19 antibody constructs for the treatment of b-cell related disorders |
US20050026881A1 (en) | 2003-07-31 | 2005-02-03 | Robinson Cynthia B. | Combination of dehydroepiandrosterone or dehydroepiandrosterone-sulfate with an anti-IgE antibody for treatment of asthma or chronic obstructive pulmonary disease |
ES2296423B1 (en) * | 2003-07-31 | 2009-03-16 | Consejo Sup. Investig. Cientificas | CONSTRUCTION OF DNA FOR THE PRODUCTION OF DIMERIC FUSION PROTEINS AND ITS APPLICATIONS. |
US7488793B2 (en) * | 2003-09-22 | 2009-02-10 | Ludwig Institute For Cancer Research | Isolated peptide which binds to HLA-Cw*07 and uses thereof |
CA2747871C (en) | 2003-11-17 | 2018-04-10 | Genentech, Inc. | Compositions and methods for the treatment of tumor of hematopoietic origin |
SI2418220T1 (en) | 2003-12-10 | 2017-10-30 | E. R. Squibb & Sons, L.L.C. | Interferon alpha antibodies and their uses |
US7235641B2 (en) | 2003-12-22 | 2007-06-26 | Micromet Ag | Bispecific antibodies |
US20050266425A1 (en) * | 2003-12-31 | 2005-12-01 | Vaccinex, Inc. | Methods for producing and identifying multispecific antibodies |
ATE417065T1 (en) | 2004-05-19 | 2008-12-15 | Medigene Ltd | HIGH-AFFINITY NY-ESO T-CELL RECEPTOR |
US20100062001A1 (en) | 2004-06-09 | 2010-03-11 | Technion Research & Development | Antibodies for selective apoptosis of cells |
CA2582963A1 (en) * | 2004-10-01 | 2006-04-13 | Avidex Ltd | T-cell receptors containing a non-native disulfide interchain bond linked to therapeutic agents |
WO2007059082A1 (en) | 2005-11-10 | 2007-05-24 | Curagen Corporation | Method of treating ovarian and renal cancer using antibodies against t cell immunoglobulin domain and mucin domain 1 (tim-1) antigen |
WO2007073147A1 (en) * | 2005-12-20 | 2007-06-28 | Erasmus University Medical Center Rotterdam | Apoptosis-inducing protein complexes and therapeutic use thereof |
KR20080090441A (en) * | 2005-12-21 | 2008-10-08 | 메디뮨 엘엘씨 | Epha2 bite molecules and uses thereof |
GB0601513D0 (en) | 2006-01-25 | 2006-03-08 | Univ Erasmus Medical Ct | Binding molecules 3 |
AT503902B1 (en) | 2006-07-05 | 2008-06-15 | F Star Biotech Forsch & Entw | METHOD FOR MANIPULATING IMMUNE LOBULINS |
US20100158927A1 (en) | 2007-03-29 | 2010-06-24 | Technion Research & Development Foundation Ltd. | Antibodies, methods and kits for diagnosing and treating melanoma |
JP2010535032A (en) * | 2007-07-31 | 2010-11-18 | メディミューン,エルエルシー | Multispecific epitope binding proteins and uses thereof |
US8568717B2 (en) | 2008-04-03 | 2013-10-29 | Vib Vzw | Single domain antibodies capable of modulating BACE activity |
WO2009131435A1 (en) | 2008-04-23 | 2009-10-29 | Erasmus University Medical Center Rotterdam | Linker containing bungarotoxin and a binding peptide |
US9109026B2 (en) | 2008-06-03 | 2015-08-18 | Abbvie, Inc. | Dual variable domain immunoglobulins and uses thereof |
EP2352765B1 (en) * | 2008-10-01 | 2018-01-03 | Amgen Research (Munich) GmbH | Cross-species-specific single domain bispecific single chain antibody |
WO2010059315A1 (en) | 2008-11-18 | 2010-05-27 | Merrimack Pharmaceuticals, Inc. | Human serum albumin linkers and conjugates thereof |
CA2747644C (en) | 2008-12-19 | 2023-01-24 | Ablynx N.V. | Method for generation of immunoglobulin sequences |
GB0908613D0 (en) * | 2009-05-20 | 2009-06-24 | Immunocore Ltd | T Cell Reseptors |
KR101431319B1 (en) | 2009-05-27 | 2014-08-20 | 에프. 호프만-라 로슈 아게 | Tri- or tetraspecific antibodies |
GB0911566D0 (en) * | 2009-07-03 | 2009-08-12 | Immunocore Ltd | T cell receptors |
EP2504360B1 (en) * | 2009-11-23 | 2018-08-15 | Amgen Inc. | Monomeric antibody fc |
WO2011064664A2 (en) | 2009-11-24 | 2011-06-03 | Chrontech Pharma Ab | T cell receptors specific for immunodominant ctl epitopes of hcv |
US20130131088A1 (en) | 2010-01-13 | 2013-05-23 | University Health Network | Treating cancer with statins and compounds having dipyridamole activity |
US20120123218A1 (en) | 2010-11-16 | 2012-05-17 | JPWaVe BV | Methods and means for clinical investigations |
AU2011353197B2 (en) | 2010-12-27 | 2017-04-20 | Apo-T B.V. | A cross linking polypeptide comprising an hexameric single chain antibody binding MHC-MAGE complex that induces apoptosis |
WO2012091563A1 (en) | 2010-12-27 | 2012-07-05 | Apo-T B.V. | A polypeptide that binds aberrant cells and induces apoptosis |
CA2860914A1 (en) | 2012-01-13 | 2013-07-18 | Apo-T B.V. | Aberrant cell-restricted immunoglobulins provided with a toxic moiety |
EP2864354A1 (en) | 2012-06-26 | 2015-04-29 | Apo-T B.V. | Binding molecules targeting pathogens |
-
2012
- 2012-09-26 JP JP2014533232A patent/JP2014530009A/en active Pending
- 2012-09-26 WO PCT/NL2012/050675 patent/WO2013048243A1/en active Application Filing
- 2012-09-26 EP EP12772530.7A patent/EP2760892A1/en not_active Ceased
- 2012-09-26 AU AU2012316859A patent/AU2012316859A1/en not_active Abandoned
- 2012-09-26 CA CA2850291A patent/CA2850291A1/en not_active Abandoned
- 2012-09-26 EP EP18153459.5A patent/EP3388451A1/en active Pending
- 2012-09-26 US US14/348,465 patent/US11098115B2/en active Active
-
2017
- 2017-09-08 JP JP2017173519A patent/JP2018046811A/en active Pending
- 2017-10-17 AU AU2017248425A patent/AU2017248425B2/en active Active
-
2019
- 2019-11-22 JP JP2019211793A patent/JP2020058354A/en active Pending
-
2020
- 2020-02-07 AU AU2020200888A patent/AU2020200888A1/en not_active Abandoned
-
2021
- 2021-07-19 US US17/379,822 patent/US20210355209A1/en active Pending
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2008119566A2 (en) * | 2007-04-03 | 2008-10-09 | Micromet Ag | Cross-species-specific bispecific binders |
US11098115B2 (en) * | 2011-09-29 | 2021-08-24 | Apo-T B.V. | Multi-specific binding molecules targeting aberrant cells |
Non-Patent Citations (1)
Title |
---|
Piche-Nicholas et al MABS 10(1): 81-94 (Year: 2018) * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2024081930A1 (en) * | 2022-10-14 | 2024-04-18 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for targeted delivery of therapeutic agents |
Also Published As
Publication number | Publication date |
---|---|
EP2760892A1 (en) | 2014-08-06 |
AU2020200888A1 (en) | 2020-02-27 |
AU2017248425A1 (en) | 2017-11-02 |
JP2018046811A (en) | 2018-03-29 |
JP2014530009A (en) | 2014-11-17 |
AU2012316859A1 (en) | 2014-04-17 |
JP2020058354A (en) | 2020-04-16 |
CA2850291A1 (en) | 2013-04-04 |
EP3388451A1 (en) | 2018-10-17 |
US20140227273A1 (en) | 2014-08-14 |
US11098115B2 (en) | 2021-08-24 |
WO2013048243A1 (en) | 2013-04-04 |
AU2017248425B2 (en) | 2019-11-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210355209A1 (en) | Multi-specific binding molecules targeting aberrant cells | |
JP7428663B2 (en) | Immune cells expressing reverse universal chimeric antigen receptors for the targeting of several multiple antigens and methods for their production and their use to treat cancer, infectious diseases and autoimmune diseases | |
CN109096396B (en) | anti-PD-L1 humanized nano antibody and application thereof | |
US20180222996A1 (en) | Bispecific scfv immunofusion (bif) | |
US20190085090A1 (en) | Cross-linking polypeptide that induces apoptosis | |
CN111699201B (en) | Heterodimeric bispecific antibody with anti-PD-1/anti-HER 2 natural antibody structure and preparation method thereof | |
US20230348627A1 (en) | Anti-4-1bb-anti-pd-l1 bispecific antibody, and pharmaceutical composition and use thereof | |
CN113272330A (en) | Bispecific antibody | |
JP7365654B2 (en) | Anti-CLDN4-anti-CD137 bispecific antibody | |
WO2023163087A1 (en) | Medicine comprising combination of anti-mutant-calr antibody and another drug | |
KR102393776B1 (en) | Humanized antibody specific for CD22 and chimeric antigen receptor using the same | |
WO2023125973A1 (en) | Development of novel pdl1 single-domain antibody | |
CN114773485B (en) | Bifunctional fusion protein molecules of anti-human PD-L1 antibodies and TGF-beta RII | |
WO2024027828A1 (en) | Multi-specific antibodies targeting a dimerizable tumor antigen and an immunostimulatory antigen | |
JP2023549977A (en) | Chimeric antigen receptor containing anti-mesothelin scFv and its uses | |
CN118139897A (en) | Synthetic T cell receptor antigen receptor specifically combined with mesothelin and application thereof | |
Marshall | Towards cancer immunotherapy |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |